4Q4Y4

Crystal structure of coxsackievirus a24v soaked with disialyllacto-n-tetraose (dslnt)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
57
Chain Sequence
b'GAQVSSQKVGAHVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 57
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4y400
1D4M4 2RMU4 2RR14 2X5ID 1ASJ4 1NCQD 1POV0 1RVF4 4Q4X4 1OOPD 1H8TD 1RUJ4 4Q4W4 1K5MD 1VBD4 3J8F4 1RUC4 1HRV4 1AR94 1VRH4 1AL24 2PLV4 1VBE4 4GB34 2R044 1PO24 1VBC4 1RUG4 1AR64 1RUI4 2R064 1MQTD 1PO14 1VBA4 1PVC4 4Q4V4 1RUD4 3JD74 1EV14 1NA1D 2R074 4Q4Y4 3JBG4 1R084 1VBB4 1RUF4 1RHI4 2RM24 2RS14 1R094 2HWC4 2HWB4 1AR84 1RMU4 1EAH4 1RUE4 1PIV4 1Z7S4 4PDWD 1BEV4 1HXS4 1AR74 1HRI4 2RS54 4RHV4 1COV4 1RUH4 2RS34
chains in the Genus database with same CATH superfamily
2WDRA 1NCQD 2PYLA 1OOPD 2PW9A 2WU5A 2PYJA 3J8F4 1RUC4 1ZOYA 2WU2A 2PLV4 3CIRA 4YTMA 3AEFA 1MQTD 1PO14 4Q4Y4 3VR8A 2R074 1R084 1VBB4 1R094 3P4RA 2HWC4 3GQHA 1L0VA 4YTPA 2WDVA 1BEV4 1HXS4 5C2TA 1HRI4 1COV4 3SFDA 1NEKA 2RS34 1KF6A 1D4M4 2RMU4 2X5ID 1POV0 1RVF4 4Q4X4 1H8TD 4YSZA 4Q4W4 3SUCA 1HRV4 1AR94 3AE9A 1AL24 3AE2A 1PO24 1VBC4 3AE3A 3AE5A 3AECA 3AE8A 3GQKA 3JD74 3SFEA 1NA1D 3JBG4 3VRBA 5C3JA 2WDQA 2HWB4 3AE6A 2EX3A 1RUE4 2WQYA 3AEGA 1AR74 1XHZA 2H89A 1RUH4 3AEEA 1ASJ4 1RUJ4 3AE1A 2PZSA 1K5MD 1VBD4 4GB34 2R044 4YTNA 2R7FA 3VRAA 2ACZA 1RUG4 1AR64 3FI7A 1VBA4 1RUD4 1EV14 1NENA 1RUF4 1RHI4 2RM24 3AEAA 2WP9A 1EAH4 4YT0A 1PIV4 4PDWD 2PY5A 4KX6A 1XI1A 1YQ3A 3P4QA 2RR14 1YQ4A 2H88A 1XHXA 3P4PA 3AEDA 3ABVA 1VRH4 3VR9A 1VBE4 2FBWA 3AE7A 1RUI4 2R064 4Q4V4 1PVC4 1KFYA 2RS14 4YSYA 4YXDA 1AR84 1RMU4 3AEBA 1Z7S4 1ZP0A 2WS3A 4YSXA 2RS54 3P4SA 4RHV4 3AE4A 2B76A
chains in the Genus database with same CATH topology
1D4M4 2RMU4 2RR14 2X5ID 1ASJ4 1NCQD 1POV0 1RVF4 4Q4X4 1OOPD 1H8TD 1RUJ4 4Q4W4 1K5MD 1VBD4 3J8F4 1RUC4 1HRV4 1AR94 1VRH4 1AL24 2PLV4 1VBE4 4GB34 2R044 1PO24 1VBC4 1RUG4 1AR64 1RUI4 2R064 1MQTD 1PO14 1VBA4 1PVC4 4Q4V4 1RUD4 3JD74 1EV14 1NA1D 2R074 4Q4Y4 3JBG4 1R084 1VBB4 1RUF4 1RHI4 2RM24 2RS14 1R094 2HWC4 2HWB4 1AR84 1RMU4 1EAH4 1RUE4 1PIV4 1Z7S4 4PDWD 1BEV4 1HXS4 1AR74 1HRI4 2RS54 4RHV4 1COV4 1RUH4 2RS34
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4M 4;  2RMU 4;  2RR1 4;  2X5I D;  1ASJ 4;  1NCQ D;  1POV 0;  1RVF 4;  4Q4X 4;  1OOP D;  1H8T D;  1RUJ 4;  4Q4W 4;  1K5M D;  1VBD 4;  3J8F 4;  1RUC 4;  1HRV 4;  1AR9 4;  1VRH 4;  1AL2 4;  2PLV 4;  1VBE 4;  4GB3 4;  2R04 4;  1PO2 4;  1VBC 4;  1RUG 4;  1AR6 4;  1RUI 4;  2R06 4;  1MQT D;  1PO1 4;  1VBA 4;  1PVC 4;  4Q4V 4;  1RUD 4;  3JD7 4;  1EV1 4;  1NA1 D;  2R07 4;  4Q4Y 4;  3JBG 4;  1R08 4;  1VBB 4;  1RUF 4;  1RHI 4;  2RM2 4;  2RS1 4;  1R09 4;  2HWC 4;  2HWB 4;  1AR8 4;  1RMU 4;  1EAH 4;  1RUE 4;  1PIV 4;  1Z7S 4;  4PDW D;  1BEV 4;  1HXS 4;  1AR7 4;  1HRI 4;  2RS5 4;  4RHV 4;  1COV 4;  1RUH 4;  2RS3 4; 
#chains in the Genus database with same CATH topology
 2WDR A;  1NCQ D;  2PYL A;  1OOP D;  2PW9 A;  2WU5 A;  2PYJ A;  3J8F 4;  1RUC 4;  1ZOY A;  2WU2 A;  2PLV 4;  3CIR A;  4YTM A;  3AEF A;  1MQT D;  1PO1 4;  4Q4Y 4;  3VR8 A;  2R07 4;  1R08 4;  1VBB 4;  1R09 4;  3P4R A;  2HWC 4;  3GQH A;  1L0V A;  4YTP A;  2WDV A;  1BEV 4;  1HXS 4;  5C2T A;  1HRI 4;  1COV 4;  3SFD A;  1NEK A;  2RS3 4;  1KF6 A;  1D4M 4;  2RMU 4;  2X5I D;  1POV 0;  1RVF 4;  4Q4X 4;  1H8T D;  4YSZ A;  4Q4W 4;  3SUC A;  1HRV 4;  1AR9 4;  3AE9 A;  1AL2 4;  3AE2 A;  1PO2 4;  1VBC 4;  3AE3 A;  3AE5 A;  3AEC A;  3AE8 A;  3GQK A;  3JD7 4;  3SFE A;  1NA1 D;  3JBG 4;  3VRB A;  5C3J A;  2WDQ A;  2HWB 4;  3AE6 A;  2EX3 A;  1RUE 4;  2WQY A;  3AEG A;  1AR7 4;  1XHZ A;  2H89 A;  1RUH 4;  3AEE A;  1ASJ 4;  1RUJ 4;  3AE1 A;  2PZS A;  1K5M D;  1VBD 4;  4GB3 4;  2R04 4;  4YTN A;  2R7F A;  3VRA A;  2ACZ A;  1RUG 4;  1AR6 4;  3FI7 A;  1VBA 4;  1RUD 4;  1EV1 4;  1NEN A;  1RUF 4;  1RHI 4;  2RM2 4;  3AEA A;  2WP9 A;  1EAH 4;  4YT0 A;  1PIV 4;  4PDW D;  2PY5 A;  4KX6 A;  1XI1 A;  1YQ3 A;  3P4Q A;  2RR1 4;  1YQ4 A;  2H88 A;  1XHX A;  3P4P A;  3AED A;  3ABV A;  1VRH 4;  3VR9 A;  1VBE 4;  2FBW A;  3AE7 A;  1RUI 4;  2R06 4;  4Q4V 4;  1PVC 4;  1KFY A;  2RS1 4;  4YSY A;  4YXD A;  1AR8 4;  1RMU 4;  3AEB A;  1Z7S 4;  1ZP0 A;  2WS3 A;  4YSX A;  2RS5 4;  3P4S A;  4RHV 4;  3AE4 A;  2B76 A; 
#chains in the Genus database with same CATH homology
 1D4M 4;  2RMU 4;  2RR1 4;  2X5I D;  1ASJ 4;  1NCQ D;  1POV 0;  1RVF 4;  4Q4X 4;  1OOP D;  1H8T D;  1RUJ 4;  4Q4W 4;  1K5M D;  1VBD 4;  3J8F 4;  1RUC 4;  1HRV 4;  1AR9 4;  1VRH 4;  1AL2 4;  2PLV 4;  1VBE 4;  4GB3 4;  2R04 4;  1PO2 4;  1VBC 4;  1RUG 4;  1AR6 4;  1RUI 4;  2R06 4;  1MQT D;  1PO1 4;  1VBA 4;  1PVC 4;  4Q4V 4;  1RUD 4;  3JD7 4;  1EV1 4;  1NA1 D;  2R07 4;  4Q4Y 4;  3JBG 4;  1R08 4;  1VBB 4;  1RUF 4;  1RHI 4;  2RM2 4;  2RS1 4;  1R09 4;  2HWC 4;  2HWB 4;  1AR8 4;  1RMU 4;  1EAH 4;  1RUE 4;  1PIV 4;  1Z7S 4;  4PDW D;  1BEV 4;  1HXS 4;  1AR7 4;  1HRI 4;  2RS5 4;  4RHV 4;  1COV 4;  1RUH 4;  2RS3 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...