The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
168
|
structure length |
168
|
Chain Sequence |
EPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Unknown function, protein binding
|
source organism |
Shigella sonnei ss046
|
publication title |
Structural Basis for the Inhibition of Host Protein Ubiquitination by Shigella Effector Kinase OspG.
pubmed doi rcsb |
molecule keywords |
Protein kinase OspG
|
total genus |
53
|
structure length |
168
|
sequence length |
168
|
ec nomenclature | |
pdb deposition date | 2014-04-16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transferase(Phosphotransferase); domain 1 | Transferase(Phosphotransferase) domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |