4Q4Y4

Crystal structure of coxsackievirus a24v soaked with disialyllacto-n-tetraose (dslnt)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
57
Chain Sequence
GAQVSSQKVGAHVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 57
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4y400
1PIV4 4GB34 1VBE4 1ASJ4 2R064 1POV0 1OOPD 1RHI4 1HRV4 1PO14 1RUG4 1Z7S4 2RS54 1VBD4 2HWC4 2HWB4 1RMU4 3JD74 1HRI4 2RS14 1RUH4 1RUE4 1VBC4 1HXS4 1VRH4 1COV4 1RUI4 1AR84 2R044 2RS34 1AR94 1RUC4 4RHV4 4Q4X4 1AR74 3JBG4 1D4M4 1VBA4 1AR64 1NCQD 1PVC4 2RMU4 3J8F4 1RUF4 1BEV4 1VBB4 2RM24 1RUJ4 2R074 1NA1D 1MQTD 1K5MD 4PDWD 4Q4V4 1R094 1RVF4 2X5ID 1R084 2RR14 4Q4W4 1EAH4 4Q4Y4 1H8TD 1PO24 2PLV4 1AL24 1RUD4 1EV14
chains in the Genus database with same CATH superfamily
2WU5A 1PIV4 2R7FA 1VBE4 2WS3A 1RUG4 2HWB4 1RMU4 1KFYA 3AE4A 1HXS4 3AE8A 4Q4X4 2RS34 4RHV4 4YXDA 4YSZA 1AR74 3VRAA 1PVC4 3J8F4 2RMU4 1RUF4 1VBB4 2RM24 2R074 1RVF4 3CIRA 2PYJA 1H8TD 3VR9A 1NENA 3P4SA 1XHXA 3FI7A 1ASJ4 5C3JA 1RHI4 3P4RA 2HWC4 4YTMA 4YSXA 1ZP0A 3JD74 3P4PA 3VR8A 1KF6A 2RS14 1RUI4 2PY5A 1YQ3A 3GQHA 3JBG4 1XI1A 2WDQA 1XHZA 4YSYA 2H89A 1MQTD 3AE9A 2WDRA 4Q4V4 4YT0A 4Q4W4 1R084 1EAH4 1PO24 2PYLA 1AL24 2WQYA 2PW9A 4GB34 3AE3A 2R064 3VRBA 1HRV4 3AEGA 3P4QA 1PO14 1Z7S4 4YTPA 3AE2A 1YQ4A 1NEKA 3SFDA 1VBC4 1COV4 1AR94 2B76A 2WU2A 3SFEA 3AEBA 1D4M4 1VBA4 1AR64 1NCQD 2WDVA 4KX6A 1BEV4 3AE6A 1ZOYA 1RUJ4 2WP9A 1NA1D 4PDWD 1K5MD 1R094 2X5ID 2RR14 2ACZA 2PLV4 3AECA 3AEEA 3AE7A 1EV14 3SUCA 1L0VA 1POV0 1OOPD 2RS54 1VBD4 1HRI4 2EX3A 3AEFA 1RUH4 3AE1A 4YTNA 3AEAA 1VRH4 1AR84 2R044 2H88A 1RUC4 3AE5A 2PZSA 2FBWA 4Q4Y4 3GQKA 5C2TA 3ABVA 1RUD4 3AEDA 1RUE4
chains in the Genus database with same CATH topology
1PIV4 4GB34 1VBE4 1ASJ4 2R064 1POV0 1OOPD 1RHI4 1HRV4 1PO14 1RUG4 1Z7S4 2RS54 1VBD4 2HWC4 2HWB4 1RMU4 3JD74 1HRI4 2RS14 1RUH4 1RUE4 1VBC4 1HXS4 1VRH4 1COV4 1RUI4 1AR84 2R044 2RS34 1AR94 1RUC4 4RHV4 4Q4X4 1AR74 3JBG4 1D4M4 1VBA4 1AR64 1NCQD 1PVC4 2RMU4 3J8F4 1RUF4 1BEV4 1VBB4 2RM24 1RUJ4 2R074 1NA1D 1MQTD 1K5MD 4PDWD 4Q4V4 1R094 1RVF4 2X5ID 1R084 2RR14 4Q4W4 1EAH4 4Q4Y4 1H8TD 1PO24 2PLV4 1AL24 1RUD4 1EV14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIV 4;  4GB3 4;  1VBE 4;  1ASJ 4;  2R06 4;  1POV 0;  1OOP D;  1RHI 4;  1HRV 4;  1PO1 4;  1RUG 4;  1Z7S 4;  2RS5 4;  1VBD 4;  2HWC 4;  2HWB 4;  1RMU 4;  3JD7 4;  1HRI 4;  2RS1 4;  1RUH 4;  1RUE 4;  1VBC 4;  1HXS 4;  1VRH 4;  1COV 4;  1RUI 4;  1AR8 4;  2R04 4;  2RS3 4;  1AR9 4;  1RUC 4;  4RHV 4;  4Q4X 4;  1AR7 4;  3JBG 4;  1D4M 4;  1VBA 4;  1AR6 4;  1NCQ D;  1PVC 4;  2RMU 4;  3J8F 4;  1RUF 4;  1BEV 4;  1VBB 4;  2RM2 4;  1RUJ 4;  2R07 4;  1NA1 D;  1MQT D;  1K5M D;  4PDW D;  4Q4V 4;  1R09 4;  1RVF 4;  2X5I D;  1R08 4;  2RR1 4;  4Q4W 4;  1EAH 4;  4Q4Y 4;  1H8T D;  1PO2 4;  2PLV 4;  1AL2 4;  1RUD 4;  1EV1 4; 
#chains in the Genus database with same CATH topology
 2WU5 A;  1PIV 4;  2R7F A;  1VBE 4;  2WS3 A;  1RUG 4;  2HWB 4;  1RMU 4;  1KFY A;  3AE4 A;  1HXS 4;  3AE8 A;  4Q4X 4;  2RS3 4;  4RHV 4;  4YXD A;  4YSZ A;  1AR7 4;  3VRA A;  1PVC 4;  3J8F 4;  2RMU 4;  1RUF 4;  1VBB 4;  2RM2 4;  2R07 4;  1RVF 4;  3CIR A;  2PYJ A;  1H8T D;  3VR9 A;  1NEN A;  3P4S A;  1XHX A;  3FI7 A;  1ASJ 4;  5C3J A;  1RHI 4;  3P4R A;  2HWC 4;  4YTM A;  4YSX A;  1ZP0 A;  3JD7 4;  3P4P A;  3VR8 A;  1KF6 A;  2RS1 4;  1RUI 4;  2PY5 A;  1YQ3 A;  3GQH A;  3JBG 4;  1XI1 A;  2WDQ A;  1XHZ A;  4YSY A;  2H89 A;  1MQT D;  3AE9 A;  2WDR A;  4Q4V 4;  4YT0 A;  4Q4W 4;  1R08 4;  1EAH 4;  1PO2 4;  2PYL A;  1AL2 4;  2WQY A;  2PW9 A;  4GB3 4;  3AE3 A;  2R06 4;  3VRB A;  1HRV 4;  3AEG A;  3P4Q A;  1PO1 4;  1Z7S 4;  4YTP A;  3AE2 A;  1YQ4 A;  1NEK A;  3SFD A;  1VBC 4;  1COV 4;  1AR9 4;  2B76 A;  2WU2 A;  3SFE A;  3AEB A;  1D4M 4;  1VBA 4;  1AR6 4;  1NCQ D;  2WDV A;  4KX6 A;  1BEV 4;  3AE6 A;  1ZOY A;  1RUJ 4;  2WP9 A;  1NA1 D;  4PDW D;  1K5M D;  1R09 4;  2X5I D;  2RR1 4;  2ACZ A;  2PLV 4;  3AEC A;  3AEE A;  3AE7 A;  1EV1 4;  3SUC A;  1L0V A;  1POV 0;  1OOP D;  2RS5 4;  1VBD 4;  1HRI 4;  2EX3 A;  3AEF A;  1RUH 4;  3AE1 A;  4YTN A;  3AEA A;  1VRH 4;  1AR8 4;  2R04 4;  2H88 A;  1RUC 4;  3AE5 A;  2PZS A;  2FBW A;  4Q4Y 4;  3GQK A;  5C2T A;  3ABV A;  1RUD 4;  3AED A;  1RUE 4; 
#chains in the Genus database with same CATH homology
 1PIV 4;  4GB3 4;  1VBE 4;  1ASJ 4;  2R06 4;  1POV 0;  1OOP D;  1RHI 4;  1HRV 4;  1PO1 4;  1RUG 4;  1Z7S 4;  2RS5 4;  1VBD 4;  2HWC 4;  2HWB 4;  1RMU 4;  3JD7 4;  1HRI 4;  2RS1 4;  1RUH 4;  1RUE 4;  1VBC 4;  1HXS 4;  1VRH 4;  1COV 4;  1RUI 4;  1AR8 4;  2R04 4;  2RS3 4;  1AR9 4;  1RUC 4;  4RHV 4;  4Q4X 4;  1AR7 4;  3JBG 4;  1D4M 4;  1VBA 4;  1AR6 4;  1NCQ D;  1PVC 4;  2RMU 4;  3J8F 4;  1RUF 4;  1BEV 4;  1VBB 4;  2RM2 4;  1RUJ 4;  2R07 4;  1NA1 D;  1MQT D;  1K5M D;  4PDW D;  4Q4V 4;  1R09 4;  1RVF 4;  2X5I D;  1R08 4;  2RR1 4;  4Q4W 4;  1EAH 4;  4Q4Y 4;  1H8T D;  1PO2 4;  2PLV 4;  1AL2 4;  1RUD 4;  1EV1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...