4Q5EA

Shigella effector kinase ospg bound to e2-ub ubch7-ub conjugate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
168
structure length
168
Chain Sequence
EPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase OspG
publication title Structural Basis for the Inhibition of Host Protein Ubiquitination by Shigella Effector Kinase OspG.
pubmed doi rcsb
source organism Shigella sonnei ss046
molecule tags Unknown function, protein binding
total genus 53
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4q5eA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4q5eA01
2FB8A 3OBGA 4CRSA 4JDIA 2RF9A 2VD5A 3DOGA 3QCXA 4QMXA 2YM7A 3W16A 3T3VA 3RK9A 4NM0A 1ZOEA 4MVFA 5C8NA 4F6SA 3GT8A 4B7TA 4G5JA 3D7TB 4JDJA 1SVGA 4O0SA 2Y0AA 4DFXE 2OXYA 2XZSA 4FVQA 2PZPA 2FA2A 4ZXTA 5HZNA 5D12A 3RWQA 4ACHA 5A14A 3MPAA 1NVQA 3V3VA 5HORA 2X4ZA 4OR5A 3CY3A 3KB7A 4GYIA 5AIKA 3ZRMA 1YWNA 3RBWA 4ZLOA 4CVAA 4XP0A 3A99A 4B0GA 2XIZA 2IJMA 2OJ9A 2ZV2A 4QMVA 1DM2A 4C4JA 5IISA 5L6OA 5IQIA 3U6HA 5CX9A 3COKA 3WOWA 4NFMA 3D14A 3QTWA 2C0IA 5KMMA 3FZOA 2OFVA 4AGCA 1Q5KA 5LCJA 4EH6A 3ZXTA 4IJ9A 3R7VA 4CV9A 3L9LA 3SD0A 4WNOA 2HW7A 5IZFA 4CMOA 4O7ZA 4II5A 5DBXA 2C68A 2QU5A 2R4BA 3P0MA 2ACXA 3ZZEA 4PNKA 3QQKA 1NXKA 3BLHA 4FEQA 3N4UA 4H36A 5AP5A 3BYVA 4YR8A 4AT5A 5EDRA 1OL6A 1Q4LA 2ITPA 3Q6WA 5ACBC 3TZ9A 1U54A 2XK8A 2PMOX 2LGCA 1GIHA 3QWKA 4LRJA 3NRMA 2A1AB 2QU6A 5CEIA 4J8NA 4USFA 3FLWA 3UQCA 2X2LA 2A2AA 3VUGA 3DBFA 5J7BA 2GQRA 1OKYA 4YP8A 5ACKA 3VJOA 3B2WA 3VQHA 5FDPA 4O0VA 4YHFA 4FG8A 4BGHA 4DE4A 4HVGA 4TWPA 1H27A 3V5LA 3UP2A 3GFWA 4O6EA 4M8TA 3LOKA 2JBPA 3JS2A 2VTJA 4IWQA 3HECA 4EOQA 5FDXA 2OZAA 5DH3A 1JNKA 1Q24A 2G1TA 5EFQA 2XBAA 1PW2A 3R00A 3TIZA 5E1EA 5HIDA 3KRLA 4BCKA 4O2ZA 2W1DA 4AQCA 3E7OA 2WMXA 5J9ZA 4H58A 4MF1A 3GBZA 4BTFA 1PXOA 4CKRA 3OROA 2ZMDA 4YNEA 3COHA 5JGAA 5DR2A 3SVVA 3ZO2A 4L6QA 2OI4X 2OJGA 2W1FA 2GHMA 5HO6A 4ERWA 5JZJA 5M44A 3GEQA 4KIQA 2Y6MA 3FV8A 5I9UA 5CAVA 3QTRA 4IX4A 5FTGA 2WQNA 5LXMA 4HPUE 4R5SA 4A9TA 1IA9A 1G8AA 5ITAA 2C47A 4E3CA 3PXZA 3KRWA 1BLXA 4O6LA 1WBVA 3BLRA 3OP5A 5AWMA 3S0OA 5BYLA 1P14A 5HLWA 5AUVA 4C4FA 2PU8A 3F5GA 2CGXA 4FODA 3NVMB 5C4KA 4NWMA 2RFDA 1IG1A 1PXKA 1KWPA 3LCDA 1XKKA 2XB7A 3MWUA 3WZUA 4EBVA 5HNIX 4A9SA 4AFEA 4ID7A 4MXYA 4TYIA 4QT1A 3TI1A 5A4TA 1DI9A 5KBQA 1W7HA 4W4YA 3FC2A 4RFMA 4IM3A 4XLVA 4N6ZA 3RK7A 5DT0A 4DLJA 4DH8A 2CNVA 3NUNA 1ZYLA 5HO8A 5DPVA 1YOLA 2JDSA 5EQEA 2GCDA 3L9PA 4J53A 3LFEA 4LL5A 3ZO4A 2P4IA 1L8TA 4J99A 3DY7A 2V7OA 3E93A 2UZDA 2UZOA 4C7TA 2FSLX 3PA5A 2F2UA 3ORXA 4MF0A 2AYPA 4XX9A 4XS2A 4WNPA 1J3HA 1U59A 2XBJA 5E8WA 1U5RA 5M09A 3DB8A 4K77A 4F64A 3SXSA 1H08A 4D4RA 5G1XA 5IA1A 4RX5A 3R83A 4OTQA 1YWRA 3PZEA 2R3QA 4RBLA 3W2PA 1IRKA 3QXOA 4ZZMA 5D11A 5CU6A 3KRRA 4FIFA 4TYHA 4BDHA 4YO6A 4C3FA 1OL7A 2F49A 4IIRA 2XIXA 3PXRA 1PY5A 3F7ZA 1GNGA 3I60A 4FTNA 5DEYA 4EHZA 4ANLA 1H1RA 2IVVA 1PXMA 1P2AA 2J50A 3OZ6A 1BL6A 5DN3A 4RIOA 3FZRA 1Z57A 4RA4A 4ACMA 1OM1A 2E9PA 5E8SA 4P90A 3BYMA 3QBNA 3KKVA 4BTKA 4PDYA 2OXDA 5KZ0A 4JG6A 4C4HA 3G90X 4IW0A 5BMMA 4KIKB 1V0BA 1YOJA 2O3PA 4E4XA 4Q5HA 2JDVA 2X9FA 2VWBA 3MI9A 4AFJA 2NRYA 2R7IA 4ZLZA 3G0FA 4V01A 4CG9A 5CAPA 2XK4A 3S4QA 3FSFA 2BZHB 4NW5A 5L8JA 3C0HA 4FT0A 5M08A 4U0IA 3ANQA 2OJFE 4ACDA 5BX0A 3H10A 4KS7A 3RALA 1WFCA 2WMBA 4MAOA 4XMOA 4GKIA 3FQSA 4G9RA 4XRLA 2A4LA 2EUFB 3E3PA 2WOTA 4YZ9A 5CANA 5HBJA 5I9VA 2R3NA 3LFAA 3QCQA 4GG7A 4I41A 5KKRB 3AC3A 4AT4A 1M7NA 2PMLX 1IASA 1OMWA 1V0OA 2C6LA 3BPRA 4EH5A 3ZZWA 2UUEA 3FLNC 3OCTA 3KMMA 4FT9A 4G6LA 5BVDA 4B9DA 5HICA 4Y8DA 4L44A 2J0MB 3MBLA 2ITTA 5IH5A 1XBCA 3WF5A 3WF8A 3TNPC 5CQUA 1LUFA 3ZEWA 2CKQA 5EM5A 4FNYA 1OVEA 1HCKA 3UZPA 2B52A 5HQ0A 3U9CA 1Q8UA 4LV5A 4I6QA 4MXAA 4QTDA 3V5TA 2CKOA 4MX9A 4UXQA 5FM3A 3HA8A 3QGWA 3ZONA 4KINA 3IOKA 5K3YA 4Q5EA 4NEUA 5CEOA 3R73A 3I5ZA 3OWPA 4G3EA 4I5PA 2CGVA 3UO4A 5B2LA 2W5BA 1M2RA 3H30A 4D1ZA 2Z8CA 1TVOA 1H8FA 2WGJA 5EM6A 4K1BA 4EOSA 4P4CA 3RCDA 5C1QB 5K5NA 4IAAA 1W8CA 3C4ZA 3QTUA 2VUWA 4L01A 4UWBA 4ASXA 5JN2A 2VWXA 3CTJA 3HMMA 1PXPA 2J7TA 3QF9A 2LAVA 2UZBA 2QVSE 3G5DA 5HLNA 3BBWA 2PZIA 4IDTA 1ERKA 3HRCA 4E6AA 3FQHA 2OXXA 4RWIA 3NNXA 3Q9ZA 3MY5A 2C5YA 4QTCA 5GJDA 3E5AA 3HVCA 2OBJA 3R01A 3R1NA 4JJRA 1UA2A 3G2FA 3EN5A 4ANMA 3AC1A 4O7RA 3SG9A 2UZEA 3F5PA 4DGLC 3MFUA 2G2FA 5TT7A 4HGTA 3ROCA 4C0TA 1FOTA 4BCFA 1YI4A 2X6DA 2WMTA 2UVXA 4AN2A 2ETKA 5JT2A 1YHSA 3E63A 3FMKA 3LMHA 3UQFA 3I1AA 4RX7A 5D7AA 5A54A 3BHUA 4KWPA 5EK7A 4BIBA 3QC4A 4D5HA 2C0TA 4IWDA 5CZIA 4I6FA 4MNFA 3UZRA 3ZO3A 3GOPA 4JBVA 1WVYA 4ZJJA 2IVTA 3PVBA 4PV0A 1V1KA 2PULA 1WBTA 3KULB 3CR0A 4IADA 1FMOE 4H1JA 4MWIA 1RE8A 3HLLA 2A27A 4M69A 2AC3A 3D15A 4JT3A 2C3KA 4EH7A 3A4OX 4M14A 4AA5A 3BZ3A 5KHWA 3C5IA 3ORNA 3FBVA 3WARA 4FIEA 4BCIA 3ZO1A 2PVJA 3R28A 4FKIA 3RJCA 5IEVA 3Q9YA 5HE2A 2XKEA 3OY3A 2WB8A 3O0GA 4ZTRA 3AMBA 4I6HA 4DINA 2FVDA 2V7AA 1BKXA 1ZARA 2ZJWA 4Z55A 3DBCA 3ACJA 5LCKA 3LQ5A 4MEDA 3IW5A 2YCQA 4PP9A 3RM6A 3D2IA 4EK6A 3O8UA 3BU6A 4JLCA 3NNVA 3SHEA 3KC3A 2X0GA 3AD6A 3D83A 2WQMA 4L7SA 3PRFA 2PZYA 1IAJA 3QUDA 4BIEA 2W06A 5IQFA 3C9WA 4NFNA 3ZUTA 3AT3A 2P55A 3KMUA 5BVOA 5KX8A 2OGVA 4AZTA 4L3JA 4U9AA 3I0QA 4RIWA 2QQ7A 2R0UA 4O1OA 2ZAZA 4K8AA 2DS1A 5HTIA 2PVLA 3MH2A 3CY2A 1DAWA 4XBUA 1JKSA 2C3IB 4GW8A 2XNNA 4IHPA 3G9NA 2R2PA 3MTFA 3MGYA 4QO9A 4W9XA 4B99A 3F2NA 4BBMA 4QP4A 3Q32A 5IUGA 4U5JA 5LARA 4WOVA 5HE1A 3FHRA 3PRIA 3SA0A 2BRGA 3QRIA 1Z9XA 3W2QA 3P7BA 5HEZA 3AC2A 4H3QA 1W82A 2J9MA 4F9AA 4W4WA 4YLLA 2VNYA 3CD3A 2DQ7X 2WO6A 3PVWA 4ONAA 3PA3A 4IWPA 2NPQA 3B8QA 4X2KA 2GHGA 4NIFB 4C38A 1BUHA 3CQUA 2JC6A 3FMLA 4FSYA 3DAJA 5HO7A 4JXFA 4D1XA 4FV6A 3UIMA 3DBQA 3D5XA 3Q04A 5AR2A 3U8WA 4IZAA 4ENYA 2JDOA 2GU8A 5AEPA 5L3AA 5C8MA 4YZCA 2PK9A 4FTAA 5GIPE 2PVMA 3HV5A 3O7LD 1P5EA 2P3GX 1XBAA 2Z7SA 4L3PA 3IOPA 3MFSA 5JMSA 3RAWA 2YM6A 4U42A 5J1VA 2A19B 3C1XA 2ZV7A 4P2KA 3VUTA 4B8LA 5BMSA 1OL5A 4E26A 3PSBA 2F7ZE 3UIXA 4NYEA 4IVBA 4DEGA 4KUJA 4O91A 2WU6A 3GCPA 1CSNA 1YI3A 3DK7A 3GI3A 4I21A 3PG3A 5HNGA 2RL5A 4JS8A 5HX6A 1NT2A 2IG7A 4KB8A 4FEWA 4N57A 4MXXA 4X21A 5HG8A 4XG9A 5AA9A 2O65A 3TXOA 1JAMA 2HZ0A 4U44A 1DS5A 4G1WA 3RM7A 2QLUA 5EI2A 1OUKA 3L8XA 4E4LA 3EQRA 2XIYA 5AAGA 4K0YA 3ZSGA 3FEGA 5FQDC 3MESA 3HRFA 3SX9A 5M55A 2FSOX 4NTSA 3VBTA 4ZTHA 3ENMA 3OWJA 1TQIA 5HE0A 4R78A 3Q96A 4FSRA 2BIYA 1R39A 3ZBFA 5H2UA 3FLZA 3TDVA 4OT6A 3KXMA 5AX9A 5L2TA 3MA3A 4EK8A 3R71A 3UG2A 2BTRA 1YDRE 3ZLYA 3QZHA 1J7LA 4CZTA 3Q9XA 4MH7A 4QMZA 2ITQA 3KFAA 3VBVA 2WMRA 3NNUA 2X81A 1SVHA 3V6RA 3RGFA 3AMYA 3MTLA 3ZS5A 3OHTA 3RAHA 1OGUA 3LJ2A 4FUYA 1FVRA 4M97A 4A9RA 3P86A 3E8EA 3WYYA 2WU7A 4TW9A 3VRYA 4KABA 3UDBA 3VWAA 3THBA 3F2AA 4EYMA 1OBGA 4BR3A 3G33A 3O96A 4JX3A 3NIEA 2WTCA 3QAME 3F69A 5EOBA 3JVRA 5CVHA 2RG6A 4XNEA 5IH6A 1YHWA 1J7UA 4OTIA 4TZRA 3UOLA 3TTJA 4D4YA 5I9XA 3QYWA 4BDIA 4C3PA 4OAVB 3U6JA 4DYMA 2CLQA 4EQUA 4F6UA 4X2FA 2YAAA 2ZB0A 4FA2A 2YA9A 1JLUE 3WZKA 4WKQA 3Q4ZA 3ZU7A 3VF8A 1U46A 1OKWA 2J51A 3RMFA 5LJJA 5AP0A 4RT7A 4JOAA 3FMJA 2PVNA 4G16A 4D2VA 1M52A 4QYHA 3BHYA 3DKGA 2VTPA 2XJ0A 3PFQA 4QYYA 4MNEB 5IA2A 4OT5A 5FG8A 3GC0A 2W0JA 2YFXA 4FV4A 2R3RA 4EOMA 4WRSA 4W8DA 4UZDA 4AXAA 4UN0C 4FTLA 4BDBA 1OIYA 5TR6A 4QMOA 2WTDA 4FIGA 5KCVA 3I4BA 3OXIA 5AIRA 2OSCA 4UMRA 2WHBA 3PPKA 3CJGA 5E8YA 3DKFA 4PMPA 3OEZA 5TOZA 3L9NA 2CSNA 1OI9A 5CXHA 4GT5A 4WNKA 5CSXA 2B9JA 3PE1A 4KNBA 4UMQA 1JWHA 2PHKA 4FUXA 3LCSA 4CD0A 5BQ0A 4F9CA 5M51A 4BVUA 5ANDA 4AZEA 3I7BA 4ZSLA 3WE4A 2C6TA 3TTIA 2OF2A 4L68A 4BZDA 4G3GA 4F6WA 2VWYA 2Y9QA 2YCSA 5CSPA 1NA7A 2CN5A 4DH7A 3ZSIA 4I23A 4NM3A 5FM2A 3LXKA 4HNFA 2ZM1A 4V0GA 2X8EA 3F3UA 3F6XA 3LZBA 2EVAA 2JKOA 3VUHA 1FVVA 3ZSHA 4WT6A 4X3FB 1H0WA 2PUUA 3HV3A 3I5NA 2PL0A 4JBPA 4QQTA 1GAGA 2HXLA 2JAVA 5EI8A 5JKGA 1UKIA 5J9YA 3QCYA 3OWLA 1UNLA 5AMNA 4ACCA 2HK5A 5M56A 2J0IA 4K11A 2W5HA 3TNWA 4BKZA 2R5TA 5EW3A 4JIAA 3WILA 2R3MA 1KE6A 3FC1X 3VUMA 4ZTLA 5AAEA 1OIQA 3IW6A 4CMTA 4EQCA 5EG3A 4D0XA 3FZPA 1R3CA 4K9YA 4QMTA 5L6PA 4O1PA 4A4LA 4GG5A 3ZLXA 5HBEA 1WCCA 2C6MA 3BGZA 2RGPA 4GFGA 3QTZA 4FIIA 5L8KA 4ANSA 3H0ZA 2WAJA 3ZH8A 1XH8A 5CF6A 4ZIMA 3SDJA 5AX3A 3EYHA 5BYZA 3OW4A 4CRLA 4RX8A 1NVRA 3POOA 4PTGA 2QKWB 3RKBA 2AC5A 3LJ1A 4O27B 5F94A 3EWHA 1FGIA 4BDEA 5GIOE 4IZYA 3BWJA 2W4JA 4D0WA 4BN1A 2JEDA 4DFUA 4S33A 4QMQA 4IVCA 4Z9LA 4WG5A 3R04A 3ZM4A 4YZMA 4AN3A 4M12A 1H1QA 4IVDA 4QMPA 4BL1A 3R22A 2W17A 3VRZA 4J95A 2PVRA 2ZYBA 4BHZA 2QO2A 5A6NA 4G9CA 3VBXA 4EH8A 3BHHA 3QQGA 3LM5A 3BGPA 5DG5A 5BVFA 2YJRA 4XH6A 4OAUC 4AW0A 4EH4A 3KXZA 5DR6A 5EYMA 3D94A 4ZTQA 3DCVA 5L2QA 2DYLA 1FGKA 4FKUA 5DLSA 5JQ8A 3LFCA 5J87A 4R3PA 2I1MA 2IVSA 4FTUA 4U7ZA 4XCUA 4I20A 3WIGA 1Y91A 1Z5MA 2P0CA 3QLGA 2XIKA 4QTEA 5IMEA 3ID6C 5IA4A 2PVKA 1GY3A 3MB6A 3OOGA 5AP2A 4BY9E 3R30A 1STCE 3DS6A 5CU0A 5FP6A 2UW0A 4FTOA 4F1TA 2BKZA 3MVMA 3EN9A 3IS5A 4FTTA 4MBJA 1J91A 3TNIA 2CKEA 2B7AA 2QR7A 3VUKA 2JIIA 3HMOA 3OBJA 2ITXA 5HGIA 4IX6A 1PRYA 2GNIA 4LYNA 4QP9A 3BYUA 3EFKA 4YMJA 4KBCA 2JDTA 3OUKA 3U4WA 2OFUA 3MJ1A 4RJ3A 2B55A 3EQGA 1B39A 2UZLA 3B8RA 1ZY5A 3G6GA 4KSQA 5FEEA 4UMTA 4AE6A 4IMYA 4MK0A 2YIYA 2UVYA 3UIUA 2H8HA 4CSVA 3QA0A 2Y4PA 3U4UA 5AP6A 4XV3A 4APCA 4RLKA 2J4ZA 4GS6A 2UW9A 3A61A 5DVRA 3TCPA 3CKXA 4FK3A 4ZTSA 2OH4A 2FYSA 2XNGA 4XOYA 2PUNA 5EDPA 2O8YA 5H9BA 3UJGA 2XK7A 3R9RA 2W1IA 5GHVA 4AUAA 4ZZNA 5AADA 5CS6A 4M67A 3DLSA 5C27A 1UU3A 1WAKA 4U6RA 5AP3A 5A6OA 2C6IA 3FKLA 4XOZA 4F7LA 3E8NA 4RVLA 2GFSA 3PY0A 2XYNA 4R7BA 4EEVA 2BILB 5KUPA 4X3JA 4RLLA 3GCUA 5M4IA 2JBOA 4Y5QA 2W9ZB 5L2IA 1CKJA 4L00A 4H3PA 2B54A 5D41A 4E7WA 5BUIA 3BEAA 4YURA 4BCOA 4ZS4A 5C4LA 4GT3A 4MKCA 5E7RA 5TKDA 2ITWA 2XEYA 4WUAA 4KS8A 3PXQA 4H1MA 4TTHB 4AW1A 3WF6A 4YBKA 1Q8TA 2VU3A 1QPDA 5GZ9A 2DWBA 3PG1A 4FEVA 3L8VA 4I4EA 4EHEA 4FICA 2XP2A 4F1MA 3NEWA 3RINA 3F3ZA 4YGAA 4YJPA 2YJSA 1KV1A 3C4CA 1IA8A 3FL5A 5BVWA 2QHNA 4CXAA 3NUAA 3BBTB 5BVEA 3IDCA 4FX3A 4YLKA 1R1WA 3EH9A 4CEGA 4JG7A 3RP9A 3P23A 3BHTA 2E2BA 3WZEA 5LMBA 4CFXA 1WBOA 3BE9A 4ORKA 3ANRA 4EK5A 1OIRA 5EOLA 5DA3A 2OF4A 4KBKA 3BU3A 3Q52A 3ZLWA 2C1AA 4ITHA 3QWJA 3VN9A 4B8MA 3MY0A 1OPLA 3HRBA 3EN4A 4WUNA 4DT8A 3BELA 1H25A 2JAMA 4IEBA 4C61A 4F09A 4AG8A 2BDJA 5FD2A 4DEBA 3VHKA 4FL3A 4RJ4A 2QOIA 3D7TA 3JPVA 4AZSA 1YXTA 5JFXA 4Y72A 1UNGA 2VO7A 4LOPA 3FPQA 1I09A 3ZDUA 4ZZOA 1OIUA 4QP7A 4FSZA 1YQJA 3CBLA 4O0RA 4C58A 4FSMA 3VBYA 5FUTA 1M17A 5HHWA 4U81A 3R0TA 3A2CA 4I0SA 4CYJA 5LVOA 3HUBA 3D4QA 4N0SA 1KE8A 4FSQA 5GJFA 2XNMA 4ITJA 2OG8A 3R8PA 3ZFXA 4USEA 1J7IA 2UW6A 4IQ6A 3ORMA 5DNRA 4WG4A 4J97A 4HCVA 1VR2A 1RJBA 1YDTE 2XYUA 3K54A 5HTCA 3PWDA 2OICA 2XA4A 2OJJA 4RJ6A 1ZYSA 4DC2A 1O6KA 5IQDA 3FLQA 3BGQA 5FEQA 2WIHA 3Q3BA 5E90A 2BTSA 2W1EA 4XEYA 1VYWA 4X2GA 3LCKA 4C4EA 4NM7A 5IH4A 4FF8A 5KMIA 2HZNA 2XS0A 4JQEA 3NX8A 3UMXA 1QMZA 1BYGA 3DAEA 4GIIA 4WNMA 2BAKA 4O7WA 4RVKA 3DDQA 1ZYJA 3MVLA 4D28A 2YABA 4O7NA 3MSSA 4GCJA 5HKMA 1PXJA 5K0KA 1H00A 1JSTA 1P4FA 4QNAA 4EOPA 3S1HA 4ZSJA 4BYJA 4HW7A 2XJ2A 1WZYA 3DJ5A 4LGHA 4J7BA 4BGQA 3R7OA 4GRBA 3IPHA 2WMUA 4X6RA 3JY0A 4TXCA 4PMMA 4ZTNA 5KHXA 3OCGA 4D5KA 2GNGA 2BPMA 1M14A 3K3IA 5DGZA 3MIYA 3CXWA 4UX9A 3CKWA 4EOKA 2J2IB 5FBNC 4BCPA 1LPUA 2J0JA 4Q2AA 4RIYA 2F7XE 4EL9A 4FL2A 3BYOA 5C01A 4QRCA 3VJNA 1MRYA 3AOXA 4AT3A 4CKIA 4NCTC 3SW7A 3EFJA 2Z2WA 3O50A 3WE8A 4MQ2A 3REPA 4DH3A 1UU8A 3KMWA 4O22A 3A7IA 4DG2E 4I0RA 3ULZA 2YACA 5FP5A 3SRVB 5BNJA 2WKMA 4O0UA 4WG3A 2ONLC 3FMDA 5E1SA 3BV3A 3TV7A 4EQMA 2R3GA 4M84A 2WNTA 3IDPA 4IB3A 4MXZA 1XH5A 5IQBA 3FQEA 4EOOA 4CLIA 2C4GA 4X2NA 3O8PA 4IWOA 3NS9A 4PPAA 2CCIA 1ZOHA 3R9DA 4RQKA 4O0XA 5CVGA 3RHXA 4CZUA 2R9SA 2NRUA 3QA8A 4KIOA 4GK4A 4YSJA 4P7EA 3ZYAA 2O2UA 2G2IA 2BZJA 3QZFA 3VW8A 4S31A 4BBEA 3ORPA 5AUXA 3UTOA 3ULIA 5JK3A 3FZTA 3R8UA 3VS2A 4LOQA 4F7NA 5CAQA 3LFFA 3AGMA 4IB5A 4ACGA 4F99A 3QRUA 4IE9A 4DF3A 5HX8A 3A7GA 4TWNA 3DQXA 4IAYA 5EHOA 4OTDA 5HCZA 4QMLA 3F3VA 2BKKA 4DFLA 4NT4A 4F08A 4XBRA 3TIYA 3AG9A 4Y83A 3UPXA 2GTMA 3QZGA 3TNHA 4WBOA 4O0WA 5DHJA 4FTQA 4FTKA 4I6BA 4IFCA 4C33A 5CF5A 3DK3A 2CKPA 3CQEA 3DNDA 4A4XA 3RAKA 1KE5A 5K4JA 3NCZA 3LKMA 2ETRA 5IA5A 2BHHA 2VWWA 2B0QA 4IXPA 3L9MA 3UOHA 4O81A 2W05A 4QQCA 1JSVA 4M7IA 2ITVA 5CLPA 2XVDA 3GC7A 3UE4A 4PX6A 5JGDA 2UW7A 3QHWA 4QP3A 2BVAA 4K33A 3CSVA 1M2QA 3O51A 4IC7A 4HYUA 5B0XA 3W33A 4RQVA 1XH9A 4FNXA 4ZMFA 3OY1A 4FMQA 2JLDA 4FTCA 4BDKA 5KMLA 4FZFB 2GS2A 5AM6A 5AUUA 5J95A 2GNJA 3E8CA 5H8BA 3I6UA 4M69B 3U51A 5AR8A 3HZTA 4ZAUA 4JDKA 5E9EA 2QLQA 2BROA 1JQHA 2QC6A 5F20A 4JR7A 5EM7A 3PJ3A 1R0EA 2O5KA 2CPKE 4FL1A 1YHVA 4UWCA 4PNIA 5CASA 2BFYA 3KRJA 4L42A 5M57A 5AUZA 4D2PA 4ARKA 3QQJA 3PDTA 1REKA 3SLSA 1HOWA 4HVIA 2XUUA 3M2WA 1W0XC 4KKGA 4QD6A 4XG2A 5AP7A 4BDAA 4BF2A 4C2WA 4DH1A 3N4TA 2JKMA 2QHMA 5C8KA 3VS1A 4EC9A 3EJ1A 3UP7A 2GQGA 4NZWB 4C8BA 3LQ3A 4G6OA 3RPRA 1M2PA 4A7CA 4F7JA 4IM0A 4KIKA 3AMAA 4RG0A 4I1ZA 3C0GA 5F1ZA 1ZAOA 4OW8A 5GJGA 3NR9A 3ET7A 4I92A 3NCGA 5KMOA 4KKHA 3IGOA 4ASDA 4BCNA 1MUOA 5CSHA 4QYGA 5EYKA 4QOXA 1ZOGA 5HTBA 5DYJA 4YJSA 2E9NA 2OO8X 3ERKA 3VNTA 4ANNA 5LMKA 2JKQA 2ZMCA 3R7EA 2VGPA 2XM8A 2EWAA 1T46A 3CD8A 2YIQA 4HYSA 1KV2A 4EONA 3G9LX 5D10A 3PZHA 4GEOA 1CDKA 4S30A 5LMKC 3ZMMA 1SZMA 4C2VA 4IX5A 1XH4A 3BHVA 4DEEA 3UODA 3BYSA 3FDNA 5EHLA 4U80A 5E92A 3NMUF 3UGCA 5KKRC 5DR9A 5GZ8A 3FE3A 1BI8A 3R7YA 1O6LA 2F4JA 5IEYA 4HYHA 2BFXA 4NKSA 5CEPA 1PKDA 3IDBA 4XG3A 3FZSA 2CGWA 2I0VA 3PWYA 3P78A 4S34A 2PVYA 2XEZA 5E8TA 5IQHA 2OLCA 4FBXA 3NPCA 3R2YA 2YDIA 2GSFA 1CMKE 3AC8A 5EDQA 3C4FA 3TT0A 3R7UA 1WBNA 2RG5A 2W1CA 1XO2B 3LHJA 4QTBA 4EHVA 4EH2A 2VWVA 4BCJA 5HD4A 2YM8A 3S95A 3FLSA 3Q9WA 3KREA 4BZOA 3SKCA 3R02A 3OT8A 2V22A 1JKTA 3BE2A 5AFVA 3AD5A 3PUPA 4BDFA 2XK3A 2V62A 5HD7A 5FRIA 3F66A 4RSSA 5DRBA 3ZXZA 4O7VA 3DKOA 4DGNA 5I9YA 2QOHA 1Y57A 1GIJA 1P4OA 2VO6A 2XNBA 3HA6A 2W1GA 4FKWA 4L46A 4RJ7A 4DTKA 4QMNA 2W9FB 4LFIA 3TZ8A 4R6VA 4YUQA 4W4XA 3FPMA 4YC6A 4F65A 2ITZA 2Y4IB 1Q99A 2B9FA 3RCJA 4DITA 3KY2A 2UW5A 3PP1A 3H4JA 1H24A 2BR1A 4GUEA 4TN6A 5HCYA 4EZ7A 4PP7A 2BRHA 3F3WA 4UYAA 3DNEA 3HL7A 3R2BA 2OZOA 5AV4A 1VZOA 1QCFA 3OVVA 2YM3A 3IW7A 4AA4A 4CTCA 5CAUA 2WD1A 1YI6A 3GU4A 4GK3A 3RTPA 5H8EA 2VTIA 3HAMA 3TUCA 4C62A 4YO4A 4JX7A 1NW1A 1JKLA 1Y6BA 3NW7A 1IAHA 3OFMA 4PMTA 1XWSA 2X2MA 4FC0A 4HVSA 3Q6UA 4Z7HA 3KF4A 3D7ZA 1L3RE 4FK6A 5TO8A 4CCUA 3SXFA 3SG8A 3QTSA 4K18A 4YPSA 2WOUA 4NL0A 3R21A 1A48A 4IJPA 2C69A 2H96A 3R8VA 3KULA 4RIXB 1GZ8A 2VTMA 3F88A 3MW1A 4WBBB 3COMA 4APPA 3BV2A 3GU7A 3W32A 4D4VA 5DEWA 5CENA 4L52A 3UNJA 3A60A 3JR1A 4ZY5A 3I79A 5HI2A 3E3BX 4WD5A 3FMMA 5CT7A 5IF1A 3ORKA 4TRLA 4LMNA 1MRVA 3V5WA 4CTBA 2WTWA 2J6MA 2GMXA 1M7QA 3MB7A 3PIZA 5L6WL 3FY2A 5J1WA 4O83A 3VHEA 3OF0A 4G31A 3EFWA 2F7EE 5GNKA 3KF7A 3T9TA 3TV6A 2PY3A 2GTNA 4Y85A 3QKLA 2ZV8A 4FV2A 3OC1A 3O23A 4EKKA 4RFYA 4FYNA 3VS3A 2WZJA 2ZM4A 2IWIA 3NDMA 3KXHA 2UV2A 5DRDA 4EK4A 4FOBA 2C6OA 2WMSA 2H6DA 3M1SA 4QP6A 3FHIA 4GK2A 4GJ2A 4RZWA 4IACA 3A62A 4AAAA 1Q61A 1Q8WA 4FGBA 2ITYA 4ZY6A 1JPAA 3JVSA 4F9BA 4BWKA 4AACA 5M53A 3UC3A 4LRMA 2QKRA 2X1NA 4H39A 4G3FA 1AGWA 2UZWE 2HELA 4IZ7A 3TJDA 5HU3A 3IECA 1Q3DA 2QG5A 2YHVA 5JFVA 2VTTA 2J5EA 2XNPA 4PL4A 4DN5A 4ZS0A 4E6CA 2R3KA 2X7FA 4LGDA 5HVJA 4RC3A 4XRJA 4DCAA 3P1AA 3DAKA 1URCA 4XV2A 1WBSA 4G17A 3VS4A 4MD9E 4LMUA 2PZRA 3Q5IA 4JBOA 4E6DA 3MFTA 2OK1A 2VTNA 3EQDA 4U41A 4FKTA 3RAIA 3GNIB 4DCEA 3GCQA 3EKNA 3PJCA 2ZDTA 3QALE 2YIRA 3DB6A 3C7QA 3FAAA 4NIFA 4PF4A 2YERA 4YTIA 2PYWA 3MH3A 3II5A 1UU7A 4FKQA 4G6NA 2VX0A 4L45A 4PDOA 3N4VA 3D5VA 3TWJA 4FZDB 3W2OA 3QQHA 3R7IA 5KMKA 1H1SA 2B4SB 3LCTA 3EIDA 5EYDA 1SM2A 3HNGA 3VS0A 4XUFA 4FSNA 2OKRA 3HP5A 3UOJA 4I94A 2GPHA 4TT7A 1ZXEA 3OEFX 5CNNA 1YDSE 2JD5A 3DFAA 5CU4A 3P7CA 3MV5A 5LQFA 1EH4A 4FT7A 4O82A 2ZM3A 4YTHA 4QNYA 5H8GA 4YHJA 3D5UA 3FI4A 4BDDA 2E9OA 2WTKB 4CT2A 3K2LA 4UALA 5IEXA 3PIYA 5HG5A 3W1FA 4WSQA 1ZZ2A 3DA6A 5BVNA 4J96A 1K9AA 4HZRA 4EI4A 2XCHA 3EQFA 3PSDA 5E91A 3QQLA 4LOOA 3ZCLA 1R78A 4C57A 3U6IA 3EN7A 3SGCA 4U97A 3TACA 1H1WA 4IANA 3KA0A 4U43A 4QYEA 3Q2MA 2OIBA 4G3CA 4G3DA 3QKMA 3G15A 1OUYA 3P08A 1MQ4A 1YXSA 2WTJA 3AXWA 3UIBA 4X2JA 4KD1A 3KU2A 5JZNA 3B2TA 4ZSEA 4DGGA 5IMXA 3V01A 2FSMX 4CFVA 3IONA 4EH9A 4AOJA 4GFMA 3ZC5A 1FBNA 4QPAA 5E4HA 1ZZLA 5AAFA 3NVKI 2R0IA 1VJYA 5J8IA 1YVJA 3DPKA 4ALUA 4A9UA 4P5QA 2NP8A 4LRKA 2GNHA 4TYEA 2CDZA 4DLIA 4H05A 2WMWA 2YLFA 4BCHA 3R1YA 2ITUA 4ANOA 5A4QA 5AUTA 3JYAA 4CKJA 1RQQA 5J9LA 5CXZA 2WFYA 4YZBA 3OCBA 2EB2A 4LM5A 4X0MA 2Z7RA 3N9XA 4C02A 4EYJA 4DEAA 3UZTA 4DT9A 4UB7A 4GU9A 3VVHA 4O84A 3UVRA 4R8QA 4ALVA 1OL2A 2WTIA 1XH6A 2W99B 4Z7GA 2J90A 4CQGA 3GU6A 2WMVA 3GB2A 4EORA 4R5YA 1GZOA 1YW2A 4R3CA 5BYYA 3FXWA 2XM9A 4F0GA 4IFGA 5A9UA 2YIXA 4GV1A 4CLJA 2FSTX 1PXIA 3F3TA 4YHTA 4PUZA 4FV5A 1H07A 2HXQA 4MYGA 2X8DA 4QP1A 1DAYA 5E8XA 2VV9A 5ETCA 4J52A 3F2RA 2PWLA 3NAXA 5AR4A 4QMUA 1YWVA 1XH7A 5FXSA 2XIRA 4CV8A 3TUDA 2QG7A 3FYJX 2QR8A 2WQBA 1J1CA 3MIAA 4JR3A 4O0YA 3QFVA 2BDWA 4NSTA 3PJ8A 4R1VA 5DE2A 5F4NA 5KNJA 4AZWA 3TM0A 4DFBA 4RJ5A 4JQ7A 2BRNA 3G0EA 2C5OA 2ITOA 4M13A 4PRJA 3NGAA 1BL7A 4LQMA 1E9HA 4MNEA 3I7CA 1IEPA 2RFNA 1NVSA 3PXFA 4QMWA 3ZC6A 3ZUVA 3DQWA 4O21A 2VWUA 3KQ7A 3C5UA 5E8ZA 3CGOA 3UBDA 2GS6A 2JDRA 2I0YA 4LG4A 4J98A 1WMKA 2JITA 4GH2A 5AR5A 2R3JA 2PMNX 2GDOA 3FSKA 1PXNA 3RZFA 3NNWA 2CNQA 3ODYX 3Q53A 5AR7A 2X9EA 4DEHA 4XYFA 5D9HA 5CTPA 3WI6A 4FVPA 4NK9A 2R7BA 2Z7LA 3UG1A 4BBFA 2FO0A 2QOKA 4I5CA 3LQ8A 3VBWA 2X2KA 1QPCA 2OWBA 1YRPA 2JKKA 2VTRA 1UKHA 4FE2A 4EC8A 1SNUA 3HV4A 4FKLA 5E8UA 2IW9A 4CFFA 3TKUA 4ZLYA 4MXOA 4U8ZA 2WPAA 3D9VA 1BI7A 3FY0A 5JRQA 5CVFA 1UVRA 4NU1A 1ZRZA 4FSUA 4J8MA 4E5AX 3QL8A 1U54B 1Q97A 3IW8A 4LI5A 1KOAA 3A8WA 5I3OA 5K0XA 1U4DA 4TYJA 2V55A 5JSMA 1APME 3DJ6A 3HEGA 1XJDA 4X3FA 2A0CX 3W2RA 5ANGA 4R77A 2HZIA 4CT1A 2W1HA 2HY81 2WELA 3HX4A 3WF9A 3MPMA 3DZOA 4UBAA 4X3FC 1KE9A 5AR3A 4DAWA 2XH5A 4DBNA 5JH6A 5DMZA 3OTUA 3O8TA 2C5NA 1GIIA 4F9WA 1ZLTA 3EL8A 3AC4A 4NKAA 4ZEGA 3DU8A 3NYNA 3HV6A 4F0IA 3OXTA 3QCSA 1YKRA 2OZAB 4RGJA 2O63A 4NM5A 4TKSA 4AE9A 2W1ZA 4L7FA 4M66A 1OB3A 3DZQA 3AGLA 4ENXA 4ANQA 3EKKA 2QOOA 4O0TA 5A46A 1E1VA 2VTOA 3LMGA 3MYGA 2OU7A 3GFEA 3MPTA 4RWJA 3OTVA 3V5PA 5GZAA 5FTOA 3LFQA 3F5UA 3HDNA 1G5SA 3QX4A 3CCNA 3EYGA 4FZAB 4C36A 3UYTA 5IA3A 3RPSA 3ZRKA 3A4PA 4JQ8A 1LEZA 4XP3A 3ZFYA 4PPBA 3EN6A 3FWQA 4RPVA 4YJNA 5AUWA 4PPCA 1K2PA 4FV0A 4O38A 4FV7A 2P33A 5IUHA 3BI6A 4F63A 2YN8A 4GL9A 1RW8A 4FGRA 3HDMA 2O64A 4BB4A 4FG9A 3RPOA 3RPYA 1B38A 2YM4A 2BRBA 4WA9A 2YISA 5FWKK 3U9NA 4E20A 3EQBA 4FTIA 4QMMA 3N51A 2PMIA 3VBQA 2CJMA 4HOKA 5L2SA 3RNYA 4YBJA 3TJCA 3EFLA 1PMNA 4FR4A 1SNXA 3MFRA 3VAPA 3W55A 3UPZA 1XHAA 5EQPA 1Y8YA 2GHLA 1KOBA 2EXMA 2YAKA 4RRVA 1PHKA 3SXRA 4R1YA 3VULA 5A4LA 1IR3A 2JIUA 5C26A 4PL5A 3QQFA 3AT4A 3CP9A 4E6QA 1H1PA 5M4CA 3GCSA 2BRMA 4B4LA 4OGRA 1H0VA 4A9YA 4WIHA 4E73A 2Q0NA 3ENHA 4BCGA 3HMNA 3D5WA 2P2HA 4HNIA 3ZBXA 4F70A 1ZY4A 2RIOA 3BQCA 1PJKA 3IKAA 5LOHA 2WTVA 3GXLA 3UMWA 3PY3A 5ANIA 3H3CA 4EUUA 4EZ3A 3GP0A 3BIZA 4JVGA 4MBIA 2BALA 4FKVA 3DGKA 2BAJA 4MXCA 2FH9A 1MP8A 4PWNA 4RIYB 2B9HA 5DI1A 4AU8A 4K6ZA 4AZFA 3EMGA 3VUIA 2VX3A 4G2FA 5HBHA 3E8DA 4QYFA 4ZK5A 2VGOA 1BX6A 4BRXA 5EKOA 5B2KA 1SYKA 3E64A 4MWHA 1VEBA 1ZYDA 3L1SA 4KBAA 4TYHB 4DA5A 4FTMA 3OOMA 3KN5A 4WO5A 1Q62A 2CHLA 2UW8A 4FNZA 4GVJA 3FXZA 3R8ZA 3AQVA 5CI7A 2QURA 4TNDA 5H3QA 3V5JA 1PF8A 4MBLA 2B9IA 3ORZA 1O9UA 5HNBA 5BPYA 2CLXA 3VO3A 2EXEA 3QGYA 4YJTA 4CG8A 5EYCA 5I0BA 1CKPA 3VS5A 1PYXA 3MS9A 5ETIA 4A07A 1QL6A 4LUDA 4CYIA 4ZJVA 2KULA 2R3LA 4A06A 2UZNA 4YJVA 4LUEA 3ZRLA 2BIKB 4ZSGA 5BUEA 5IQGA 2WEVA 3QYZA 4GT4A 4OBQA 3PSCA 4DEDA 3AD4A 3OMVA 2QI8A 1FMKA 4CNHA 2IZSA 4FV9A 4XP2A 3ATSA 5T68A 2YITA 4BIDA 2OW3A 2I6LA 2R3OA 3LM0A 2WEIA 2XKFA 3MA6A 4MD8E 2CMWA 3EZRA 1R0PA 3JUHA 3QRJA 4YJQA 2XRWA 3TNQB 4D55A 5I9WA 2C0OA 3V04A 1YOMA 2RKUA 4U3YA 3HYHA 5CWZA 5EHYA 4Z16A 2C5XA 4PDSA 2YDKA 3F9NA 5JGBA 4HGEA 4L3LA 4FKJA 4KRCA 4DGMA 4D58A 2QNJA 3RZBA 1A06A 3PJ1A 3I81A 4ASEA 4NCTA 5CYIA 3MDYA 3VS6A 2GQSA 2HWOA 3MJ2A 4I3ZA 3DFCB 2Y7JA 5I9ZA 2ZOQA 4J1RA 3EQPA 4M15A 3SV0A 4ZSAA 3C4XA 4XV9A 1OZ1A 3UVQA 3NW5A 5BUJA 5JQ5A 1ND4A 3FMHA 3K5VA 1CM8A 4D2RA 3EL7A 5G6VA 2CN8A 4CZYB 3BEGA 3BQRA 1V0PA 1PMUA 2ERZE 3DKCA 4DG3E 2ONLA 4CGAA 3KCFA 3DT1A 3CE3A 4NUSA 5CAOA 5L8LA 2PTKA 4L43A 5F95A 3WZJA 3BKBA 1YXVA 2QOBA 4IB0A 4XG6A 4YTFA 5AP1A 4YJRA 4JNWA 3CS9A 2VTHA 1CKIA 4EHGA 3RK5A 1REJA 2C3LA 3F5XA 4RA5A 2VRXA 3H9RA 4E4MA 5C9CA 3R6XA 4EJNA 3FMNA 1LEWA 1TQMA 3IK3A 3FYKX 3RNIA 4BCMA 4UZHA 3U54A 4UV0A 3LFBA 2PVHA 5CF4A 3HP2A 2XK9A 3HMPA 4X6QC 4I93A 5FLFA 1SVEA 2QCSA 4E5WA 3ZEPA 4PL3A 4JBQA 5LMAA 4FEXA 3ZM9A 2YDJA 4EOIA 4EUTA 4O7SA 3FUPA 4D9TA 4C59A 3CPCA 4BZNA 3FLYA 4L67A 4G5PA 5T3QA 4O96A 1S9JA 4U3ZA 5KMNA 3ALNA 2J0LA 5B7VA 3R9OA 1ZYCA 3EZVA 3ORTA 1MQBA 3NYXA 5EKNA 4FIHA 3FI3A 5EW9A 3UVPA 1S9IA 4E4NA 4N6YA 4NJDA 4JAIA 3V8WA 3D2KA 4W8EA 1VYZA 4WSYA 5KO1A 2F2CB 3OWKA 2W4OA 4I24A 4PMSA 3ZLSA 1G8SA 4HZSA 2G01A 4I4FA 2BHEA 4E5BA 3KRXA 5CEQA 1KUTA 2W4KA 2FUMA 5IU2A 2R64A 3R9HA 4OTRA 2HOGA 1JOWB 3QTXA 1OPJA 5LWNA 1ZMVA 1QPEA 4BWPA 5FEDA 1PYEA 5HIBA 3SC1A 3LLAA 4UEUA 3ALOA 2I7QA 4TWOA 5ETAA 4IAIA 4W9WA 2C6DA 3CTQA 4R7IA 4KAOA 4V05A 5BVKA 5L2WA 2Q0BA 3IW4A 2IO6A 2R3PA 2C3JA 3RHKA 2VO3A 4TWCA 3RPVA 5ANJA 2PPQA 4IM2A 1SMHA 2HZ4A 4H3BA 4AF3A 3E87A 3A7HA 4D2SA 3ZHPC 4I5HA 2HAKA 2YIWA 4RVMA 3ATTA 1Y8GA 4YU2A 3PPJA 5ANEA 4DTAA 4AOTA 3OCSA 2ZV9A 2JIVA 3MVHA 2ZB1A 4GJ3A 3WF7A 3WZDA 3GQIA 3PY1A 5DIAA 5I5ZA 5CI6A 1WVWA 1KSWA 4IBMA 2HWPA 3E92A 3SQQA 4DFZE 1WBPA 3NUUA 3DBEA 4ZY4A 3SW4A 3DXQA 2UW3A 3GOKA 4QQ5A 5M06A 4FV8A 2O0UA 4ANBA 4D1SA 5F9EA 4QP2A 3SRVA 4DBXA 5GINE 5A4CA 3TUBA 4BYIA 3HAVA 4O7TA 3F82A 5J5SA 3MY1A 1PXLA 3TDWA 4D2TA 4BDJA 3NW6A 2C6EA 2WMAA 4KIPA 4OTFA 4OTGA 4BICA 2JFMA 2QOFA 5HU9A 2HW6A 4FKPA 3DDPA 2YZAA 3ACKA 3K3JA 3QD4A 3IO7A 4GSBA 4RWLA 2XCKA 2H34A 2EXCX 3E62A 4J71A 3HKOA 5IDPA 5LWMA 4FI1A 3BX5A 4GUBA 5AM7A 3OUNB 4XG7A 3R8MA 4GIHA 4HCUA 2EB3A 2GS7A 4CCBA 2BAQA 3BU5A 2RFEA 3W10A 4AGUA 2HIWA 1H28A 4KKEA 3L8PA 1JKKA 3NUSA 4K2RA 2BCJA 3C50A 4UY9A 2CNUA 3OS3A 5B2MA 2AUHA 5HOAA 3H9OA 3G51A 3EB0A 5K9IA 3EHAA 3NUYA 4OBOA 4PQNA 4YNOA 3M11A 2GFCA 4PTEA 1OITA 4RIWB 3WBLA 3HGKA 5AV3A 4LV8A 1W98A 4O2PA 3QUPA 4QQJA 3ZTXA 4IAZA 2B53A 1F5QA 4IZ5A 1LP4A 3A7FA 2BMCA 4BTJA 3CEKA 4GVAA 4DEIA 4CFNA 3DTCA 3HV7A 1LR4A 4OLIA 4XLIA 3FKOA 3GU5A 4Q9SA 5J5TA 4DGOA 5HE3A 5FTQA 5IUIA 2NO3A 4DFNA 1X8BA 5CZHA 3PJ2A 4R3RA 1OPKA 2YCRA 4EWHA 3PVUA 2V5QA 5KE0A 2QD9A 3DBDA 5M4FA 4Q9ZA 2BZIB 2HENA 4OBPA 1JVPP 2BUJA 5FBOA 2H9VA 5EI6A 5CQWA 4CFUA 5KMJA 4M68A 4EWQA 3HMIA 5AV1A 4HVHA 3U55A 5HVYA 3WYXA 3W2SA 4BCQA 4EOLA 4LL0A 3F61A 3PXKA 3LAUA 4D2WA 1QPJA 3IQ7A 2OJIA 2ERKA 1FVTA 2UVZA 4TYGA 5CU3A 4BFMA 2HYYA 3OD6X 3LW0A 4RJ8A 4WRGA 1F0QA 4IVAA 1FQ1B 4FVRA 3O2MA 1UWHA 2KTYA 2ITNA 2WXVA 4U79A 2QOLA 1AQ1A 2ZDUA 2GNLA 5K4IA 5JEBA 2B1PA 4HPTE 3LLTA 4N4SA 3NUXA 3LIJA 3RWPA 3JXWA 4BWXA 3Q2JA 4BDGA 4FNWA 1JSUA 2BDFA 5AUYA 4AWIA 4EJ7A 2YLEA 4ZOGA 4A4OA 3QD2B 5CNOA 2JFLA 3D0EA 4UXLA 4YC8A 2XMYA 4JRVA 5DOSA 4BC6A 3UYSA 2YZLA 4TNBA 4IAFA 1MRUA 3PTGA 3QLFA 4XV1A 3S3IA 2PZ5A 1UV5A 2I40A 3ZOSA 3LE6A 3NYOA 2RFSA 4ITIA 3UQGA 1UWJA 4CQEA 3P9JA 5CEMA 4FT3A 2IZTA 4QPMA 4BTMA 4RWKA 2VTQA 4DFYA 2GNFA 4JL9A 4WHZA 1ATPE 2CCHA 2YEXA 4IDVA 4RMZA 2EU9A 2QO9A 1PKGA 2PE1A 1KE7A 2Z60A 4HYIA 3T9IA 1JBPE 3RI1A 3O71A 3SOCA 5HG7A 2Z02A 2JGZA 1UU9A 3H0YA 4C34A 3NLBA 3QX2A 3P79A 1Q41A 1BMKA 3CQWA 4I0TA 2REIA 3A7JA 3PLSA 4DH5A 5AA8A 4RFZA 5KBRA 3QTQA 5EQYA 5IQEA 4E8AA 1H4LA 5JRSA 5ANKA 5IQAA 2VZ6A 3CJFA 4QMSA 3BWFA 4HGSA 3NSZA 5CEKA 5ICPA 3NYVA 2OIDA 4BI1A 2Y8OA 1W83A 3SOAA 3AT2A 2ETMA 5JFWA 3OW3A 1DI8A 4IB1A 5LVLA 3W8QA 1UNHA 3PP0A 4JDHA 4AOIA 3TEIA 3VQUA 4CFWA 2YM5A 1ZWSA 4IH8A 2X6EA 3DLZA 3UOKA 3C4WA 3Q60A 3I6WA 4GFOA 2WQOA 3NAYA 3VC4A 1GZNA 2E9VA 4L9IA 5AP4A 5HG9A 4AS0A 3KK9A 3DXNA 2VNWA 4NTTA 3QKKA 3V5QA 3KXGA 1AD5A 3KXXA 4FSTA 3VS7A 3BLQA 5FGKA 2QOCA 2DUVA 3IGGA 2UZTA 4S2ZA 3MN3A 2YCFA 4U40A 4USDA 5CSWA 4ERKA 3CPBA 3C4EA 4JRNA 3GGFA 3ODZX 4QMYA 2BZKB 3VW6A 4F9YA 5K5XA 4FOCA 3GENA 3P5KA 4I22A 5CALA 1I44A 1GOLA 2WMQA 2G2HA 4G34A 4JIKA 1ZMWA 4FT5A 2G9XA 4YZNA 5M4UA 1FINA 3C51A 2Y4IC 2V0DA 1GZKA 3FMEA 3QC9A 3LXLA 3QRTA 3LXPA 4FZ7A 4RZVA 5IA0A 4MD7E 4JI9A 3LMIA 3U87A 4PTCA 5CT0A 4AGDA 2YWVA 4P5ZA 5CU2A 3W18A 4EK3A 2C5VA 3KN6A 3F7WA 5AV0A 3MH1A 3QXPA 3R7GA 3KGAA 1K3AA 4AW5A 2X7OA 1PMEA 3CLYA 5I3RA 3PLAE 5HVKA 2P2IA 2ESMA 2FGIA 3Q5ZA 5ANOA 2VTSA 5ETFA 5IQCA 4F7SA 3BCEA 2R3IA 3S2PA 3W2CA 1Y6AA 1CTPE 4OTWA 3UC4A 4TY1A 5AV2A 3TKIA 3V51A 4GKHA 3GU8A 4FG7A 4FV1A 4BDCA 5AJQA 4OTPA 4RIXA 1OL1A 4F1OA 3VUDA 3OG7A 2IPXA 5LVMA 4FKOA 3QU0A 5EW8A 2QO7A 4ZMEA 4YTCA 3O17A 3LFDA 3I0OA 3R1SA 4L53A 2IVUA 2VX1A 3QD0A 2Y6OA 3CGFA 3QRKA 5DT4A 3WIKA 4KRDA 2IZRA 4V0GB 3P4KA 1G3NA 4KSPA 4FEUA 4Y95A 5J79A 4IAKA 1XQZA 1A9UA 2XK6A 3LCOA 3Q4TA 4UMPA 5I4NA 5M07A 4S32A 4BKYA 4YSMA 3DJ7A 3Q4UA 3TL8A 4D4SA 4JAJA 3ZDIA 3JY9A 5IKWA 3VF9A 4YZDA 4YJOA 4EKLA 4O7LA 4IC8A 3H9FA 3AC5A 3PXYA 4YJUA 1WVXA 1J1BA 2X8IA 4Z3VA 2VTAA 1ZMUA 4NW6A 4XJ0A 2QODA 2VWIA 3LXNA 3POZA 4O86A 4YLJA 2VTLA 2UW4A 3QUEA 3T3UA 1XBBA 4JG8A 3P7AA 4E1ZA 1YXXA 3ELJA 2PSQA 5TE0A 5J7HA 1GJOA 3FI2A 4FYOA 2PUIA 4EZ5A 4M0YA 2UZVA 1TKIA 3PYYA 5T6KA 2OH0E 4PY1A 1TQPA 2HY0A 2IZUA 3GC8A 4FIJA 1FPUA 4QPSA 3L8SA 3KEXA 3ITZA 3NZ0A 4RVTA 3PA4A 1XR1A 3KK8A 5LVPA 4FKRA 3CC6A 3DV3A 3KVWA 3OT3A 1OBDA 1U5QA 2R3FA 1H26A 4AGWA 3FJQE 4KA3A 3DK6A 2PE0A 3MH0A 2R3HA 4EBWA 2C30A 4AZVA 3E7VA 2W96B 3PPZA 3HUCA 4Y46A 4YC3A 4N70A 3V8TA 4AX8A 1E1XA 2SRCA 4MTAA 4BGGA 3LFSA 2W5AA 4FV3A 3TG1A 1URWA 2PUPA 1WBWA 3O7LB 4L8MA 4E93A 2X4FA 2YWPA 3QQUA 5C03A 3NUPA 4C35A 4TL0A 3COIA 2VAGA 4FKSA 4GU6A 5DFPA 2C6KA 3OXZA 2X7GA 4U45A 3RVGA 4C3RA 2Z7QA 3UO5A 2VWZA 5HLPA 5LVNA 4HJOA 4D9UA 3NIZA 4B6LA 1B6CB 4XG4A 2I0EA 1OECA 3KL8A 4QTAA 5CF8A 4AA0A 3IG7A 3PVGA 4HCTA 1OKVA 4PDPA 4AW2A 3MVJA 4YPDA 5HESA 5DT3A 4IX3A 2QONA 4C4GA 3EQHA 5KZIA 4MQ1A 3W8LA 5L4QA 3R9NA 4XHKB 3Q4CA 1W84A 3KXNA 3ORLA 2RSVA 2F57A 2WIPA 3GVUA 4GYGA 4MCVA 4ZP5A 1H01A 3UO6A 4Y5HA 3UNKA 2HCKA 4DHFA 3GCVA 5EH0A 2PVFA 4X7QA 5JFSA 4BI0A 3SAYA 3T8OA 4HGLA 2I0HA 2IN6A 4FZ6A 3ORIA 4C4IA 3LFNA 3TV4A 5IG1A 1OKZA 3S00A 2XNOA 4FTRA 4NH1A 3ZUUA 4BI2A 2IW6A 4C37A 4UMUA 3LVPA 3FZ1A 4DTBA 3CTHA 4LGGA 4ALWA 5IPJA 3A8XA 3FL4A 4HVDA 1Q8ZA 4I5MA 1RDQE 3GQLA 4QP8A 3ROYA 2NNWB 2X39A 4FSWA 1F3MC 2G15A 3KCKA 2CGUA 4RC4A 4AP7A 4M0ZA 4RX9A 5CSVA 2WTKC 4AN9A 4ASZA 4UWYA 2QOQA 2J0KA 3LPBA 2XKDA 4BKJA 4EH3A 5A4EA 1HCLA 5TF9A 2XKCA 3CIKA 3TKHA 1Q3WA 4RC2A 3DTWA 3DXPA 3K5UA 3ETAA 2Q83A 3GUBA 1PMVA 3FKNA 2ZVAA 3QTIA 2VN9A 5DWRA 3PE2A 3EQIA 4F0FA 2E9UA 4Y73A 2OIQA 5D7VA 2UZUE 3EQCA 3VIDA 3PIXA 5EM8A 4UYNA 1T45A 1YXUA 2XRUA 4FTJA 4ZJIA 1O6YA 3C13A 2XJ1A 2IW8A 2XF0A 4O7YA 2J5FA 3QZIA 2WQEA 4MHAA 4NJ3A 4TPTA 4XG8A 3QHRA 3NWWA 4GMYA 3V8SA 4F4PA 4CMUA 4ZTMA 3KVXA 3TZMA 4EOJA 4FKGA 5HIEA 5FXRA 3BRBA 3UNZA 3R1QA 5CY3A 5A3XA 4BHNA 4OTHA 3ZFMA 3M42A 3EOCA 3TZ7A 4R7HA 5IDNA 3LJ0A 2F9GA 2VO0A 3E88A 3QD3A 2C1BA 3GC9A 3G6HA 3TN8A 3C0IA 4W4VA 5E8VA 4V04A 5FXQA 5D1JA 4DG0E 3R8LA 2W7XA 4M3QA 1Q8YA 1NY3A 4OUCA 2PE2A 2XNEA 5HCXA 3FI8A 3R63A 3V6SA 3FXXA 4CFMA
chains in the Genus database with same CATH superfamily
2FB8A 3OBGA 4CRSA 4JDIA 2RF9A 2VD5A 3DOGA 3QCXA 4QMXA 2YM7A 3W16A 3T3VA 3RK9A 4NM0A 1ZOEA 4MVFA 5C8NA 4F6SA 3GT8A 4B7TA 4G5JA 3D7TB 4JDJA 1SVGA 4O0SA 2Y0AA 4DFXE 2OXYA 2XZSA 4FVQA 2PZPA 2FA2A 4ZXTA 5HZNA 5D12A 3RWQA 4ACHA 5A14A 3MPAA 1NVQA 3V3VA 5HORA 2X4ZA 4OR5A 3CY3A 3KB7A 4GYIA 5AIKA 3ZRMA 1YWNA 3RBWA 4ZLOA 4CVAA 4XP0A 3A99A 3AKKA 4B0GA 2XIZA 2IJMA 2OJ9A 2NYAA 2ZV2A 4QMVA 1DM2A 4C4JA 5IISA 5L6OA 5IQIA 3U6HA 5CX9A 3COKA 3WOWA 4NFMA 3D14A 3QTWA 2C0IA 5KMMA 3FZOA 2OFVA 4AGCA 1Q5KA 5LCJA 4EH6A 3ZXTA 4IJ9A 3R7VA 4CV9A 3L9LA 3SD0A 4WNOA 2HW7A 5IZFA 4CMOA 4O7ZA 4II5A 5DBXA 2C68A 2QU5A 2R4BA 3P0MA 2ACXA 3ZZEA 4PNKA 3QQKA 1NXKA 3BLHA 4FEQA 3N4UA 4H36A 5AP5A 3BYVA 4YR8A 4AT5A 5EDRA 1OL6A 1Q4LA 2ITPA 3Q6WA 5ACBC 3TZ9A 1U54A 2XK8A 2PMOX 2LGCA 1GIHA 3QWKA 4LRJA 3NRMA 2A1AB 2QU6A 5CEIA 4J8NA 4USFA 3FLWA 3UQCA 2X2LA 2A2AA 3VUGA 3DBFA 5J7BA 2GQRA 1OKYA 4YP8A 5ACKA 3VJOA 3B2WA 3VQHA 5FDPA 4O0VA 4YHFA 4FG8A 4BGHA 4DE4A 4HVGA 4TWPA 1H27A 3V5LA 3UP2A 3GFWA 4O6EA 4M8TA 3LOKA 2JBPA 3JS2A 2VTJA 4IWQA 3HECA 4EOQA 5FDXA 2OZAA 5DH3A 1JNKA 1Q24A 2G1TA 5EFQA 2XBAA 1PW2A 3R00A 3TIZA 5E1EA 5HIDA 3KRLA 4BCKA 3PFYA 4O2ZA 2W1DA 4AQCA 4DDGA 3E7OA 2WMXA 5J9ZA 4H58A 4MF1A 3GBZA 4BTFA 1PXOA 4CKRA 3OROA 2ZMDA 4YNEA 3COHA 5JGAA 5DR2A 3SVVA 3ZO2A 4L6QA 2OI4X 3UDTA 2OJGA 2W1FA 2GHMA 5HO6A 4ERWA 5JZJA 5M44A 3GEQA 4KIQA 2Y6MA 3FV8A 5I9UA 5CAVA 3QTRA 4IX4A 5FTGA 2WQNA 5LXMA 4HPUE 4R5SA 4A9TA 1IA9A 1G8AA 5ITAA 2C47A 4E3CA 3PXZA 3KRWA 1BLXA 4O6LA 4JMQA 1WBVA 3BLRA 3OP5A 5AWMA 3S0OA 5BYLA 1P14A 5HLWA 5AUVA 4C4FA 2PU8A 3F5GA 2CGXA 4FODA 3NVMB 5C4KA 4NWMA 2RFDA 1IG1A 1PXKA 1KWPA 3LCDA 1XKKA 2XB7A 3MWUA 3WZUA 4EBVA 5HNIX 4A9SA 4AFEA 4ID7A 4MXYA 4TYIA 4QT1A 3TI1A 5A4TA 1DI9A 5KBQA 1W7HA 4W4YA 3FC2A 4RFMA 4IM3A 4XLVA 4N6ZA 3RK7A 5DT0A 4DLJA 4DH8A 2CNVA 3NUNA 1ZYLA 5HO8A 5DPVA 1YOLA 2JDSA 5EQEA 2GCDA 3L9PA 4J53A 3LFEA 4LL5A 3ZO4A 2P4IA 1L8TA 4J99A 3DY7A 2V7OA 3E93A 2UZDA 2UZOA 4C7TA 2FSLX 3PA5A 2F2UA 3ORXA 4MF0A 2AYPA 4XX9A 4XS2A 4WNPA 1J3HA 1U59A 2XBJA 5E8WA 1U5RA 5M09A 3DB8A 4K77A 4F64A 3SXSA 1H08A 4D4RA 5G1XA 5IA1A 4RX5A 3R83A 4OTQA 1YWRA 3PZEA 2R3QA 4RBLA 3W2PA 1IRKA 3QXOA 4ZZMA 5D11A 5CU6A 3KRRA 4FIFA 4TYHA 4BDHA 4YO6A 4C3FA 1OL7A 2F49A 4IIRA 2XIXA 3PXRA 1PY5A 3F7ZA 1GNGA 3I60A 4FTNA 5DEYA 4EHZA 4ANLA 1H1RA 2IVVA 1PXMA 1P2AA 2J50A 3OZ6A 1BL6A 5DN3A 4RIOA 3FZRA 1Z57A 4RA4A 4ACMA 1OM1A 2E9PA 5E8SA 4P90A 3BYMA 3QBNA 3KKVA 4BTKA 4PDYA 2OXDA 5KZ0A 4JG6A 4C4HA 3G90X 4IW0A 5BMMA 4KIKB 1V0BA 1YOJA 2O3PA 4E4XA 4Q5HA 2JDVA 2X9FA 2VWBA 3MI9A 4AFJA 2NRYA 2R7IA 4ZLZA 3G0FA 4V01A 4CG9A 5CAPA 2XK4A 3S4QA 3FSFA 2BZHB 4NW5A 5L8JA 3C0HA 4FT0A 5M08A 4U0IA 3ANQA 2OJFE 4ACDA 5BX0A 3H10A 4KS7A 3RALA 1WFCA 2WMBA 4MAOA 4XMOA 4GKIA 3FQSA 4G9RA 4XRLA 2A4LA 2EUFB 3E3PA 2WOTA 4YZ9A 5CANA 5HBJA 5I9VA 2R3NA 3LFAA 3QCQA 4GG7A 4I41A 5KKRB 3AC3A 4AT4A 1M7NA 2PMLX 1IASA 1OMWA 1V0OA 2C6LA 3BPRA 4DHJA 4EH5A 3ZZWA 2UUEA 3FLNC 3OCTA 3KMMA 4FT9A 4G6LA 5BVDA 4B9DA 5HICA 4Y8DA 4L44A 2J0MB 3MBLA 2ITTA 5IH5A 1XBCA 3WF5A 3WF8A 3TNPC 5CQUA 1LUFA 3ZEWA 2CKQA 5EM5A 4FNYA 1OVEA 1HCKA 3UZPA 2B52A 5HQ0A 3U9CA 1Q8UA 4LV5A 4I6QA 4MXAA 4QTDA 3V5TA 2CKOA 4MX9A 4UXQA 5FM3A 3HA8A 3QGWA 3ZONA 4KINA 3IOKA 5K3YA 2A98A 4Q5EA 4NEUA 5CEOA 3R73A 3I5ZA 3OWPA 4G3EA 4I5PA 2CGVA 3UO4A 5B2LA 2W5BA 1M2RA 3H30A 4D1ZA 2Z8CA 1TVOA 1H8FA 2WGJA 5EM6A 4K1BA 4EOSA 4P4CA 3RCDA 5C1QB 5K5NA 4IAAA 1W8CA 3C4ZA 3QTUA 2VUWA 4L01A 4UWBA 4ASXA 5JN2A 2VWXA 3CTJA 3HMMA 1PXPA 2J7TA 3QF9A 2LAVA 2UZBA 2QVSE 3G5DA 5HLNA 3BBWA 2PZIA 4IDTA 1ERKA 3HRCA 4E6AA 3FQHA 2OXXA 4RWIA 3NNXA 3Q9ZA 3MY5A 2C5YA 4QTCA 5GJDA 3E5AA 3HVCA 2OBJA 3R01A 3R1NA 4JJRA 1UA2A 3G2FA 3EN5A 4ANMA 3AC1A 3PUFC 4O4CA 4O7RA 3SG9A 2UZEA 3F5PA 4DGLC 3MFUA 2G2FA 5TT7A 4HGTA 3ROCA 4C0TA 1FOTA 4BCFA 1YI4A 2X6DA 2WMTA 2UVXA 4AN2A 2ETKA 5JT2A 1YHSA 3E63A 3FMKA 3LMHA 3UQFA 3I1AA 4RX7A 5D7AA 5A54A 3BHUA 4KWPA 5EK7A 4BIBA 3QC4A 4D5HA 2C0TA 4IWDA 5CZIA 4I6FA 4MNFA 3UZRA 3ZO3A 3GOPA 4JBVA 1WVYA 4ZJJA 2IVTA 3PVBA 4PV0A 1V1KA 2PULA 1WBTA 3KULB 3CR0A 4IADA 1FMOE 4H1JA 4MWIA 1RE8A 3HLLA 2A27A 4M69A 2AC3A 3D15A 4JT3A 2C3KA 4EH7A 3A4OX 4M14A 4AA5A 3BZ3A 5KHWA 3C5IA 3ORNA 3FBVA 3WARA 4FIEA 4BCIA 4FJVA 3ZO1A 2PVJA 3R28A 4FKIA 3RJCA 5IEVA 3Q9YA 5HE2A 2XKEA 3OY3A 2WB8A 3O0GA 4ZTRA 3AMBA 4I6HA 4DINA 2FVDA 2V7AA 1BKXA 1ZARA 2ZJWA 4Z55A 3DBCA 3ACJA 5LCKA 3LQ5A 4MEDA 3IW5A 2YCQA 4PP9A 3RM6A 3D2IA 4EK6A 3O8UA 3BU6A 4JLCA 3NNVA 3SHEA 3KC3A 2X0GA 3AD6A 3D83A 2WQMA 4L7SA 3PRFA 2PZYA 1IAJA 3QUDA 4BIEA 2W06A 5IQFA 3C9WA 4NFNA 3ZUTA 3AT3A 2P55A 3KMUA 5BVOA 5KX8A 2OGVA 4AZTA 4L3JA 4U9AA 1ST4A 3I0QA 4RIWA 2QQ7A 2R0UA 4O1OA 2ZAZA 4K8AA 2DS1A 5HTIA 2PVLA 3MH2A 3CY2A 1DAWA 4XBUA 1JKSA 2C3IB 4GW8A 2XNNA 4IHPA 3G9NA 2R2PA 3MTFA 3MGYA 4QO9A 4W9XA 4B99A 3F2NA 4BBMA 4QP4A 4FRFA 3Q32A 5IUGA 4U5JA 5LARA 4WOVA 5HE1A 3FHRA 3PRIA 3SA0A 2BRGA 3QRIA 1Z9XA 3W2QA 3P7BA 5HEZA 3AC2A 4H3QA 1W82A 2J9MA 4F9AA 4W4WA 4YLLA 2VNYA 3CD3A 2DQ7X 2WO6A 3PVWA 4ONAA 3PA3A 4IWPA 2NPQA 3B8QA 4X2KA 2GHGA 4NIFB 4C38A 1BUHA 3CQUA 2JC6A 3FMLA 4FSYA 3DAJA 5HO7A 4JXFA 4D1XA 4FV6A 3UIMA 3DBQA 3D5XA 3Q04A 5AR2A 3U8WA 4IZAA 4ENYA 2JDOA 2GU8A 5AEPA 5L3AA 5C8MA 4YZCA 2PK9A 4FTAA 5GIPE 2PVMA 3HV5A 3O7LD 1P5EA 2P3GX 1XBAA 2Z7SA 4L3PA 3IOPA 3MFSA 5JMSA 3RAWA 2YM6A 4U42A 5J1VA 2A19B 3C1XA 2ZV7A 4P2KA 3VUTA 4B8LA 5BMSA 1OL5A 4E26A 3PSBA 2F7ZE 3UIXA 4NYEA 4IVBA 4DEGA 1XMMA 4KUJA 4O91A 2WU6A 3GCPA 1CSNA 1YI3A 3DK7A 3GI3A 4I21A 3PG3A 5HNGA 2RL5A 4JS8A 5HX6A 1XMLA 1NT2A 2IG7A 4KB8A 4FEWA 4N57A 4MXXA 4X21A 5HG8A 4XG9A 5AA9A 4LV7A 2O65A 3TXOA 1JAMA 2HZ0A 4U44A 1DS5A 4G1WA 3RM7A 2QLUA 5EI2A 1OUKA 3L8XA 4E4LA 3EQRA 2XIYA 5AAGA 4K0YA 3ZSGA 3FEGA 5FQDC 3MESA 3HRFA 3SX9A 5M55A 2FSOX 4NTSA 3VBTA 4ZTHA 3ENMA 3OWJA 1TQIA 5HE0A 4R78A 3Q96A 4FSRA 2XANA 2BIYA 1R39A 3ZBFA 5H2UA 3FLZA 3TDVA 4OT6A 3KXMA 5AX9A 5L2TA 3MA3A 4EK8A 3R71A 3UG2A 2BTRA 1YDRE 3ZLYA 3QZHA 1J7LA 4CZTA 3Q9XA 4MH7A 4QMZA 2ITQA 3KFAA 3VBVA 2WMRA 3NNUA 2X81A 1SVHA 3V6RA 3RGFA 3AMYA 3MTLA 3ZS5A 3OHTA 3RAHA 1OGUA 3LJ2A 4O4BB 4FUYA 1FVRA 4M97A 4A9RA 3P86A 3E8EA 3WYYA 2WU7A 4TW9A 3VRYA 4KABA 3UDBA 3VWAA 3THBA 3F2AA 4EYMA 1OBGA 4BR3A 3G33A 3O96A 4JX3A 3NIEA 2WTCA 3QAME 3F69A 5EOBA 3JVRA 5CVHA 2RG6A 4XNEA 5IH6A 1YHWA 1J7UA 4OTIA 4TZRA 3UOLA 3TTJA 4D4YA 5I9XA 3QYWA 4BDIA 4C3PA 4OAVB 3U6JA 4DYMA 2CLQA 4EQUA 4F6UA 4X2FA 2YAAA 2ZB0A 4FA2A 2YA9A 1JLUE 4O4DA 4WKQA 3WZKA 3Q4ZA 3ZU7A 3VF8A 1U46A 1OKWA 2J51A 3RMFA 5LJJA 5AP0A 4RT7A 4JOAA 3FMJA 2PVNA 4G16A 4D2VA 1M52A 4QYHA 3BHYA 3DKGA 3NFFB 2VTPA 2XJ0A 3PFQA 4QYYA 4MNEB 5IA2A 4OT5A 5FG8A 3GC0A 2W0JA 2YFXA 4FV4A 2R3RA 4EOMA 4WRSA 4W8DA 4UZDA 4AXAA 4UN0C 4FTLA 4BDBA 1OIYA 5TR6A 4QMOA 2WTDA 4FIGA 5KCVA 3I4BA 3OXIA 5AIRA 2OSCA 4UMRA 2WHBA 3PPKA 3CJGA 5E8YA 3DKFA 4PMPA 3OEZA 5TOZA 3L9NA 2CSNA 1OI9A 5CXHA 4GT5A 4WNKA 5CSXA 2B9JA 3PE1A 4KNBA 4UMQA 1JWHA 2PHKA 4FUXA 3LCSA 4O4EA 4CD0A 5BQ0A 4F9CA 5M51A 4BVUA 5ANDA 4AZEA 3I7BA 4ZSLA 3WE4A 2C6TA 3TTIA 2OF2A 4L68A 4BZDA 4G3GA 4F6WA 2VWYA 2Y9QA 2YCSA 5CSPA 1NA7A 2CN5A 4DH7A 3ZSIA 4I23A 4NM3A 5FM2A 3LXKA 4HNFA 2ZM1A 4V0GA 2X8EA 3F3UA 3F6XA 3LZBA 2EVAA 2JKOA 3VUHA 1FVVA 3ZSHA 4WT6A 4X3FB 1H0WA 2PUUA 3HV3A 3I5NA 2PL0A 4JBPA 4QQTA 1GAGA 2HXLA 2JAVA 5EI8A 5JKGA 1UKIA 5J9YA 3QCYA 3OWLA 1UNLA 5AMNA 4ACCA 2HK5A 5M56A 2J0IA 4K11A 2W5HA 3TNWA 4BKZA 2R5TA 5EW3A 4JIAA 3WILA 2R3MA 1KE6A 3FC1X 3VUMA 4ZTLA 5AAEA 1OIQA 3IW6A 4CMTA 4EQCA 5EG3A 4D0XA 3FZPA 1R3CA 4K9YA 4QMTA 5L6PA 4O1PA 4A4LA 4GG5A 3ZLXA 5HBEA 1WCCA 2C6MA 3BGZA 2RGPA 4GFGA 3QTZA 4FIIA 5L8KA 4ANSA 3H0ZA 2WAJA 3ZH8A 1XH8A 5CF6A 4ZIMA 3SDJA 5AX3A 3EYHA 5BYZA 3OW4A 4CRLA 4RX8A 1NVRA 3POOA 4PTGA 2QKWB 3RKBA 2AC5A 3LJ1A 4O27B 4O4FA 3EWHA 1FGIA 5F94A 4BDEA 5GIOE 4IZYA 3BWJA 2W4JA 4D0WA 4BN1A 2JEDA 4DFUA 4S33A 4QMQA 4IVCA 4Z9LA 4WG5A 3R04A 3ZM4A 4YZMA 4AN3A 4M12A 1H1QA 4IVDA 4QMPA 4BL1A 3R22A 2W17A 3VRZA 4J95A 2PVRA 2ZYBA 4BHZA 2QO2A 5A6NA 4G9CA 3VBXA 4EH8A 3BHHA 3QQGA 3LM5A 3BGPA 5DG5A 5BVFA 2YJRA 4XH6A 4OAUC 4AW0A 4EH4A 3KXZA 5DR6A 5EYMA 3D94A 4ZTQA 3DCVA 5L2QA 2DYLA 1FGKA 4FKUA 5DLSA 5JQ8A 3LFCA 5J87A 4R3PA 2I1MA 2IVSA 4FTUA 4U7ZA 4XCUA 4I20A 3WIGA 1Y91A 1Z5MA 2P0CA 3QLGA 2XIKA 4QTEA 5IMEA 3ID6C 5IA4A 2PVKA 1GY3A 3MB6A 3OOGA 5AP2A 4BY9E 3BL9A 3R30A 1STCE 3DS6A 5CU0A 5FP6A 2UW0A 4FTOA 4F1TA 2BKZA 3MVMA 3EN9A 3IS5A 4FTTA 4MBJA 1J91A 3TNIA 2CKEA 2B7AA 2QR7A 3VUKA 2JIIA 3HMOA 3OBJA 2ITXA 5HGIA 4IX6A 1PRYA 2GNIA 4LYNA 4QP9A 3BYUA 3EFKA 4YMJA 4KBCA 2JDTA 3OUKA 3U4WA 2OFUA 3MJ1A 4RJ3A 2B55A 3EQGA 1B39A 2UZLA 3B8RA 1ZY5A 3G6GA 4KSQA 5FEEA 4UMTA 4AE6A 4IMYA 4MK0A 2YIYA 2UVYA 3UIUA 2H8HA 4CSVA 3QA0A 2Y4PA 3U4UA 5AP6A 4XV3A 4APCA 4RLKA 2J4ZA 4GS6A 2UW9A 3A61A 5DVRA 3TCPA 3CKXA 4FK3A 4ZTSA 2OH4A 2FYSA 2XNGA 4XOYA 2PUNA 5EDPA 2O8YA 5H9BA 3UJGA 2XK7A 3R9RA 2W1IA 5GHVA 4AUAA 4ZZNA 5AADA 5CS6A 4M67A 3DLSA 5C27A 1UU3A 1WAKA 4U6RA 5AP3A 5A6OA 2C6IA 3FKLA 4XOZA 4F7LA 3E8NA 4RVLA 2GFSA 3PY0A 2XYNA 4R7BA 4EEVA 2BILB 5KUPA 4X3JA 4RLLA 3GCUA 5M4IA 2JBOA 4Y5QA 2W9ZB 5L2IA 1CKJA 4L00A 4H3PA 2B54A 5D41A 4E7WA 5BUIA 3BEAA 4YURA 4BCOA 4ZS4A 5C4LA 4GT3A 4MKCA 5E7RA 5TKDA 2ITWA 2XEYA 4WUAA 4KS8A 3PXQA 4H1MA 4TTHB 4AW1A 3WF6A 4YBKA 1Q8TA 2VU3A 1QPDA 5GZ9A 2DWBA 3PG1A 4FEVA 3L8VA 4I4EA 4EHEA 4FICA 2XP2A 4F1MA 3NEWA 3RINA 3F3ZA 4YGAA 4YJPA 2YJSA 1KV1A 3C4CA 1IA8A 3FL5A 5BVWA 2QHNA 4CXAA 3NUAA 2XAMA 3BBTB 5BVEA 3IDCA 4FX3A 4YLKA 1R1WA 3EH9A 4CEGA 4JG7A 3W0SA 3RP9A 3P23A 3BHTA 2E2BA 3WZEA 5LMBA 4CFXA 1WBOA 3BE9A 4ORKA 3ANRA 4EK5A 1OIRA 5EOLA 5DA3A 2OF4A 4KBKA 3BU3A 3Q52A 3ZLWA 2C1AA 4ITHA 3QWJA 3VN9A 4B8MA 3MY0A 1OPLA 3HRBA 3EN4A 4WUNA 4DT8A 3BELA 1H25A 2JAMA 4IEBA 4C61A 4F09A 4AG8A 2BDJA 5FD2A 4DEBA 3VHKA 4FL3A 4RJ4A 2QOIA 3D7TA 3JPVA 4AZSA 1YXTA 5JFXA 4Y72A 1UNGA 2VO7A 4LOPA 3FPQA 1I09A 3ZDUA 4ZZOA 1OIUA 4QP7A 4FSZA 1YQJA 3CBLA 4O0RA 4C58A 4FSMA 3VBYA 5FUTA 1M17A 5HHWA 4U81A 3R0TA 3A2CA 4DHZA 4I0SA 4CYJA 5LVOA 3HUBA 3D4QA 4N0SA 1KE8A 4FSQA 5GJFA 2XNMA 4ITJA 2OG8A 3R8PA 3ZFXA 4USEA 1J7IA 3NFGB 2UW6A 4IQ6A 3ORMA 5DNRA 4WG4A 4J97A 4HCVA 1VR2A 1RJBA 1YDTE 2XYUA 3K54A 5HTCA 3PWDA 2OICA 2XA4A 2OJJA 4RJ6A 1ZYSA 4DC2A 1O6KA 5IQDA 3FLQA 3BGQA 5FEQA 2WIHA 3Q3BA 5E90A 2BTSA 2W1EA 4XEYA 1VYWA 4X2GA 3LCKA 4C4EA 4NM7A 5IH4A 1ST0A 4FF8A 5KMIA 2HZNA 2XS0A 4JQEA 3NX8A 3UMXA 4AXDA 1QMZA 1BYGA 3DAEA 4GIIA 4WNMA 2BAKA 4O7WA 4RVKA 3DDQA 1ZYJA 3MVLA 4D28A 2YABA 4O7NA 3MSSA 4GCJA 5HKMA 1PXJA 5K0KA 1H00A 1JSTA 1P4FA 4QNAA 4EOPA 3S1HA 4ZSJA 4BYJA 4HW7A 2XJ2A 1WZYA 3DJ5A 4LGHA 4J7BA 4BGQA 3R7OA 4GRBA 3IPHA 2WMUA 4X6RA 3JY0A 4TXCA 4PMMA 4ZTNA 5KHXA 3OCGA 4D5KA 2GNGA 2BPMA 1M14A 3K3IA 5DGZA 3MIYA 3CXWA 4UX9A 3CKWA 4EOKA 2J2IB 5FBNC 4BCPA 1LPUA 2J0JA 4Q2AA 4RIYA 2F7XE 4EL9A 4FL2A 3BYOA 5C01A 4QRCA 3TMOA 3VJNA 1MRYA 3AOXA 4AT3A 4CKIA 4NCTC 3SW7A 3EFJA 2Z2WA 3O50A 3WE8A 4MQ2A 3REPA 4DH3A 1UU8A 3KMWA 4O22A 3A7IA 4DG2E 4I0RA 3ULZA 2YACA 5FP5A 3SRVB 5BNJA 2WKMA 4O0UA 4WG3A 2ONLC 3AKLA 3FMDA 5E1SA 3BV3A 3TV7A 4EQMA 2R3GA 1TFFA 4M84A 2WNTA 3IDPA 4IB3A 4MXZA 1XH5A 5IQBA 3FQEA 4EOOA 4CLIA 2C4GA 4X2NA 3O8PA 4IWOA 3NS9A 4PPAA 2CCIA 1ZOHA 3R9DA 4RQKA 4O0XA 5CVGA 3RHXA 4CZUA 2R9SA 2NRUA 3W0PA 3QA8A 4KIOA 4GK4A 4YSJA 4P7EA 3ZYAA 2O2UA 2G2IA 2BZJA 3QZFA 3VW8A 4S31A 4BBEA 3ORPA 5AUXA 3UTOA 3ULIA 5JK3A 3FZTA 3R8UA 3VS2A 4LOQA 4F7NA 5CAQA 3LFFA 3AGMA 4IB5A 4ACGA 4F99A 3QRUA 4IE9A 4I6LA 5HX8A 4DF3A 3A7GA 4TWNA 3DQXA 4IAYA 5EHOA 4OTDA 5HCZA 4QMLA 3F3VA 2BKKA 4DFLA 4NT4A 4F08A 4XBRA 1G8KA 3TIYA 3AG9A 4Y83A 3UPXA 2GTMA 3QZGA 3TNHA 4WBOA 4O0WA 5DHJA 4FTQA 4FTKA 4I6BA 4IFCA 4C33A 5CF5A 3DK3A 2CKPA 3CQEA 3DNDA 4A4XA 3RAKA 1KE5A 5K4JA 3NCZA 3LKMA 2ETRA 5IA5A 2BHHA 2VWWA 2B0QA 4IXPA 3L9MA 3UOHA 4O81A 2W05A 4QQCA 1JSVA 4M7IA 2ITVA 5CLPA 2XVDA 3GC7A 3UE4A 4PX6A 5JGDA 2UW7A 3QHWA 4QP3A 2BVAA 4K33A 3CSVA 1M2QA 3O51A 4IC7A 4HYUA 5B0XA 3W33A 4RQVA 1XH9A 4FNXA 4ZMFA 3OY1A 4FMQA 2JLDA 4FTCA 4BDKA 5KMLA 4FZFB 2GS2A 5AM6A 5AUUA 5J95A 2GNJA 3E8CA 5H8BA 3I6UA 4M69B 3U51A 5AR8A 3HZTA 4ZAUA 4JDKA 5E9EA 2QLQA 2BROA 1JQHA 2QC6A 5F20A 4JR7A 5EM7A 3PJ3A 3W0OA 1R0EA 2O5KA 2CPKE 4FL1A 1YHVA 4UWCA 4PNIA 5CASA 2BFYA 3KRJA 4L42A 5M57A 5AUZA 4D2PA 4ARKA 3QQJA 3PDTA 1REKA 3SLSA 1HOWA 4HVIA 2XUUA 3M2WA 1W0XC 4KKGA 4QD6A 4XG2A 5AP7A 4BDAA 4BF2A 4C2WA 4DH1A 3N4TA 2JKMA 2QHMA 5C8KA 2XARA 3VS1A 4EC9A 3EJ1A 3UP7A 2GQGA 4NZWB 4C8BA 3LQ3A 4G6OA 3RPRA 1M2PA 4A7CA 4F7JA 4IM0A 4KIKA 3AMAA 4RG0A 4I1ZA 3C0GA 5F1ZA 1ZAOA 4OW8A 5GJGA 3NR9A 3ET7A 4I92A 3NCGA 5KMOA 4KKHA 3IGOA 4ASDA 4BCNA 1MUOA 5CSHA 4QYGA 5EYKA 4QOXA 1ZOGA 5HTBA 5DYJA 4YJSA 2E9NA 2OO8X 2X0QA 3ERKA 3VNTA 4ANNA 5LMKA 2JKQA 2ZMCA 3R7EA 2VGPA 2XM8A 2EWAA 1T46A 3CD8A 2YIQA 4HYSA 1KV2A 4EONA 3G9LX 5D10A 3PZHA 4GEOA 1CDKA 4S30A 5LMKC 3ZMMA 1SZMA 4C2VA 4IX5A 1XH4A 3BHVA 4DEEA 3UODA 3BYSA 3FDNA 5EHLA 4U80A 5E92A 3NMUF 3UGCA 5KKRC 5DR9A 5GZ8A 3FE3A 1BI8A 3R7YA 1O6LA 2F4JA 5IEYA 4HYHA 2BFXA 4NKSA 5CEPA 1PKDA 3IDBA 4XG3A 3FZSA 2CGWA 2I0VA 3PWYA 3P78A 4S34A 2PVYA 2XEZA 5E8TA 5IQHA 2OLCA 4FBXA 3NPCA 3R2YA 2YDIA 2GSFA 1CMKE 3AC8A 5EDQA 3C4FA 3TT0A 3R7UA 1WBNA 2RG5A 2W1CA 1XO2B 3LHJA 4QTBA 4EHVA 4EH2A 2VWVA 4BCJA 5HD4A 2YM8A 3S95A 3FLSA 3Q9WA 3KREA 4BZOA 3SKCA 3R02A 3OT8A 2V22A 1JKTA 3BE2A 5AFVA 3AD5A 3PUPA 4BDFA 2XK3A 2V62A 5HD7A 5FRIA 3F66A 4RSSA 5DRBA 3ZXZA 4O7VA 3DKOA 4DGNA 5I9YA 2QOHA 1Y57A 1GIJA 1P4OA 2VO6A 2XNBA 3HA6A 2W1GA 4FKWA 4L46A 4RJ7A 4DTKA 4QMNA 2W9FB 4LFIA 3TZ8A 4R6VA 4YUQA 4W4XA 3FPMA 4YC6A 4F65A 2ITZA 2Y4IB 1Q99A 2B9FA 3RCJA 4DITA 3KY2A 2UW5A 3PP1A 3H4JA 1H24A 2BR1A 4GUEA 4TN6A 5HCYA 4EZ7A 4PP7A 2BRHA 3F3WA 4UYAA 3DNEA 3HL7A 3R2BA 2OZOA 5AV4A 1VZOA 1QCFA 3OVVA 2YM3A 3IW7A 4AA4A 4CTCA 5CAUA 2WD1A 1YI6A 3GU4A 4GK3A 3RTPA 5H8EA 2VTIA 3HAMA 3TUCA 4C62A 4YO4A 4JX7A 1NW1A 1JKLA 1Y6BA 3NW7A 1IAHA 3OFMA