4Q58A

Crystal structure of the plectin 1a actin-binding domain/integrin beta 4 fragment complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
225
structure length
225
Chain Sequence
DERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plectin
publication title Crystal structure of the plectin 1a actin-binding domain/integrin beta 4 fragment complex
rcsb
molecule tags Structural protein/protein binding
total genus 65
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 4q58A02
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 4q58A01
1P2XA 3KY9A 1WIXA 4EDMA 5L0OA 2WFNA 4EDLA 2D89A 1AOAA 1AA2A 1BHDA 2QJZA 2EYNA 1PXYA 2WA5A 2RR8A 2D85A 2EE7A 1QAGA 3KMWB 3JARM 5A37A 2D87A 1H67A 1RT8A 3JALM 2L3GA 3JAKM 1DXXA 5BVRA 2WA7A 1WJOA 1WYRA 2E9KA 2D86A 2VZDA 5J8EA 2D88A 1P5SA 2DK9A 2EYIA 5A38A 2R0OA 2VZGB 1MB8A 3REPB 4Q58A 1UEGA 1WKUA 2YRNA 1WYNA 1PA7A 2VZIB 4EDNA 3I6XA 3F7PA 4TXKA 1BKRA 1WYLA 2QJXA 1UJOA 1WYMA 4Q57B 2K2RA 4B7LA 2K3SA 1SH5A 2VZCA 1TJTA 3HOCA 1V5KA 2R8UA 4Q59A 2WA6A 3CO1A 1WYOA 3HORA 3HOPA 1SH6A 5A36A 1VKAA 3KMUB 5A4BA 1WYQA 3FERA 1WYPA 2JV9A 4TXIA
chains in the Genus database with same CATH superfamily
1P2XA 3KY9A 2HL9A 1WIXA 4EDMA 5L0OA 2IGPA 2WFNA 4EDLA 2D89A 1AOAA 1AA2A 1BHDA 2QJZA 2EYNA 1PXYA 2WA5A 2RR8A 2D85A 2EE7A 1EUVA 1QAGA 2WDTA 3KMWB 3JARM 5A37A 4LVRA 2D87A 1H67A 1RT8A 3JALM 2HKPA 2L3GA 3JAKM 1DXXA 5BVRA 2WA7A 1WJOA 1WYRA 2E9KA 2EQOA 2VZDA 3VP7A 5J8EA 2D88A 5FMUA 1P5SA 2DK9A 2EYIA 5A38A 3EAYA 2R0OA 2VZGB 1MB8A 3REPB 4Q58A 1UEGA 1WKUA 2YRNA 1WYNA 1PA7A 2VZIB 4EDNA 3I6XA 2WE6A 3F7PA 4DDPA 5FMTA 4TXKA 1BKRA 1WYLA 2QJXA 2VE7C 1UJOA 1WYMA 4Q57B 2K2RA 4B7LA 2K3SA 1SH5A 2VZCA 2HL8A 1TJTA 3HOCA 1V5KA 2R8UA 4Q59A 2WA6A 3CO1A 1WYOA 3HORA 3HOPA 1SH6A 5A36A 1VKAA 3KMUB 4TXIA 5A4BA 2VE7A 1WYQA 3FERA 1WYPA 2JV9A 4LVPA 2D86A
chains in the Genus database with same CATH topology
1P2XA 3KY9A 1WIXA 4EDMA 5L0OA 2WFNA 4EDLA 2D89A 1AOAA 1AA2A 1BHDA 2QJZA 2EYNA 1PXYA 2WA5A 2RR8A 2D85A 2EE7A 1QAGA 3KMWB 3JARM 5A37A 2D87A 1H67A 1RT8A 3JALM 2L3GA 3JAKM 1DXXA 5BVRA 2WA7A 1WJOA 1WYRA 2E9KA 2D86A 2VZDA 5J8EA 2D88A 1P5SA 2DK9A 2EYIA 5A38A 2R0OA 2VZGB 1MB8A 3REPB 4Q58A 1UEGA 1WKUA 2YRNA 1WYNA 1PA7A 2VZIB 4EDNA 3I6XA 3F7PA 4TXKA 1BKRA 1WYLA 2QJXA 1UJOA 1WYMA 4Q57B 2K2RA 4B7LA 2K3SA 1SH5A 2VZCA 1TJTA 3HOCA 1V5KA 2R8UA 4Q59A 2WA6A 3CO1A 1WYOA 3HORA 3HOPA 1SH6A 5A36A 1VKAA 3KMUB 5A4BA 1WYQA 3FERA 1WYPA 2JV9A 4TXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2X A;  3KY9 A;  1WIX A;  4EDM A;  5L0O A;  2WFN A;  4EDL A;  2D89 A;  1AOA A;  1AA2 A;  1BHD A;  2QJZ A;  2EYN A;  1PXY A;  2WA5 A;  2RR8 A;  2D85 A;  2EE7 A;  1QAG A;  3KMW B;  3JAR M;  5A37 A;  2D87 A;  1H67 A;  1RT8 A;  3JAL M;  2L3G A;  3JAK M;  1DXX A;  5BVR A;  2WA7 A;  1WJO A;  1WYR A;  2E9K A;  2D86 A;  2VZD A;  5J8E A;  2D88 A;  1P5S A;  2DK9 A;  2EYI A;  5A38 A;  2R0O A;  2VZG B;  1MB8 A;  3REP B;  4Q58 A;  1UEG A;  1WKU A;  2YRN A;  1WYN A;  1PA7 A;  2VZI B;  4EDN A;  3I6X A;  3F7P A;  4TXK A;  1BKR A;  1WYL A;  2QJX A;  1UJO A;  1WYM A;  4Q57 B;  2K2R A;  4B7L A;  2K3S A;  1SH5 A;  2VZC A;  1TJT A;  3HOC A;  1V5K A;  2R8U A;  4Q59 A;  2WA6 A;  3CO1 A;  1WYO A;  3HOR A;  3HOP A;  1SH6 A;  5A36 A;  1VKA A;  3KMU B;  5A4B A;  1WYQ A;  3FER A;  1WYP A;  2JV9 A;  4TXI A; 
#chains in the Genus database with same CATH topology
 1P2X A;  3KY9 A;  2HL9 A;  1WIX A;  4EDM A;  5L0O A;  2IGP A;  2WFN A;  4EDL A;  2D89 A;  1AOA A;  1AA2 A;  1BHD A;  2QJZ A;  2EYN A;  1PXY A;  2WA5 A;  2RR8 A;  2D85 A;  2EE7 A;  1EUV A;  1QAG A;  2WDT A;  3KMW B;  3JAR M;  5A37 A;  4LVR A;  2D87 A;  1H67 A;  1RT8 A;  3JAL M;  2HKP A;  2L3G A;  3JAK M;  1DXX A;  5BVR A;  2WA7 A;  1WJO A;  1WYR A;  2E9K A;  2EQO A;  2VZD A;  3VP7 A;  5J8E A;  2D88 A;  5FMU A;  1P5S A;  2DK9 A;  2EYI A;  5A38 A;  3EAY A;  2R0O A;  2VZG B;  1MB8 A;  3REP B;  4Q58 A;  1UEG A;  1WKU A;  2YRN A;  1WYN A;  1PA7 A;  2VZI B;  4EDN A;  3I6X A;  2WE6 A;  3F7P A;  4DDP A;  5FMT A;  4TXK A;  1BKR A;  1WYL A;  2QJX A;  2VE7 C;  1UJO A;  1WYM A;  4Q57 B;  2K2R A;  4B7L A;  2K3S A;  1SH5 A;  2VZC A;  2HL8 A;  1TJT A;  3HOC A;  1V5K A;  2R8U A;  4Q59 A;  2WA6 A;  3CO1 A;  1WYO A;  3HOR A;  3HOP A;  1SH6 A;  5A36 A;  1VKA A;  3KMU B;  4TXI A;  5A4B A;  2VE7 A;  1WYQ A;  3FER A;  1WYP A;  2JV9 A;  4LVP A;  2D86 A; 
#chains in the Genus database with same CATH homology
 1P2X A;  3KY9 A;  1WIX A;  4EDM A;  5L0O A;  2WFN A;  4EDL A;  2D89 A;  1AOA A;  1AA2 A;  1BHD A;  2QJZ A;  2EYN A;  1PXY A;  2WA5 A;  2RR8 A;  2D85 A;  2EE7 A;  1QAG A;  3KMW B;  3JAR M;  5A37 A;  2D87 A;  1H67 A;  1RT8 A;  3JAL M;  2L3G A;  3JAK M;  1DXX A;  5BVR A;  2WA7 A;  1WJO A;  1WYR A;  2E9K A;  2D86 A;  2VZD A;  5J8E A;  2D88 A;  1P5S A;  2DK9 A;  2EYI A;  5A38 A;  2R0O A;  2VZG B;  1MB8 A;  3REP B;  4Q58 A;  1UEG A;  1WKU A;  2YRN A;  1WYN A;  1PA7 A;  2VZI B;  4EDN A;  3I6X A;  3F7P A;  4TXK A;  1BKR A;  1WYL A;  2QJX A;  1UJO A;  1WYM A;  4Q57 B;  2K2R A;  4B7L A;  2K3S A;  1SH5 A;  2VZC A;  1TJT A;  3HOC A;  1V5K A;  2R8U A;  4Q59 A;  2WA6 A;  3CO1 A;  1WYO A;  3HOR A;  3HOP A;  1SH6 A;  5A36 A;  1VKA A;  3KMU B;  5A4B A;  1WYQ A;  3FER A;  1WYP A;  2JV9 A;  4TXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...