4Q5EA

Shigella effector kinase ospg bound to e2-ub ubch7-ub conjugate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
168
structure length
168
Chain Sequence
EPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function, protein binding
molecule keywords Protein kinase OspG
publication title Structural Basis for the Inhibition of Host Protein Ubiquitination by Shigella Effector Kinase OspG.
pubmed doi rcsb
source organism Shigella sonnei ss046
total genus 53
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4q5eA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4q5eA01
2AYPA 4QQ5A 4EK5A 4F65A 3KMMA 2ZYBA 4ZTRA 1P5EA 4I4FA 2OK1A 2PZPA 3F69A 3WF8A 3F5UA 1LEWA 4HVHA 1WMKA 4PTCA 4KKHA 3D7TA 4YC8A 1G3NA 5AADA 4F6UA 5LCJA 3OROA 2Q0BA 4A9RA 4WUAA 3I6WA 1KOAA 5CEMA 1OL5A 4QP7A 2O8YA 5FUTA 3C13A 2UZWE 2R5TA 2CSNA 5B2KA 1XH4A 5KNJA 2W4OA 3FE3A 4RMZA 4BL1A 2JDRA 2XBJA 4GVJA 4ACDA 3NNXA 2C6EA 4IMYA 5AP0A 4ZS4A 5L6OA 3IONA 3HA8A 3RINA 4GU6A 1O6KA 2XRWA 2IPXA 1SZMA 1VR2A 3R7VA 5HLWA 4PMSA 4IHPA 3O50A 5L8JA 4S30A 5IQDA 4UEUA 5CALA 1Q8TA 3RAWA 4CQEA 4K0YA 4ZZMA 4B0GA 4FGBA 3RPRA 2WO6A 2VO7A 4AACA 2YM4A 3R9NA 4TL0A 2WPAA 4ID7A 4EZ3A 3LLTA 3QQJA 1KWPA 4MXXA 1K9AA 5M51A 2XNOA 5FDXA 4I41A 2UZLA 5AAGA 1UU8A 4D1ZA 4PDYA 3VUHA 1O6YA 4FKVA 4UMRA 5HE3A 4BF2A 3F88A 3EJ1A 3SOAA 2WNTA 3P79A 2HENA 5J9YA 2ZV7A 4ALUA 1E9HA 2QOOA 4ZTSA 3Q53A 3SC1A 2UZEA 4RC2A 3IKAA 3W16A 2YITA 4IDTA 3AC3A 1B38A 3ZLXA 3SGCA 2G2HA 4DGGA 2RFDA 2CKEA 1H4LA 3A7FA 1OL6A 3JS2A 4L44A 4YTHA 1OPKA 4JL9A 5H3QA 5AA9A 4QPSA 3CEKA 4WG4A 1WBWA 5I0BA 4FKOA 4C35A 3P0MA 2RIOA 5CLPA 3TACA 3PLSA 5GJFA 1TVOA 2HY81 2PWLA 2YFXA 2XJ0A 4ITIA 4C34A 4AZWA 5FLFA 3UP7A 4W9XA 2O64A 2C3JA 3Q52A 4FKRA 3ITZA 4IJ9A 2XK6A 5JZJA 5IH6A 3FMLA 4EWQA 4BVUA 3KF4A 1JBPE 3TWJA 5ANGA 5LVNA 2W1IA 3G33A 3UPXA 4CG8A 5CEPA 3R0TA 1Z9XA 1VYZA 2H8HA 3QL8A 4FZFB 4G6NA 4IVCA 4KA3A 1ZOEA 4MF0A 4XHKB 4ZTHA 4H3QA 5J95A 5JKGA 2JLDA 3C5UA 1H27A 3FY0A 5M4UA 3ZCLA 5FD2A 2A19B 4RJ3A 4QMWA 4BDJA 3HL7A 4EONA 4TXCA 3B8RA 3GU7A 3WZDA 3JUHA 4NJDA 5ICPA 5M08A 2W7XA 2WKMA 3WIKA 5I5ZA 3BWJA 4QMQA 2ITTA 4FZDB 3TV7A 4C4HA 3QTIA 4ENXA 5LVOA 5E90A 3TNQB 3TV4A 5AA8A 3EIDA 4WNPA 2GTMA 1S9IA 4QO9A 1YI6A 4TYIA 5DEYA 4CFVA 2GNIA 4QOXA 4DG0E 3ZZEA 4DEIA 4WD5A 3NUSA 1KUTA 3MV5A 3NUXA 4IW0A 1XH6A 4XBRA 4KABA 2VTPA 3FZOA 4U79A 2PZIA 3CD8A 4NKAA 5CT7A 3UBDA 1JAMA 3OWLA 3DZOA 5DLSA 2Z60A 4FX3A 4AW2A 3HGKA 4DT9A 3BZ3A 3PJ8A 2V5QA 5HNGA 5I9VA 5L4QA 2C5YA 5LXMA 4DFLA 3QUDA 2BIKB 3PWDA 5DIAA 5CU3A 3HV3A 4PF4A 3EKKA 4QMLA 2OFVA 4JAIA 2QCSA 5EKOA 5A4LA 1LPUA 4AE6A 3K2LA 5CF4A 4FTCA 1QL6A 1HCLA 5BYZA 2QR7A 1JOWB 1FGKA 3VUIA 3TUBA 3OY1A 3C4XA 2PVJA 1H08A 1DAYA 4R8QA 1OVEA 4RX8A 4WRGA 4I92A 4CFNA 3QAME 2UVXA 3CQWA 5EDRA 3QKLA 3VBWA 4DH5A 5KCVA 3F5XA 5DI1A 2QU5A 3G2FA 3RPYA 5IEVA 3Q2JA 4RZVA 3HKOA 3L1SA 4FTTA 1J1CA 3KB7A 4MNEA 4KKEA 4TKSA 4BZDA 2I0VA 4L68A 5J7BA 2X8DA 3DK3A 3HUCA 1FMKA 2OJFE 4CNHA 3SG9A 3A60A 4LUEA 3OP5A 1Q8YA 1DS5A 1LUFA 5HIEA 4ZTMA 2PZRA 4K18A 5I9UA 4N57A 4CFFA 3LCOA 2F2UA 3POZA 2GCDA 4XBUA 4BYIA 1M2QA 3SD0A 3R9DA 5I9XA 3U54A 4E6CA 2YEXA 1QPDA 2CCHA 3CKWA 3GQLA 3HMNA 5HBHA 2XKFA 5GNKA 2J0IA 3SXSA 5KHWA 3L9PA 1JPAA 3ORPA 3ORXA 5AP5A 2RSVA 4MQ1A 4CQGA 5IH5A 2P0CA 3VS7A 5JT2A 1XJDA 1WBPA 4GK2A 5KMNA 3MFRA 1ZLTA 3QA8A 4JBOA 4RA5A 4XP2A 4AZVA 1F5QA 3MPTA 2A4LA 4FNYA 4NM7A 4QYYA 1TQIA 5CQUA 4BRXA 1NVQA 4H3PA 3D5VA 3N9XA 1OKYA 1F3MC 2DWBA 5TOZA 2IZSA 3RBWA 4ACMA 3A99A 4NK9A 3UVQA 4EH6A 1ZAOA 5IH4A 3SQQA 3NR9A 3VBQA 5BUJA 2P2HA 3CBLA 4TWNA 4JS8A 3O17A 2WTVA 4F08A 4PNIA 1U5RA 3BHYA 5LWMA 3EFWA 4FT7A 5HHWA 1JKKA 2GFSA 3QBNA 5C4LA 1T45A 2QOLA 4HYUA 5HNBA 3R8UA 4Z3VA 4BCNA 1H1PA 4R7IA 4UMTA 2PTKA 2GQRA 4BICA 4LGHA 3NYNA 4DH3A 4I1ZA 5BVDA 3KN6A 3AXWA 3GBZA 3RHKA 2PK9A 2GS6A 2C6IA 4E5BA 2Z7LA 3PPKA 4O7ZA 5E7RA 2LGCA 4C2WA 1M7NA 4NCTC 4DITA 3OTVA 3E8EA 5F1ZA 4ZEGA 3ZUTA 2OBJA 4KRCA 4MTAA 1CM8A 1PXPA 3PE1A 4GKHA 2XVDA 2QOKA 3ORNA 4BGQA 5A14A 4IVAA 4N4SA 2HAKA 1E1XA 4CV9A 2W1GA 4A9UA 3F2RA 4E5WA 3F3UA 1YXUA 2UZBA 4YPDA 2UZDA 2PMLX 2BRNA 4I0SA 3NNUA 2ETKA 4PP9A 4HCUA 4AF3A 3FBVA 2OJ9A 4XG6A 1CMKE 4L01A 2ZDTA 3EL7A 4A9YA 4AWIA 2VD5A 2VTTA 3TJCA 3BIZA 2VX1A 5L6WL 3TKHA 5AEPA 3WE8A 4FMQA 3OXIA 1SVEA 4YZMA 3P7BA 4CMTA 3G51A 5JFWA 5LARA 2ONLA 4NIFB 4GK4A 3IG7A 1P4FA 3S95A 4ZOGA 4MXYA 4C33A 5AP3A 3QTZA 5HESA 1Q8UA 3FY2A 4RLKA 2P2IA 5IQGA 3PSCA 4BCGA 1BX6A 2J0JA 2ZM3A 4YHFA 5AR2A 1Q99A 1H24A 3DK7A 5KMJA 2F57A 2XUUA 1KE5A 3A7HA 3MA3A 3G90X 3QYWA 4I5HA 4IQ6A 4N6ZA 4MQ2A 1H1WA 2YLFA 3UIBA 5C8MA 4QMYA 3VJOA 2PULA 3VBTA 1Y6BA 2QOIA 4C62A 3E7OA 3NCZA 3C50A 4M0YA 4HPTE 4ZJJA 3JVSA 3QKKA 2UVZA 5LMBA 3FI3A 4QMVA 4G3GA 3R7OA 4AZSA 2UW0A 4AT4A 4XG4A 1NA7A 2OU7A 2WTDA 3C4WA 2UZUE 3BI6A 1FPUA 2PE2A 2R3LA 3FPQA 5CT0A 2X8EA 5C8NA 5CAOA 3PP0A 3UC4A 3ZC5A 2HWPA 4RSSA 4UX9A 1IASA 5JSMA 3GENA 4FSWA 4O7VA 2VWUA 3EHAA 4G6LA 3Q4CA 3QHRA 4ZP5A 3FYJX 4U97A 3O71A 4BTKA 3QKMA 3QGWA 4W8EA 4FC0A 1MP8A 4HNFA 4MD7E 3P7AA 3G0FA 4B99A 3PE2A 1U5QA 3ZH8A 2WMVA 4E5AX 3W10A 5H8GA 1OBDA 3NRMA 3PIXA 3E7VA 2I6LA 2R3KA 4D1XA 1YDRE 1GIHA 2X0GA 3PPZA 4QMZA 3GXLA 3Q6WA 3E8CA 2ITVA 4BBEA 4E4NA 4X6RA 2B9IA 3ODZX 3BYVA 4R1YA 5LOHA 2GNFA 2JKMA 3AT3A 3CJGA 4BWPA 4JOAA 2PMIA 5IZFA 3R7EA 4FSQA 5I9WA 5L8KA 5CSPA 3A2CA 2QKWB 1ERKA 1V0OA 1MRVA 2C6TA 3UVRA 4KWPA 3R8PA 2VWIA 3RPSA 4O7LA 3T9TA 4BCPA 4DN5A 4HVGA 3BRBA 4EOOA 2QO9A 3HP5A 3OTUA 2HZ4A 3BKBA 5ETCA 3O7LD 4XV2A 4QQTA 2OICA 3OEFX 5KX8A 4OUCA 4BCOA 5CS6A 4JLCA 3FEGA 1JKLA 3ENHA 5T3QA 4ZMEA 4IZAA 3EYGA 5FP6A 4WBOA 2VTLA 5EFQA 3PIZA 4I93A 4DEGA 3KULB 1UKIA 2C6OA 3VAPA 2QONA 4WNKA 3BBTB 4BY9E 4O7RA 4EBVA 4J53A 3ATSA 4BTFA 3RNYA 2QHNA 5E8SA 1URWA 5IQFA 2CGUA 2R3NA 5BQ0A 1PXLA 2VTOA 5AV1A 3RPOA 3LJ2A 3LFSA 3R2BA 4LRMA 4ANMA 4DFYA 1UU7A 5HTIA 3DQXA 3CGOA 4DGNA 1BI8A 3PJ1A 3ZXZA 5GIOE 5E8XA 1WBNA 2BDWA 2PE0A 3QCXA 4TPTA 2CJMA 1PMUA 2RFNA 1LP4A 4TNDA 2JKOA 4F9YA 1SM2A 4FSMA 4YZ9A 2OJGA 3PWYA 1OECA 5IF1A 2X4ZA 3DBCA 4MXAA 4NW5A 5AIKA 5AIRA 5AP2A 2YAKA 4I3ZA 2PY3A 4I6FA 4IAZA 5CXHA 4AW0A 4IX6A 1Q24A 5M06A 3V5PA 4MEDA 2VX0A 3UO4A 2A0CX 1RDQE 2C30A 3MPAA 4IACA 5AWMA 2WQNA 2GFCA 5KKRB 4O82A 3PG3A 3Q60A 4FV4A 2VV9A 5BPYA 3BBWA 3HAMA 4GH2A 3O8PA 3NGAA 4DGOA 3HDNA 2R3MA 2O0UA 2JAVA 3EKNA 3D2KA 4AN9A 3VS6A 4H39A 2ERZE 4L45A 1Q41A 3CTHA 4AAAA 4QP1A 2ITXA 3HX4A 4MK0A 4E73A 3RPVA 1UKHA 5DR9A 4H36A 4IM0A 2HZNA 3WF5A 1Y6AA 3ZS5A 4DEAA 3EQCA 2UZOA 3A61A 3BU6A 3P4KA 4XUFA 2YDJA 3LQ3A 5L6PA 1OITA 3PA3A 4WOVA 3VS1A 4PP7A 4IB3A 4GCJA 4JG7A 4UZDA 3VIDA 4E4LA 4X3JA 4XV9A 2J7TA 3QLGA 4QP3A 4FTQA 3TTJA 3UIUA 1ZYCA 1MQBA 2OKRA 2GS2A 2VTMA 4ANLA 2BDJA 3LIJA 4IAFA 5CVHA 4R6VA 2IZRA 3VS0A 4B7TA 4DCEA 4PTEA 4TWCA 4F9WA 4X0MA 4D4RA 2YACA 4O2ZA 2HYYA 2YM6A 4S33A 5EM6A 2WQMA 4ZSEA 2WIPA 3FZPA 4OTFA 1PMVA 3QQKA 4BDEA 1CKPA 3F6XA 4GYGA 5E8VA 2WOUA 2EB2A 4JBQA 4M97A 4BGGA 3LKMA 1WZYA 3TEIA 1Q3DA 2IW6A 3OOGA 3IDPA 3AGMA 3DBQA 3IDCA 3QQUA 3QD0A 4FKTA 5AJQA 5FXSA 4O7NA 3F5PA 2NO3A 4GYIA 5BUIA 5HICA 3Q96A 4ZTNA 5IKWA 2V22A 3ORIA 1VYWA 1JSUA 3P9JA 4EORA 4EH7A 2QURA 4A4XA 4C3RA 2R3HA 2J0LA 3BHTA 3BYUA 1GZOA 4ZTQA 2EU9A 3HLLA 4OTDA 2GTNA 4C3PA 5IA4A 3KL8A 3HYHA 3QZHA 3BE2A 2HZ0A 4YZNA 5ANKA 2ZMDA 3GCSA 4V0GB 4N0SA 3MH0A 1M17A 2JIUA 5ANIA 4CLIA 3C4EA 4FKIA 2GNLA 4RIYB 3DLZA 4LV8A 3L8VA 5E8WA 3VW6A 4V04A 5ETAA 3NVKI 5F4NA 3AOXA 4F1MA 3D94A 4AN2A 4U42A 2GDOA 2C68A 3S3IA 4ZY4A 5A54A 3U6HA 2YDKA 1QCFA 3QZGA 2QKRA 4JNWA 4TY1A 4D2TA 4C8BA 4FUYA 2YZAA 5CU4A 5GZ9A 3ZSIA 3AGLA 2EVAA 3DBDA 3AMYA 3PDTA 4OLIA 2JEDA 4FIEA 4FIHA 5ETFA 4TNBA 2BCJA 3C4CA 3MESA 2CDZA 1GNGA 2P4IA 3BE9A 2YABA 5KMIA 4AT3A 3QCYA 3VS5A 2YLEA 4IIRA 4AUAA 2Q0NA 3IGGA 3SG8A 3LFAA 3RM6A 1OGUA 2XNNA 1L3RE 3OCTA 4NT4A 5HE2A 2FSTX 4EOIA 3FJQE 3DZQA 3E3PA 3OXTA 4A9TA 1KE9A 1REKA 4FOBA 4C4GA 3IS5A 2FSMX 3E62A 3V8TA 4DYMA 1YRPA 2Y4IB 3EB0A 2Y4IC 4RJ8A 3ZLWA 3DFAA 4AOIA 4RFMA 5IA5A 4M67A 4P90A 3OOMA 3SLSA 3COKA 4F6SA 3LMGA 5JGAA 1KOBA 3HV5A 5DG5A 4BCMA 5J9ZA 5TT7A 4S32A 4YGAA 4NFMA 3R83A 2PMOX 2JDVA 2PVRA 3NYVA 4PV0A 3CE3A 4EQUA 1PKDA 1Q97A 2YM5A 4PDPA 4KIPA 1FOTA 3QCQA 2PUUA 3KF7A 3NZ0A 3O8UA 3PRIA 1URCA 4BBFA 3LJ1A 4CFUA 5C27A 3NNWA 2XKCA 1H0WA 1RE8A 4EOLA 5LVPA 3LVPA 2JIIA 1DAWA 3OUKA 4H1JA 5EM8A 4CZTA 4EC9A 4RJ4A 5IDNA 5DHJA 3S2PA 5FXQA 4ACCA 4IAIA 4NCTA 5KZIA 1ZYLA 5JGBA 1GZ8A 3GFEA 4L9IA 3ZBXA 3HECA 2HIWA 4GG5A 3UIMA 2XK3A 4ZSJA 1IAJA 1OKZA 4FNZA 4EOQA 1SNXA 1JQHA 1HOWA 4D2WA 4DGLC 5DVRA 3A8WA 2OXXA 4WNOA 4F0IA 5EOLA 2NRYA 4EK8A 1O6LA 4MCVA 3KRRA 2W5AA 3P78A 2VNYA 5C01A 5HD4A 5LVMA 1IR3A 1OL7A 1VJYA 2PVFA 3G6GA 3KRLA 5IDPA 3O51A 4ZSAA 3LMHA 5M4IA 5CNOA 5CAQA 5DFPA 1JNKA 3E87A 3EYHA 4RIOA 3I7BA 4IB5A 4OTWA 3V5LA 3FZRA 1YI4A 4Q2AA 4QTBA 4QP4A 4BDHA 2F7EE 1PXIA 4DGMA 2Y7JA 1ZOHA 4NIFA 4W4XA 2G15A 4FT0A 1YQJA 5DMZA 3C7QA 5G1XA 4O1PA 3EQGA 4F1OA 1TQMA 4I5PA 4F0FA 2XNEA 3WI6A 4GFGA 4O38A 2Z7SA 3QF9A 4TT7A 3ET7A 5D10A 4EK6A 2QOBA 4KS8A 5F94A 5BX0A 4FSRA 1SYKA 3R28A 5EI8A 4M13A 2RGPA 4S2ZA 4CFMA 5HNIX 2J0MB 3IW6A 4G1WA 5M57A 4G6OA 2E9UA 4PPCA 3UIXA 4LMUA 4XG9A 5DR2A 4CV8A 2WB8A 5D7AA 4JG8A 3BV3A 1FINA 3T8OA 4KAOA 1YW2A 2VX3A 5CXZA 5CTPA 4EHZA 2VTHA 5KE0A 3PFQA 5K9IA 1LEZA 2UW9A 4HOKA 4FG7A 1PMNA 4Y85A 3BYOA 1Q4LA 2WHBA 2B55A 4I0TA 3ULZA 4EQCA 4KIKB 4YJPA 5FEDA 4JJRA 1UA2A 4JBVA 2IN6A 5TKDA 3W8LA 3QCSA 4UMUA 4OBQA 3KCFA 5DT0A 3EQDA 4AE9A 5HX8A 3SW4A 4BI1A 2HK5A 3UDBA 4EH8A 3R22A 4QQCA 4FEQA 4JI9A 4F9CA 3FL5A 3QD4A 1WCCA 3H9RA 1Q61A 4JQEA 4BIEA 4AZTA 3ACJA 4FV3A 2YM3A 4RQVA 3MB7A 4X3FB 4X3FC 3TUDA 5IUGA 2OZAB 3OY3A 5H8EA 3UO6A 4DFNA 4FZAB 2UVYA 3R9RA 2R3OA 2YDIA 4ONAA 4UV0A 4E8AA 3VO3A 5CI7A 3UMXA 1OMWA 4G5PA 5DRBA 1UVRA 2QC6A 3BLHA 5CQWA 4R77A 3U9NA 4X2FA 4B6LA 4BTJA 4BDDA 4WRSA 3TZ9A 4FTNA 3D15A 3NIZA 3P23A 3D5UA 3H9FA 5EQEA 2W17A 2JDOA 2XJ1A 4RWLA 3KULA 2GNHA 5E8YA 5BMSA 1OI9A 1JKSA 5IA1A 3LFQA 4YC3A 3KK8A 2VWWA 4RJ5A 2Z7QA 4UWBA 4F7JA 2W9FB 3PUPA 4GJ3A 4RG0A 4U8ZA 3UE4A 3V8WA 2UW6A 4CT2A 5CF6A 1OKWA 2FO0A 2HOGA 4BDCA 3A4OX 3OHTA 3PVGA 2ACXA 2XH5A 3K3JA 5JRQA 4Y95A 4D4YA 4KBKA 5H9BA 4D28A 2LAVA 2F2CB 4M66A 1Q8ZA 2JAMA 2PZYA 2VO0A 2WTWA 3KFAA 4DHFA 3WOWA 3F3TA 4U5JA 2GNJA 3I5NA 4G31A 3NVMB 4YJRA 4GL9A 4J99A 3VRZA 3NW7A 4IM2A 5AUYA 4FZ7A 2I1MA 3RAKA 4ANNA 4V01A 4CFWA 4JDHA 3BU5A 5C9CA 4J1RA 4G3FA 4IJPA 3DY7A 3ZXTA 2X8IA 3GC9A 4FEVA 2ZMCA 2BTSA 4CMOA 3OW4A 4BIBA 3CSVA 5AP4A 2BKKA 4F7SA 2IVUA 3TN8A 2PVLA 3QZIA 4BDKA 3HRBA 4XMOA 1W8CA 3IW5A 3UOHA 3P08A 4BHNA 3Q9ZA 4UXQA 1R78A 2BR1A 2B7AA 1XWSA 2ZDUA 3FLQA 3FLWA 2BUJA 3ALOA 3R9HA 2QO7A 4FUXA 4FEUA 5G6VA 3UQCA 3DNDA 1NY3A 3ZEWA 4CCBA 4XNEA 3IGOA 2Z7RA 2YERA 3TDWA 3S4QA 1A9UA 1YI3A 3FV8A 5DNRA 4C02A 4G17A 5K5NA 3IOPA 3FMHA 4NUSA 3I81A 4YHTA 3SKCA 5IG1A 1J3HA 3E64A 4FIJA 4YNOA 4USDA 4BI2A 4OAVB 4BKZA 4X21A 3O96A 2QHMA 1YOLA 3FKLA 1S9JA 3CLYA 3LFNA 2B9FA 3NAYA 3QC9A 5JQ5A 5F9EA 4GIHA 2Z2WA 3FMEA 4EH2A 4P2KA 3FC2A 2XCKA 4P7EA 4WKQA 3ELJA 2QG7A 1NW1A 2OJJA 4YHJA 3R01A 2QODA 1XH9A 3MH1A 5DYJA 2QOHA 3KRJA 3OWKA 3P86A 4OW8A 3IOKA 4C2VA 2EXCX 1OBGA 2YN8A 4NM5A 5M4CA 3DJ6A 4HCTA 2NP8A 4I23A 2WGJA 3OG7A 4A06A 2XMYA 3NW6A 2OG8A 4HZSA 3AQVA 4LMNA 4QMUA 4RX7A 4H1MA 3COIA 5EYCA 4O84A 3LFCA 2XJ2A 4E20A 1SVGA 4O7SA 2C6LA 4FTOA 4OR5A 3SA0A 3EWHA 4D2VA 4C61A 4CKRA 4F09A 4GFMA 5HTCA 3UZRA 2R7BA 2IVSA 3MY5A 3I0QA 2GHMA 4KBAA 3ZUVA 4X2KA 1REJA 4QP6A 4U80A 4LOOA 3QTQA 4F9AA 3FSKA 2W0JA 3ZYAA 3FZ1A 4W8DA 4C36A 2XIXA 2BPMA 4TWPA 2VTRA 3RTPA 3BWFA 3U6IA 2BALA 4QPAA 4BZNA 3WZKA 2PSQA 4V0GA 3PSBA 4DH7A 4NJ3A 4E93A 5HVJA 3GNIB 4CVAA 1GZKA 3D7ZA 4RIYA 4Y73A 4FSUA 2ESMA 1J7IA 3K5UA 4YZCA 2VGPA 5IQEA 4X2GA 1KV2A 3BLQA 5HIBA 2IVVA 3SHEA 2PVNA 3EH9A 4NZWB 3RAHA 4CGAA 1UNGA 4CG9A 4HVSA 1H1SA 4U43A 3A7GA 5EW3A 2XIZA 4Y8DA 4CFXA 3D0EA 4F63A 2JITA 4QD6A 4BIDA 5FTGA 3C9WA 4F64A 1M7QA 2DUVA 4FK6A 2GS7A 3FLYA 3SDJA 4MHAA 3KXMA 3V51A 3VS4A 3W2SA 3BHVA 3ZSHA 3ANRA 3GOPA 4K77A 4V05A 5H8BA 1J1BA 3OCSA 2BIYA 1BMKA 2PVYA 3F82A 2VWZA 3FKNA 4QMPA 4O0VA 2QOQA 3FKOA 4HPUE 4O7TA 2WZJA 3FDNA 5CVGA 3QQGA 2WU7A 3FQEA 4EWHA 3HMIA 5EK7A 3MN3A 2OW3A 5LCKA 3S0OA 3DBFA 3A4PA 2BHHA 3F66A 3PY0A 3PZEA 3UYTA 1F0QA 4NSTA 4XV1A 3GCQA 4FTJA 5L2IA 2XNMA 3MB6A 4BDIA 3KU2A 5D41A 4DEHA 2CGWA 3TKIA 2ITZA 2GHLA 3HV4A 4OTPA 3U87A 2W1ZA 1STCE 3NDMA 5CZIA 3F7WA 3BLRA 4ZY5A 3G0EA 2PVHA 1M2RA 2WMAA 3H30A 3L9NA 3O2MA 4Q5EA 4QMSA 4X2NA 3KXXA 3RVGA 3VQUA 4UB7A 4MD8E 2FSLX 5HLNA 4II5A 3OC1A 5B2MA 4JXFA 4M69B 2XYUA 2Z8CA 4FV8A 1BLXA 4MH7A 3TNPC 3GU6A 5FQDC 3UJGA 4OTHA 5IU2A 2VTJA 3HMOA 1JLUE 5IUHA 5BVNA 5DE2A 1EH4A 1GAGA 1PY5A 2FA2A 4IFCA 4XLVA 3THBA 4BCHA 4AZFA 1W84A 3UYSA 4LGDA 4RVLA 3FHIA 4B8LA 2JIVA 1Q3WA 3QFVA 4FV5A 4S34A 3TNIA 4P4CA 4MWHA 1FVTA 3D14A 5KBRA 3C0HA 4O0YA 3ODYX 4C38A 4DG2E 4FKLA 4FKWA 3FMMA 5CAUA 2IZUA 3CXWA 4NM3A 5JN2A 1DM2A 4GVAA 4YSMA 3Q9YA 3TDVA 2CNVA 4E4XA 5C26A 3OFMA 4I6BA 4UN0C 3A7IA 1XQZA 3QX2A 4AA4A 4F7LA 4JG6A 4FTLA 4MX9A 3I4BA 1H8FA 4RVTA 1XBAA 4I6HA 3QA0A 1V0PA 3MFTA 3R1SA 3F9NA 3FL4A 3NIEA 2E9PA 1M52A 2KTYA 4RBLA 3KRXA 2WOTA 3WZUA 5AR7A 2X2LA 4L8MA 1A06A 3ZEPA 3HMMA 3H10A 5E4HA 4I5MA 4D0WA 3PJ2A 2BRMA 5KMOA 2G2IA 4MBIA 1YXTA 4QPMA 4CLJA 2WMQA 4AG8A 4MYGA 2J5FA 1NVRA 2PE1A 3FC1X 3KN5A 4IXPA 2GQSA 3N4UA 1ZARA 2X6DA 3W2OA 4FTUA 2PUPA 5HO7A 3GVUA 2ZOQA 3EQBA 4J8NA 4O0TA 4MKCA 4RX9A 5AUVA 3ZTXA 4AOJA 4XRLA 4M14A 4GSBA 3PY3A 2OLCA 4L00A 4MBLA 2WQEA 3RHXA 2JDTA 2XKEA 2CNUA 5DBXA 4O91A 2WTJA 3EQHA 5CEQA 3HVCA 4EH4A 5IQBA 2W05A 5HG8A 2DYLA 3CQUA 3C4ZA 4XH6A 3PXKA 2XNPA 4D4VA 2KULA 1Z57A 1OKVA 5E1EA 2R2PA 4LOPA 2QNJA 4K6ZA 3UZPA 5LMKC 4YNEA 5ANJA 3SV0A 4PY1A 2I40A 3LXKA 5CSWA 4U7ZA 4KIKA 4KIOA 4RC3A 3UG2A 3KY2A 4LGGA 4ZS0A 2O2UA 2X81A 4FA2A 1H00A 3RCJA 4UY9A 4ASZA 3GCVA 1BYGA 3O23A 4CRLA 3EN4A 3FI4A 4OTIA 2F7ZE 2ITQA 2WMWA 3GP0A 4PL4A 2FSOX 4CZYB 4D0XA 3ROCA 5K5XA 5I3OA 3AD5A 1K2PA 3DB8A 4GT5A 4OBOA 3W1FA 3C0GA 4O7YA 4F7NA 1QMZA 4FODA 4EZ7A 5CF8A 1RW8A 3WZJA 4HJOA 3WZEA 3MJ2A 2X39A 4GUEA 3DS6A 4JBPA 4U44A 1OL2A 4X3FA 4ACHA 2R9SA 5EDPA 2C0TA 2OZAA 4APPA 3LFBA 3R21A 4FG9A 5HBEA 5CANA 3PVWA 5HCYA 1XHAA 3CGFA 3H0ZA 2B53A 4Q9SA 5T68A 3ZC6A 2NNWB 3BHUA 3FQSA 4WG5A 3RZBA 3DT1A 4AOTA 4XV3A 2OF2A 5AR5A 5BYLA 2EWAA 4AS0A 4E3CA 3MJ1A 4TZRA 4DEDA 1JVPP 2J4ZA 5C8KA 4EOKA 4DA5A 5M09A 1YXVA 3UVPA 3LOKA 3UOLA 2RFSA 4AFJA 4EI4A 5TF9A 3CD3A 3UNZA 2NPQA 4NWMA 4RX5A 4KSPA 3LCKA 4LOQA 4UZHA 3KMWA 2OJIA 4XLIA 5AP6A 4B4LA 2XBAA 3TZMA 3NUAA 3M2WA 5BNJA 1UV5A 2CLXA 3JVRA 3R1QA 4NKSA 3RAIA 4F0GA 5GHVA 5JH6A 3M11A 2ITPA 5EI6A 4DCAA 2W9ZB 2C6MA 2OI4X 3JY9A 4JR7A 2B52A 4JQ8A 3P5KA 4RT7A 2QD9A 4CKIA 1QPEA 5AM7A 3DNEA 5EQPA 4EL9A 3ROYA 5M4FA 2VN9A 2XF0A 5F95A 3VUGA 3R7IA 4C0TA 1PKGA 4GJ2A 4O0XA 2XZSA 3POOA 2J51A 4ACGA 3LAUA 4L7SA 2OZOA 4NW6A 4JRNA 4U45A 3GC7A 3RWPA 1YOJA 3HAVA 3HEGA 4YO4A 2YIYA 2EUFB 3NPCA 2GMXA 4ZSLA 4QYGA 2VU3A 5FM3A 3QRUA 3QRIA 3UC3A 3BGQA 1KE6A 3R9OA 4DINA 4FEWA 5C1QB 4USEA 2VWYA 4JDKA 5JK3A 1ZWSA 4GT4A 4XG8A 4YJTA 5FG8A 2CGXA 2OXYA 4B9DA 5K0KA 4EKKA 3CR0A 2O63A 2R0IA 2FB8A 3LPBA 4AZEA 5A4CA 1FMOE 3F3WA 4QMXA 4ZMFA 3LHJA 3LM0A 3DKFA 4KKGA 3O0GA 1YWRA 5F20A 4I21A 4EKLA 1JSVA 1H26A 2VTSA 3PP1A 2C0IA 1J7UA 2X7GA 4R7BA 5A4QA 3GI3A 3ZM4A 4Z7HA 4NEUA 3BEGA 3D5WA 5HG9A 5CAVA 2OIBA 1V1KA 5BVFA 2FYSA 3NSZA 3OCGA 4D4SA 1CKIA 4IC7A 3B2TA 5EM7A 5FDPA 5HU3A 1SVHA 3PYYA 4TYGA 5AV0A 4ANQA 4DLJA 5JEBA 1AD5A 2UW7A 2G1TA 3KQ7A 3MYGA 5HGIA 2QOFA 4QTEA 4FT5A 4L3JA 5J5SA 2CKOA 2FGIA 1KV1A 3VF8A 2AC3A 4F99A 3KCKA 2XKDA 4O6EA 4YP8A 3UNKA 4YO6A 2VRXA 5BVEA 4FL1A 4K33A 5E1SA 3DA6A 5IMEA 1ZZ2A 2UZVA 1YDSE 2PL0A 3W2PA 2QG5A 3MY0A 1FGIA 3NUUA 3FXZA 2E9NA 3TJDA 4MNFA 3QRKA 5HE0A 1WBTA 3NAXA 3GCPA 4QMMA 4B8MA 3E63A 2RF9A 3PLAE 4MXCA 4IBMA 3BQRA 4BCFA 2UW5A 4QYFA 4EHEA 1G5SA 4JR3A 4L67A 2HXLA 1OIQA 3K5VA 5FTOA 2HZIA 3EMGA 3ZO2A 4UBAA 3NNVA 3ZDIA 5AUUA 2C1AA 5AP1A 3NYXA 5HZNA 5L2SA 2XK4A 3U9CA 2YISA 3KREA 3RKBA 3NLBA 3VRYA 4IB1A 2YJRA 3MH3A 2JKKA 4KRDA 4QRCA 4CT1A 3FUPA 5IMXA 1OM1A 1ZRZA 1XO2B 2UW3A 3AC5A 3VN9A 5BYYA 3DTWA 2DQ7X 2PVKA 1P4OA 2VGOA 3ORMA 4XG7A 3EZRA 4D2SA 5KZ0A 2XA4A 4FBXA 4FIGA 2BAKA 4N70A 4EHGA 4EHVA 3G5DA 4MD9E 5JZNA 4MVFA 3ETAA 2R3FA 1U46A 3UP2A 2X2KA 4P5QA 2W5BA 2C47A 4FV7A 3GUBA 5BMMA 4FZ6A 4PTGA 3LE6A 4I22A 5J7HA 4QQJA 3U51A 3VS2A 3B8QA 3O8TA 3UOJA 4J96A 1J91A 1JSTA 1PXJA 4FVQA 1NXKA 3DAKA 3DGKA 4RPVA 4WA9A 3H0YA 3FLNC 4ASEA 4TW9A 5A9UA 2CHLA 4KSQA 2VTAA 2B54A 1H01A 4NL0A 3BGZA 4IWOA 3QU0A 1JWHA 3K54A 5EH0A 2O65A 4J71A 2XEYA 5H2UA 3AD4A 2OFUA 1ZYJA 4K8AA 5TE0A 4YSJA 2PUIA 4FI1A 4XG2A 4BB4A 3TV6A 5AFVA 4M68A 4AGWA 1HCKA 3VS3A 3N4TA 3F3ZA 2J90A 3GU8A 4GKIA 3HUBA 3OBGA 1BI7A 4LM5A 3V5TA 2QI8A 4M69A 4G5JA 3CC6A 4PL3A 3TIZA 3W8QA 4DG3E 2VWXA 4CEGA 1R0EA 2H6DA 3W33A 3UQFA 4AXAA 4PMMA 4ZK5A 4D9TA 2CNQA 2H9VA 4D5HA 1PW2A 1PHKA 4GV1A 4ENYA 4C4JA 4BCJA 3G9LX 3LZBA 2AC5A 4PPBA 5FEQA 5HCXA 4RZWA 1YWVA 3W2QA 2B0QA 4YJOA 4RIXB 3CTQA 4GS6A 1CSNA 5DR6A 3OZ6A 2XK7A 4HGSA 4O96A 1ZY4A 3HV6A 5ITAA 5GINE 4IADA 3LLAA 3R8LA 1ZMWA 5ANEA 5L8LA 1WVXA 3CY3A 4RLLA 3Q3BA 4G9CA 3EQRA 2VWVA 4NYEA 5FGKA 5KO1A 4WSQA 3DXPA 3VF9A 3QTSA 4L7FA 4N6YA 3HMPA 4I6QA 3IQ7A 3FMDA 3LW0A 2P3GX 3CY2A 3Q4ZA 5TR6A 3RK5A 5HU9A 1SMHA 2W99B 3M42A 3D4QA 3QALE 4JIAA 4MBJA 3MVMA 2WMUA 5CY3A 3MA6A 1PRYA 5CU2A 3PPJA 2ETRA 5EHLA 3NUYA 4K11A 2J9MA 2UZTA 2YA9A 3I5ZA 5AR3A 3C5IA 3A7JA 4RJ7A 3NUNA 5C03A 4X2JA 3V6SA 3VVHA 4BC6A 3CTJA 4UWCA 4E6DA 3ZLSA 4BDAA 5HVKA 3L8PA 4LRKA 2F4JA 5LMAA 4Y5HA 3FXXA 3O7LB 4OTGA 2YIQA 3I60A 3L8XA 4IWDA 4DFZE 3LXLA 5TO8A 1ZMUA 4J98A 4RWIA 3TXOA 3VNTA 4LL5A 2YWPA 2ITNA 5DOSA 3Q4UA 2YM8A 3MFSA 4ZY6A 2ONLC 4OBPA 2C5XA 4DEEA 4PPAA 4QTDA 2UW4A 3Q04A 4BI0A 4M15A 4EK4A 2W1FA 1YXSA 3RCDA 5AV3A 5AAEA 2OO8X 2ZM1A 3G15A 2WTIA 4FL2A 3H4JA 3T3VA 5JMSA 1NVSA 3NUPA 5IISA 2IZTA 2O3PA 3KVWA 4HGEA 4ZTLA 2WMSA 4XS2A 4BDFA 5LMKA 2Z02A 5ACBC 4NM0A 3DB6A 3DJ5A 3V5QA 4D55A 3WF7A 4ANSA 3KC3A 4IWPA 4APCA 1FVVA 4K9YA 4ITJA 4Z16A 2W4KA 1UU9A 2J5EA 2XCHA 3CPCA 4PQNA 4QYHA 4PMPA 4EJ7A 2OGVA 1E1VA 3V5JA 3MDYA 5HI2A 3PXYA 5DRDA 3UQGA 3U8WA 5AV4A 4FSZA 1PYEA 5J79A 4OAUC 2BVAA 2W96B 1YOMA 4C37A 1W7HA 4CKJA 3E5AA 3C0IA 3NEWA 2R3GA 2ZV8A 4GW8A 1W82A 4TYJA 4EH3A 4XOZA 2WQBA 3V5WA 3DDPA 3QQLA 3CIKA 3RK7A 3D5XA 3ULIA 1P2AA 1YVJA 2V55A 4QMNA 3V6RA 1U59A 3MTFA 2VWBA 3V04A 5I3RA 3BHHA 2FVDA 5ACKA 4MWIA 5IA3A 2RG6A 3UPZA 4IWQA 1XH8A 4OTQA 3BPRA 5HO6A 4BCKA 4YPSA 2WTCA 5DT3A 3RK9A 3CPBA 3UG1A 4YZDA 4DFUA 4IANA 5JFXA 3IW8A 3PIYA 2RG5A 4I20A 3IDBA 4QP9A 3R1YA 3LQ8A 3KKVA 3IPHA 5AV2A 2J0KA 4E6AA 4IX5A 2VTQA 4BKYA 4IZ7A 4GT3A 4DAWA 4M7IA 3EFKA 3BGPA 3R00A 2WFYA 3ALNA 4U3YA 1DI8A 3ZUUA 4AW1A 4QP2A 4U40A 3DXNA 5E91A 5AX9A 2YIRA 3NW5A 2W06A 3OCBA 1Q5KA 3R04A 4Y72A 4IX4A 4C58A 4O21A 4WUNA 3B2WA 1OB3A 3L8SA 4XG3A 4CRSA 3TL8A 3AG9A 4ZZOA 3E92A 2E9OA 3UO5A 2IJMA 3E3BX 4M3QA 5L2QA 4RA4A 3FMNA 2REIA 4QYEA 4UYNA 5AUTA 1R0PA 4JDJA 3OMVA 3GC0A 5BVOA 3BEAA 4NTTA 2Y9QA 3QUEA 1Y57A 3T9IA 1CDKA 3ZO4A 4IZ5A 4J95A 2HELA 2EB3A 3OVVA 4IE9A 1KSWA 2C69A 3BYSA 3QTRA 2HY0A 2BFYA 3NWWA 3QXOA 4G16A 3TZ8A 4TYHB 4FGRA 2I0HA 3ZFYA 4A07A 4DTKA 2CKQA 4EZ5A 4HCVA 2PVMA 3WYXA 1PXKA 2OH0E 5CU6A 3PVBA 4RWKA 5KMKA 5JFVA 5DWRA 5CX9A 3RJCA 3N51A 2VUWA 5AAFA 2YM7A 3GGFA 5D9HA 3RI1A 1FVRA 1YWNA 4YJSA 5K4JA 4ASXA 2QVSE 5BVKA 4CTCA 2XEZA 3WILA 4FKSA 3TNHA 5HG5A 3AC1A 5E9EA 3AC2A 4RVMA 3F5GA 3JYAA 3KGAA 4GFOA 4R78A 5LQFA 4E4MA 3QWJA 3TI1A 1Z5MA 4TRLA 4RIWB 4FG8A 4UYAA 3CKXA 4Q9ZA 3ZRKA 5ANDA 3A62A 5EQYA 4WIHA 4FSTA 3BV2A 3W55A 3MW1A 2XM9A 4FKUA 4BCIA 4EC8A 4FL3A 4FNXA 3ZRLA 2XIRA 5JFSA 4FICA 4XP3A 5K4IA 4FVRA 3ID6C 3NMUF 3ACKA 2JKQA 4WHZA 3FPMA 3VHEA 4NFNA 3QQHA 3FZTA 3ZM9A 3WE4A 5M55A 2C5VA 3U4UA 2BMCA 2BRGA 3EQFA 4G3DA 4Z9LA 4DTBA 2PHKA 1IA9A 3L9MA 2AUHA 2Y0AA 1XR1A 1G8AA 1WVYA 2BZJA 2CMWA 2JFLA 3EL8A 3PY1A 3KXGA 3W2RA 5J5TA 4TWOA 5J9LA 1FBNA 2WMRA 1WBSA 2W1DA 3F2AA 3QX4A 4GMYA 3QLFA 5AMNA 1WBOA 1ZOGA 3DFCB 4HW7A 3FAAA 3Q32A 4M12A 4CYJA 2Y4PA 3GFWA 4GRBA 4L46A 3ZHPC 5M07A 5CASA 5HEZA 3PA4A 3RWQA 1X8BA 4CTBA 5BUEA 3MTLA 4JX7A 4ASDA 4YMJA 2X6EA 4EUUA 3R02A 1BKXA 3HV7A 3SRVB 4ALWA 4ORKA 4AA5A 2ETMA 4ZXTA 1XH7A 4E7WA 3V8SA 4PMTA 4F4PA 5FRIA 5CSVA 1GZNA 2VO6A 1IA8A 5CEOA 1B6CB 2RFEA 2VAGA 3PZHA 4FT3A 4PX6A 4RRVA 5HG7A 5JGDA 2C6DA 4J97A 1PJKA 1SNUA 2C4GA 4KNBA 5FWKK 4JX3A 3I6UA 1AQ1A 2YCFA 2SRCA 3QUPA 4O6LA 3QHWA 3MVLA 4FV1A 4WNMA 2X9FA 4U0IA 4YR8A 2C5OA 5IUIA 3NCGA 1QPCA 3D2IA 3ZBFA 1DI9A 3QRJA 3TCPA 2JBPA 5AP7A 3EN7A 4O0UA 1U54B 4NH1A 4YLLA 4E6QA 5I9ZA 5E8UA 3FI8A 3REPA 3SX9A 1YHSA 4BFMA 5IPJA 2YHVA 2C6KA 4F6WA 5B0XA 3OT3A 4U9AA 5IQIA 1YHVA 5A46A 2J50A 1XH5A 5CSHA 2C1BA 3DV3A 5HD7A 4BWKA 3AT4A 3COMA 3JPVA 4MF1A 3FXWA 4HYSA 4PUZA 4L43A 2WXVA 3MVHA 2IW9A 1UNLA 1APME 3VJNA 1OL1A 3QRTA 3GU4A 2XB7A 5EHOA 3ZOSA 4IAAA 3BU3A 4IVBA 4RFZA 3QD3A 5IQAA 3ANQA 4W9WA 4IEBA 2R7IA 3NYOA 3LMIA 4EUTA 3R1NA 4CD0A 4P5ZA 4F1TA 2BRHA 5AUWA 4RGJA 5EDQA 4DE4A 1M14A 4YUQA 1KE8A 4UMPA 2BILB 4YTFA 1WFCA 3E93A 3PXFA 4Z55A 4L3LA 3RNIA 3LCSA 4HZRA 3AC4A 4U81A 5CAPA 3EFJA 2H96A 4UXLA 3DKCA 4FTKA 4J8MA 3UZTA 2XIYA 1OIYA 3TKUA 4D1SA 3ZO3A 4D2RA 2I7QA 5JQ8A 3PTGA 3DBEA 2DS1A 3IECA 3OD6X 4ITHA 4WO5A 4DH8A 5A4TA 3F2NA 2I0YA 4IC8A 2X2MA 3DXQA 4RIXA 1KE7A 3FQHA 3HP2A 1IRKA 3BELA 4FV9A 2X7FA 3UTOA 4QTCA 4IAKA 4BBMA 4WG3A 4ZJVA 2CLQA 3R7UA 5KMMA 3RP9A 4AGDA 4ZLYA 3NS9A 3PG1A 4JT3A 3OS3A 3PRFA 2F9GA 3ORLA 4D9UA 5CZHA 4YU2A 3N4VA 2ZM4A 2W1CA 2XM8A 4GEOA 3VWAA 4R3RA 3U6JA 4O86A 4YLJA 2UZNA 1O9UA 2R3PA 1YKRA 3E88A 3FLSA 3F3VA 4YJVA 1Y8GA 3VW8A 5CEIA 3U4WA 4I94A 1MUOA 2ZV2A 1R39A 4I4EA 4A4LA 4ERKA 2WMTA 4D58A 1ATPE 4EEVA 4E1ZA 5LWNA 1MRYA 1P14A 2BROA 3GB2A 5EM5A 5D7VA 2UV2A 3TT0A 4R7HA 4M84A 2QQ7A 2C3KA 3WBLA 4DTAA 3R7GA 2JFMA 5GJGA 2JD5A 1IG1A 4IM3A 5HOAA 3W18A 3I79A 4ZIMA 4RVKA 3VULA 5M44A 5HKMA 3CP9A 2IWIA 3MH2A 3IO7A 3OUNB 2XYNA 3PJ3A 3R8VA 2HWOA 2GQGA 1MRUA 1Y91A 2CPKE 2BRBA 4BGHA 4JAJA 4QTAA 2YCRA 5EYKA 4C4EA 4A4OA 4LI5A 3EN9A 4IFGA 4AP7A 4D5KA 3W32A 2XS0A 4WSYA 3Q5ZA 2GSFA 4I5CA 3Q2MA 4O0SA 4PL5A 3RM7A 4JQ7A 5JRSA 2QLUA 2W4JA 4FVPA 2QOCA 2YIWA 2B4SB 3MSSA 4EOJA 3DKGA 2XNGA 4O81A 3DCVA 5L2TA 2YJSA 2BHEA 5AR8A 2XP2A 5M56A 5FXRA 3VUDA 3ZFXA 4C7TA 3QD2B 4M8TA 5HQ0A 1UNHA 2OWBA 4KBCA 4KINA 5L2WA 3D83A 3OEZA 3QQFA 3KVXA 2A27A 1GOLA 2WIHA 3LM5A 4I24A 4KD1A 5CENA 4BWXA 4C4FA 4DFBA 2BAJA 3EQPA 4BYJA 3VBYA 4FIIA 1YDTE 4XYFA 3HDMA 3F61A 5K0XA 2BZHB 4AN3A 3SW7A 2R3JA 2V7OA 3VQHA 1H1QA 2PYWA 5C4KA 1ZY5A 5E8TA 5IA2A 2Y8OA 3MY1A 4K2RA 4IAYA 1V0BA 3EN6A 2BAQA 3I1AA 1WAKA 3QTWA 4RWJA 4CCUA 3ZO1A 4WBBB 1H07A 2QU6A 4W4YA 4XRJA 3KK9A 5HE1A 5AM6A 2JGZA 3DQWA 5KUPA 4ARKA 4EBWA 4EYJA 3WF6A 3Q4TA 4YLKA 1U4DA 4HVDA 2WQOA 3TG1A 5HBJA 3H9OA 4CMUA 5EW8A 4EH9A 3LXNA 5EI2A 4YURA 5GZAA 4U41A 2BFXA 4DLIA 2CCIA 2PPQA 2Q83A 3WYYA 1UWHA 5T6KA 1XKKA 1OPLA 2JC6A 3DDQA 5D1JA 2CN5A 3QGYA 3I7CA 1ZYDA 4BHZA 5DEWA 5AR4A 3D7TB 4AA0A 4JIKA 4AFEA 3PSDA 2V7AA 4QMOA 4XCUA 4L6QA 2UW8A 2VO3A 4XOYA 4OTRA 4BR3A 3ZU7A 1TKIA 5KMLA 3OBJA 4EH5A 5FEEA 3LQ5A 4G3CA 2Y6MA 4FYOA 4G9RA 2ITOA 3FMJA 4JRVA 3ORTA 4WT6A 3SXRA 4Z7GA 4BKJA 3GQIA 4YBJA 2ZB1A 2GNGA 3MPMA 5D11A 4ZLOA 3LCDA 4ZAUA 3S1HA 1OUKA 1PXMA 4IB0A 4YJNA 1H25A 3Q9XA 4FV0A 2X1NA 2A1AB 3LFEA 5BVWA 3S00A 4LL0A 1YXXA 5DN3A 3VUMA 1WBVA 2PUNA 1OIRA 3FHRA 4HNIA 2F49A 1H28A 3T3UA 3DAEA 4Y46A 4EK3A 4F70A 1W98A 3CQEA 3PVUA 4FIFA 2XK9A 4IVDA 4R5YA 4TYHA 5J8IA 3II5A 3UODA 2CGVA 1LR4A 2BDFA 4L42A 3I0OA 4LRJA 4BCQA 5A6OA 4AGCA 3QXPA 3RALA 3QTXA 4FTMA 5AX3A 2QO2A 1M2PA 2G2FA 4GIIA 2B9JA 3VHKA 2WMXA 3BQCA 3IK3A 3FMKA 4PDSA 3MGYA 2IVTA 5EYMA 3VBXA 5A4EA 4FYNA 4O2PA 1IEPA 4EYMA 2HXQA 4S31A 2UUEA 1YHWA 5E92A 3C4FA 4DC2A 1GIJA 5DPVA 4FKJA 3UGCA 1OUYA 3Q9WA 2BZKB 3KEXA 4FTIA 2O5KA 3NX8A 5IQCA 1OZ1A 3TIYA 5ANOA 4QNYA 4RIWA 3P1AA 3BYMA 3KXZA 3CJFA 1BL7A 3FLZA 4HGTA 3R7YA 1WVWA 5KKRC 1GY3A 1CKJA 4CSVA 2OH4A 3EZVA 4GG7A 3TNWA 2V62A 4BN1A 4FNWA 3L9LA 5D12A 4LG4A 4O27B 3AT2A 4C4IA 2R0UA 5IQHA 4L3PA 2BKZA 2YIXA 2R64A 3G6HA 3IW4A 3R71A 4Y83A 1GJOA 2YWVA 3R63A 1PMEA 4EJNA 3LFFA 2NRUA 4AX8A 4DF3A 4RFYA 5GIPE 3KXHA 4JVGA 3DOGA 3UOKA 1ND4A 2EXMA 2YCSA 3GC8A 3HA6A 1ZZLA 4FT9A 4W4WA 4JDIA 3BX5A 4OT6A 3UNJA 4ANBA 3DKOA 4DEBA 1VZOA 4YJUA 3W2CA 1TQPA 4CXAA 2ZJWA 3ZRMA 1L8TA 4DBXA 1Y8YA 5CF5A 4J52A 4EOMA 5LVLA 2VTIA 1MQ4A 3LCTA 3PA5A 5DH3A 3R8ZA 4DFXE 5B7VA 4D2PA 5HCZA 2RKUA 4FTAA 4DBNA 3KRWA 1JKTA 4TTHB 4I0RA 2XRUA 3FI2A 2IW8A 2OIQA 4TN6A 2WEVA 3ORZA 4NTSA 4XP0A 4YZBA 4A9SA 2G01A 1PF8A 3GCUA 1NT2A 3AC8A 1Q62A 4KIQA 2GU8A 5DT4A 4YTCA 5I9YA 5CSXA 1ZYSA 2QLQA 1FQ1B 2XNBA 2ITWA 3Q6UA 4ZZNA 3HRFA 1ZMVA 3R30A 1T46A 3D9VA 5ETIA 3SRVA 4BTMA 3R6XA 2RL5A 3PXQA 3R2YA 5FBNC 2VTNA 3IW7A 3QYZA 5J87A 3JY0A 4RC4A 2E9VA 4H05A 3ZMMA 2YAAA 4UWYA 5J1VA 4FKQA 3TUCA 4UMQA 5EKNA 1G8SA 5EOBA 2JDSA 3DPKA 5HLPA 3E8NA 2B1PA 4O22A 3ERKA 4FTRA 4GU9A 2YZLA 3ZLYA 4MAOA 5M53A 2WU6A 2C3IB 2GHGA 2XK8A 3QTUA 4QP8A 4AGUA 4XJ0A 4E26A 4KUJA 3TM0A 3V3VA 2HCKA 4HYIA 1XBBA 2ITYA 5CWZA 1U54A 1ZXEA 3GEQA 4FV2A 2ZB0A 3KXNA 4BDBA 4MNEB 5E8ZA 4Q5HA 3VUTA 5I4NA 3OT8A 4ANOA 2P33A 4W4VA 3FWQA 4G34A 3EQIA 4AW5A 5EG3A 4PNKA 5B2LA 3M1SA 4CZUA 3OXZA 5IA0A 2PU8A 1H0VA 3TZ7A 3MIYA 2OF4A 3AD6A 5FP5A 3COHA 3H3CA 5CNNA 4DT8A 4DH1A 2C3LA 4HYHA 1CTPE 2XIKA 3GOKA 1RQQA 2WEIA 2ZVAA 2ERKA 1PXNA 4J7BA 2W1HA 4LQMA 4O0WA 4L53A 3AMAA 2HW7A 5GZ8A 4IZYA 3CCNA 4OGRA 4O83A 2PMNX 1K3AA 5FM2A 3ORKA 4LUDA 4QT1A 3ATTA 2CKPA 1R1WA 4FF8A 3UMWA 4IDVA 3V01A 4AT5A 4HGLA 3KA0A 4UALA 3WARA 1Q8WA 3ENMA 3DK6A 5EHYA 4CYIA 4EOPA 5FBOA 5CI6A 4PDOA 4Y5QA 2BZIB 3QWKA 4NU1A 3P7CA 3HNGA 2IG7A 3R73A 4EOSA 4RQKA 2YCQA 3LJ0A 3RGFA 4FSNA 4QNAA 4BDGA 2PZ5A 4G3EA 5DA3A 4O7WA 3TTIA 5GJDA 2H34A 5L3AA 1I44A 4FK3A 5HORA 2OXDA 3Q5IA 4X6QC 3ZFMA 3VUKA 2WTKB 1GIIA 2ITUA 2WTKC 2VNWA 4YJQA 2I0EA 2X4FA 5KBQA 4H58A 2ZAZA 2FUMA 4PWNA 1UWJA 3HRCA 4H3BA 2BTRA 5A3XA 4FOCA 3GT8A 3DAJA 4FV6A 3JR1A 2R3IA 4BZOA 4U6RA 3VC4A 1QPJA 3DJ7A 3DU8A 3G9NA 5KHXA 2W1EA 4X7QA 1RJBA 5HX6A 3C51A 3GU5A 4FE2A 3ZSGA 1J7LA 3MWUA 3FSFA 2OIDA 3QC4A 2WELA 3MVJA 3ZDUA 5IEYA 4EQMA 2C5NA 4KB8A 4C59A 4C3FA 3DLSA 3MI9A 2W5HA 4OT5A 4C57A 4A7CA 5IEXA 3ZZWA 5CVFA 1IAHA 3JXWA 4GUBA 1W83A 2A2AA 3C1XA 3CS9A 3KMUA 4R1VA 3SXFA 1VEBA 4FSYA 5HO8A 2X7OA 4R5SA 5HIDA 3AMBA 1A48A 4RJ6A 2Y6OA 4U3ZA 2WAJA 4YTIA 3QZFA 4M0ZA 4LV5A 3U55A 2VZ6A 4R3PA 1UU3A 4FR4A 3OF0A 3OWJA 4YBKA 3VBVA 5HVYA 4F9BA 4KS7A 2EXEA 2J6MA 3FZSA 4MXZA 5CYIA 5DGZA 5K3YA 4XEYA 3EN5A 2E2BA 2GPHA 3LXPA 1I09A 5LJJA 2X9EA 3MBLA 1XBCA 3OW3A 4YC6A 2F7XE 5A6NA 3PXRA 5AUXA 4PRJA 5CEKA 2C0OA 4O0RA 5J1WA 1BUHA 2R3QA 3SOCA 4TYEA 3WF9A 4IX3A 2R3RA 4MXOA 3RMFA 3ZONA 3K3IA 5HTBA 1B39A 2WMBA 1BL6A 1AGWA 1W0XC 2FH9A 3WIGA 3PXZA 2IO6A 3FYKX 5EW9A 3RZFA 3E8DA 3A8XA 3LFDA 1H1RA 3MIAA 4ZSGA 3F7ZA 3PJCA 4ZJIA 4ALVA 4ZLZA 3DTCA 2OSCA 2QR8A 2R4BA 4R3CA 3MFUA 3BCEA 3R8MA 5FTQA 1OIUA 2WD1A 2V0DA 2G9XA 4LFIA 4AQCA 2P55A 4G2FA 4QMTA 2JBOA 2B9HA 3SVVA 1PXOA 3EOCA 4LYNA 5AUZA 4XX9A 5EYDA 4IH8A 3EFLA 1PYXA 3MS9A 4FKPA 4HVIA 1OPJA 4USFA 2CN8A 1R3CA 2J2IB 4AU8A 4L52A 4ERWA 4O1OA 4FEXA 3OWPA 2HW6A 5CU0A 4FKGA 4K1BA 4GK3A 2ZV9A 3HZTA 3SAYA
chains in the Genus database with same CATH superfamily
2AYPA 4QQ5A 4EK5A 4F65A 3KMMA 2ZYBA 4ZTRA 1P5EA 4I4FA 2OK1A 2PZPA 3F69A 3WF8A 3F5UA 1LEWA 4HVHA 1WMKA 4PTCA 4KKHA 3D7TA 4YC8A 1G3NA 5AADA 4F6UA 5LCJA 3OROA 2Q0BA 4A9RA 4WUAA 3I6WA 1KOAA 5CEMA 1OL5A 4QP7A 2O8YA 5FUTA 3C13A 2UZWE 2R5TA 2CSNA 5B2KA 1XH4A 5KNJA 2W4OA 3FE3A 4RMZA 4BL1A 2JDRA 2XBJA 4GVJA 4ACDA 3NNXA 2C6EA 4IMYA 5AP0A 4ZS4A 5L6OA 3IONA 3HA8A 3RINA 4GU6A 1O6KA 2XRWA 2IPXA 1SZMA 1VR2A 3R7VA 5HLWA 4PMSA 4IHPA 3O50A 5L8JA 4S30A 5IQDA 4UEUA 5CALA 1Q8TA 3RAWA 4CQEA 4K0YA 4ZZMA 4B0GA 4FGBA 3RPRA 2WO6A 2VO7A 4AACA 2YM4A 3R9NA 4TL0A 2WPAA 4ID7A 4EZ3A 3LLTA 3QQJA 1KWPA 4MXXA 1K9AA 5M51A 2XNOA 5FDXA 4I41A 2UZLA 5AAGA 1UU8A 4D1ZA 4PDYA 3VUHA 1O6YA 4FKVA 4MUQA 4UMRA 5HE3A 4BF2A 3F88A 3EJ1A 3SOAA 2WNTA 3P79A 2HENA 5J9YA 2ZV7A 4ALUA 1E9HA 2QOOA 4ZTSA 3Q53A 3SC1A 2UZEA 4RC2A 3IKAA 3W16A 2YITA 4IDTA 3AC3A 1B38A 3ZLXA 3SGCA 2G2HA 4DGGA 2RFDA 2CKEA 1H4LA 3A7FA 1OL6A 3JS2A 4L44A 4YTHA 1OPKA 4JL9A 5H3QA 5AA9A 4QPSA 3CEKA 4WG4A 1WBWA 5I0BA 4FKOA 4C35A 3P0MA 2RIOA 5CLPA 3TACA 3PLSA 5GJFA 1TVOA 2HY81 2PWLA 2YFXA 2XJ0A 4ITIA 4C34A 4AZWA 5FLFA 3UP7A 4W9XA 2O64A 2C3JA 3Q52A 4FKRA 3ITZA 4IJ9A 2XK6A 5JZJA 5IH6A 3FMLA 4EWQA 4BVUA 3KF4A 1JBPE 3TWJA 5ANGA 5LVNA 2W1IA 3G33A 3UPXA 4CG8A 5CEPA 3R0TA 1Z9XA 1VYZA 2H8HA 3QL8A 4FZFB 4G6NA 4IVCA 4KA3A 1ZOEA 4MF0A 4XHKB 4ZTHA 4H3QA 5J95A 5JKGA 2JLDA 3C5UA 1H27A 3FY0A 5M4UA 3ZCLA 5FD2A 2A19B 4RJ3A 4QMWA 4BDJA 3HL7A 4EONA 4TXCA 3B8RA 3GU7A 3WZDA 3JUHA 4NJDA 5ICPA 5M08A 2W7XA 2WKMA 3WIKA 5I5ZA 3BWJA 4QMQA 2ITTA 4FZDB 3TV7A 4C4HA 3QTIA 4ENXA 5LVOA 5E90A 3TNQB 4O4FA 3TV4A 5AA8A 3EIDA 4WNPA 2GTMA 1S9IA 4QO9A 1YI6A 4TYIA 5DEYA 4CFVA 2GNIA 4QOXA 4DG0E 3ZZEA 4DEIA 4WD5A 3NUSA 1KUTA 3MV5A 3NUXA 4IW0A 1XH6A 4XBRA 4KABA 2VTPA 3FZOA 4U79A 2PZIA 3CD8A 4NKAA 5CT7A 3UBDA 1JAMA 3OWLA 3DZOA 5DLSA 2Z60A 4FX3A 4AW2A 3HGKA 4DT9A 3BZ3A 2XARA 3PJ8A 2V5QA 5HNGA 5I9VA 5L4QA 2C5YA 5LXMA 4DFLA 3QUDA 2BIKB 3PWDA 5DIAA 5CU3A 3HV3A 4PF4A 3EKKA 4QMLA 2OFVA 4JAIA 2QCSA 5EKOA 5A4LA 1LPUA 4AE6A 3K2LA 5CF4A 4FTCA 1QL6A 1HCLA 5BYZA 2QR7A 1JOWB 1FGKA 3VUIA 3TUBA 3OY1A 3C4XA 2PVJA 1H08A 1DAYA 4R8QA 1OVEA 4RX8A 4WRGA 4I92A 4CFNA 3QAME 2UVXA 3CQWA 5EDRA 3QKLA 3VBWA 4DH5A 5KCVA 3F5XA 5DI1A 2QU5A 3G2FA 3RPYA 5IEVA 3Q2JA 4RZVA 3HKOA 3L1SA 4FTTA 1J1CA 3KB7A 4MNEA 4KKEA 4TKSA 4BZDA 2I0VA 4L68A 2X0PA 2X8DA 5J7BA 3DK3A 3HUCA 1FMKA 2OJFE 4CNHA 3SG9A 3A60A 4LUEA 3OP5A 1Q8YA 1DS5A 1LUFA 5HIEA 4ZTMA 2PZRA 4K18A 5I9UA 4N57A 4CFFA 3LCOA 2F2UA 3POZA 2GCDA 4XBUA 4BYIA 1M2QA 3SD0A 3R9DA 5I9XA 3U54A 4BJJA 4E6CA 4DHIB 2YEXA 1QPDA 2CCHA 3CKWA 3GQLA 3HMNA 5HBHA 2XKFA 5GNKA 2J0IA 3SXSA 5KHWA 3L9PA 1JPAA 3ORPA 3ORXA 5AP5A 2RSVA 4MQ1A 4CQGA 5IH5A 2P0CA 3VS7A 5JT2A 1XJDA 1XMLA 1WBPA 4GK2A 5KMNA 3MFRA 4DDIA 1ZLTA 3QA8A 4JBOA 4RA5A 4XP2A 4AZVA 1F5QA 3MPTA 2A4LA 4FNYA 4NM7A 4QYYA 1TQIA 5CQUA 4BRXA 1NVQA 4H3PA 3D5VA 3N9XA 1OKYA 1F3MC 2DWBA 5TOZA 2IZSA 3RBWA 4ACMA 3A99A 4NK9A 3UVQA 4EH6A 1ZAOA 5IH4A 3SQQA 3NR9A 3VBQA 5BUJA 2P2HA 3CBLA 4TWNA 4JS8A 3O17A 2WTVA 4F08A 4PNIA 1U5RA 3BHYA 5LWMA 3EFWA 4FT7A 5HHWA 1JKKA 2GFSA 3QBNA 5C4LA 1T45A 2QOLA 4O4BB 4HYUA 2ZFYA 5HNBA 3R8UA 4Z3VA 4BCNA 1H1PA 4R7IA 4UMTA 2PTKA 2GQRA 4BICA 4LGHA 3NYNA 4DH3A 4I1ZA 5BVDA 3KN6A 3AXWA 3GBZA 3RHKA 2PK9A 2GS6A 2C6IA 4E5BA 2Z7LA 3PPKA 4O7ZA 5E7RA 2LGCA 4C2WA 1M7NA 4NCTC 4DITA 4FJVA 3OTVA 3E8EA 5F1ZA 4ZEGA 3ZUTA 2OBJA 4KRCA 4MTAA 1CM8A 1PXPA 3PE1A 3BL7A 4GKHA 2XVDA 2QOKA 3ORNA 4BGQA 5A14A 4IVAA 4N4SA 2HAKA 1E1XA 4CV9A 2W1GA 4A9UA 3F2RA 4E5WA 3F3UA 1YXUA 2UZBA 4YPDA 2UZDA 2PMLX 2BRNA 4I0SA 3NNUA 2ETKA 4PP9A 4HCUA 4AF3A 3FBVA 2OJ9A 4XG6A 1CMKE 4L01A 2ZDTA 3EL7A 4A9YA 4AWIA 2VD5A 2VTTA 3TJCA 3BIZA 2VX1A 5L6WL 3TKHA 5AEPA 3WE8A 4FMQA 3OXIA 1SVEA 4YZMA 1XMMA 3P7BA 4CMTA 3G51A 5JFWA 5LARA 2ONLA 4NIFB 4GK4A 1W2CA 1P4FA 3IG7A 4ZOGA 3S95A 4MXYA 4C33A 5AP3A 3QTZA 5HESA 1Q8UA 3FY2A 4RLKA 2P2IA 5IQGA 3PSCA 4BCGA 1BX6A 2J0JA 2ZM3A 4YHFA 5AR2A 1Q99A 1H24A 3DK7A 5KMJA 2F57A 2XUUA 1KE5A 3A7HA 3MA3A 3G90X 3QYWA 4I5HA 4IQ6A 4N6ZA 4MQ2A 1H1WA 2YLFA 3UIBA 5C8MA 4QMYA 3VJOA 2PULA 3VBTA 1Y6BA 2QOIA 4C62A 3E7OA 3NCZA 3C50A 4M0YA 4HPTE 4ZJJA 3JVSA 3QKKA 2UVZA 5LMBA 3FI3A 4QMVA 4G3GA 3R7OA 4AZSA 2UW0A 4AT4A 4XG4A 1NA7A 2OU7A 2WTDA 3C4WA 2UZUE 3BI6A 1FPUA 2PE2A 2R3LA 3FPQA 5CT0A 2X8EA 5C8NA 5CAOA 3PP0A 3UC4A 3ZC5A 2HWPA 4RSSA 4UX9A 1IASA 5JSMA 3GENA 4FSWA 4O7VA 1TFFA 2VWUA 2XAMA 3EHAA 4G6LA 3Q4CA 3QHRA 4ZP5A 3FYJX 4U97A 3O71A 4BTKA 3QKMA 3QGWA 4W8EA 4FC0A 1MP8A 4HNFA 4MD7E 3P7AA 3G0FA 4B99A 3PE2A 1U5QA 3ZH8A 2WMVA 4E5AX 3W10A 5H8GA 1OBDA 3NRMA 3PIXA 3E7VA 2I6LA 2R3KA 4D1XA 1YDRE 1GIHA 2X0GA 3PPZA 4QMZA 3GXLA 3Q6WA 3E8CA 2ITVA 4BBEA 4E4NA 4X6RA 2B9IA 3ODZX 3BYVA 4R1YA 5LOHA 2GNFA 2JKMA 3AT3A 3CJGA 4BWPA 4JOAA 2PMIA 5IZFA 3R7EA 4FSQA 5I9WA 5L8KA 5CSPA 3A2CA 2QKWB 1ERKA 1V0OA 1MRVA 2C6TA 3UVRA 4KWPA 3R8PA 2VWIA 3RPSA 4O7LA 3T9TA 4BCPA 4DN5A 4HVGA 3BRBA 4EOOA 2QO9A 3HP5A 3OTUA 2HZ4A 3BKBA 5ETCA 3O7LD 4XV2A 4QQTA 2OICA 3OEFX 5KX8A 4OUCA 4BCOA 5CS6A 4JLCA 3FEGA 1JKLA 3ENHA 5T3QA 4ZMEA 4IZAA 3EYGA 5FP6A 4WBOA 2VTLA 5EFQA 3PIZA 4I93A 4DEGA 3KULB 1UKIA 4QDVA 2C6OA 3VAPA 2QONA 4WNKA 3BBTB 4BY9E 4O4DA 4O7RA 4EBVA 4J53A 3ATSA 4BTFA 3RNYA 2QHNA 5E8SA 1URWA 5IQFA 2CGUA 2R3NA 5BQ0A 1PXLA 2VTOA 5AV1A 3RPOA 3LJ2A 3LFSA 3R2BA 4LRMA 4ANMA 4DFYA 1UU7A 5HTIA 3DQXA 3CGOA 4DGNA 1BI8A 3PJ1A 3ZXZA 5GIOE 5E8XA 1WBNA 2BDWA 2PE0A 3QCXA 4TPTA 2CJMA 1PMUA 2RFNA 1LP4A 4TNDA 2JKOA 4F9YA 1SM2A 4FSMA 4YZ9A 2OJGA 3PWYA 1OECA 5IF1A 2X4ZA 3DBCA 4MXAA 4NW5A 5AIKA 5AIRA 5AP2A 2YAKA 4I3ZA 2PY3A 4I6FA 4IAZA 5CXHA 3W0QA 4AW0A 4IX6A 1Q24A 3P5JC 5M06A 3V5PA 4MEDA 2VX0A 3UO4A 2A98A 2A0CX 1RDQE 2C30A 3MPAA 4IACA 5AWMA 2WQNA 2GFCA 5KKRB 4O82A 3PG3A 3Q60A 1W2DA 3O5AA 4FV4A 2VV9A 5BPYA 3BBWA 3HAMA 4GH2A 3O8PA 3NGAA 4DGOA 3HDNA 2R3MA 2O0UA 2JAVA 3EKNA 3D2KA 4AN9A 3VS6A 4H39A 2ERZE 4L45A 1Q41A 3CTHA 4AAAA 4QP1A 2ITXA 3HX4A 4MK0A 3W0OA 4E73A 3RPVA 1UKHA 5DR9A 4H36A 4IM0A 2HZNA 3WF5A 1Y6AA 3ZS5A 4DEAA 3EQCA 2UZOA 3A61A 3BU6A 3P4KA 4XUFA 2YDJA 2XAOA 5L6PA 1OITA 3PA3A 4WOVA 3VS1A 4PP7A 4IB3A 4GCJA 4JG7A 4UZDA 3W0NA 3VIDA 4E4LA 4X3JA 4XV9A 2J7TA 3W0RA 3QLGA 4QP3A 4FTQA 3TTJA 3UIUA 1ZYCA 1MQBA 2OKRA 2GS2A 2VTMA 4ANLA 2BDJA 3LIJA 4IAFA 5CVHA 4R6VA 2IZRA 3VS0A 4B7TA 4DCEA 4PTEA 4TWCA 4F9WA 4X0MA 3UDSA 4D4RA 2YACA 4O2ZA 2HYYA 2YM6A 4S33A 5EM6A 2WQMA 4ZSEA 2WIPA 3FZPA 4OTFA 1PMVA 3QQKA 4BDEA 1CKPA 3F6XA 4GYGA 5E8VA 2WOUA 2EB2A 4JBQA 4M97A 4BGGA 3LKMA 1WZYA 3TEIA 1Q3DA 2IW6A 3OOGA 3IDPA 3AGMA 3DBQA 3IDCA 3QQUA 3QD0A 4FKTA 5AJQA 5FXSA 4O7NA 2AQXA 3F5PA 2NO3A 4GYIA 5BUIA 5HICA 3Q96A 4ZTNA 5IKWA 2V22A 3ORIA 1VYWA 1JSUA 3P9JA 4EORA 4EH7A 2QURA 4A4XA 4C3RA 2R3HA 2J0LA 3BHTA 3BYUA 1GZOA 4ZTQA 2EU9A 3HLLA 4OTDA 2GTNA 4C3PA 5IA4A 3KL8A 3HYHA 3QZHA 3BE2A 2HZ0A 4YZNA 5ANKA 2ZMDA 3GCSA 4V0GB 4N0SA 3MH0A 1M17A 2JIUA 5ANIA 4CLIA 3C4EA 4FKIA 2GNLA 4RIYB 3DLZA 4LV8A 3L8VA 5E8WA 3VW6A 4V04A 5ETAA 3NVKI 5F4NA 3AOXA 4F1MA 3D94A 4AN2A 4U42A 2GDOA 2C68A 3S3IA 4ZY4A 5A54A 3U6HA 2YDKA 1QCFA 3QZGA 2QKRA 4JNWA 4TY1A 4D2TA 4C8BA 4FUYA 2YZAA 5CU4A 5GZ9A 3ZSIA 3AGLA 2EVAA 3DBDA 3AMYA 3PDTA 4OLIA 2JEDA 4FIEA 4FIHA 5ETFA 4TNBA 2BCJA 3C4CA 3MESA 2CDZA 1GNGA 2P4IA 3BE9A 2YABA 5KMIA 4AT3A 3QCYA 3VS5A 2YLEA 4IIRA 4AUAA 3VONA 2Q0NA 3IGGA 3SG8A 3LFAA 3RM6A 1OGUA 2XNNA 1L3RE 3OCTA 4NT4A 5HE2A 2FSTX 4EOIA 3FJQE 3DZQA 3E3PA 3OXTA 4A9TA 1KE9A 1REKA 4FOBA 4C4GA 3IS5A 2FSMX 3E62A 3V8TA 4DYMA 1YRPA 2Y4IB 3EB0A 2Y4IC 4RJ8A 3ZLWA 3DFAA 4AOIA 4RFMA 5IA5A 4M67A 4P90A 3OOMA 3SLSA 3COKA 4F6SA 3LMGA 5JGAA 1KOBA 3HV5A 5DG5A 4BCMA 5J9ZA 5TT7A 4S32A 4YGAA 4NFMA 3R83A 2PMOX 2JDVA 2PVRA 3NYVA 4PV0A 3CE3A 4EQUA 1PKDA 1Q97A 2YM5A 4PDPA 4KIPA 1FOTA 3QCQA 2PUUA 3KF7A 3NZ0A 3O8UA 3PRIA 1URCA 4BBFA 3LJ1A 4CFUA 5C27A 3NNWA 2XKCA 1H0WA 1RE8A 4EOLA 5LVPA 3LVPA 2JIIA 1DAWA 3OUKA 4H1JA 5EM8A 4CZTA 4EC9A 4RJ4A 5IDNA 5DHJA 3S2PA 5FXQA 4ACCA 4IAIA 4AAYA 4NCTA 5KZIA 1ZYLA 5JGBA 1GZ8A 3GFEA 4L9IA 3ZBXA 3HECA 2HIWA 4GG5A 3UIMA 2XK3A 4ZSJA 1IAJA 1OKZA 4FNZA 4EOQA 1SNXA 1JQHA 1HOWA 4D2WA 4DGLC 5DVRA 3A8WA 2OXXA 4WNOA 4F0IA 5EOLA 2NRYA 4EK8A 1O6LA 4MCVA 3KRRA 2W5AA 3P78A 2VNYA 5C01A 5HD4A 5LVMA 1IR3A 1OL7A 1VJYA 2PVFA 3G6GA 3KRLA 5IDPA 3O51A 4ZSAA 3LMHA 5M4IA 5CNOA 5CAQA 3PFYA 5DFPA 1JNKA 3E87A 3EYHA 4RIOA 3I7BA 4IB5A 4OTWA 3V5LA 3FZRA 1YI4A 4Q2AA 4QTBA 4QP4A 4BDHA 3ML1A 2F7EE 1PXIA 4DGMA 2Y7JA 1ZOHA 4NIFA 4W4XA 2G15A 4FT0A 1YQJA 5DMZA 3C7QA 5G1XA 4O1PA 3EQGA 4F1OA 1OGYA 1TQMA 4I5PA 4F0FA 2XNEA 3WI6A 4GFGA 2XANA 4O38A 2Z7SA 3QF9A 4TT7A 3ET7A 5D10A 4EK6A 2QOBA 4KS8A 5F94A 5BX0A 4FSRA 1SYKA 2X0OA 3R28A 4M13A 2RGPA 4S2ZA 5EI8A 4CFMA 2J0MB 3IW6A 5HNIX 4G1WA 5M57A 4G6OA 2E9UA 4PPCA 3KIOC 3UIXA 4LMUA 4XG9A 5DR2A 4CV8A 2WB8A 5D7AA 2XALA 4JG8A 3BV3A 1FINA 3T8OA 4KAOA 1YW2A 1G8JA 3NFFB 2VX3A 5CXZA 5CTPA 4EHZA 2VTHA 5KE0A 3PFQA 5K9IA 1LEZA 2UW9A 4HOKA 4FG7A 1PMNA 4Y85A 3BYOA 1Q4LA 2WHBA 2B55A 4I0TA 3ULZA 4EQCA 4KIKB 4YJPA 5FEDA 4JJRA 1UA2A 4JBVA 2IN6A 5TKDA 3W8LA 3QCSA 4UMUA 4OBQA 3KCFA 5DT0A 3EQDA 4AE9A 5HX8A 3SW4A 4BI1A 2HK5A 3UDBA 4EH8A 3R22A 4QQCA 4FEQA 4JI9A 4F9CA 3FL5A 3QD4A 1WCCA 3H9RA 1Q61A 4JQEA 4BIEA 1TZDA 4AZTA 3ACJA 4FV3A 2YM3A 4RQVA 3MB7A 4X3FB 4X3FC 3TUDA 5IUGA 2OZAB 3OY3A 5H8EA 3UO6A 4DFNA 4FZAB 2UVYA 3R9RA 2R3OA 2YDIA 4ONAA 4UV0A 4E8AA 3VO3A 5CI7A 3UMXA 1OMWA 4G5PA 5DRBA 1UVRA 2QC6A 3BLHA 5CQWA 4R77A 3U9NA 4X2FA 4B6LA 4BTJA 4BDDA 4WRSA 3TZ9A 4FTNA 3D15A 3NIZA 3P23A 3D5UA 3H9FA 5EQEA 2W17A 2JDOA 2XJ1A 4RWLA 3KULA 2GNHA 5E8YA 5BMSA 1OI9A 1JKSA 5IA1A 3LFQA 4YC3A 3KK8A 2VWWA 4RJ5A 2Z7QA 3W0PA 4UWBA 4F7JA 2W9FB 3PUPA 4GJ3A 4RG0A 4U8ZA 3UE4A 3V8WA 2UW6A 4CT2A 5CF6A 1OKWA 2FO0A 2HOGA 4BDCA 3A4OX 3OHTA 3PVGA 2ACXA 2XH5A 3K3JA 5JRQA 4Y95A 4D4YA 4KBKA 5H9BA 4D28A 2LAVA 2F2CB 4M66A 1Q8ZA 2JAMA 2PZYA 2VO0A 2WTWA 3KFAA 4DHFA 3WOWA 3F3TA 4U5JA 2GNJA 3I5NA 4G31A 3NVMB 4YJRA 4GL9A 4J99A 3VRZA 3NW7A 4IM2A 5AUYA 4FZ7A 2I1MA 3RAKA 4ANNA 4V01A 4CFWA 4JDHA 3BU5A 5C9CA 4J1RA 4G3FA 4LDTA 4IJPA 4O4CA 3DY7A 3ZXTA 2X8IA 3GC9A 4FEVA 2ZMCA 2BTSA 4CMOA 3OW4A 4BIBA 3CSVA 5AP4A 2BKKA 4F7SA 2IVUA 3TN8A 2PVLA 3QZIA 4BDKA 3HRBA 4XMOA 1W8CA 3IW5A 3UOHA 3P08A 4BHNA 3Q9ZA 4UXQA 1R78A 2BR1A 2B7AA 1XWSA 2ZDUA 3FLQA 3FLWA 2BUJA 3ALOA 3R9HA 2QO7A 4FUXA 4FEUA 5G6VA 3UQCA 3DNDA 1NY3A 3ZEWA 4CCBA 3BL9A 4XNEA 3IGOA 2Z7RA 2YERA 3TDWA 3S4QA 1A9UA 1YI3A 3FV8A 5DNRA 4C02A 4G17A 5K5NA 3IOPA 3FMHA 4NUSA 3I81A 4YHTA 3SKCA 5IG1A 1J3HA 3E64A 4FIJA 4YNOA 4USDA 4BI2A 4OAVB 4BKZA 4X21A 3O96A 2QHMA 1YOLA 3FKLA 1S9JA 3CLYA 3LFNA 2B9FA 3NAYA 3QC9A 5JQ5A 5F9EA 4GIHA 2Z2WA 3FMEA 4EH2A 4P2KA 3FC2A 2XCKA 4P7EA 4WKQA 3ELJA 2QG7A 1NW1A 2OJJA 4YHJA 3R01A 2QODA 1XH9A 3MH1A 5DYJA 2QOHA 3KRJA 3OWKA 3P86A 4OW8A 3IOKA 4C2VA 2EXCX 1OBGA 2YN8A 4NM5A 5M4CA 4AXFA 3DJ6A 4FRFA 4HCTA 2NP8A 4I23A 2WGJA 3OG7A 4A06A 2XMYA 3NW6A 2OG8A 2X0QA 4HZSA 3AQVA 4LMNA 4QMUA 4RX7A 4H1MA 3COIA 5EYCA 4O84A 3LFCA 2XJ2A 4E20A 1SVGA 4O7SA 2C6LA 4FTOA 4OR5A 3SA0A 3EWHA 4D2VA 4C61A 4CKRA 4F09A 4GFMA 5HTCA 3UZRA 2R7BA 2IVSA 3MY5A 3I0QA 2GHMA 4KBAA 3ZUVA 4X2KA 1REJA 4QP6A 4U80A 4LOOA 3QTQA 4F9AA 3FSKA 2W0JA 3ZYAA 3FZ1A 4W8DA 4C36A 2XIXA 2BPMA 4TWPA 2VTRA 3RTPA 3BWFA 3U6IA 2BALA 4QPAA 4BZNA 3WZKA 2PSQA 4V0GA 3PSBA 4DH7A 4NJ3A 4E93A 5HVJA 3GNIB 4CVAA 1GZKA 3D7ZA 4RIYA 4Y73A 4FSUA 2ESMA 1J7IA 3K5UA 4YZCA 2VGPA 5IQEA 4X2GA 1KV2A 3BLQA 5HIBA 2IVVA 3SHEA 2PVNA 3EH9A 4NZWB 3RAHA 4CGAA 1UNGA 4CG9A 4HVSA 1H1SA 4U43A 3A7GA 5EW3A 2XIZA 4Y8DA 4CFXA 3D0EA 4F63A 2JITA 4QD6A 4BIDA 5FTGA 3W0MA 3C9WA 4F64A 1M7QA 2DUVA 4FK6A 2GS7A 3FLYA 3SDJA 4MHAA 3KXMA 3V51A 3VS4A 3W2SA 3BHVA 3ZSHA 3ANRA 3GOPA 4K77A 4V05A 5H8BA 3UDTA 1J1BA 3OCSA 2BIYA 1BMKA 2PVYA 3F82A 2VWZA 3FKNA 4QMPA 4O0VA 2QOQA 3FKOA 4HPUE 4O7TA 2WZJA 3FDNA 5CVGA 3QQGA 2WU7A 3FQEA 4EWHA 3HMIA 5EK7A 3MN3A 2OW3A 5LCKA 3S0OA 3DBFA 3A4PA 2BHHA 3F66A 3PY0A 3PZEA 3UYTA 1F0QA 4NSTA 4XV1A 3AKJA 3GCQA 4FTJA 5L2IA 2XNMA 3TMOA 3MB6A 4BDIA 3KU2A 5D41A 4DEHA 2CGWA 3TKIA 2ITZA 2GHLA 3HV4A 4OTPA 3U87A 2W1ZA 1STCE 3NDMA 5CZIA 3F7WA 3BLRA 4ZY5A 3G0EA 2PVHA 1M2RA 2WMAA 3H30A 3L9NA 3O2MA 4Q5EA 4QMSA 4X2NA 3KXXA 3RVGA 3VQUA 4UB7A 4MD8E 2FSLX 5HLNA 4II5A 3OC1A 5B2MA 4JXFA 4M69B 3TYKA 2XYUA 2Z8CA 4FV8A 1BLXA 4MH7A 3TNPC 3GU6A 5FQDC 3UJGA 4OTHA 5IU2A 2VTJA 3HMOA 1JLUE 5IUHA 5BVNA 5DE2A 1EH4A 1GAGA 1PY5A 2FA2A 4IFCA 4XLVA 3THBA 4BCHA 4AZFA 1W84A 3UYSA 4LGDA 4RVLA 3FHIA 4B8LA 2JIVA 1Q3WA 3QFVA 4FV5A 4S34A 3TNIA 4P4CA 4MWHA 1FVTA 3D14A 5KBRA 3C0HA 4O0YA 3ODYX 4C38A 4DG2E 4FKLA 4FKWA 3FMMA 5CAUA 2IZUA 3CXWA 4NM3A 5JN2A 1DM2A 4GVAA 4YSMA 3Q9YA 3TDVA 2CNVA 4E4XA 5C26A 3OFMA 4I6BA 4UN0C 3A7IA 1XQZA 3QX2A 4AA4A 3UDZA 4F7LA 4AXCA 4JG6A 4FTLA 4MX9A 3I4BA 1H8FA 4RVTA 1XBAA 4I6HA 3QA0A 1V0PA 3MFTA 3R1SA 3F9NA 3FL4A 3NIEA 2E9PA 1M52A 2KTYA 4RBLA 3KRXA 2WOTA 3WZUA 5AR7A 2X2LA 4L8MA 1A06A 3ZEPA 3HMMA 3H10A 5E4HA 4I5MA 4D0WA 3PJ2A 2BRMA 5KMOA 2G2IA 4MBIA 1YXTA 4QPMA 4CLJA 2WMQA 4AG8A 4MYGA 2J5FA 1NVRA 2PE1A 3FC1X 3KN5A 4IXPA 2GQSA 3N4UA 1ZARA 2X6DA 3W2OA 4FTUA 2PUPA 5HO7A 3GVUA 2ZOQA 3EQBA 4J8NA 4O0TA 4MKCA 4RX9A 5AUVA 3ZTXA 4AOJA 4XRLA 4M14A 4GSBA 3PY3A 2OLCA 4L00A 4MBLA 2WQEA 3RHXA 2JDTA 2XKEA 2CNUA 5DBXA 4O91A 2WTJA 3W0SA 3EQHA 5CEQA 3HVCA 4EH4A 5IQBA 2W05A 5HG8A 2DYLA 3CQUA 3C4ZA 4XH6A 3PXKA 2XNPA 4D4VA 2KULA 1Z57A 1OKVA 5E1EA 2R2PA 4LOPA 2QNJA 4K6ZA 3UZPA 5LMKC 4YNEA 5ANJA 3SV0A 4PY1A 2I40A 3LXKA 5CSWA 4U7ZA 4KIKA 4KIOA 4RC3A 3UG2A 3KY2A 4LGGA 4ZS0A 2O2UA 2X81A 4FA2A 1H00A 3RCJA 4UY9A 4ASZA 3GCVA 1BYGA 3O23A 4CRLA 3EN4A 3FI4A 4OTIA 2F7ZE 2ITQA 2WMWA 3GP0A 4PL4A 2FSOX 4CZYB 4D0XA 3ROCA 5K5XA 5I3OA 3AD5A 1K2PA 3DB8A 4GT5A 4OBOA 3W1FA 3C0GA 4O7YA 4F7NA 1QMZA 4FODA 4EZ7A 5CF8A 1RW8A 3WZJA 4HJOA 3WZEA 3MJ2A 2X39A 4GUEA 3DS6A 4JBPA 4U44A 1OL2A 4X3FA 4ACHA 2R9SA 5EDPA 2C0TA 2OZAA 4APPA