4Q5QA

Crystal structure of the glutathione s-transferase der p 8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
SQPILGYWDIRGYAQPIRLLLTYSGVDFVDKRYQIGPAPDFDRSEWLNEKFNLGLDFPNLPYYIDGDMKMTQTFAILRYLGRKYKLNGSNDHEEIRISMAEQQTEDMMAAMIRVCYDANCDKLKPDYLKSLPDCLKLMSKFVGEHAFIAGANISYVDFNLYEYLCHVKVMVPEVFGQFENLKRYVERMESLPRVSDYIKKQQPKTFNAPTSKWNASYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal Structure of the Glutathione S-transferase Der p 8
rcsb
source organism Dermatophagoides pteronyssinus
molecule tags Transferase
total genus 79
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4q5qA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4q5qA01
1F3BA 2PMTA 2VD1A 3OR5A 3VK9A 2R2JA 3HJPA 3TJBA 4ZB9A 2L4CA 2A2SA 5DQYA 3P90A 2OE3A 4NXIA 1F37A 3ZL5A 2CT6A 2LQOA 3NOFA 1QXHA 2X64A 4K7NA 4L5OA 2C3TA 3I69A 4FYCA 4K0NA 3ED3A 1PKWA 2LQQA 2H75A 5H5QA 3GX8A 3CBUA 3GTUA 1WPIA 3O3TA 1TK5B 3F0IA 2YP6A 3FRCA 4RI6A 3F6FA 2DJJA 1O73A 4WEYA 1MD4A 3WT2A 1W4VA 2CVBA 3VWVA 2IL3A 4TN8A 1A2MA 3QR6A 2R6KA 4MH2A 4YAPA 3GKXA 1WP0A 3C1RA 5B8AA 2FA4A 3WGXA 3ISOA 3TKSC 3GNJA 3GKNA 4HS1A 1T4YA 4AJ7A 1PL2A 3M3MA 19GSA 4XTSA 4N10A 4KB3A 5DALA 4BA7A 2CA8A 1GP1A 4MP4A 1XWCA 3IC8A 1X0RA 4ZBBA 4WBJA 3D4MA 5D8IA 2L6CA 1B9XC 14GSA 2VLTA 3DVXA 5IOXA 3J7Yb 4XS1A 5GZZB 4MMMA 4IJ3A 3ZTLA 1PX6A 2HQTA 1O8WA 1SKSB 4NAXA 2YWNA 2IWTA 4ECBA 1XWBA 1K3LA 1WWJA 3WD6A 1TP9A 3GL3A 1H4OA 3TRXA 1GSFA 3TKSE 1LU4A 4IVFA 1HD2A 3FW2A 1ACVA 1SENA 4MJBA 1K0CA 1JZOA 5ECNB 3HJOA 4IP1A 2K18A 3H8QA 1UA5A 1T3BA 4L0UA 1X5DA 4IHUA 2YANA 4FYBA 3TJJA 4BWQA 5EVOA 4F0CA 5H5RA 3GSTA 2B7JA 2CAQA 3BJ5A 2R37A 3GMFA 4V2NA 3UOMA 5CO3A 1OC9A 2BJXA 6GSSA 5HFGA 2YWIA 5ID2B 1ZOFA 2EIQA 3V1WA 5ECMB 3PINA 1OKTA 1R5AA 3LEFA 4JBBA 2VCQA 4PURA 2H70A 4JR4A 1EEMA 3EWLA 4ID0A 3A5WA 5G1KA 2GT6A 1T1VA 1VF2A 1ZZYA 5LCZA 3FZ4A 2GZPA 1I5GA 3R2QA 3VWUA 2HZFA 2EC4A 5D96A 1GNWA 1SJIA 3QFBC 2WB9A 4MPFA 5ECQB 4CDOA 2HZEA 3RAZA 1B4QA 2H76A 2DJ1A 4MF5A 5D9XA 16GSA 3ZYWA 4TOPA 4JE1A 1AW9A 2PBJA 3I6AA 5DCHA 2LNSA 1E6BA 5ELAA 3ZLPA 3ZMLA 1U3IA 1TRUA 2IMDA 1B8XA 2WS2A 1X5EA 2LUSA 2NBSA 2GLRA 4TR1A 4OMVA 3O6TA 1TRWA 2HRKB 2HRFA 1GUKA 5A4VA 1SK2A 3UBLA 3EMPA 1FG4A 2REMA 3A2VA 1WJKA 2TRCP 4KCEA 2ON5A 2VL9A 18GSA 1ZGNA 3BCKA 2DC5A 2RUFA 2MMOA 4FH8A 4DSSB 2YZUA 4IKHA 2MBSA 3GSSA 2FLSA 3FY7A 2GSSA 4WETA 1GTBA 3TKPA 3A3TA 1O6JA 2GGTA 1GH2A 1THOA 2VCTA 2UZ8A 1XOAA 2GT5A 2RLIA 2C1YA 1K0MA 2DIZA 4KW6A 1K3OA 3UARA 1XVQA 5HR2A 5CYYA 3W8JA 2LKUA 2LTKA 5ENUA 2LJAA 4POMA 4OD7A 1KNGA 1XOBA 2GZZA 2HI7A 5HR1A 12GSA 3F6DA 5FT3A 4J56E 3GL5A 3FZ5A 4KX4A 1WIKA 1PD21 1U3AA 2LNTA 4GQFA 1TU8A 4GWRA 4USSA 4LL1B 4DVCA 5IMDA 4EDZA 1BX9A 5DAKA 1OKDA 5IMCA 2HSMB 3O76A 4G0KA 4V1Ap 3BBYA 4PUFC 4MZBA 3H4KA 4F0BA 3EE2A 4KSOA 4FYUA 1T4ZA 2H74A 4JRRA 4ULXA 2PVOC 4NHWA 4HU9A 3APSA 2C0EA 1PL1A 1Y6EA 2HT9A 1GRXA 5LD0A 3HDCA 5IIZA 3C1SA 2GQMA 2F8FA 1USBA 3KZQA 1Z7RA 3IPZA 4POBA 2LRNA 3GKMA 2HXKA 4GCIA 1TI1A 1GULA 1A8YA 1SJ6A 4JU5A 3KD0A 4MF7A 1NM3A 2V41A 1GSEA 4YQMA 1AUCA 4OWYA 4ML6A 3DKSA 1WOUA 2VOCA 1BEDA 1RQMA 1ON4A 3QD9A 4AJ6A 3P2AA 2L4QA 1A24A 2R3XA 4NV5A 3VI7A 3TOTA 4ZIJA 4JEDA 3Q6OA 4BPYA 3F63A 1GSUA 4XIHA 3GV1A 5JCWA 5HR3A 3L78A 1OE8A 2VO4A 4ZB8A 4LA1A 2H1BA 2CVKA 2KOKA 1Z5YE 5IQYA 5D73A 4GSTA 3UVHA 4IN0A 2I81A 2C8UA 4L5LA 2P31A 5JWOB 3HA9A 1RK4A 1JLWA 4I2UA 3GFKA 5JCGA 3ZZXA 1UN2A 2GS3A 3CSJA 2L6DA 4KDUA 2H0IA 3W8SA 2LJKA 4RQRA 4O5RA 4XHMA 3DGQA 5AGYA 3ZRDA 5ECOB 2C0DA 2VL2A 1QK8A 3UVTA 4RI7A 4HEA2 1M2DA 1GL8A 5F0GA 2JZRA 4KH7A 2OJLA 3KMNA 3IOSA 1UVZA 3FR6A 1R26A 1ERVA 1XW6A 4NMUA 3IAS2 2CX3A 1IYHA 5DQSA 4OO4A 1ZL9A 2H71A 2B1LA 1OC3A 6GSXA 2RM5A 1AQVA 1EWXA 3GHAA 2N5AA 4IW9A 2IMKA 3U6VA 4ML1A 4GQCA 3KXOA 1DE2A 3KTBA 2R5GA 3D21A 4BVYB 1AXDA 2MMZA 3QAGA 1R5PA 4EDYA 1JZDA 2XBQA 5IM9A 3WGDA 2A2RA 2GZYA 4V1Ag 2XBIA 2ZCTA 3VWWA 3W6GA 4ISDA 3GURA 1HQOA 4K0GA 3H1NA 2QKEA 5B6MA 4MLYA 4G9HA 4PNFA 5GAPD 3LXTA 9GSSA 3GH6A 5G30A 4BWSA 1ERTA 1TTZA 3ZREA 3TUEA 2OACA 2RUEA 1PSQA 2B5YA 1Z3EA 5AN1A 3QAVA 4HQZA 1T8EB 1EEJA 5FHIA 2K8VA 1SU9A 4G0LA 4LL4B 2JL4A 2JZSA 2QC7A 2F3MA 1K0AA 5KN3A 3VFIA 6GSWA 2YNXA 3LFLA 1WE0A 4RUVA 5AIVA 3CTGA 1A0FA 3LYKA 2H19A 2P5RA 3L9SA 6GSVA 2FCHA 2O87A 7GSSA 4IBPA 3LQ7A 4EXJA 1PA3A 2I1UA 3TJGA 4F03A 2LRCA 1B9YC 3ERGA 1EV4A 3I43A 4AGSA 2J23A 1K0OA 2H1AA 3CTFA 2F51A 4G19A 4XS4B 4F2IA 2C4JA 1BG5A 4E8HA 8GSSA 2BTOT 1SKRB 3L0HA 1XVWA 4BL7A 3QMXA 5HR0A 3IR4A 4Q5RA 2KP2A 2IPAA 3CRUA 3DIEA 4IS0A 1B4PA 1X5CA 2FUG2 4I5QA 3L4NA 2J9HA 2PVQA 4LLRA 2HNLA 1XWAA 5B6NA 1JHBA 1GSDA 3CMIA 1PQNA 4D73A 5KN1A 1TK8B 4XRDA 1QMVA 5EY6A 3M9JA 5DBQA 4GTUA 3ERWA 3KP8A 3M9KA 3MDKA 2MMNA 1G0TA 6GSTA 4N0ZA 3E3EA 4RQXA 1IYIA 4ZBAA 2M46A 1SL1B 3DMLA 3C73A 2FHEA 4TXOA 2XC2A 1K0BA 1V58A 3QFAC 2FY6A 4Q5NA 4ZBDA 2WRTA 1S3CA 4TXVA 3G7YA 2O7KA 1XIYA 1YF0A 3Q18A 1BAYA 1YZXA 2FA8A 3L9VA 5G2ZA 2A4VA 3PR8A 3UBKA 3LWAA 1Z6NA 3QDNA 1OVNA 3TRQA 4LMVA 4EO3A 4ECJA 4HJ2A 4KGIA 1E2YA 2GTUA 2V32A 1THXA 4KNDA 4PQIA 3ZMKA 3TDGA 1NHYA 4J2FA 5G1LA 3F3RA 4POLA 1A2JA 4WBRD 3D4TA 1PGTA 4I2TA 1B48A 5CRGA 2IFQA 4HOJA 3GKKA 1YKAA 2L59A 5INYA 3TOUA 2MMAA 2I9HA 3IC4A 4O92A 3U5RE 3EVIA 3GTUB 3HD5A 2CV4A 3A2XA 1N2AA 3FKFA 2VLVA 1TKDB 5KN2A 2AV4A 1M99A 2GDRA 4GSSA 1SKWB 2F8AA 2PU9C 2N5BA 2VM1A 5J4UA 2O8VB 1Q4JA 1URMA 4TR4A 5G5EA 2GSRA 4TW5A 2FNOA 2ALBA 5DALB 4MZCA 1HNCA 5IMVA 1YY7A 1EP7A 2XHFA 1X9MB 4MA9A 2JU5A 3KH7A 3HVSA 4KUNA 2K8SA 1WRYA 3J7Yk 1ILOA 1FHEA 5F07A 3K8NA 3LSZA 2WULA 1DE1A 3GIXA 3F4RA 2DJ0A 3DRNA 2WDUA 1GWCA 1G6WA 2IMIA 3LYPA 2CVDA 1F6MC 2VCWA 1Q98A 1J08A 4X1UA 3CYNA 2PN8A 1TW9A 5G5FA 5IO2A 4F9ZA 4ECCA 5ECHB 3H79A 1FVJA 2Z9SA 3HJMA 2VUPA 4MH3A 3E9JB 4HQSA 3KIJA 3ZIVA 22GSA 1XCCA 5ECIB 2H66A 2EIOA 1AAZA 4I6XA 3US3A 4GXZA 5D9WA 2VLUA 1LJRA 4IJIA 4PNGA 1XBSA 3TKQA 2HYXA 2BMXA 1YF1A 1G7OA 3ZVJA 4L0WA 2I3YA 4K6XA 3P7XA 2CZ2A 1K0NA 1T7PB 3CXGA 5DJLA 2AJQB 1OC9B 3HVXA 3UEMA 1M2BA 1CQGA 1CQHA 2DJKA 4JZQA 2V2GA 4DSRA 1VF3A 2AAWA 2GQKA 1U87A 1XZOA 1XPVA 3EU4A 1R7HA 4BVXA 5CREA 3TKRA 3FK8A 2PGTA 3FZAA 1HYUA 1TRVA 6GSYA 4PGTA 1H75A 2DSAA 4QL7A 5CRDA 2DBCA 5E59A 3M1GA 4P3YB 2GSTA 2P5QA 3ME8A 3R3EA 1KBNA 3L9UA 3BCIA 1U6TA 4L8EA 4GF0A 4AJ8A 1QUWA 3EYTA 1M7TA 5A5KA 2VCZA 1PX7A 2FWFA 1V40A 2HZEB 2JACA 2E2GA 2AHEA 5L71A 5IPGA 2E0QA 2V1MA 5ELGA 3HZ4A 2LSTA 2CX4A 3UIWA 1W89A 1SK1A 2K6VA 4ZILA 4MJEA 2IIYA 3FYGA 1YEXA 2H6ZA 4EKZA 4TR1B 3FHKA 3TGZA 1F2EA 2PPTA 5G31A 4GLTA 1VRSD 3IRAA 4WR4A 3E0UA 2LEGA 2VAFA 2GVPA 5EPFA 2OKAA 2H8LA 1TXXA 3FR3A 4ZXGA 5KN0A 2X8CA 2MBTA 4TVEA 3TRPA 5GAND 4MZWA 4MABA 3KM6A 3ME7A 4CHSA 4K1FA 1X9SB 5BMUA 3VWXA 2FWEA 2N5FA 4K8MA 1J9BA 2G0FA 4ZL7A 1GTUA 4ZL8A 3SWLA 3UAPA 3RPNA 5DJMA 2V6KA 3HZ8A 2LRTA 1OE7A 1X9WB 1XW5A 3G7IA 3RDWA 1G7EA 4KSMA 1DUGA 2KLXA 4E8EA 2YWMA 5DAKB 3TKSA 4IQ1A 3QOUA 2DJ2A 1BJXA 3MSZA 2C80A 4WF5A 1NSWA 5IMAA 2F9SA 1YDKA 4NHZA 1V57A 4H86A 4J57E 1GUMA 3WYWA 3ZFBA 3LG6A 2HFDA 4HDEA 3CSIA 3ERFA 2WZ9A 2IMFA 5AIXA 2FWGA 1YKCA 1SYRA 5F05A 2DMLA 1EGOA 2B5EA 4KA0A 5E4WA 1PKZA 3KH9A 1O81A 4TRXA 2ES7A 1O8XA 4Q5QA 2AYTA 4EVMA 4WXTA 2XPEA 4G2EA 3VLNA 1PMTA 1AQXA 3I9V2 2L5LA 4MDCA 1I9DA 2QSIA 4MJCA 5IMZA 2O89A 5JCUA 1ABAA 2AB6A 3IA1A 2K9FA 2OBIA 1ML6A 2PERA 1AQWA 2JZTA 5ECRB 1EP8A 3IAM2 1WMJA 5J9CA 5ID2A 1FW1A 2WCIA 4GSNA 3RHCA 5D93A 2CAIA 2VM2A 4KAEA 1ZCPA 3BD2A 4HI7A 2B5XA 3M8NA 1VGLA 1F3AA 5ECKB 3NZNA 3HHVA 4HZ2A 1BYEA 2VL2C 20GSA 4WKWA 3SBCA 4PXOA 3TJKA 1MDIA 4PQHA 3C7MA 3GYKA 3F4TA 2JSYA 5HQPA 5J5NA 5IMFA 2YV9A 3CSHA 3IBHA 2IN3A 1O7UA 3FZ9A 1FB0A 2PWJA 4KCAA 2RM6A 3LORA 2YZHA 1TDIA 1ZMAA 1O85A 3EMXA 3APOA 1QGVA 4HJMA 4KF9A 3GUSA 5ECLB 4Q5FA 1DSBA 4K2DA 3F3QA 4MJAA 1GLQA 2OBKA 2CQ9A 1T00A 3HYPA 3IK9A 2C0FA 5LNKe 3KEBA 3PPUA 2GQLA 2HRKA 2H1GA 4V2LA 2I4AA 3P8WA 1OYJA 1PRXA 1Z7PA 3TB2A 2C0GA 1TU7A 1XWGA 2H30A 4DSSA 2LJRA 4HUAA 5F06A 4OCEA 1S3AA 4K7IA 3MWHA 3ZITA 5FWGA 3QAWA 1ST9A 3HXSA 4WF4A 1XW9A 2HRAA 2HRNA 1Y25A 1KEBA 1HNBA 1EOGA 4YAVA 1K0DA 2C3NA 3CRTA 2LV3A 5HFKA 5CRHA 3VPTA 2YPMA 4MF6A 4OFMA 2H1DA 5GSSA 2KUCA 2B7KA 3APQA 4YH2A 3D5JA 5CP1A 4YQUA 3DXBA 3N5OA 1A2LA 1MTCA 4K7OA 5A4UA 1XWKA 1ERWA 1HNAA 1SJZA 3RPPA 3QPMA 2DIYA 1OC8A 3IK7A 4XRAA 2VD0A 4MCUA 2E2MA 4FQUA 2H72A 4ACSA 2IJYA 2V6OA 1V2AA 2LS5A 2ON7A 2HSMA 3HCZA 1QQ2A 1ZYQB 1SL0B 3S9FA 1M9BA 5H5SA 1V9WA 2X99A 2TIRA 5IOWA 1NW2A 4PTSA 4WR5A 1SD9A 1GSSA 2YJHA 4PUAA 1SL2B 3PGTA 2YCDA 2RIIA 3EU3A 2EIRA 4HZ4A 1K3YA 4KE3A 4CW9A 5ECSA 4Z7XA 1TOFA 3AY8A 2VCXA 2YOIA 3HY2A 5IO0A 5GSTA 5CRWA 4BL7B 3TCOA 2E7PA 3KCMA 1RW1A 3IE3A 1JFUA 5IPHA 3KTLA 5D9VA 5HFIA 2FWHA 2JADA 4OFNA 1UC7A 1GSYA 1XFLA 1EOHA 2OA7A 4D73B 4X0XA 2KP1A 3MNGA 3GRXA 4N11A 2X8HA 2HSHA 3BOAA 5DVBA 3D0ZA 1AC1A 2WJUA 1EGRA 3C8EA 2DJ3A 4TXOB 1MD3A 1YQ1A 1GTIA 1SYXA 1TI3A 2VL3A 2VIMA 3LJRA 3WT1A 1OAZA 2P0GA 3LXZA 1GLPA 1NHOA 17GSA 4G10A 4XS6A 4EF0A 2L5OA 3KMOA 2MZCA 3EURA 5CNWA 6GSUA 1AIUA 1QFNA 2ZUPA 1SK0A 1MEKA 2JSZA 4TKYA 3HKRA 5EL8A 4I97A 3QCPA 1TK0B 1FAAA 5KEJA 1M2AA 3LGCA 4PQ1A 2YJ7A 2HLSA 1F9MA 5JWQB 3RBTA 4ZB6A 3IV4A 2NDOA 10GSA 4MPGA 3D22A 5J41A 2PUKC 5COHA 1JZWA 4GRFA 3VURA 4G0IA 4O7HA 2FGXA 2IFQB 5J3RA 4IP6A 5J9BA 1M9AA 1TRSA 2B6MA 5B8BA 4XCSA 4ZL9A 5JWRB 1SD8A 1ERUA 1A0RP 2AUVA 3A2WA 2OE0A 3DWVA 3MAKA 2C3QA 1TJDA 4N30A 3WGEA 3C71A 5D9TA 4BVYA 3HVVA 2YWOA 1GUHA 3IXRA 2X8GA 5CAXA 2H0GA 4YQVA 3NIVA 1N8JA 3KP9A 1KTEA 4TR3A 2R4VA 5DCGA 4V2MA 2L57A 3DVWA 3UL3A 1GSQA 1VF1A 2WFCA 5ECPB 4LMWA 1C72A 1XXUA 4KDYA 2QGVA 3UJ1A 3Q74A 5C04A 2B1KA 2GSQA 1EZKA 2B3SA 1FVKA 5B7CA 4OO5A 2NVLA 3G7JA 3F9UA 3UMAA 4MK3A 2M72A 3KJYA 3IHQA 1A23A 1GNEA 2HSYA 3GH9A 5A4WA 3GA4A 3EINA 3D6IA 1U88A 2ZNMA 4QQ7A 3ZIJA 1J0FA 1VF4A 4NPBA 3IDVA 2DLXA 2YN1A 1DBYA 3F8UA 2NPBA 2H0HA 4QL9A 4EUYA 1YJ6A 11GSA 3ZVJD 3Q19A 1S3DA 1JLVA 1JZRA 2FD3A 1BQ7A 5DDLA 2CZ3A 2D2ZA 4EC0A 2OE1A 4I8BA 1Z6MA 3DYRA 4OFTA 2IMEA 4EE0A 1ZYEA 4XS4A 4IELA 1FOVA 3DEXA 2H6YA 3KGKA 1PN9A 2XPDA 4AF2A 4NWYA 2O85A 5C00A 3N9JA 3DD3A 4DSQA 4TR0A 2VCVA 2TRXA 4POKA 3VI5A 2HE3A 2DMMA 4ILFA 2YV7A 3GN3A 4IQAA 1FB6A 4N0VA 4BVXB 2H01A 5ABRA 1A8LA 2HSNB 2NTOA 3GX0A 13GSA 1MDKA 2KHPA 4HU7A 1EV9A 2MYGA 3H93A 4IGJA 4PX1A 2M80A 4JR6A 2WGRA 3JCML 4OCFA 1G6YA 1Z9HA 2H6XA 3F4SA 2H73A 4FO5A 1GTAA 3PH9A 3EC3A 4F82A 1FO5A 4DEJA 4X43A 3RHBA 1YEPA 5AISA 3G9BA 2OADA 4NV2A 4FIWA 3FEUA 4KDXA 1R4WA 3M0FA 1MDJA 1V98A 5F8BA 3VPQA 2G2QA 1M0UA 4EL1A 3FR9A 4ECIA 4K9ZA 3ZFLA 1LBKA 3TJFA 4O32A
chains in the Genus database with same CATH superfamily
1F3BA 4CY6A 2PMTA 2O5VA 2VD1A 3OR5A 3VK9A 2R2JA 3HJPA 3TJBA 4ZB9A 2L4CA 2A2SA 5DQYA 3P90A 2OE3A 4NXIA 1F37A 3ZL5A 2QA1A 2CT6A 2LQOA 4YKGA 3NOFA 1QXHA 2X64A 4K7NA 4L5OA 4YKFA 2C3TA 3I69A 4FYCA 4K0NA 3ED3A 1PKWA 2LQQA 2H75A 5H5QA 3GX8A 3CBUA 3GTUA 1WPIA 3O3TA 1TK5B 3F0IA 2R0CA 2YP6A 3FRCA 4RI6A 3F6FA 2DJJA 1O73A 4WEYA 1MD4A 3WT2A 1W4VA 5BMUB 2CVBA 3VWVA 2IL3A 4TN8A 1A2MA 3QR6A 2R6KA 4MH2A 4YAPA 3GKXA 1WP0A 3C1RA 5B8AA 2FA4A 3WGXA 3ISOA 3TKSC 3GNJA 3GKNA 4HS1A 1T4YA 4AJ7A 1PL2A 3M3MA 19GSA 4XTSA 4Z2TA 4N10A 4KB3A 5DALA 4BA7A 2CA8A 1GP1A 4MP4A 1XWCA 3IC8A 1BG1A 1X0RA 4ZBBA 4WBJA 2A2PA 3D4MA 5D8IA 2L6CA 1B9XC 14GSA 2VLTA 3DVXA 5IOXA 3J7Yb 4Z2RA 4XS1A 5GZZB 4MMMA 4IJ3A 3ZTLA 1PX6A 2HQTA 1O8WA 1SKSB 4NAXA 2YWNA 2IWTA 4ECBA 1XWBA 1K3LA 1WWJA 2X49A 3WD6A 1TP9A 3HVNA 3GL3A 1H4OA 3TRXA 1GSFA 3IHGA 3TKSE 1LU4A 4IVFA 1HD2A 3FW2A 2OT3A 1S3RA 1N25A 1ACVA 1SENA 4MJBA 1K0CA 1JZOA 5ECNB 3HJOA 4IP1A 2K18A 3H8QA 1UA5A 1T3BA 4L0UA 1X5DA 4IHUA 2YANA 4FYBA 3TJJA 4BWQA 5EVOA 4F0CA 5H5RA 3GSTA 4AKIA 5A1NB 2B7JA 2CAQA 3BJ5A 2R37A 3GMFA 4V2NA 3UOMA 5CO3A 1OC9A 2BJXA 6GSSA 5HFGA 2YWIA 5ID2B 1ZOFA 2EIQA 3V1WA 5ECMB 3PINA 1OKTA 1R5AA 3LEFA 4JBBA 2VCQA 4PURA 2H70A 4JR4A 1EEMA 3EWLA 4ID0A 3A5WA 5G1KA 2GT6A 1T1VA 1VF2A 1ZZYA 4W66A 5LCZA 3FZ4A 2GZPA 1I5GA 3R2QA 3VWUA 2HZFA 2EC4A 5D96A 1GNWA 1SJIA 3QFBC 2WB9A 4MPFA 5ECQB 4CDOA 2HZEA 3RAZA 1B4QA 2H76A 2DJ1A 4MF5A 5D9XA 16GSA 3ZYWA 4TOPA 4JE1A 1AW9A 2PBJA 3I6AA 5DCHA 2LNSA 1E6BA 5ELAA 3ZLPA 3ZMLA 1U3IA 1TRUA 2IMDA 1B8XA 2WS2A 1X5EA 2LUSA 2NBSA 2GLRA 4TR1A 2WW3A 4OMVA 3O6TA 1TRWA 2HRKB 2HRFA 1GUKA 5A4VA 1SK2A 3UBLA 3EMPA 1FG4A 2REMA 3A2VA 1WJKA 2TRCP 4KCEA 2ON5A 2VL9A 18GSA 1ZGNA 3BCKA 2DC5A 2RUFA 2MMOA 4FH8A 4DSSB 2YZUA 4IKHA 2MBSA 3GSSA 1SVLA 2FLSA 3FY7A 2GSSA 4WETA 1GTBA 3TKPA 3A3TA 1O6JA 2GGTA 1GH2A 1THOA 2VCTA 2UZ8A 1XOAA 2GT5A 2RLIA 2C1YA 1K0MA 2DIZA 4KW6A 1K3OA 3UARA 1XVQA 5HR2A 5CYYA 3W8JA 2LKUA 2LTKA 5ENUA 2LJAA 4POMA 4OD7A 1KNGA 1XOBA 2GZZA 2HI7A 5HR1A 12GSA 3F6DA 5FT3A 4J56E 3GL5A 3FZ5A 4KX4A 1WIKA 1PD21 1U3AA 2LNTA 4GQFA 1TU8A 4GWRA 4USSA 4LL1B 4DVCA 5IMDA 4EDZA 1BX9A 5DAKA 1OKDA 5IMCA 2HSMB 3O76A 4G0KA 4V1Ap 3BBYA 4PUFC 4X4JA 4MZBA 3H4KA 4F0BA 3EE2A 4KSOA 4FYUA 1T4ZA 2H74A 4JRRA 4ULXA 2PVOC 4NHWA 4HU9A 3APSA 2C0EA 2WVZA 1PL1A 1Y6EA 2HT9A 1GRXA 5LD0A 3HDCA 5IIZA 3C1SA 2GQMA 2F8FA 1USBA 3KZQA 1Z7RA 3IPZA 4POBA 2LRNA 3GKMA 2HXKA 5BRTA 4GCIA 1TI1A 1GULA 1A8YA 1SJ6A 4JU5A 3KD0A 4MF7A 1NM3A 2V41A 4A5PA 1GSEA 4PI2C 4YQMA 1AUCA 4OWYA 4ML6A 3DKSA 1WOUA 2VOCA 1BEDA 1RQMA 1ON4A 3QD9A 4AJ6A 3P2AA 2L4QA 1A24A 2R3XA 4NV5A 3VI7A 3TOTA 4ZIJA 4JEDA 3Q6OA 4BPYA 3F63A 1GSUA 4XIHA 3GV1A 5JCWA 5HR3A 3L78A 1OE8A 2VO4A 4ZB8A 4LA1A 2H1BA 2CVKA 2KOKA 1Z5YE 5IQYA 5D73A 4GSTA 3UVHA 4IN0A 2I81A 2C8UA 4L5LA 4N3ZA 2P31A 5JWOB 3HA9A 1RK4A 1JLWA 4I2UA 5KOWA 3GFKA 5JCGA 3ZZXA 1UN2A 2GS3A 3CSJA 2L6DA 4KDUA 2H0IA 3W8SA 2LJKA 4RQRA 4O5RA 4XHMA 3DGQA 5AGYA 3ZRDA 5ECOB 2C0DA 2VL2A 1QK8A 3UVTA 4RI7A 4HEA2 1M2DA 1GL8A 5F0GA 2JZRA 4KH7A 1Y1UA 2OJLA 3KMNA 3IOSA 1UVZA 3FR6A 4GDFA 1R26A 1ERVA 1XW6A 4NMUA 2EFDA 3IAS2 2CX3A 1IYHA 5DQSA 4OO4A 2R0PA 1ZL9A 2H71A 2B1LA 1OC3A 6GSXA 2RM5A 1AQVA 1EWXA 3GHAA 2N5AA 4IW9A 2IMKA 3U6VA 4ML1A 4GQCA 3KXOA 1DE2A 3KTBA 2R5GA 3D21A 4BVYB 1AXDA 2MMZA 3QAGA 1R5PA 4EDYA 1JZDA 2XBQA 4ZB7A 5IM9A 3WGDA 2A2RA 2GZYA 4V1Ag 2XBIA 2ZCTA 5A34A 3VWWA 3W6GA 4ISDA 3GURA 1HQOA 4K0GA 3H1NA 2QKEA 5B6MA 4MLYA 4G9HA 4PNFA 5GAPD 3LXTA 9GSSA 3GH6A 2WVYA 5G30A 4BWSA 1ERTA 1TTZA 3TU3B 3ZREA 3TUEA 2OACA 2RUEA 1PSQA 2B5YA 1Z3EA 5AN1A 3QAVA 4HQZA 1T8EB 1EEJA 5FHIA 2K8VA 1SU9A 4G0LA 4LL4B 2JL4A 2JZSA 2QC7A 2F3MA 1K0AA 5KN3A 3VFIA 6GSWA 2YNXA 3LFLA 1WE0A 4RUVA 5AIVA 3CTGA 1A0FA 3LYKA 1ZYNA 2H19A 2P5RA 3L9SA 6GSVA 2FCHA 2O87A 7GSSA 4IBPA 4PI0C 3LQ7A 4EXJA 1PA3A 2I1UA 3TJGA 4F03A 2LRCA 1B9YC 3ERGA 1EV4A 3I43A 4AGSA 2J23A 1K0OA 2H1AA 3CTFA 2F51A 4G19A 2WVXB 4XS4B 4F2IA 2C4JA 1BG5A 4E8HA 8GSSA 2BTOT 1SKRB 3L0HA 1XVWA 4BL7A 3QMXA 5HR0A 3IR4A 4Q5RA 2KP2A 2IPAA 3CRUA 3DIEA 4IS0A 1B4PA 1X5CA 2FUG2 4I5QA 2PVQA 2J9HA 3L4NA 3CHXC 4LLRA 2HNLA 1XWAA 5B6NA 1JHBA 1GSDA 3CMIA 1PQNA 4D73A 5KN1A 1TK8B 4XRDA 1QMVA 2EFCA 5EY6A 3M9JA 5DBQA 4GTUA 3ERWA 3KP8A 3M9KA 3MDKA 2MMNA 1G0TA 6GSTA 4N0ZA 3E3EA 4RQXA 1IYIA 4ZBAA 2M46A 1SL1B 3DMLA 4AKXB 3C73A 2FHEA 4TXOA 2XC2A 1K0BA 1V58A 3QFAC 2FY6A 4Q5NA 4ZBDA 2WRTA 1S3CA 4TXVA 3G7YA 2O7KA 1XIYA 1YF0A 3Q18A 1BAYA 1YZXA 2FA8A 3L9VA 2O3EA 5G2ZA 2A4VA 3PR8A 3UBKA 3LWAA 1Z6NA 2VKZG 1OVNA 3QDNA 3TRQA 4LMVA 4EO3A 1YEWC 4ECJA 4HJ2A 4KGIA 1E2YA 2GTUA 2V32A 1THXA 4KNDA 4PQIA 3ZMKA 3TDGA 1NHYA 4J2FA 4E68A 5G1LA 3F3RA 4POLA 1A2JA 4WBRD 4PHZC 3D4TA 1PGTA 4I2TA 5A5HB 1B48A 5CRGA 2IFQA 4HOJA 3GKKA 1YKAA 2L59A 5INYA 3TOUA 2MMAA 2I9HA 3IC4A 4O92A 3U5RE 3EVIA 3GTUB 3HD5A 2CV4A 3A2XA 1N2AA 3FKFA 2VLVA 1TKDB 5KN2A 2AV4A 1M99A 2GDRA 4GSSA 1SKWB 2F8AA 2PU9C 2N5BA 2VM1A 5J4UA 2O8VB 1Q4JA 1URMA 4TR4A 4O5QA 5G5EA 2GSRA 4O5UA 4TW5A 2FNOA 2ALBA 5DALB 4MZCA 1HNCA 5IMVA 1YY7A 1EP7A 2XHFA 1X9MB 4MA9A 2JU5A 3KH7A 3HVSA 4KUNA 2K8SA 1WRYA 3J7Yk 2R0GA 1ILOA 1FHEA 5F07A 3K8NA 3LSZA 2WULA 1DE1A 3GIXA 3F4RA 3DRNA 2DJ0A 2WDUA 1GWCA 1G6WA 2IMIA 3LYPA 2CVDA 1F6MC 3LW9A 2VCWA 1Q98A 1J08A 4X1UA 3CYNA 2PN8A 1TW9A 5G5FA 5IO2A 4K5RA 4F9ZA 4ECCA 5ECHB 3H79A 1FVJA 2Z9SA 3HJMA 2VUPA 4MH3A 3E9JB 4HQSA 3KIJA 3ZIVA 22GSA 1XCCA 5ECIB 2H66A 2EIOA 1AAZA 4I6XA 3US3A 2EFEA 4GXZA 5D9WA 2VLUA 1LJRA 4IJIA 4PNGA 1XBSA 3TKQA 2HYXA 2BMXA 1YF1A 1G7OA 3ZVJA 4L0WA 2I3YA 4K6XA 3P7XA 2CZ2A 1K0NA 1T7PB 3CXGA 5DJLA 2AJQB 1OC9B 3HVXA 3UEMA 1M2BA 1CQGA 1CQHA 2DJKA 4JZQA 2V2GA 4DSRA 1VF3A 2AAWA 2QA2A 2GQKA 1U87A 1XZOA 1XPVA 1YVLA 3EU4A 3CWGA 1R7HA 4BVXA 5CREA 2HSNA 3TKRA 3FK8A 2PGTA 3FZAA 1HYUA 1TRVA 6GSYA 4PGTA 1H75A 2DSAA 4QL7A 5CRDA 2DBCA 5E59A 3M1GA 4P3YB 2GSTA 2P5QA 3ME8A 3R3EA 1KBNA 3L9UA 3BCIA 1U6TA 4L8EA 4GF0A 4AJ8A 1QUWA 3EYTA 1M7TA 2WW1A 5A5KA 2VCZA 1PX7A 2FWFA 1V40A 2HZEB 2JACA 2E2GA 2AHEA 5L71A 5IPGA 2E0QA 2V1MA 5ELGA 3HZ4A 4BIKA 2LSTA 2CX4A 3UIWA 1W89A 1SK1A 2K6VA 4ZILA 4MJEA 2IIYA 3FYGA 1YEXA 2H6ZA 4EKZA 4TR1B 3FHKA 3TGZA 1F2EA 2PPTA 5G31A 4GLTA 1VRSD 3IRAA 4WR4A 3E0UA 1M3JA 2LEGA 2VAFA 2GVPA 5EPFA 2OKAA 2H8LA 1TXXA 3FR3A 3EPTA 4ZXGA 5KN0A 1SVMA 2X8CA 2MBTA 4TVEA 3TRPA 5GAND 2UV8G 4MZWA 4MABA 3KM6A 3ME7A 4CHSA 4K1FA 1X9SB 3RGBC 5BMUA 3VWXA 2FWEA 2N5FA 4K8MA 1J9BA 2G0FA 4ZL7A 1GTUA 4ZL8A 3SWLA 3UAPA 3RPNA 5DJMA 2V6KA 3HZ8A 2LRTA 1OE7A 1I1IP 1X9WB 1XW5A 3G7IA 3RDWA 1G7EA 4KSMA 1DUGA 4EIPA 2KLXA 4E8EA 2YWMA 5DAKB 3TKSA 4IQ1A 3QOUA 2DJ2A 1BJXA 3MSZA 2C80A 4WF5A 1NSWA 5IMAA 2F9SA 1YDKA 4NHZA 1V57A 4H86A 4J57E 1GUMA 3WYWA 3ZFBA 3LG6A 2HFDA 4HDEA 3CSIA 3ERFA 2WZ9A 2IMFA 5AIXA 2FWGA 1YKCA 1SYRA 5F05A 2DMLA 1EGOA 5KOXA 2B5EA 2WZSA 4KA0A 5E4WA 1PKZA 3KH9A 1O81A 4TRXA 2ES7A 1O8XA 4Q5QA 2AYTA 4EVMA 4WXTA 2XPEA 4G2EA 3VLNA 1PMTA 1AQXA 3I9V2 2L5LA 4MDCA 1I9DA 2QSIA 4MJCA 5IMZA 2O89A 5JCUA 1ABAA 2AB6A 3IA1A 2K9FA 5A1NA 2OBIA 1ML6A 2PERA 1AQWA 2JZTA 5ECRB 1EP8A 3IAM2 1WMJA 5J9CA 5ID2A 1FW1A 1S4BP 2WCIA 4GSNA 3RHCA 5D93A 2CAIA 2VM2A 4KAEA 1ZCPA 3BD2A 5A5HA 1PN0A 4HI7A 2B5XA 3M8NA 1VGLA 1F3AA 5ECKB 3NZNA 3HHVA 4HZ2A 1BYEA 2VL2C 20GSA 4WKWA 3SBCA 4PXOA 3TJKA 1MDIA 4PQHA 3C7MA 3GYKA 3F4TA 2JSYA 2DKIA 5HQPA 5J5NA 5IMFA 2YV9A 3CSHA 3IBHA 2IN3A 1O7UA 3FZ9A 1FB0A 2PWJA 4KCAA 2RM6A 3LORA 1M3IA 2YZHA 2DKHA 1TDIA 1ZMAA 1O85A 3EMXA 3APOA 1QGVA 4HJMA 3FMWA 4MNNA 4KF9A 3GUSA 5ECLB 4Q5FA 1DSBA 4K2DA 3F3QA 4MJAA 1GLQA 2OBKA 2CQ9A 1T00A 3HYPA 3IK9A 2C0FA 5LNKe 3KEBA 3PPUA 2GQLA 2HRKA 2H1GA 4V2LA 2I4AA 3P8WA 3CQFA 1OYJA 1PRXA 1Z7PA 3TB2A 2C0GA 1TU7A 1XWGA 2H30A 4DSSA 2LJRA 4HUAA 5F06A 4OCEA 1S3AA 4K7IA 2EFHA 3MWHA 3ZITA 5FWGA 3QAWA 1ST9A 3HXSA 3A5IA 4FXYP 4WF4A 1XW9A 2HRAA 2HRNA 1Y25A 1KEBA 1HNBA 1EOGA 4YAVA 1K0DA 2C3NA 3CRTA 4Z2UA 2LV3A 5HFKA 5CRHA 3VPTA 2YPMA 4MF6A 4OFMA 2H1DA 5GSSA 5A34B 2KUCA 2B7KA 3APQA 4YH2A 3D5JA 5CP1A 4YQUA 3DXBA 5J40A 3N5OA 1A2LA 1MTCA 4K7OA 5A4UA 1XWKA 1ERWA 1HNAA 1SJZA 3RPPA 5J47A 3QPMA 2DIYA 1OC8A 3IK7A 1SVOA 4XRAA 3HMJG 2VD0A 4MCUA 2E2MA 4AKGA 4FQUA 2H72A 4ACSA 2IJYA 2V6OA 1V2AA 2LS5A 2ON7A 2HSMA 3HCZA 1QQ2A 3MIXA 1ZYQB 1SL0B 3S9FA 1M9BA 5H5SA 1V9WA 2X99A 2TIRA 5IOWA 1NW2A 4PTSA 4WR5A 1SD9A 1GSSA 2YJHA 4PUAA 1SL2B 3PGTA 2YCDA 2RIIA 3EU3A 2A4HA 2EIRA 4HZ4A 1K3YA 4KE3A 4ICYA 4CW9A 5ECSA 4Z7XA 1TOFA 3AY8A 2VCXA 2YOIA 3HY2A 5IO0A 5GSTA 5CRWA 4BL7B 3TCOA 4CY8A 2E7PA 3KCMA 1RW1A 3IE3A 1JFUA 5IPHA 3KTLA 5D9VA 5HFIA 2FWHA 2X4AA 1XG8A 2JADA 4OFNA 4K2XA 1UC7A 1GSYA 1XFLA 5J4VA 1EOHA 2OA7A 4D73B 4X0XA 2KP1A 3MNGA 3GRXA 4N11A 2X8HA 2HSHA 3BOAA 5DVBA 3D0ZA 1AC1A 2WJUA 1EGRA 3C8EA 2DJ3A 4TXOB 1MD3A 1YQ1A 1GTIA 1SYXA 1TI3A 2VL3A 2VIMA 4AI6A 3LJRA 3WT1A 1OAZA 2P0GA 3LXZA 3RFRC 1GLPA 1NHOA 17GSA 4G10A 4XS6A 4EF0A 2L5OA 3KMOA 2MZCA 3EURA 5CNWA 6GSUA 1AIUA 1QFNA 2ZUPA 1SK0A 1MEKA 2JSZA 4QMKA 4TKYA 3HKRA 5EL8A 4I97A 3QCPA 1TK0B 1FAAA 5KEJA 1M2AA 3LGCA 4PQ1A 2YJ7A 2HLSA 1F9MA 5JWQB 3RBTA 4ZB6A 3IV4A 2NDOA 10GSA 4MPGA 3D22A 5J41A 2PUKC 5COHA 1JZWA 4GRFA 3VURA 4G0IA 4O7HA 2FGXA 2IFQB 5J3RA 4IP6A 5J9BA 1M9AA 3MYDA 1TRSA 4EIQA 2WW0A 2B6MA 5B8BA 4XCSA 4ZL9A 5JWRB 1SD8A 1ERUA 1A0RP 2AUVA 3A2WA 2OE0A 3DWVA 3MAKA 2C3QA 1TJDA 4N30A 3WGEA 3C71A 5D9TA 4G01A 4BVYA 3HVVA 1BF5A 2YWOA 1GUHA 3IXRA 2X8GA 5CAXA 2H0GA 4YQVA 3NIVA 1N8JA 3KP9A 1KTEA 4TR3A 2R4VA 5DCGA 4V2MA 2L57A 3DVWA 3UL3A 1GSQA 1FOHA 1VF1A 2WFCA 4K5SA 5ECPB 4LMWA 1C72A 1XXUA 4KDYA 2QGVA 3UJ1A 1PFOA 3Q74A 5C04A 2B1KA 2GSQA 4AKHA 1EZKA 2B3SA 1FVKA 5B7CA 4OO5A 2NVLA 3G7JA 3F9UA 3UMAA 4MK3A 2M72A 3KJYA 3IHQA 1A23A 1GNEA 2HSYA 3GH9A 5A4WA 3GA4A 3EINA 3D6IA 1U88A 2ZNMA 4QQ7A 3ZIJA 1J0FA 1VF4A 4NPBA 3IDVA 2DLXA 1TXUA 1ZYPA 2YN1A 1DBYA 3F8UA 2NPBA 2H0HA 4QL9A 4EUYA 1YJ6A 11GSA 3ZVJD 3Q19A 1S3DA 1JLVA 1JZRA 2FD3A 1BQ7A 5DDLA 2CZ3A 2D2ZA 4EC0A 2OE1A 4I8BA 1Z6MA 3DYRA 4OFTA 2IMEA 2WVXA 4EE0A 1ZYEA 4XS4A 4IELA 1FOVA 5J4YA 3DEXA 2H6YA 2XPDA 1PN9A 3KGKA 4AF2A 4NWYA 2O85A 5C00A 2H1LA 3N9JA 3DD3A 4DSQA 4TR0A 2VCVA 2TRXA 4POKA 3VI5A 2HE3A 2DMMA 4ILFA 2YV7A 3GN3A 4IQAA 1FB6A 4N0VA 4BVXB 2H01A 5ABRA 1A8LA 2HSNB 2NTOA 3GX0A 13GSA 2WW2A 1MDKA 2KHPA 4HU7A 1EV9A 2MYGA 3H93A 4IGJA 4PX1A 2M80A 4JR6A 2WGRA 3JCML 4OCFA 1G6YA 1Z9HA 2H6XA 3F4SA 2H73A 4FO5A 1GTAA 4HSCX 3PH9A 3EC3A 4F82A 1FO5A 4DEJA 4X43A 3RHBA 1YEPA 5AISA 3G9BA 2OADA 4NV2A 2O36A 4FIWA 3FEUA 4KDXA 1R4WA 3M0FA 1MDJA 1V98A 5F8BA 3VPQA 2G2QA 1M0UA 4EL1A 3FR9A 4ECIA 4K9ZA 3ZFLA 1LBKA 3TJFA 4O32A
chains in the Genus database with same CATH topology
1F3BA 4CY6A 2PMTA 2O5VA 2VD1A 3OR5A 3VK9A 2R2JA 3HJPA 3TJBA 4ZB9A 2L4CA 2A2SA 5DQYA 3P90A 2OE3A 4NXIA 1F37A 3ZL5A 2QA1A 2CT6A 2LQOA 4YKGA 3NOFA 1QXHA 2X64A 4K7NA 4L5OA 4YKFA 2C3TA 3I69A 4FYCA 4K0NA 3ED3A 1PKWA 2LQQA 2H75A 5H5QA 3GX8A 3CBUA 3GTUA 1WPIA 3O3TA 1TK5B 3F0IA 2R0CA 2YP6A 3FRCA 4RI6A 3F6FA 2DJJA 1O73A 4WEYA 1MD4A 3WT2A 1W4VA 5BMUB 2CVBA 3VWVA 2IL3A 4TN8A 1A2MA 3QR6A 2R6KA 4MH2A 4YAPA 3GKXA 1WP0A 3C1RA 5B8AA 2FA4A 3WGXA 3ISOA 3TKSC 3GNJA 3GKNA 4HS1A 1T4YA 4AJ7A 1PL2A 3M3MA 19GSA 4XTSA 4Z2TA 4N10A 4KB3A 5DALA 4BA7A 2CA8A 1GP1A 4MP4A 1XWCA 3IC8A 1BG1A 1X0RA 4ZBBA 4WBJA 2A2PA 3D4MA 5D8IA 2L6CA 1B9XC 14GSA 2VLTA 3DVXA 5IOXA 3J7Yb 4Z2RA 4XS1A 5GZZB 4MMMA 4IJ3A 3ZTLA 1PX6A 2HQTA 1O8WA 1SKSB 4NAXA 2YWNA 2IWTA 4ECBA 1XWBA 1K3LA 1WWJA 2X49A 3WD6A 1TP9A 3GL3A 1H4OA 3TRXA 1GSFA 3IHGA 3TKSE 1LU4A 4IVFA 1HD2A 3FW2A 2OT3A 1N25A 1ACVA 1SENA 4MJBA 1K0CA 1JZOA 5ECNB 3HJOA 4IP1A 2K18A 3H8QA 1UA5A 1T3BA 4L0UA 1X5DA 4IHUA 2YANA 4FYBA 3TJJA 4BWQA 5EVOA 4F0CA 5H5RA 3GSTA 4AKIA 5A1NB 2B7JA 2CAQA 3BJ5A 2R37A 3GMFA 4V2NA 3UOMA 5CO3A 1OC9A 2BJXA 6GSSA 5HFGA 2YWIA 5ID2B 1ZOFA 2EIQA 3V1WA 5ECMB 3PINA 1OKTA 1R5AA 3LEFA 4JBBA 2VCQA 4PURA 2H70A 4JR4A 1EEMA 3EWLA 4ID0A 3A5WA 5G1KA 2GT6A 1T1VA 1VF2A 1ZZYA 4W66A 5LCZA 3FZ4A 2GZPA 1I5GA 3R2QA 3VWUA 2HZFA 2EC4A 5D96A 1GNWA 1SJIA 3QFBC 2WB9A 4MPFA 5ECQB 4CDOA 2HZEA 3RAZA 1B4QA 2H76A 2DJ1A 4MF5A 5D9XA 16GSA 3ZYWA 4TOPA 4JE1A 1AW9A 2PBJA 3I6AA 5DCHA 2LNSA 1E6BA 5ELAA 3ZLPA 3ZMLA 1U3IA 1TRUA 2IMDA 1B8XA 2WS2A 1X5EA 2LUSA 2NBSA 2GLRA 4TR1A 4OMVA 3O6TA 1TRWA 2HRKB 2HRFA 1GUKA 5A4VA 1SK2A 3UBLA 3EMPA 1FG4A 2REMA 3A2VA 1WJKA 2TRCP 4KCEA 2ON5A 2VL9A 18GSA 1ZGNA 3BCKA 2DC5A 2RUFA 2MMOA 4FH8A 4DSSB 2YZUA 4IKHA 2MBSA 3GSSA 1SVLA 2FLSA 3FY7A 2GSSA 4WETA 1GTBA 3TKPA 3A3TA 1O6JA 2GGTA 1GH2A 1THOA 2VCTA 2UZ8A 1XOAA 2GT5A 2RLIA 2C1YA 1K0MA 2DIZA 4KW6A 1K3OA 3UARA 1XVQA 5HR2A 5CYYA 3W8JA 2LKUA 2LTKA 5ENUA 2LJAA 4POMA 4OD7A 1KNGA 1XOBA 2GZZA 2HI7A 5HR1A 12GSA 3F6DA 5FT3A 4J56E 3GL5A 3FZ5A 4KX4A 1WIKA 1PD21 1U3AA 2LNTA 4GQFA 1TU8A 4GWRA 4USSA 4LL1B 4DVCA 5IMDA 4EDZA 1BX9A 5DAKA 1OKDA 5IMCA 2HSMB 3O76A 4G0KA 4V1Ap 3BBYA 4PUFC 4X4JA 4MZBA 3H4KA 4F0BA 3EE2A 4KSOA 4FYUA 1T4ZA 2H74A 4JRRA 4ULXA 2PVOC 4NHWA 4HU9A 3APSA 2C0EA 1PL1A 1Y6EA 2HT9A 1GRXA 5LD0A 3HDCA 5IIZA 3C1SA 2GQMA 2F8FA 1USBA 3KZQA 1Z7RA 3IPZA 4POBA 2LRNA 3GKMA 2HXKA 5BRTA 4GCIA 1TI1A 1GULA 1A8YA 1SJ6A 4JU5A 3KD0A 4MF7A 1NM3A 2V41A 4A5PA 1GSEA 4YQMA 1AUCA 4OWYA 4ML6A 3DKSA 1WOUA 2VOCA 1BEDA 1RQMA 1ON4A 3QD9A 4AJ6A 3P2AA 2L4QA 1A24A 2R3XA 4NV5A 3VI7A 3TOTA 4ZIJA 4JEDA 3Q6OA 4BPYA 3F63A 1GSUA 4XIHA 3GV1A 5JCWA 5HR3A 3L78A 1OE8A 2VO4A 4ZB8A 4LA1A 2H1BA 2CVKA 2KOKA 1Z5YE 5IQYA 5D73A 4GSTA 3UVHA 4IN0A 2I81A 2C8UA 4L5LA 4N3ZA 2P31A 5JWOB 3HA9A 1RK4A 1JLWA 4I2UA 5KOWA 3GFKA 5JCGA 3ZZXA 1UN2A 2GS3A 3CSJA 2L6DA 4KDUA 2H0IA 3W8SA 2LJKA 4RQRA 4O5RA 4XHMA 3DGQA 5AGYA 3ZRDA 5ECOB 2C0DA 2VL2A 1QK8A 3UVTA 4RI7A 4HEA2 1M2DA 1GL8A 5F0GA 2JZRA 4KH7A 1Y1UA 2OJLA 3KMNA 3IOSA 1UVZA 3FR6A 4GDFA 1R26A 1ERVA 1XW6A 4NMUA 2EFDA 3IAS2 2CX3A 1IYHA 5DQSA 4OO4A 2R0PA 1ZL9A 2H71A 2B1LA 1OC3A 6GSXA 2RM5A 1AQVA 1EWXA 3GHAA 2N5AA 4IW9A 2IMKA 3U6VA 4ML1A 4GQCA 3KXOA 1DE2A 3KTBA 2R5GA 3D21A 4BVYB 1AXDA 2MMZA 3QAGA 1R5PA 4EDYA 1JZDA 2XBQA 4ZB7A 5IM9A 3WGDA 2A2RA 2GZYA 4V1Ag 2XBIA 2ZCTA 5A34A 3VWWA 3W6GA 4ISDA 3GURA 1HQOA 4K0GA 3H1NA 2QKEA 5B6MA 4MLYA 4G9HA 4PNFA 5GAPD 3LXTA 9GSSA 3GH6A 5G30A 4BWSA 1ERTA 1TTZA 3TU3B 3ZREA 3TUEA 2OACA 2RUEA 1PSQA 2B5YA 1Z3EA 5AN1A 3QAVA 4HQZA 1T8EB 1EEJA 5FHIA 2K8VA 1SU9A 4G0LA 4LL4B 2JL4A 2JZSA 2QC7A 2F3MA 1K0AA 5KN3A 3VFIA 6GSWA 2YNXA 3LFLA 1WE0A 4RUVA 5AIVA 3CTGA 1A0FA 3LYKA 1ZYNA 2H19A 2P5RA 3L9SA 6GSVA 2FCHA 2O87A 7GSSA 4IBPA 3LQ7A 4EXJA 1PA3A 2I1UA 3TJGA 4F03A 2LRCA 1B9YC 3ERGA 1EV4A 3I43A 4AGSA 2J23A 1K0OA 2H1AA 3CTFA 2F51A 4G19A 4XS4B 4F2IA 2C4JA 1BG5A 4E8HA 8GSSA 2BTOT 1SKRB 3L0HA 1XVWA 4BL7A 3QMXA 5HR0A 3IR4A 4Q5RA 2KP2A 2IPAA 3CRUA 3DIEA 4IS0A 1B4PA 1X5CA 2FUG2 4I5QA 3L4NA 2J9HA 2PVQA 4LLRA 2HNLA 1XWAA 5B6NA 1JHBA 1GSDA 3CMIA 1PQNA 4D73A 5KN1A 1TK8B 4XRDA 1QMVA 2EFCA 5EY6A 3M9JA 5DBQA 4GTUA 3ERWA 3KP8A 3M9KA 3MDKA 2MMNA 1G0TA 6GSTA 4N0ZA 3E3EA 4RQXA 1IYIA 4ZBAA 2M46A 1SL1B 3DMLA 4AKXB 3C73A 2FHEA 4TXOA 2XC2A 1K0BA 1V58A 3QFAC 2FY6A 4Q5NA 4ZBDA 2WRTA 1S3CA 4TXVA 3G7YA 2O7KA 1XIYA 1YF0A 3Q18A 1BAYA 1YZXA 2FA8A 3L9VA 5G2ZA 2A4VA 3PR8A 3UBKA 3LWAA 1Z6NA 2VKZG 1OVNA 3QDNA 3TRQA 4LMVA 4EO3A 4ECJA 4HJ2A 4KGIA 1E2YA 2GTUA 2V32A 1THXA 4KNDA 4PQIA 3ZMKA 3TDGA 1NHYA 4J2FA 4E68A 5G1LA 3F3RA 4POLA 1A2JA 4WBRD 3D4TA 1PGTA 4I2TA 5A5HB 1B48A 5CRGA 2IFQA 4HOJA 3GKKA 1YKAA 2L59A 5INYA 3TOUA 2MMAA 2I9HA 3IC4A 4O92A 3U5RE 3EVIA 3GTUB 3HD5A 2CV4A 3A2XA 1N2AA 3FKFA 2VLVA 1TKDB 5KN2A 2AV4A 1M99A 2GDRA 4GSSA 1SKWB 2F8AA 2PU9C 2N5BA 2VM1A 5J4UA 2O8VB 1Q4JA 1URMA 4TR4A 4O5QA 5G5EA 2GSRA 4O5UA 4TW5A 2FNOA 2ALBA 5DALB 4MZCA 1HNCA 5IMVA 1YY7A 1EP7A 2XHFA 1X9MB 4MA9A 2JU5A 3KH7A 3HVSA 4KUNA 2K8SA 1WRYA 3J7Yk 2R0GA 1ILOA 1FHEA 5F07A 3K8NA 3LSZA 2WULA 1DE1A 3GIXA 3F4RA 2DJ0A 3DRNA 2WDUA 1GWCA 1G6WA 2IMIA 3LYPA 2CVDA 1F6MC 3LW9A 2VCWA 1Q98A 1J08A 4X1UA 3CYNA 2PN8A 1TW9A 5G5FA 5IO2A 4K5RA 4F9ZA 4ECCA 5ECHB 3H79A 1FVJA 2Z9SA 3HJMA 2VUPA 4MH3A 3E9JB 4HQSA 3KIJA 3ZIVA 22GSA 1XCCA 5ECIB 2H66A 2EIOA 1AAZA 4I6XA 3US3A 2EFEA 4GXZA 5D9WA 2VLUA 1LJRA 4IJIA 4PNGA 1XBSA 3TKQA 2HYXA 2BMXA 1YF1A 1G7OA 3ZVJA 4L0WA 2I3YA 4K6XA 3P7XA 2CZ2A 1K0NA 1T7PB 3CXGA 5DJLA 2AJQB 1OC9B 3HVXA 3UEMA 1M2BA 1CQGA 1CQHA 2DJKA 4JZQA 2V2GA 4DSRA 1VF3A 2AAWA 2QA2A 2GQKA 1U87A 1XZOA 1XPVA 1YVLA 3EU4A 3CWGA 1R7HA 4BVXA 5CREA 2HSNA 3TKRA 3FK8A 2PGTA 3FZAA 1HYUA 1TRVA 6GSYA 4PGTA 1H75A 2DSAA 4QL7A 5CRDA 2DBCA 5E59A 3M1GA 4P3YB 2GSTA 2P5QA 3ME8A 3R3EA 1KBNA 3L9UA 3BCIA 1U6TA 4L8EA 4GF0A 4AJ8A 1QUWA 3EYTA 1M7TA 5A5KA 2VCZA 1PX7A 2FWFA 1V40A 2HZEB 2JACA 2E2GA 2AHEA 5L71A 5IPGA 2E0QA 2V1MA 5ELGA 3HZ4A 2LSTA 2CX4A 3UIWA 1W89A 1SK1A 2K6VA 4ZILA 4MJEA 2IIYA 3FYGA 1YEXA 2H6ZA 4EKZA 4TR1B 3FHKA 3TGZA 1F2EA 2PPTA 5G31A 4GLTA 1VRSD 3IRAA 4WR4A 3E0UA 2LEGA 2VAFA 2GVPA 5EPFA 2OKAA 2H8LA 1TXXA 3FR3A 3EPTA 4ZXGA 5KN0A 1SVMA 2X8CA 2MBTA 4TVEA 3TRPA 5GAND 2UV8G 4MZWA 4MABA 3KM6A 3ME7A 4CHSA 4K1FA 1X9SB 5BMUA 3VWXA 2FWEA 2N5FA 4K8MA 1J9BA 2G0FA 4ZL7A 1GTUA 4ZL8A 3SWLA 3UAPA 3RPNA 5DJMA 2V6KA 3HZ8A 2LRTA 1OE7A 1X9WB 1XW5A 3G7IA 3RDWA 1G7EA 4KSMA 1DUGA 4EIPA 2KLXA 4E8EA 2YWMA 5DAKB 3TKSA 4IQ1A 3QOUA 2DJ2A 1BJXA 3MSZA 2C80A 4WF5A 1NSWA 5IMAA 2F9SA 1YDKA 4NHZA 1V57A 4H86A 4J57E 1GUMA 3WYWA 3ZFBA 3LG6A 2HFDA 4HDEA 3CSIA 3ERFA 2WZ9A 2IMFA 5AIXA 2FWGA 1YKCA 1SYRA 5F05A 2DMLA 1EGOA 5KOXA 2B5EA 4KA0A 5E4WA 1PKZA 3KH9A 1O81A 4TRXA 2ES7A 1O8XA 4Q5QA 2AYTA 4EVMA 4WXTA 2XPEA 4G2EA 3VLNA 1PMTA 1AQXA 3I9V2 2L5LA 4MDCA 1I9DA 2QSIA 4MJCA 5IMZA 2O89A 5JCUA 1ABAA 2AB6A 3IA1A 2K9FA 5A1NA 2OBIA 1ML6A 2PERA 1AQWA 2JZTA 5ECRB 1EP8A 3IAM2 1WMJA 5J9CA 5ID2A 1FW1A 2WCIA 4GSNA 3RHCA 5D93A 2CAIA 2VM2A 4KAEA 1ZCPA 3BD2A 5A5HA 1PN0A 4HI7A 2B5XA 3M8NA 1VGLA 1F3AA 5ECKB 3NZNA 3HHVA 4HZ2A 1BYEA 2VL2C 20GSA 4WKWA 3SBCA 4PXOA 3TJKA 1MDIA 4PQHA 3C7MA 3GYKA 3F4TA 2JSYA 2DKIA 5HQPA 5J5NA 5IMFA 2YV9A 3CSHA 3IBHA 2IN3A 1O7UA 3FZ9A 1FB0A 2PWJA 4KCAA 2RM6A 3LORA 2YZHA 2DKHA 1TDIA 1ZMAA 1O85A 3EMXA 3APOA 1QGVA 4HJMA 3FMWA 4MNNA 4KF9A 3GUSA 5ECLB 4Q5FA 1DSBA 4K2DA 3F3QA 4MJAA 1GLQA 2OBKA 2CQ9A 1T00A 3HYPA 3IK9A 2C0FA 5LNKe 3KEBA 3PPUA 2GQLA 2HRKA 2H1GA 4V2LA 2I4AA 3P8WA 1OYJA 1PRXA 1Z7PA 3TB2A 2C0GA 1TU7A 1XWGA 2H30A 4DSSA 2LJRA 4HUAA 5F06A 4OCEA 1S3AA 4K7IA 2EFHA 3MWHA 3ZITA 5FWGA 3QAWA 1ST9A 3HXSA 3A5IA 4WF4A 1XW9A 2HRAA 2HRNA 1Y25A 1KEBA 1HNBA 1EOGA 4YAVA 1K0DA 2C3NA 3CRTA 4Z2UA 2LV3A 5HFKA 5CRHA 3VPTA 2YPMA 4MF6A 4OFMA 2H1DA 5GSSA 5A34B 2KUCA 2B7KA 3APQA 4YH2A 3D5JA 5CP1A 4YQUA 3DXBA 5J40A 3N5OA 1A2LA 1MTCA 4K7OA 5A4UA 1XWKA 1ERWA 1HNAA 1SJZA 3RPPA 5J47A 3QPMA 2DIYA 1OC8A 3IK7A 1SVOA 4XRAA 3HMJG 2VD0A 4MCUA 2E2MA 4AKGA 4FQUA 2H72A 4ACSA 2IJYA 2V6OA 1V2AA 2LS5A 2ON7A 2HSMA 3HCZA 1QQ2A 3MIXA 1ZYQB 1SL0B 3S9FA 1M9BA 5H5SA 1V9WA 2X99A 2TIRA 5IOWA 1NW2A 4PTSA 4WR5A 1SD9A 1GSSA 2YJHA 4PUAA 1SL2B 3PGTA 2YCDA 2RIIA 3EU3A 2A4HA 2EIRA 4HZ4A 1K3YA 4KE3A 4ICYA 4CW9A 5ECSA 4Z7XA 1TOFA 3AY8A 2VCXA 2YOIA 3HY2A 5IO0A 5GSTA 5CRWA 4BL7B 3TCOA 4CY8A 2E7PA 3KCMA 1RW1A 3IE3A 1JFUA 5IPHA 3KTLA 5D9VA 5HFIA 2FWHA 2X4AA 2JADA 4OFNA 4K2XA 1UC7A 1GSYA 1XFLA 5J4VA 1EOHA 2OA7A 4D73B 4X0XA 2KP1A 3MNGA 3GRXA 4N11A 2X8HA 2HSHA 3BOAA 5DVBA 3D0ZA 1AC1A 2WJUA 1EGRA 3C8EA 2DJ3A 4TXOB 1MD3A 1YQ1A 1GTIA 1SYXA 1TI3A 2VL3A 2VIMA 4AI6A 3LJRA 3WT1A 1OAZA 2P0GA 3LXZA 1GLPA 1NHOA 17GSA 4G10A 4XS6A 4EF0A 2L5OA 3KMOA 2MZCA 3EURA 5CNWA 6GSUA 1AIUA 1QFNA 2ZUPA 1SK0A 1MEKA 2JSZA 4QMKA 4TKYA 3HKRA 5EL8A 4I97A 3QCPA 1TK0B 1FAAA 5KEJA 1M2AA 3LGCA 4PQ1A 2YJ7A 2HLSA 1F9MA 5JWQB 3RBTA 4ZB6A 3IV4A 2NDOA 10GSA 4MPGA 3D22A 5J41A 2PUKC 5COHA 1JZWA 4GRFA 3VURA 4G0IA 4O7HA 2FGXA 2IFQB 5J3RA 4IP6A 5J9BA 1M9AA 3MYDA 1TRSA 4EIQA 2B6MA 5B8BA 4XCSA 4ZL9A 5JWRB 1SD8A 1ERUA 1A0RP 2AUVA 3A2WA 2OE0A 3DWVA 3MAKA 2C3QA 1TJDA 4N30A 3WGEA 3C71A 5D9TA 4G01A 4BVYA 3HVVA 1BF5A 2YWOA 1GUHA 3IXRA 2X8GA 5CAXA 2H0GA 4YQVA 3NIVA 1N8JA 3KP9A 1KTEA 4TR3A 2R4VA 5DCGA 4V2MA 2L57A 3DVWA 3UL3A 1GSQA 1FOHA 1VF1A 2WFCA 4K5SA 5ECPB 4LMWA 1C72A 1XXUA 4KDYA 2QGVA 3UJ1A 3Q74A 5C04A 2B1KA 2GSQA 4AKHA 1EZKA 2B3SA 1FVKA 5B7CA 4OO5A 2NVLA 3G7JA 3F9UA 3UMAA 4MK3A 2M72A 3KJYA 3IHQA 1A23A 1GNEA 2HSYA 3GH9A 5A4WA 3GA4A 3EINA 3D6IA 1U88A 2ZNMA 4QQ7A 3ZIJA 1J0FA 1VF4A 4NPBA 3IDVA 2DLXA 1TXUA 1ZYPA 2YN1A 1DBYA 3F8UA 2NPBA 2H0HA 4QL9A 4EUYA 1YJ6A 11GSA 3ZVJD 3Q19A 1S3DA 1JLVA 1JZRA 2FD3A 1BQ7A 5DDLA 2CZ3A 2D2ZA 4EC0A 2OE1A 4I8BA 1Z6MA 3DYRA 4OFTA 2IMEA 4EE0A 1ZYEA 4XS4A 4IELA 1FOVA 5J4YA 3DEXA 2H6YA 3KGKA 1PN9A 2XPDA 4AF2A 4NWYA 2O85A 5C00A 3N9JA 2H1LA 3DD3A 4DSQA 4TR0A 2VCVA 2TRXA 4POKA 3VI5A 2HE3A 2DMMA 4ILFA 2YV7A 3GN3A 4IQAA 1FB6A 4N0VA 4BVXB 2H01A 5ABRA 1A8LA 2HSNB 2NTOA 3GX0A 13GSA 1MDKA 2KHPA 4HU7A 1EV9A 2MYGA 3H93A 4IGJA 4PX1A 2M80A 4JR6A 2WGRA 3JCML 4OCFA 1G6YA 1Z9HA 2H6XA 3F4SA 2H73A 4FO5A 1GTAA 3PH9A 3EC3A 4F82A 1FO5A 4DEJA 4X43A 3RHBA 1YEPA 5AISA 3G9BA 2OADA 4NV2A 4FIWA 3FEUA 4KDXA 1R4WA 3M0FA 1MDJA 1V98A 5F8BA 3VPQA 2G2QA 1M0UA 4EL1A 3FR9A 4ECIA 4K9ZA 3ZFLA 1LBKA 3TJFA 4O32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3B A;  2PMT A;  2VD1 A;  3OR5 A;  3VK9 A;  2R2J A;  3HJP A;  3TJB A;  4ZB9 A;  2L4C A;  2A2S A;  5DQY A;  3P90 A;  2OE3 A;  4NXI A;  1F37 A;  3ZL5 A;  2CT6 A;  2LQO A;  3NOF A;  1QXH A;  2X64 A;  4K7N A;  4L5O A;  2C3T A;  3I69 A;  4FYC A;  4K0N A;  3ED3 A;  1PKW A;  2LQQ A;  2H75 A;  5H5Q A;  3GX8 A;  3CBU A;  3GTU A;  1WPI A;  3O3T A;  1TK5 B;  3F0I A;  2YP6 A;  3FRC A;  4RI6 A;  3F6F A;  2DJJ A;  1O73 A;  4WEY A;  1MD4 A;  3WT2 A;  1W4V A;  2CVB A;  3VWV A;  2IL3 A;  4TN8 A;  1A2M A;  3QR6 A;  2R6K A;  4MH2 A;  4YAP A;  3GKX A;  1WP0 A;  3C1R A;  5B8A A;  2FA4 A;  3WGX A;  3ISO A;  3TKS C;  3GNJ A;  3GKN A;  4HS1 A;  1T4Y A;  4AJ7 A;  1PL2 A;  3M3M A;  19GS A;  4XTS A;  4N10 A;  4KB3 A;  5DAL A;  4BA7 A;  2CA8 A;  1GP1 A;  4MP4 A;  1XWC A;  3IC8 A;  1X0R A;  4ZBB A;  4WBJ A;  3D4M A;  5D8I A;  2L6C A;  1B9X C;  14GS A;  2VLT A;  3DVX A;  5IOX A;  3J7Y b;  4XS1 A;  5GZZ B;  4MMM A;  4IJ3 A;  3ZTL A;  1PX6 A;  2HQT A;  1O8W A;  1SKS B;  4NAX A;  2YWN A;  2IWT A;  4ECB A;  1XWB A;  1K3L A;  1WWJ A;  3WD6 A;  1TP9 A;  3GL3 A;  1H4O A;  3TRX A;  1GSF A;  3TKS E;  1LU4 A;  4IVF A;  1HD2 A;  3FW2 A;  1ACV A;  1SEN A;  4MJB A;  1K0C A;  1JZO A;  5ECN B;  3HJO A;  4IP1 A;  2K18 A;  3H8Q A;  1UA5 A;  1T3B A;  4L0U A;  1X5D A;  4IHU A;  2YAN A;  4FYB A;  3TJJ A;  4BWQ A;  5EVO A;  4F0C A;  5H5R A;  3GST A;  2B7J A;  2CAQ A;  3BJ5 A;  2R37 A;  3GMF A;  4V2N A;  3UOM A;  5CO3 A;  1OC9 A;  2BJX A;  6GSS A;  5HFG A;  2YWI A;  5ID2 B;  1ZOF A;  2EIQ A;  3V1W A;  5ECM B;  3PIN A;  1OKT A;  1R5A A;  3LEF A;  4JBB A;  2VCQ A;  4PUR A;  2H70 A;  4JR4 A;  1EEM A;  3EWL A;  4ID0 A;  3A5W A;  5G1K A;  2GT6 A;  1T1V A;  1VF2 A;  1ZZY A;  5LCZ A;  3FZ4 A;  2GZP A;  1I5G A;  3R2Q A;  3VWU A;  2HZF A;  2EC4 A;  5D96 A;  1GNW A;  1SJI A;  3QFB C;  2WB9 A;  4MPF A;  5ECQ B;  4CDO A;  2HZE A;  3RAZ A;  1B4Q A;  2H76 A;  2DJ1 A;  4MF5 A;  5D9X A;  16GS A;  3ZYW A;  4TOP A;  4JE1 A;  1AW9 A;  2PBJ A;  3I6A A;  5DCH A;  2LNS A;  1E6B A;  5ELA A;  3ZLP A;  3ZML A;  1U3I A;  1TRU A;  2IMD A;  1B8X A;  2WS2 A;  1X5E A;  2LUS A;  2NBS A;  2GLR A;  4TR1 A;  4OMV A;  3O6T A;  1TRW A;  2HRK B;  2HRF A;  1GUK A;  5A4V A;  1SK2 A;  3UBL A;  3EMP A;  1FG4 A;  2REM A;  3A2V A;  1WJK A;  2TRC P;  4KCE A;  2ON5 A;  2VL9 A;  18GS A;  1ZGN A;  3BCK A;  2DC5 A;  2RUF A;  2MMO A;  4FH8 A;  4DSS B;  2YZU A;  4IKH A;  2MBS A;  3GSS A;  2FLS A;  3FY7 A;  2GSS A;  4WET A;  1GTB A;  3TKP A;  3A3T A;  1O6J A;  2GGT A;  1GH2 A;  1THO A;  2VCT A;  2UZ8 A;  1XOA A;  2GT5 A;  2RLI A;  2C1Y A;  1K0M A;  2DIZ A;  4KW6 A;  1K3O A;  3UAR A;  1XVQ A;  5HR2 A;  5CYY A;  3W8J A;  2LKU A;  2LTK A;  5ENU A;  2LJA A;  4POM A;  4OD7 A;  1KNG A;  1XOB A;  2GZZ A;  2HI7 A;  5HR1 A;  12GS A;  3F6D A;  5FT3 A;  4J56 E;  3GL5 A;  3FZ5 A;  4KX4 A;  1WIK A;  1PD2 1;  1U3A A;  2LNT A;  4GQF A;  1TU8 A;  4GWR A;  4USS A;  4LL1 B;  4DVC A;  5IMD A;  4EDZ A;  1BX9 A;  5DAK A;  1OKD A;  5IMC A;  2HSM B;  3O76 A;  4G0K A;  4V1A p;  3BBY A;  4PUF C;  4MZB A;  3H4K A;  4F0B A;  3EE2 A;  4KSO A;  4FYU A;  1T4Z A;  2H74 A;  4JRR A;  4ULX A;  2PVO C;  4NHW A;  4HU9 A;  3APS A;  2C0E A;  1PL1 A;  1Y6E A;  2HT9 A;  1GRX A;  5LD0 A;  3HDC A;  5IIZ A;  3C1S A;  2GQM A;  2F8F A;  1USB A;  3KZQ A;  1Z7R A;  3IPZ A;  4POB A;  2LRN A;  3GKM A;  2HXK A;  4GCI A;  1TI1 A;  1GUL A;  1A8Y A;  1SJ6 A;  4JU5 A;  3KD0 A;  4MF7 A;  1NM3 A;  2V41 A;  1GSE A;  4YQM A;  1AUC A;  4OWY A;  4ML6 A;  3DKS A;  1WOU A;  2VOC A;  1BED A;  1RQM A;  1ON4 A;  3QD9 A;  4AJ6 A;  3P2A A;  2L4Q A;  1A24 A;  2R3X A;  4NV5 A;  3VI7 A;  3TOT A;  4ZIJ A;  4JED A;  3Q6O A;  4BPY A;  3F63 A;  1GSU A;  4XIH A;  3GV1 A;  5JCW A;  5HR3 A;  3L78 A;  1OE8 A;  2VO4 A;  4ZB8 A;  4LA1 A;  2H1B A;  2CVK A;  2KOK A;  1Z5Y E;  5IQY A;  5D73 A;  4GST A;  3UVH A;  4IN0 A;  2I81 A;  2C8U A;  4L5L A;  2P31 A;  5JWO B;  3HA9 A;  1RK4 A;  1JLW A;  4I2U A;  3GFK A;  5JCG A;  3ZZX A;  1UN2 A;  2GS3 A;  3CSJ A;  2L6D A;  4KDU A;  2H0I A;  3W8S A;  2LJK A;  4RQR A;  4O5R A;  4XHM A;  3DGQ A;  5AGY A;  3ZRD A;  5ECO B;  2C0D A;  2VL2 A;  1QK8 A;  3UVT A;  4RI7 A;  4HEA 2;  1M2D A;  1GL8 A;  5F0G A;  2JZR A;  4KH7 A;  2OJL A;  3KMN A;  3IOS A;  1UVZ A;  3FR6 A;  1R26 A;  1ERV A;  1XW6 A;  4NMU A;  3IAS 2;  2CX3 A;  1IYH A;  5DQS A;  4OO4 A;  1ZL9 A;  2H71 A;  2B1L A;  1OC3 A;  6GSX A;  2RM5 A;  1AQV A;  1EWX A;  3GHA A;  2N5A A;  4IW9 A;  2IMK A;  3U6V A;  4ML1 A;  4GQC A;  3KXO A;  1DE2 A;  3KTB A;  2R5G A;  3D21 A;  4BVY B;  1AXD A;  2MMZ A;  3QAG A;  1R5P A;  4EDY A;  1JZD A;  2XBQ A;  5IM9 A;  3WGD A;  2A2R A;  2GZY A;  4V1A g;  2XBI A;  2ZCT A;  3VWW A;  3W6G A;  4ISD A;  3GUR A;  1HQO A;  4K0G A;  3H1N A;  2QKE A;  5B6M A;  4MLY A;  4G9H A;  4PNF A;  5GAP D;  3LXT A;  9GSS A;  3GH6 A;  5G30 A;  4BWS A;  1ERT A;  1TTZ A;  3ZRE A;  3TUE A;  2OAC A;  2RUE A;  1PSQ A;  2B5Y A;  1Z3E A;  5AN1 A;  3QAV A;  4HQZ A;  1T8E B;  1EEJ A;  5FHI A;  2K8V A;  1SU9 A;  4G0L A;  4LL4 B;  2JL4 A;  2JZS A;  2QC7 A;  2F3M A;  1K0A A;  5KN3 A;  3VFI A;  6GSW A;  2YNX A;  3LFL A;  1WE0 A;  4RUV A;  5AIV A;  3CTG A;  1A0F A;  3LYK A;  2H19 A;  2P5R A;  3L9S A;  6GSV A;  2FCH A;  2O87 A;  7GSS A;  4IBP A;  3LQ7 A;  4EXJ A;  1PA3 A;  2I1U A;  3TJG A;  4F03 A;  2LRC A;  1B9Y C;  3ERG A;  1EV4 A;  3I43 A;  4AGS A;  2J23 A;  1K0O A;  2H1A A;  3CTF A;  2F51 A;  4G19 A;  4XS4 B;  4F2I A;  2C4J A;  1BG5 A;  4E8H A;  8GSS A;  2BTO T;  1SKR B;  3L0H A;  1XVW A;  4BL7 A;  3QMX A;  5HR0 A;  3IR4 A;  4Q5R A;  2KP2 A;  2IPA A;  3CRU A;  3DIE A;  4IS0 A;  1B4P A;  1X5C A;  2FUG 2;  4I5Q A;  3L4N A;  2J9H A;  2PVQ A;  4LLR A;  2HNL A;  1XWA A;  5B6N A;  1JHB A;  1GSD A;  3CMI A;  1PQN A;  4D73 A;  5KN1 A;  1TK8 B;  4XRD A;  1QMV A;  5EY6 A;  3M9J A;  5DBQ A;  4GTU A;  3ERW A;  3KP8 A;  3M9K A;  3MDK A;  2MMN A;  1G0T A;  6GST A;  4N0Z A;  3E3E A;  4RQX A;  1IYI A;  4ZBA A;  2M46 A;  1SL1 B;  3DML A;  3C73 A;  2FHE A;  4TXO A;  2XC2 A;  1K0B A;  1V58 A;  3QFA C;  2FY6 A;  4Q5N A;  4ZBD A;  2WRT A;  1S3C A;  4TXV A;  3G7Y A;  2O7K A;  1XIY A;  1YF0 A;  3Q18 A;  1BAY A;  1YZX A;  2FA8 A;  3L9V A;  5G2Z A;  2A4V A;  3PR8 A;  3UBK A;  3LWA A;  1Z6N A;  3QDN A;  1OVN A;  3TRQ A;  4LMV A;  4EO3 A;  4ECJ A;  4HJ2 A;  4KGI A;  1E2Y A;  2GTU A;  2V32 A;  1THX A;  4KND A;  4PQI A;  3ZMK A;  3TDG A;  1NHY A;  4J2F A;  5G1L A;  3F3R A;  4POL A;  1A2J A;  4WBR D;  3D4T A;  1PGT A;  4I2T A;  1B48 A;  5CRG A;  2IFQ A;  4HOJ A;  3GKK A;  1YKA A;  2L59 A;  5INY A;  3TOU A;  2MMA A;  2I9H A;  3IC4 A;  4O92 A;  3U5R E;  3EVI A;  3GTU B;  3HD5 A;  2CV4 A;  3A2X A;  1N2A A;  3FKF A;  2VLV A;  1TKD B;  5KN2 A;  2AV4 A;  1M99 A;  2GDR A;  4GSS A;  1SKW B;  2F8A A;  2PU9 C;  2N5B A;  2VM1 A;  5J4U A;  2O8V B;  1Q4J A;  1URM A;  4TR4 A;  5G5E A;  2GSR A;  4TW5 A;  2FNO A;  2ALB A;  5DAL B;  4MZC A;  1HNC A;  5IMV A;  1YY7 A;  1EP7 A;  2XHF A;  1X9M B;  4MA9 A;  2JU5 A;  3KH7 A;  3HVS A;  4KUN A;  2K8S A;  1WRY A;  3J7Y k;  1ILO A;  1FHE A;  5F07 A;  3K8N A;  3LSZ A;  2WUL A;  1DE1 A;  3GIX A;  3F4R A;  2DJ0 A;  3DRN A;  2WDU A;  1GWC A;  1G6W A;  2IMI A;  3LYP A;  2CVD A;  1F6M C;  2VCW A;  1Q98 A;  1J08 A;  4X1U A;  3CYN A;  2PN8 A;  1TW9 A;  5G5F A;  5IO2 A;  4F9Z A;  4ECC A;  5ECH B;  3H79 A;  1FVJ A;  2Z9S A;  3HJM A;  2VUP A;  4MH3 A;  3E9J B;  4HQS A;  3KIJ A;  3ZIV A;  22GS A;  1XCC A;  5ECI B;  2H66 A;  2EIO A;  1AAZ A;  4I6X A;  3US3 A;  4GXZ A;  5D9W A;  2VLU A;  1LJR A;  4IJI A;  4PNG A;  1XBS A;  3TKQ A;  2HYX A;  2BMX A;  1YF1 A;  1G7O A;  3ZVJ A;  4L0W A;  2I3Y A;  4K6X A;  3P7X A;  2CZ2 A;  1K0N A;  1T7P B;  3CXG A;  5DJL A;  2AJQ B;  1OC9 B;  3HVX A;  3UEM A;  1M2B A;  1CQG A;  1CQH A;  2DJK A;  4JZQ A;  2V2G A;  4DSR A;  1VF3 A;  2AAW A;  2GQK A;  1U87 A;  1XZO A;  1XPV A;  3EU4 A;  1R7H A;  4BVX A;  5CRE A;  3TKR A;  3FK8 A;  2PGT A;  3FZA A;  1HYU A;  1TRV A;  6GSY A;  4PGT A;  1H75 A;  2DSA A;  4QL7 A;  5CRD A;  2DBC A;  5E59 A;  3M1G A;  4P3Y B;  2GST A;  2P5Q A;  3ME8 A;  3R3E A;  1KBN A;  3L9U A;  3BCI A;  1U6T A;  4L8E A;  4GF0 A;  4AJ8 A;  1QUW A;  3EYT A;  1M7T A;  5A5K A;  2VCZ A;  1PX7 A;  2FWF A;  1V40 A;  2HZE B;  2JAC A;  2E2G A;  2AHE A;  5L71 A;  5IPG A;  2E0Q A;  2V1M A;  5ELG A;  3HZ4 A;  2LST A;  2CX4 A;  3UIW A;  1W89 A;  1SK1 A;  2K6V A;  4ZIL A;  4MJE A;  2IIY A;  3FYG A;  1YEX A;  2H6Z A;  4EKZ A;  4TR1 B;  3FHK A;  3TGZ A;  1F2E A;  2PPT A;  5G31 A;  4GLT A;  1VRS D;  3IRA A;  4WR4 A;  3E0U A;  2LEG A;  2VAF A;  2GVP A;  5EPF A;  2OKA A;  2H8L A;  1TXX A;  3FR3 A;  4ZXG A;  5KN0 A;  2X8C A;  2MBT A;  4TVE A;  3TRP A;  5GAN D;  4MZW A;  4MAB A;  3KM6 A;  3ME7 A;  4CHS A;  4K1F A;  1X9S B;  5BMU A;  3VWX A;  2FWE A;  2N5F A;  4K8M A;  1J9B A;  2G0F A;  4ZL7 A;  1GTU A;  4ZL8 A;  3SWL A;  3UAP A;  3RPN A;  5DJM A;  2V6K A;  3HZ8 A;  2LRT A;  1OE7 A;  1X9W B;  1XW5 A;  3G7I A;  3RDW A;  1G7E A;  4KSM A;  1DUG A;  2KLX A;  4E8E A;  2YWM A;  5DAK B;  3TKS A;  4IQ1 A;  3QOU A;  2DJ2 A;  1BJX A;  3MSZ A;  2C80 A;  4WF5 A;  1NSW A;  5IMA A;  2F9S A;  1YDK A;  4NHZ A;  1V57 A;  4H86 A;  4J57 E;  1GUM A;  3WYW A;  3ZFB A;  3LG6 A;  2HFD A;  4HDE A;  3CSI A;  3ERF A;  2WZ9 A;  2IMF A;  5AIX A;  2FWG A;  1YKC A;  1SYR A;  5F05 A;  2DML A;  1EGO A;  2B5E A;  4KA0 A;  5E4W A;  1PKZ A;  3KH9 A;  1O81 A;  4TRX A;  2ES7 A;  1O8X A;  4Q5Q A;  2AYT A;  4EVM A;  4WXT A;  2XPE A;  4G2E A;  3VLN A;  1PMT A;  1AQX A;  3I9V 2;  2L5L A;  4MDC A;  1I9D A;  2QSI A;  4MJC A;  5IMZ A;  2O89 A;  5JCU A;  1ABA A;  2AB6 A;  3IA1 A;  2K9F A;  2OBI A;  1ML6 A;  2PER A;  1AQW A;  2JZT A;  5ECR B;  1EP8 A;  3IAM 2;  1WMJ A;  5J9C A;  5ID2 A;  1FW1 A;  2WCI A;  4GSN A;  3RHC A;  5D93 A;  2CAI A;  2VM2 A;  4KAE A;  1ZCP A;  3BD2 A;  4HI7 A;  2B5X A;  3M8N A;  1VGL A;  1F3A A;  5ECK B;  3NZN A;  3HHV A;  4HZ2 A;  1BYE A;  2VL2 C;  20GS A;  4WKW A;  3SBC A;  4PXO A;  3TJK A;  1MDI A;  4PQH A;  3C7M A;  3GYK A;  3F4T A;  2JSY A;  5HQP A;  5J5N A;  5IMF A;  2YV9 A;  3CSH A;  3IBH A;  2IN3 A;  1O7U A;  3FZ9 A;  1FB0 A;  2PWJ A;  4KCA A;  2RM6 A;  3LOR A;  2YZH A;  1TDI A;  1ZMA A;  1O85 A;  3EMX A;  3APO A;  1QGV A;  4HJM A;  4KF9 A;  3GUS A;  5ECL B;  4Q5F A;  1DSB A;  4K2D A;  3F3Q A;  4MJA A;  1GLQ A;  2OBK A;  2CQ9 A;  1T00 A;  3HYP A;  3IK9 A;  2C0F A;  5LNK e;  3KEB A;  3PPU A;  2GQL A;  2HRK A;  2H1G A;  4V2L A;  2I4A A;  3P8W A;  1OYJ A;  1PRX A;  1Z7P A;  3TB2 A;  2C0G A;  1TU7 A;  1XWG A;  2H30 A;  4DSS A;  2LJR A;  4HUA A;  5F06 A;  4OCE A;  1S3A A;  4K7I A;  3MWH A;  3ZIT A;  5FWG A;  3QAW A;  1ST9 A;  3HXS A;  4WF4 A;  1XW9 A;  2HRA A;  2HRN A;  1Y25 A;  1KEB A;  1HNB A;  1EOG A;  4YAV A;  1K0D A;  2C3N A;  3CRT A;  2LV3 A;  5HFK A;  5CRH A;  3VPT A;  2YPM A;  4MF6 A;  4OFM A;  2H1D A;  5GSS A;  2KUC A;  2B7K A;  3APQ A;  4YH2 A;  3D5J A;  5CP1 A;  4YQU A;  3DXB A;  3N5O A;  1A2L A;  1MTC A;  4K7O A;  5A4U A;  1XWK A;  1ERW A;  1HNA A;  1SJZ A;  3RPP A;  3QPM A;  2DIY A;  1OC8 A;  3IK7 A;  4XRA A;  2VD0 A;  4MCU A;  2E2M A;  4FQU A;  2H72 A;  4ACS A;  2IJY A;  2V6O A;  1V2A A;  2LS5 A;  2ON7 A;  2HSM A;  3HCZ A;  1QQ2 A;  1ZYQ B;  1SL0 B;  3S9F A;  1M9B A;  5H5S A;  1V9W A;  2X99 A;  2TIR A;  5IOW A;  1NW2 A;  4PTS A;  4WR5 A;  1SD9 A;  1GSS A;  2YJH A;  4PUA A;  1SL2 B;  3PGT A;  2YCD A;  2RII A;  3EU3 A;  2EIR A;  4HZ4 A;  1K3Y A;  4KE3 A;  4CW9 A;  5ECS A;  4Z7X A;  1TOF A;  3AY8 A;  2VCX A;  2YOI A;  3HY2 A;  5IO0 A;  5GST A;  5CRW A;  4BL7 B;  3TCO A;  2E7P A;  3KCM A;  1RW1 A;  3IE3 A;  1JFU A;  5IPH A;  3KTL A;  5D9V A;  5HFI A;  2FWH A;  2JAD A;  4OFN A;  1UC7 A;  1GSY A;  1XFL A;  1EOH A;  2OA7 A;  4D73 B;  4X0X A;  2KP1 A;  3MNG A;  3GRX A;  4N11 A;  2X8H A;  2HSH A;  3BOA A;  5DVB A;  3D0Z A;  1AC1 A;  2WJU A;  1EGR A;  3C8E A;  2DJ3 A;  4TXO B;  1MD3 A;  1YQ1 A;  1GTI A;  1SYX A;  1TI3 A;  2VL3 A;  2VIM A;  3LJR A;  3WT1 A;  1OAZ A;  2P0G A;  3LXZ A;  1GLP A;  1NHO A;  17GS A;  4G10 A;  4XS6 A;  4EF0 A;  2L5O A;  3KMO A;  2MZC A;  3EUR A;  5CNW A;  6GSU A;  1AIU A;  1QFN A;  2ZUP A;  1SK0 A;  1MEK A;  2JSZ A;  4TKY A;  3HKR A;  5EL8 A;  4I97 A;  3QCP A;  1TK0 B;  1FAA A;  5KEJ A;  1M2A A;  3LGC A;  4PQ1 A;  2YJ7 A;  2HLS A;  1F9M A;  5JWQ B;  3RBT A;  4ZB6 A;  3IV4 A;  2NDO A;  10GS A;  4MPG A;  3D22 A;  5J41 A;  2PUK C;  5COH A;  1JZW A;  4GRF A;  3VUR A;  4G0I A;  4O7H A;  2FGX A;  2IFQ B;  5J3R A;  4IP6 A;  5J9B A;  1M9A A;  1TRS A;  2B6M A;  5B8B A;  4XCS A;  4ZL9 A;  5JWR B;  1SD8 A;  1ERU A;  1A0R P;  2AUV A;  3A2W A;  2OE0 A;  3DWV A;  3MAK A;  2C3Q A;  1TJD A;  4N30 A;  3WGE A;  3C71 A;  5D9T A;  4BVY A;  3HVV A;  2YWO A;  1GUH A;  3IXR A;  2X8G A;  5CAX A;  2H0G A;  4YQV A;  3NIV A;  1N8J A;  3KP9 A;  1KTE A;  4TR3 A;  2R4V A;  5DCG A;  4V2M A;  2L57 A;  3DVW A;  3UL3 A;  1GSQ A;  1VF1 A;  2WFC A;  5ECP B;  4LMW A;  1C72 A;  1XXU A;  4KDY A;  2QGV A;  3UJ1 A;  3Q74 A;  5C04 A;  2B1K A;  2GSQ A;  1EZK A;  2B3S A;  1FVK A;  5B7C A;  4OO5 A;  2NVL A;  3G7J A;  3F9U A;  3UMA A;  4MK3 A;  2M72 A;  3KJY A;  3IHQ A;  1A23 A;  1GNE A;  2HSY A;  3GH9 A;  5A4W A;  3GA4 A;  3EIN A;  3D6I A;  1U88 A;  2ZNM A;  4QQ7 A;  3ZIJ A;  1J0F A;  1VF4 A;  4NPB A;  3IDV A;  2DLX A;  2YN1 A;  1DBY A;  3F8U A;  2NPB A;  2H0H A;  4QL9 A;  4EUY A;  1YJ6 A;  11GS A;  3ZVJ D;  3Q19 A;  1S3D A;  1JLV A;  1JZR A;  2FD3 A;  1BQ7 A;  5DDL A;  2CZ3 A;  2D2Z A;  4EC0 A;  2OE1 A;  4I8B A;  1Z6M A;  3DYR A;  4OFT A;  2IME A;  4EE0 A;  1ZYE A;  4XS4 A;  4IEL A;  1FOV A;  3DEX A;  2H6Y A;  3KGK A;  1PN9 A;  2XPD A;  4AF2 A;  4NWY A;  2O85 A;  5C00 A;  3N9J A;  3DD3 A;  4DSQ A;  4TR0 A;  2VCV A;  2TRX A;  4POK A;  3VI5 A;  2HE3 A;  2DMM A;  4ILF A;  2YV7 A;  3GN3 A;  4IQA A;  1FB6 A;  4N0V A;  4BVX B;  2H01 A;  5ABR A;  1A8L A;  2HSN B;  2NTO A;  3GX0 A;  13GS A;  1MDK A;  2KHP A;  4HU7 A;  1EV9 A;  2MYG A;  3H93 A;  4IGJ A;  4PX1 A;  2M80 A;  4JR6 A;  2WGR A;  3JCM L;  4OCF A;  1G6Y A;  1Z9H A;  2H6X A;  3F4S A;  2H73 A;  4FO5 A;  1GTA A;  3PH9 A;  3EC3 A;  4F82 A;  1FO5 A;  4DEJ A;  4X43 A;  3RHB A;  1YEP A;  5AIS A;  3G9B A;  2OAD A;  4NV2 A;  4FIW A;  3FEU A;  4KDX A;  1R4W A;  3M0F A;  1MDJ A;  1V98 A;  5F8B A;  3VPQ A;  2G2Q A;  1M0U A;  4EL1 A;  3FR9 A;  4ECI A;  4K9Z A;  3ZFL A;  1LBK A;  3TJF A;  4O32 A; 
#chains in the Genus database with same CATH topology
 1F3B A;  4CY6 A;  2PMT A;  2O5V A;  2VD1 A;  3OR5 A;  3VK9 A;  2R2J A;  3HJP A;  3TJB A;  4ZB9 A;  2L4C A;  2A2S A;  5DQY A;  3P90 A;  2OE3 A;  4NXI A;  1F37 A;  3ZL5 A;  2QA1 A;  2CT6 A;  2LQO A;  4YKG A;  3NOF A;  1QXH A;  2X64 A;  4K7N A;  4L5O A;  4YKF A;  2C3T A;  3I69 A;  4FYC A;  4K0N A;  3ED3 A;  1PKW A;  2LQQ A;  2H75 A;  5H5Q A;  3GX8 A;  3CBU A;  3GTU A;  1WPI A;  3O3T A;  1TK5 B;  3F0I A;  2R0C A;  2YP6 A;  3FRC A;  4RI6 A;  3F6F A;  2DJJ A;  1O73 A;  4WEY A;  1MD4 A;  3WT2 A;  1W4V A;  5BMU B;  2CVB A;  3VWV A;  2IL3 A;  4TN8 A;  1A2M A;  3QR6 A;  2R6K A;  4MH2 A;  4YAP A;  3GKX A;  1WP0 A;  3C1R A;  5B8A A;  2FA4 A;  3WGX A;  3ISO A;  3TKS C;  3GNJ A;  3GKN A;  4HS1 A;  1T4Y A;  4AJ7 A;  1PL2 A;  3M3M A;  19GS A;  4XTS A;  4Z2T A;  4N10 A;  4KB3 A;  5DAL A;  4BA7 A;  2CA8 A;  1GP1 A;  4MP4 A;  1XWC A;  3IC8 A;  1BG1 A;  1X0R A;  4ZBB A;  4WBJ A;  2A2P A;  3D4M A;  5D8I A;  2L6C A;  1B9X C;  14GS A;  2VLT A;  3DVX A;  5IOX A;  3J7Y b;  4Z2R A;  4XS1 A;  5GZZ B;  4MMM A;  4IJ3 A;  3ZTL A;  1PX6 A;  2HQT A;  1O8W A;  1SKS B;  4NAX A;  2YWN A;  2IWT A;  4ECB A;  1XWB A;  1K3L A;  1WWJ A;  2X49 A;  3WD6 A;  1TP9 A;  3HVN A;  3GL3 A;  1H4O A;  3TRX A;  1GSF A;  3IHG A;  3TKS E;  1LU4 A;  4IVF A;  1HD2 A;  3FW2 A;  2OT3 A;  1S3R A;  1N25 A;  1ACV A;  1SEN A;  4MJB A;  1K0C A;  1JZO A;  5ECN B;  3HJO A;  4IP1 A;  2K18 A;  3H8Q A;  1UA5 A;  1T3B A;  4L0U A;  1X5D A;  4IHU A;  2YAN A;  4FYB A;  3TJJ A;  4BWQ A;  5EVO A;  4F0C A;  5H5R A;  3GST A;  4AKI A;  5A1N B;  2B7J A;  2CAQ A;  3BJ5 A;  2R37 A;  3GMF A;  4V2N A;  3UOM A;  5CO3 A;  1OC9 A;  2BJX A;  6GSS A;  5HFG A;  2YWI A;  5ID2 B;  1ZOF A;  2EIQ A;  3V1W A;  5ECM B;  3PIN A;  1OKT A;  1R5A A;  3LEF A;  4JBB A;  2VCQ A;  4PUR A;  2H70 A;  4JR4 A;  1EEM A;  3EWL A;  4ID0 A;  3A5W A;  5G1K A;  2GT6 A;  1T1V A;  1VF2 A;  1ZZY A;  4W66 A;  5LCZ A;  3FZ4 A;  2GZP A;  1I5G A;  3R2Q A;  3VWU A;  2HZF A;  2EC4 A;  5D96 A;  1GNW A;  1SJI A;  3QFB C;  2WB9 A;  4MPF A;  5ECQ B;  4CDO A;  2HZE A;  3RAZ A;  1B4Q A;  2H76 A;  2DJ1 A;  4MF5 A;  5D9X A;  16GS A;  3ZYW A;  4TOP A;  4JE1 A;  1AW9 A;  2PBJ A;  3I6A A;  5DCH A;  2LNS A;  1E6B A;  5ELA A;  3ZLP A;  3ZML A;  1U3I A;  1TRU A;  2IMD A;  1B8X A;  2WS2 A;  1X5E A;  2LUS A;  2NBS A;  2GLR A;  4TR1 A;  2WW3 A;  4OMV A;  3O6T A;  1TRW A;  2HRK B;  2HRF A;  1GUK A;  5A4V A;  1SK2 A;  3UBL A;  3EMP A;  1FG4 A;  2REM A;  3A2V A;  1WJK A;  2TRC P;  4KCE A;  2ON5 A;  2VL9 A;  18GS A;  1ZGN A;  3BCK A;  2DC5 A;  2RUF A;  2MMO A;  4FH8 A;  4DSS B;  2YZU A;  4IKH A;  2MBS A;  3GSS A;  1SVL A;  2FLS A;  3FY7 A;  2GSS A;  4WET A;  1GTB A;  3TKP A;  3A3T A;  1O6J A;  2GGT A;  1GH2 A;  1THO A;  2VCT A;  2UZ8 A;  1XOA A;  2GT5 A;  2RLI A;  2C1Y A;  1K0M A;  2DIZ A;  4KW6 A;  1K3O A;  3UAR A;  1XVQ A;  5HR2 A;  5CYY A;  3W8J A;  2LKU A;  2LTK A;  5ENU A;  2LJA A;  4POM A;  4OD7 A;  1KNG A;  1XOB A;  2GZZ A;  2HI7 A;  5HR1 A;  12GS A;  3F6D A;  5FT3 A;  4J56 E;  3GL5 A;  3FZ5 A;  4KX4 A;  1WIK A;  1PD2 1;  1U3A A;  2LNT A;  4GQF A;  1TU8 A;  4GWR A;  4USS A;  4LL1 B;  4DVC A;  5IMD A;  4EDZ A;  1BX9 A;  5DAK A;  1OKD A;  5IMC A;  2HSM B;  3O76 A;  4G0K A;  4V1A p;  3BBY A;  4PUF C;  4X4J A;  4MZB A;  3H4K A;  4F0B A;  3EE2 A;  4KSO A;  4FYU A;  1T4Z A;  2H74 A;  4JRR A;  4ULX A;  2PVO C;  4NHW A;  4HU9 A;  3APS A;  2C0E A;  2WVZ A;  1PL1 A;  1Y6E A;  2HT9 A;  1GRX A;  5LD0 A;  3HDC A;  5IIZ A;  3C1S A;  2GQM A;  2F8F A;  1USB A;  3KZQ A;  1Z7R A;  3IPZ A;  4POB A;  2LRN A;  3GKM A;  2HXK A;  5BRT A;  4GCI A;  1TI1 A;  1GUL A;  1A8Y A;  1SJ6 A;  4JU5 A;  3KD0 A;  4MF7 A;  1NM3 A;  2V41 A;  4A5P A;  1GSE A;  4PI2 C;  4YQM A;  1AUC A;  4OWY A;  4ML6 A;  3DKS A;  1WOU A;  2VOC A;  1BED A;  1RQM A;  1ON4 A;  3QD9 A;  4AJ6 A;  3P2A A;  2L4Q A;  1A24 A;  2R3X A;  4NV5 A;  3VI7 A;  3TOT A;  4ZIJ A;  4JED A;  3Q6O A;  4BPY A;  3F63 A;  1GSU A;  4XIH A;  3GV1 A;  5JCW A;  5HR3 A;  3L78 A;  1OE8 A;  2VO4 A;  4ZB8 A;  4LA1 A;  2H1B A;  2CVK A;  2KOK A;  1Z5Y E;  5IQY A;  5D73 A;  4GST A;  3UVH A;  4IN0 A;  2I81 A;  2C8U A;  4L5L A;  4N3Z A;  2P31 A;  5JWO B;  3HA9 A;  1RK4 A;  1JLW A;  4I2U A;  5KOW A;  3GFK A;  5JCG A;  3ZZX A;  1UN2 A;  2GS3 A;  3CSJ A;  2L6D A;  4KDU A;  2H0I A;  3W8S A;  2LJK A;  4RQR A;  4O5R A;  4XHM A;  3DGQ A;  5AGY A;  3ZRD A;  5ECO B;  2C0D A;  2VL2 A;  1QK8 A;  3UVT A;  4RI7 A;  4HEA 2;  1M2D A;  1GL8 A;  5F0G A;  2JZR A;  4KH7 A;  1Y1U A;  2OJL A;  3KMN A;  3IOS A;  1UVZ A;  3FR6 A;  4GDF A;  1R26 A;  1ERV A;  1XW6 A;  4NMU A;  2EFD A;  3IAS 2;  2CX3 A;  1IYH A;  5DQS A;  4OO4 A;  2R0P A;  1ZL9 A;  2H71 A;  2B1L A;  1OC3 A;  6GSX A;  2RM5 A;  1AQV A;  1EWX A;  3GHA A;  2N5A A;  4IW9 A;  2IMK A;  3U6V A;  4ML1 A;  4GQC A;  3KXO A;  1DE2 A;  3KTB A;  2R5G A;  3D21 A;  4BVY B;  1AXD A;  2MMZ A;  3QAG A;  1R5P A;  4EDY A;  1JZD A;  2XBQ A;  4ZB7 A;  5IM9 A;  3WGD A;  2A2R A;  2GZY A;  4V1A g;  2XBI A;  2ZCT A;  5A34 A;  3VWW A;  3W6G A;  4ISD A;  3GUR A;  1HQO A;  4K0G A;  3H1N A;  2QKE A;  5B6M A;  4MLY A;  4G9H A;  4PNF A;  5GAP D;  3LXT A;  9GSS A;  3GH6 A;  2WVY A;  5G30 A;  4BWS A;  1ERT A;  1TTZ A;  3TU3 B;  3ZRE A;  3TUE A;  2OAC A;  2RUE A;  1PSQ A;  2B5Y A;  1Z3E A;  5AN1 A;  3QAV A;  4HQZ A;  1T8E B;  1EEJ A;  5FHI A;  2K8V A;  1SU9 A;  4G0L A;  4LL4 B;  2JL4 A;  2JZS A;  2QC7 A;  2F3M A;  1K0A A;  5KN3 A;  3VFI A;  6GSW A;  2YNX A;  3LFL A;  1WE0 A;  4RUV A;  5AIV A;  3CTG A;  1A0F A;  3LYK A;  1ZYN A;  2H19 A;  2P5R A;  3L9S A;  6GSV A;  2FCH A;  2O87 A;  7GSS A;  4IBP A;  4PI0 C;  3LQ7 A;  4EXJ A;  1PA3 A;  2I1U A;  3TJG A;  4F03 A;  2LRC A;  1B9Y C;  3ERG A;  1EV4 A;  3I43 A;  4AGS A;  2J23 A;  1K0O A;  2H1A A;  3CTF A;  2F51 A;  4G19 A;  2WVX B;  4XS4 B;  4F2I A;  2C4J A;  1BG5 A;  4E8H A;  8GSS A;  2BTO T;  1SKR B;  3L0H A;  1XVW A;  4BL7 A;  3QMX A;  5HR0 A;  3IR4 A;  4Q5R A;  2KP2 A;  2IPA A;  3CRU A;  3DIE A;  4IS0 A;  1B4P A;  1X5C A;  2FUG 2;  4I5Q A;  2PVQ A;  2J9H A;  3L4N A;  3CHX C;  4LLR A;  2HNL A;  1XWA A;  5B6N A;  1JHB A;  1GSD A;  3CMI A;  1PQN A;  4D73 A;  5KN1 A;  1TK8 B;  4XRD A;  1QMV A;  2EFC A;  5EY6 A;  3M9J A;  5DBQ A;  4GTU A;  3ERW A;  3KP8 A;  3M9K A;  3MDK A;  2MMN A;  1G0T A;  6GST A;  4N0Z A;  3E3E A;  4RQX A;  1IYI A;  4ZBA A;  2M46 A;  1SL1 B;  3DML A;  4AKX B;  3C73 A;  2FHE A;  4TXO A;  2XC2 A;  1K0B A;  1V58 A;  3QFA C;  2FY6 A;  4Q5N A;  4ZBD A;  2WRT A;  1S3C A;  4TXV A;  3G7Y A;  2O7K A;  1XIY A;  1YF0 A;  3Q18 A;  1BAY A;  1YZX A;  2FA8 A;  3L9V A;  2O3E A;  5G2Z A;  2A4V A;  3PR8 A;  3UBK A;  3LWA A;  1Z6N A;  2VKZ G;  1OVN A;  3QDN A;  3TRQ A;  4LMV A;  4EO3 A;  1YEW C;  4ECJ A;  4HJ2 A;  4KGI A;  1E2Y A;  2GTU A;  2V32 A;  1THX A;  4KND A;  4PQI A;  3ZMK A;  3TDG A;  1NHY A;  4J2F A;  4E68 A;  5G1L A;  3F3R A;  4POL A;  1A2J A;  4WBR D;  4PHZ C;  3D4T A;  1PGT A;  4I2T A;  5A5H B;  1B48 A;  5CRG A;  2IFQ A;  4HOJ A;  3GKK A;  1YKA A;  2L59 A;  5INY A;  3TOU A;  2MMA A;  2I9H A;  3IC4 A;  4O92 A;  3U5R E;  3EVI A;  3GTU B;  3HD5 A;  2CV4 A;  3A2X A;  1N2A A;  3FKF A;  2VLV A;  1TKD B;  5KN2 A;  2AV4 A;  1M99 A;  2GDR A;  4GSS A;  1SKW B;  2F8A A;  2PU9 C;  2N5B A;  2VM1 A;  5J4U A;  2O8V B;  1Q4J A;  1URM A;  4TR4 A;  4O5Q A;  5G5E A;  2GSR A;  4O5U A;  4TW5 A;  2FNO A;  2ALB A;  5DAL B;  4MZC A;  1HNC A;  5IMV A;  1YY7 A;  1EP7 A;  2XHF A;  1X9M B;  4MA9 A;  2JU5 A;  3KH7 A;  3HVS A;  4KUN A;  2K8S A;  1WRY A;  3J7Y k;  2R0G A;  1ILO A;  1FHE A;  5F07 A;  3K8N A;  3LSZ A;  2WUL A;  1DE1 A;  3GIX A;  3F4R A;  3DRN A;  2DJ0 A;  2WDU A;  1GWC A;  1G6W A;  2IMI A;  3LYP A;  2CVD A;  1F6M C;  3LW9 A;  2VCW A;  1Q98 A;  1J08 A;  4X1U A;  3CYN A;  2PN8 A;  1TW9 A;  5G5F A;  5IO2 A;  4K5R A;  4F9Z A;  4ECC A;  5ECH B;  3H79 A;  1FVJ A;  2Z9S A;  3HJM A;  2VUP A;  4MH3 A;  3E9J B;  4HQS A;  3KIJ A;  3ZIV A;  22GS A;  1XCC A;  5ECI B;  2H66 A;  2EIO A;  1AAZ A;  4I6X A;  3US3 A;  2EFE A;  4GXZ A;  5D9W A;  2VLU A;  1LJR A;  4IJI A;  4PNG A;  1XBS A;  3TKQ A;  2HYX A;  2BMX A;  1YF1 A;  1G7O A;  3ZVJ A;  4L0W A;  2I3Y A;  4K6X A;  3P7X A;  2CZ2 A;  1K0N A;  1T7P B;  3CXG A;  5DJL A;  2AJQ B;  1OC9 B;  3HVX A;  3UEM A;  1M2B A;  1CQG A;  1CQH A;  2DJK A;  4JZQ A;  2V2G A;  4DSR A;  1VF3 A;  2AAW A;  2QA2 A;  2GQK A;  1U87 A;  1XZO A;  1XPV A;  1YVL A;  3EU4 A;  3CWG A;  1R7H A;  4BVX A;  5CRE A;  2HSN A;  3TKR A;  3FK8 A;  2PGT A;  3FZA A;  1HYU A;  1TRV A;  6GSY A;  4PGT A;  1H75 A;  2DSA A;  4QL7 A;  5CRD A;  2DBC A;  5E59 A;  3M1G A;  4P3Y B;  2GST A;  2P5Q A;  3ME8 A;  3R3E A;  1KBN A;  3L9U A;  3BCI A;  1U6T A;  4L8E A;  4GF0 A;  4AJ8 A;  1QUW A;  3EYT A;  1M7T A;  2WW1 A;  5A5K A;  2VCZ A;  1PX7 A;  2FWF A;  1V40 A;  2HZE B;  2JAC A;  2E2G A;  2AHE A;  5L71 A;  5IPG A;  2E0Q A;  2V1M A;  5ELG A;  3HZ4 A;  4BIK A;  2LST A;  2CX4 A;  3UIW A;  1W89 A;  1SK1 A;  2K6V A;  4ZIL A;  4MJE A;  2IIY A;  3FYG A;  1YEX A;  2H6Z A;  4EKZ A;  4TR1 B;  3FHK A;  3TGZ A;  1F2E A;  2PPT A;  5G31 A;  4GLT A;  1VRS D;  3IRA A;  4WR4 A;  3E0U A;  1M3J A;  2LEG A;  2VAF A;  2GVP A;  5EPF A;  2OKA A;  2H8L A;  1TXX A;  3FR3 A;  3EPT A;  4ZXG A;  5KN0 A;  1SVM A;  2X8C A;  2MBT A;  4TVE A;  3TRP A;  5GAN D;  2UV8 G;  4MZW A;  4MAB A;  3KM6 A;  3ME7 A;  4CHS A;  4K1F A;  1X9S B;  3RGB C;  5BMU A;  3VWX A;  2FWE A;  2N5F A;  4K8M A;  1J9B A;  2G0F A;  4ZL7 A;  1GTU A;  4ZL8 A;  3SWL A;  3UAP A;  3RPN A;  5DJM A;  2V6K A;  3HZ8 A;  2LRT A;  1OE7 A;  1I1I P;  1X9W B;  1XW5 A;  3G7I A;  3RDW A;  1G7E A;  4KSM A;  1DUG A;  4EIP A;  2KLX A;  4E8E A;  2YWM A;  5DAK B;  3TKS A;  4IQ1 A;  3QOU A;  2DJ2 A;  1BJX A;  3MSZ A;  2C80 A;  4WF5 A;  1NSW A;  5IMA A;  2F9S A;  1YDK A;  4NHZ A;  1V57 A;  4H86 A;  4J57 E;  1GUM A;  3WYW A;  3ZFB A;  3LG6 A;  2HFD A;  4HDE A;  3CSI A;  3ERF A;  2WZ9 A;  2IMF A;  5AIX A;  2FWG A;  1YKC A;  1SYR A;  5F05 A;  2DML A;  1EGO A;  5KOX A;  2B5E A;  2WZS A;  4KA0 A;  5E4W A;  1PKZ A;  3KH9 A;  1O81 A;  4TRX A;  2ES7 A;  1O8X A;  4Q5Q A;  2AYT A;  4EVM A;  4WXT A;  2XPE A;  4G2E A;  3VLN A;  1PMT A;  1AQX A;  3I9V 2;  2L5L A;  4MDC A;  1I9D A;  2QSI A;  4MJC A;  5IMZ A;  2O89 A;  5JCU A;  1ABA A;  2AB6 A;  3IA1 A;  2K9F A;  5A1N A;  2OBI A;  1ML6 A;  2PER A;  1AQW A;  2JZT A;  5ECR B;  1EP8 A;  3IAM 2;  1WMJ A;  5J9C A;  5ID2 A;  1FW1 A;  1S4B P;  2WCI A;  4GSN A;  3RHC A;  5D93 A;  2CAI A;  2VM2 A;  4KAE A;  1ZCP A;  3BD2 A;  5A5H A;  1PN0 A;  4HI7 A;  2B5X A;  3M8N A;  1VGL A;  1F3A A;  5ECK B;  3NZN A;  3HHV A;  4HZ2 A;  1BYE A;  2VL2 C;  20GS A;  4WKW A;  3SBC A;  4PXO A;  3TJK A;  1MDI A;  4PQH A;  3C7M A;  3GYK A;  3F4T A;  2JSY A;  2DKI A;  5HQP A;  5J5N A;  5IMF A;  2YV9 A;  3CSH A;  3IBH A;  2IN3 A;  1O7U A;  3FZ9 A;  1FB0 A;  2PWJ A;  4KCA A;  2RM6 A;  3LOR A;  1M3I A;  2YZH A;  2DKH A;  1TDI A;  1ZMA A;  1O85 A;  3EMX A;  3APO A;  1QGV A;  4HJM A;  3FMW A;  4MNN A;  4KF9 A;  3GUS A;  5ECL B;  4Q5F A;  1DSB A;  4K2D A;  3F3Q A;  4MJA A;  1GLQ A;  2OBK A;  2CQ9 A;  1T00 A;  3HYP A;  3IK9 A;  2C0F A;  5LNK e;  3KEB A;  3PPU A;  2GQL A;  2HRK A;  2H1G A;  4V2L A;  2I4A A;  3P8W A;  3CQF A;  1OYJ A;  1PRX A;  1Z7P A;  3TB2 A;  2C0G A;  1TU7 A;  1XWG A;  2H30 A;  4DSS A;  2LJR A;  4HUA A;  5F06 A;  4OCE A;  1S3A A;  4K7I A;  2EFH A;  3MWH A;  3ZIT A;  5FWG A;  3QAW A;  1ST9 A;  3HXS A;  3A5I A;  4FXY P;  4WF4 A;  1XW9 A;  2HRA A;  2HRN A;  1Y25 A;  1KEB A;  1HNB A;  1EOG A;  4YAV A;  1K0D A;  2C3N A;  3CRT A;  4Z2U A;  2LV3 A;  5HFK A;  5CRH A;  3VPT A;  2YPM A;  4MF6 A;  4OFM A;  2H1D A;  5GSS A;  5A34 B;  2KUC A;  2B7K A;  3APQ A;  4YH2 A;  3D5J A;  5CP1 A;  4YQU A;  3DXB A;  5J40 A;  3N5O A;  1A2L A;  1MTC A;  4K7O A;  5A4U A;  1XWK A;  1ERW A;  1HNA A;  1SJZ A;  3RPP A;  5J47 A;  3QPM A;  2DIY A;  1OC8 A;  3IK7 A;  1SVO A;  4XRA A;  3HMJ G;  2VD0 A;  4MCU A;  2E2M A;  4AKG A;  4FQU A;  2H72 A;  4ACS A;  2IJY A;  2V6O A;  1V2A A;  2LS5 A;  2ON7 A;  2HSM A;  3HCZ A;  1QQ2 A;  3MIX A;  1ZYQ B;  1SL0 B;  3S9F A;  1M9B A;  5H5S A;  1V9W A;  2X99 A;  2TIR A;  5IOW A;  1NW2 A;  4PTS A;  4WR5 A;  1SD9 A;  1GSS A;  2YJH A;  4PUA A;  1SL2 B;  3PGT A;  2YCD A;  2RII A;  3EU3 A;  2A4H A;  2EIR A;  4HZ4 A;  1K3Y A;  4KE3 A;  4ICY A;  4CW9 A;  5ECS A;  4Z7X A;  1TOF A;  3AY8 A;  2VCX A;  2YOI A;  3HY2 A;  5IO0 A;  5GST A;  5CRW A;  4BL7 B;  3TCO A;  4CY8 A;  2E7P A;  3KCM A;  1RW1 A;  3IE3 A;  1JFU A;  5IPH A;  3KTL A;  5D9V A;  5HFI A;  2FWH A;  2X4A A;  1XG8 A;  2JAD A;  4OFN A;  4K2X A;  1UC7 A;  1GSY A;  1XFL A;  5J4V A;  1EOH A;  2OA7 A;  4D73 B;  4X0X A;  2KP1 A;  3MNG A;  3GRX A;  4N11 A;  2X8H A;  2HSH A;  3BOA A;  5DVB A;  3D0Z A;  1AC1 A;  2WJU A;  1EGR A;  3C8E A;  2DJ3 A;  4TXO B;  1MD3 A;  1YQ1 A;  1GTI A;  1SYX A;  1TI3 A;  2VL3 A;  2VIM A;  4AI6 A;  3LJR A;  3WT1 A;  1OAZ A;  2P0G A;  3LXZ A;  3RFR C;  1GLP A;  1NHO A;  17GS A;  4G10 A;  4XS6 A;  4EF0 A;  2L5O A;  3KMO A;  2MZC A;  3EUR A;  5CNW A;  6GSU A;  1AIU A;  1QFN A;  2ZUP A;  1SK0 A;  1MEK A;  2JSZ A;  4QMK A;  4TKY A;  3HKR A;  5EL8 A;  4I97 A;  3QCP A;  1TK0 B;  1FAA A;  5KEJ A;  1M2A A;  3LGC A;  4PQ1 A;  2YJ7 A;  2HLS A;  1F9M A;  5JWQ B;  3RBT A;  4ZB6 A;  3IV4 A;  2NDO A;  10GS A;  4MPG A;  3D22 A;  5J41 A;  2PUK C;  5COH A;  1JZW A;  4GRF A;  3VUR A;  4G0I A;  4O7H A;  2FGX A;  2IFQ B;  5J3R A;  4IP6 A;  5J9B A;  1M9A A;  3MYD A;  1TRS A;  4EIQ A;  2WW0 A;  2B6M A;  5B8B A;  4XCS A;  4ZL9 A;  5JWR B;  1SD8 A;  1ERU A;  1A0R P;  2AUV A;  3A2W A;  2OE0 A;  3DWV A;  3MAK A;  2C3Q A;  1TJD A;  4N30 A;  3WGE A;  3C71 A;  5D9T A;  4G01 A;  4BVY A;  3HVV A;  1BF5 A;  2YWO A;  1GUH A;  3IXR A;  2X8G A;  5CAX A;  2H0G A;  4YQV A;  3NIV A;  1N8J A;  3KP9 A;  1KTE A;  4TR3 A;  2R4V A;  5DCG A;  4V2M A;  2L57 A;  3DVW A;  3UL3 A;  1GSQ A;  1FOH A;  1VF1 A;  2WFC A;  4K5S A;  5ECP B;  4LMW A;  1C72 A;  1XXU A;  4KDY A;  2QGV A;  3UJ1 A;  1PFO A;  3Q74 A;  5C04 A;  2B1K A;  2GSQ A;  4AKH A;  1EZK A;  2B3S A;  1FVK A;  5B7C A;  4OO5 A;  2NVL A;  3G7J A;  3F9U A;  3UMA A;  4MK3 A;  2M72 A;  3KJY A;  3IHQ A;  1A23 A;  1GNE A;  2HSY A;  3GH9 A;  5A4W A;  3GA4 A;  3EIN A;  3D6I A;  1U88 A;  2ZNM A;  4QQ7 A;  3ZIJ A;  1J0F A;  1VF4 A;  4NPB A;  3IDV A;  2DLX A;  1TXU A;  1ZYP A;  2YN1 A;  1DBY A;  3F8U A;  2NPB A;  2H0H A;  4QL9 A;  4EUY A;  1YJ6 A;  11GS A;  3ZVJ D;  3Q19 A;  1S3D A;  1JLV A;  1JZR A;  2FD3 A;  1BQ7 A;  5DDL A;  2CZ3 A;  2D2Z A;  4EC0 A;  2OE1 A;  4I8B A;  1Z6M A;  3DYR A;  4OFT A;  2IME A;  2WVX A;  4EE0 A;  1ZYE A;  4XS4 A;  4IEL A;  1FOV A;  5J4Y A;  3DEX A;  2H6Y A;  2XPD A;  1PN9 A;  3KGK A;  4AF2 A;  4NWY A;  2O85 A;  5C00 A;  2H1L A;  3N9J A;  3DD3 A;  4DSQ A;  4TR0 A;  2VCV A;  2TRX A;  4POK A;  3VI5 A;  2HE3 A;  2DMM A;  4ILF A;  2YV7 A;  3GN3 A;  4IQA A;  1FB6 A;  4N0V A;  4BVX B;  2H01 A;  5ABR A;  1A8L A;  2HSN B;  2NTO A;  3GX0 A;  13GS A;  2WW2 A;  1MDK A;  2KHP A;  4HU7 A;  1EV9 A;  2MYG A;  3H93 A;  4IGJ A;  4PX1 A;  2M80 A;  4JR6 A;  2WGR A;  3JCM L;  4OCF A;  1G6Y A;  1Z9H A;  2H6X A;  3F4S A;  2H73 A;  4FO5 A;  1GTA A;  4HSC X;  3PH9 A;  3EC3 A;  4F82 A;  1FO5 A;  4DEJ A;  4X43 A;  3RHB A;  1YEP A;  5AIS A;  3G9B A;  2OAD A;  4NV2 A;  2O36 A;  4FIW A;  3FEU A;  4KDX A;  1R4W A;  3M0F A;  1MDJ A;  1V98 A;  5F8B A;  3VPQ A;  2G2Q A;  1M0U A;  4EL1 A;  3FR9 A;  4ECI A;  4K9Z A;  3ZFL A;  1LBK A;  3TJF A;  4O32 A; 
#chains in the Genus database with same CATH homology
 1F3B A;  4CY6 A;  2PMT A;  2O5V A;  2VD1 A;  3OR5 A;  3VK9 A;  2R2J A;  3HJP A;  3TJB A;  4ZB9 A;  2L4C A;  2A2S A;  5DQY A;  3P90 A;  2OE3 A;  4NXI A;  1F37 A;  3ZL5 A;  2QA1 A;  2CT6 A;  2LQO A;  4YKG A;  3NOF A;  1QXH A;  2X64 A;  4K7N A;  4L5O A;  4YKF A;  2C3T A;  3I69 A;  4FYC A;  4K0N A;  3ED3 A;  1PKW A;  2LQQ A;  2H75 A;  5H5Q A;  3GX8 A;  3CBU A;  3GTU A;  1WPI A;  3O3T A;  1TK5 B;  3F0I A;  2R0C A;  2YP6 A;  3FRC A;  4RI6 A;  3F6F A;  2DJJ A;  1O73 A;  4WEY A;  1MD4 A;  3WT2 A;  1W4V A;  5BMU B;  2CVB A;  3VWV A;  2IL3 A;  4TN8 A;  1A2M A;  3QR6 A;  2R6K A;  4MH2 A;  4YAP A;  3GKX A;  1WP0 A;  3C1R A;  5B8A A;  2FA4 A;  3WGX A;  3ISO A;  3TKS C;  3GNJ A;  3GKN A;  4HS1 A;  1T4Y A;  4AJ7 A;  1PL2 A;  3M3M A;  19GS A;  4XTS A;  4Z2T A;  4N10 A;  4KB3 A;  5DAL A;  4BA7 A;  2CA8 A;  1GP1 A;  4MP4 A;  1XWC A;  3IC8 A;  1BG1 A;  1X0R A;  4ZBB A;  4WBJ A;  2A2P A;  3D4M A;  5D8I A;  2L6C A;  1B9X C;  14GS A;  2VLT A;  3DVX A;  5IOX A;  3J7Y b;  4Z2R A;  4XS1 A;  5GZZ B;  4MMM A;  4IJ3 A;  3ZTL A;  1PX6 A;  2HQT A;  1O8W A;  1SKS B;  4NAX A;  2YWN A;  2IWT A;  4ECB A;  1XWB A;  1K3L A;  1WWJ A;  2X49 A;  3WD6 A;  1TP9 A;  3GL3 A;  1H4O A;  3TRX A;  1GSF A;  3IHG A;  3TKS E;  1LU4 A;  4IVF A;  1HD2 A;  3FW2 A;  2OT3 A;  1N25 A;  1ACV A;  1SEN A;  4MJB A;  1K0C A;  1JZO A;  5ECN B;  3HJO A;  4IP1 A;  2K18 A;  3H8Q A;  1UA5 A;  1T3B A;  4L0U A;  1X5D A;  4IHU A;  2YAN A;  4FYB A;  3TJJ A;  4BWQ A;  5EVO A;  4F0C A;  5H5R A;  3GST A;  4AKI A;  5A1N B;  2B7J A;  2CAQ A;  3BJ5 A;  2R37 A;  3GMF A;  4V2N A;  3UOM A;  5CO3 A;  1OC9 A;  2BJX A;  6GSS A;  5HFG A;  2YWI A;  5ID2 B;  1ZOF A;  2EIQ A;  3V1W A;  5ECM B;  3PIN A;  1OKT A;  1R5A A;  3LEF A;  4JBB A;  2VCQ A;  4PUR A;  2H70 A;  4JR4 A;  1EEM A;  3EWL A;  4ID0 A;  3A5W A;  5G1K A;  2GT6 A;  1T1V A;  1VF2 A;  1ZZY A;  4W66 A;  5LCZ A;  3FZ4 A;  2GZP A;  1I5G A;  3R2Q A;  3VWU A;  2HZF A;  2EC4 A;  5D96 A;  1GNW A;  1SJI A;  3QFB C;  2WB9 A;  4MPF A;  5ECQ B;  4CDO A;  2HZE A;  3RAZ A;  1B4Q A;  2H76 A;  2DJ1 A;  4MF5 A;  5D9X A;  16GS A;  3ZYW A;  4TOP A;  4JE1 A;  1AW9 A;  2PBJ A;  3I6A A;  5DCH A;  2LNS A;  1E6B A;  5ELA A;  3ZLP A;  3ZML A;  1U3I A;  1TRU A;  2IMD A;  1B8X A;  2WS2 A;  1X5E A;  2LUS A;  2NBS A;  2GLR A;  4TR1 A;  4OMV A;  3O6T A;  1TRW A;  2HRK B;  2HRF A;  1GUK A;  5A4V A;  1SK2 A;  3UBL A;  3EMP A;  1FG4 A;  2REM A;  3A2V A;  1WJK A;  2TRC P;  4KCE A;  2ON5 A;  2VL9 A;  18GS A;  1ZGN A;  3BCK A;  2DC5 A;  2RUF A;  2MMO A;  4FH8 A;  4DSS B;  2YZU A;  4IKH A;  2MBS A;  3GSS A;  1SVL A;  2FLS A;  3FY7 A;  2GSS A;  4WET A;  1GTB A;  3TKP A;  3A3T A;  1O6J A;  2GGT A;  1GH2 A;  1THO A;  2VCT A;  2UZ8 A;  1XOA A;  2GT5 A;  2RLI A;  2C1Y A;  1K0M A;  2DIZ A;  4KW6 A;  1K3O A;  3UAR A;  1XVQ A;  5HR2 A;  5CYY A;  3W8J A;  2LKU A;  2LTK A;  5ENU A;  2LJA A;  4POM A;  4OD7 A;  1KNG A;  1XOB A;  2GZZ A;  2HI7 A;  5HR1 A;  12GS A;  3F6D A;  5FT3 A;  4J56 E;  3GL5 A;  3FZ5 A;  4KX4 A;  1WIK A;  1PD2 1;  1U3A A;  2LNT A;  4GQF A;  1TU8 A;  4GWR A;  4USS A;  4LL1 B;  4DVC A;  5IMD A;  4EDZ A;  1BX9 A;  5DAK A;  1OKD A;  5IMC A;  2HSM B;  3O76 A;  4G0K A;  4V1A p;  3BBY A;  4PUF C;  4X4J A;  4MZB A;  3H4K A;  4F0B A;  3EE2 A;  4KSO A;  4FYU A;  1T4Z A;  2H74 A;  4JRR A;  4ULX A;  2PVO C;  4NHW A;  4HU9 A;  3APS A;  2C0E A;  1PL1 A;  1Y6E A;  2HT9 A;  1GRX A;  5LD0 A;  3HDC A;  5IIZ A;  3C1S A;  2GQM A;  2F8F A;  1USB A;  3KZQ A;  1Z7R A;  3IPZ A;  4POB A;  2LRN A;  3GKM A;  2HXK A;  5BRT A;  4GCI A;  1TI1 A;  1GUL A;  1A8Y A;  1SJ6 A;  4JU5 A;  3KD0 A;  4MF7 A;  1NM3 A;  2V41 A;  4A5P A;  1GSE A;  4YQM A;  1AUC A;  4OWY A;  4ML6 A;  3DKS A;  1WOU A;  2VOC A;  1BED A;  1RQM A;  1ON4 A;  3QD9 A;  4AJ6 A;  3P2A A;  2L4Q A;  1A24 A;  2R3X A;  4NV5 A;  3VI7 A;  3TOT A;  4ZIJ A;  4JED A;  3Q6O A;  4BPY A;  3F63 A;  1GSU A;  4XIH A;  3GV1 A;  5JCW A;  5HR3 A;  3L78 A;  1OE8 A;  2VO4 A;  4ZB8 A;  4LA1 A;  2H1B A;  2CVK A;  2KOK A;  1Z5Y E;  5IQY A;  5D73 A;  4GST A;  3UVH A;  4IN0 A;  2I81 A;  2C8U A;  4L5L A;  4N3Z A;  2P31 A;  5JWO B;  3HA9 A;  1RK4 A;  1JLW A;  4I2U A;  5KOW A;  3GFK A;  5JCG A;  3ZZX A;  1UN2 A;  2GS3 A;  3CSJ A;  2L6D A;  4KDU A;  2H0I A;  3W8S A;  2LJK A;  4RQR A;  4O5R A;  4XHM A;  3DGQ A;  5AGY A;  3ZRD A;  5ECO B;  2C0D A;  2VL2 A;  1QK8 A;  3UVT A;  4RI7 A;  4HEA 2;  1M2D A;  1GL8 A;  5F0G A;  2JZR A;  4KH7 A;  1Y1U A;  2OJL A;  3KMN A;  3IOS A;  1UVZ A;  3FR6 A;  4GDF A;  1R26 A;  1ERV A;  1XW6 A;  4NMU A;  2EFD A;  3IAS 2;  2CX3 A;  1IYH A;  5DQS A;  4OO4 A;  2R0P A;  1ZL9 A;  2H71 A;  2B1L A;  1OC3 A;  6GSX A;  2RM5 A;  1AQV A;  1EWX A;  3GHA A;  2N5A A;  4IW9 A;  2IMK A;  3U6V A;  4ML1 A;  4GQC A;  3KXO A;  1DE2 A;  3KTB A;  2R5G A;  3D21 A;  4BVY B;  1AXD A;  2MMZ A;  3QAG A;  1R5P A;  4EDY A;  1JZD A;  2XBQ A;  4ZB7 A;  5IM9 A;  3WGD A;  2A2R A;  2GZY A;  4V1A g;  2XBI A;  2ZCT A;  5A34 A;  3VWW A;  3W6G A;  4ISD A;  3GUR A;  1HQO A;  4K0G A;  3H1N A;  2QKE A;  5B6M A;  4MLY A;  4G9H A;  4PNF A;  5GAP D;  3LXT A;  9GSS A;  3GH6 A;  5G30 A;  4BWS A;  1ERT A;  1TTZ A;  3TU3 B;  3ZRE A;  3TUE A;  2OAC A;  2RUE A;  1PSQ A;  2B5Y A;  1Z3E A;  5AN1 A;  3QAV A;  4HQZ A;  1T8E B;  1EEJ A;  5FHI A;  2K8V A;  1SU9 A;  4G0L A;  4LL4 B;  2JL4 A;  2JZS A;  2QC7 A;  2F3M A;  1K0A A;  5KN3 A;  3VFI A;  6GSW A;  2YNX A;  3LFL A;  1WE0 A;  4RUV A;  5AIV A;  3CTG A;  1A0F A;  3LYK A;  1ZYN A;  2H19 A;  2P5R A;  3L9S A;  6GSV A;  2FCH A;  2O87 A;  7GSS A;  4IBP A;  3LQ7 A;  4EXJ A;  1PA3 A;  2I1U A;  3TJG A;  4F03 A;  2LRC A;  1B9Y C;  3ERG A;  1EV4 A;  3I43 A;  4AGS A;  2J23 A;  1K0O A;  2H1A A;  3CTF A;  2F51 A;  4G19 A;  4XS4 B;  4F2I A;  2C4J A;  1BG5 A;  4E8H A;  8GSS A;  2BTO T;  1SKR B;  3L0H A;  1XVW A;  4BL7 A;  3QMX A;  5HR0 A;  3IR4 A;  4Q5R A;  2KP2 A;  2IPA A;  3CRU A;  3DIE A;  4IS0 A;  1B4P A;  1X5C A;  2FUG 2;  4I5Q A;  3L4N A;  2J9H A;  2PVQ A;  4LLR A;  2HNL A;  1XWA A;  5B6N A;  1JHB A;  1GSD A;  3CMI A;  1PQN A;  4D73 A;  5KN1 A;  1TK8 B;  4XRD A;  1QMV A;  2EFC A;  5EY6 A;  3M9J A;  5DBQ A;  4GTU A;  3ERW A;  3KP8 A;  3M9K A;  3MDK A;  2MMN A;  1G0T A;  6GST A;  4N0Z A;  3E3E A;  4RQX A;  1IYI A;  4ZBA A;  2M46 A;  1SL1 B;  3DML A;  4AKX B;  3C73 A;  2FHE A;  4TXO A;  2XC2 A;  1K0B A;  1V58 A;  3QFA C;  2FY6 A;  4Q5N A;  4ZBD A;  2WRT A;  1S3C A;  4TXV A;  3G7Y A;  2O7K A;  1XIY A;  1YF0 A;  3Q18 A;  1BAY A;  1YZX A;  2FA8 A;  3L9V A;  5G2Z A;  2A4V A;  3PR8 A;  3UBK A;  3LWA A;  1Z6N A;  2VKZ G;  1OVN A;  3QDN A;  3TRQ A;  4LMV A;  4EO3 A;  4ECJ A;  4HJ2 A;  4KGI A;  1E2Y A;  2GTU A;  2V32 A;  1THX A;  4KND A;  4PQI A;  3ZMK A;  3TDG A;  1NHY A;  4J2F A;  4E68 A;  5G1L A;  3F3R A;  4POL A;  1A2J A;  4WBR D;  3D4T A;  1PGT A;  4I2T A;  5A5H B;  1B48 A;  5CRG A;  2IFQ A;  4HOJ A;  3GKK A;  1YKA A;  2L59 A;  5INY A;  3TOU A;  2MMA A;  2I9H A;  3IC4 A;  4O92 A;  3U5R E;  3EVI A;  3GTU B;  3HD5 A;  2CV4 A;  3A2X A;  1N2A A;  3FKF A;  2VLV A;  1TKD B;  5KN2 A;  2AV4 A;  1M99 A;  2GDR A;  4GSS A;  1SKW B;  2F8A A;  2PU9 C;  2N5B A;  2VM1 A;  5J4U A;  2O8V B;  1Q4J A;  1URM A;  4TR4 A;  4O5Q A;  5G5E A;  2GSR A;  4O5U A;  4TW5 A;  2FNO A;  2ALB A;  5DAL B;  4MZC A;  1HNC A;  5IMV A;  1YY7 A;  1EP7 A;  2XHF A;  1X9M B;  4MA9 A;  2JU5 A;  3KH7 A;  3HVS A;  4KUN A;  2K8S A;  1WRY A;  3J7Y k;  2R0G A;  1ILO A;  1FHE A;  5F07 A;  3K8N A;  3LSZ A;  2WUL A;  1DE1 A;  3GIX A;  3F4R A;  2DJ0 A;  3DRN A;  2WDU A;  1GWC A;  1G6W A;  2IMI A;  3LYP A;  2CVD A;  1F6M C;  3LW9 A;  2VCW A;  1Q98 A;  1J08 A;  4X1U A;  3CYN A;  2PN8 A;  1TW9 A;  5G5F A;  5IO2 A;  4K5R A;  4F9Z A;  4ECC A;  5ECH B;  3H79 A;  1FVJ A;  2Z9S A;  3HJM A;  2VUP A;  4MH3 A;  3E9J B;  4HQS A;  3KIJ A;  3ZIV A;  22GS A;  1XCC A;  5ECI B;  2H66 A;  2EIO A;  1AAZ A;  4I6X A;  3US3 A;  2EFE A;  4GXZ A;  5D9W A;  2VLU A;  1LJR A;  4IJI A;  4PNG A;  1XBS A;  3TKQ A;  2HYX A;  2BMX A;  1YF1 A;  1G7O A;  3ZVJ A;  4L0W A;  2I3Y A;  4K6X A;  3P7X A;  2CZ2 A;  1K0N A;  1T7P B;  3CXG A;  5DJL A;  2AJQ B;  1OC9 B;  3HVX A;  3UEM A;  1M2B A;  1CQG A;  1CQH A;  2DJK A;  4JZQ A;  2V2G A;  4DSR A;  1VF3 A;  2AAW A;  2QA2 A;  2GQK A;  1U87 A;  1XZO A;  1XPV A;  1YVL A;  3EU4 A;  3CWG A;  1R7H A;  4BVX A;  5CRE A;  2HSN A;  3TKR A;  3FK8 A;  2PGT A;  3FZA A;  1HYU A;  1TRV A;  6GSY A;  4PGT A;  1H75 A;  2DSA A;  4QL7 A;  5CRD A;  2DBC A;  5E59 A;  3M1G A;  4P3Y B;  2GST A;  2P5Q A;  3ME8 A;  3R3E A;  1KBN A;  3L9U A;  3BCI A;  1U6T A;  4L8E A;  4GF0 A;  4AJ8 A;  1QUW A;  3EYT A;  1M7T A;  5A5K A;  2VCZ A;  1PX7 A;  2FWF A;  1V40 A;  2HZE B;  2JAC A;  2E2G A;  2AHE A;  5L71 A;  5IPG A;  2E0Q A;  2V1M A;  5ELG A;  3HZ4 A;  2LST A;  2CX4 A;  3UIW A;  1W89 A;  1SK1 A;  2K6V A;  4ZIL A;  4MJE A;  2IIY A;  3FYG A;  1YEX A;  2H6Z A;  4EKZ A;  4TR1 B;  3FHK A;  3TGZ A;  1F2E A;  2PPT A;  5G31 A;  4GLT A;  1VRS D;  3IRA A;  4WR4 A;  3E0U A;  2LEG A;  2VAF A;  2GVP A;  5EPF A;  2OKA A;  2H8L A;  1TXX A;  3FR3 A;  3EPT A;  4ZXG A;  5KN0 A;  1SVM A;  2X8C A;  2MBT A;  4TVE A;  3TRP A;  5GAN D;  2UV8 G;  4MZW A;  4MAB A;  3KM6 A;  3ME7 A;  4CHS A;  4K1F A;  1X9S B;  5BMU A;  3VWX A;  2FWE A;  2N5F A;  4K8M A;  1J9B A;  2G0F A;  4ZL7 A;  1GTU A;  4ZL8 A;  3SWL A;  3UAP A;  3RPN A;  5DJM A;  2V6K A;  3HZ8 A;  2LRT A;  1OE7 A;  1X9W B;  1XW5 A;  3G7I A;  3RDW A;  1G7E A;  4KSM A;  1DUG A;  4EIP A;  2KLX A;  4E8E A;  2YWM A;  5DAK B;  3TKS A;  4IQ1 A;  3QOU A;  2DJ2 A;  1BJX A;  3MSZ A;  2C80 A;  4WF5 A;  1NSW A;  5IMA A;  2F9S A;  1YDK A;  4NHZ A;  1V57 A;  4H86 A;  4J57 E;  1GUM A;  3WYW A;  3ZFB A;  3LG6 A;  2HFD A;  4HDE A;  3CSI A;  3ERF A;  2WZ9 A;  2IMF A;  5AIX A;  2FWG A;  1YKC A;  1SYR A;  5F05 A;  2DML A;  1EGO A;  5KOX A;  2B5E A;  4KA0 A;  5E4W A;  1PKZ A;  3KH9 A;  1O81 A;  4TRX A;  2ES7 A;  1O8X A;  4Q5Q A;  2AYT A;  4EVM A;  4WXT A;  2XPE A;  4G2E A;  3VLN A;  1PMT A;  1AQX A;  3I9V 2;  2L5L A;  4MDC A;  1I9D A;  2QSI A;  4MJC A;  5IMZ A;  2O89 A;  5JCU A;  1ABA A;  2AB6 A;  3IA1 A;  2K9F A;  5A1N A;  2OBI A;  1ML6 A;  2PER A;  1AQW A;  2JZT A;  5ECR B;  1EP8 A;  3IAM 2;  1WMJ A;  5J9C A;  5ID2 A;  1FW1 A;  2WCI A;  4GSN A;  3RHC A;  5D93 A;  2CAI A;  2VM2 A;  4KAE A;  1ZCP A;  3BD2 A;  5A5H A;  1PN0 A;  4HI7 A;  2B5X A;  3M8N A;  1VGL A;  1F3A A;  5ECK B;  3NZN A;  3HHV A;  4HZ2 A;  1BYE A;  2VL2 C;  20GS A;  4WKW A;  3SBC A;  4PXO A;  3TJK A;  1MDI A;  4PQH A;  3C7M A;  3GYK A;  3F4T A;  2JSY A;  2DKI A;  5HQP A;  5J5N A;  5IMF A;  2YV9 A;  3CSH A;  3IBH A;  2IN3 A;  1O7U A;  3FZ9 A;  1FB0 A;  2PWJ A;  4KCA A;  2RM6 A;  3LOR A;  2YZH A;  2DKH A;  1TDI A;  1ZMA A;  1O85 A;  3EMX A;  3APO A;  1QGV A;  4HJM A;  3FMW A;  4MNN A;  4KF9 A;  3GUS A;  5ECL B;  4Q5F A;  1DSB A;  4K2D A;  3F3Q A;  4MJA A;  1GLQ A;  2OBK A;  2CQ9 A;  1T00 A;  3HYP A;  3IK9 A;  2C0F A;  5LNK e;  3KEB A;  3PPU A;  2GQL A;  2HRK A;  2H1G A;  4V2L A;  2I4A A;  3P8W A;  1OYJ A;  1PRX A;  1Z7P A;  3TB2 A;  2C0G A;  1TU7 A;  1XWG A;  2H30 A;  4DSS A;  2LJR A;  4HUA A;  5F06 A;  4OCE A;  1S3A A;  4K7I A;  2EFH A;  3MWH A;  3ZIT A;  5FWG A;  3QAW A;  1ST9 A;  3HXS A;  3A5I A;  4WF4 A;  1XW9 A;  2HRA A;  2HRN A;  1Y25 A;  1KEB A;  1HNB A;  1EOG A;  4YAV A;  1K0D A;  2C3N A;  3CRT A;  4Z2U A;  2LV3 A;  5HFK A;  5CRH A;  3VPT A;  2YPM A;  4MF6 A;  4OFM A;  2H1D A;  5GSS A;  5A34 B;  2KUC A;  2B7K A;  3APQ A;  4YH2 A;  3D5J A;  5CP1 A;  4YQU A;  3DXB A;  5J40 A;  3N5O A;  1A2L A;  1MTC A;  4K7O A;  5A4U A;  1XWK A;  1ERW A;  1HNA A;  1SJZ A;  3RPP A;  5J47 A;  3QPM A;  2DIY A;  1OC8 A;  3IK7 A;  1SVO A;  4XRA A;  3HMJ G;  2VD0 A;  4MCU A;  2E2M A;  4AKG A;  4FQU A;  2H72 A;  4ACS A;  2IJY A;  2V6O A;  1V2A A;  2LS5 A;  2ON7 A;  2HSM A;  3HCZ A;  1QQ2 A;  3MIX A;  1ZYQ B;  1SL0 B;  3S9F A;  1M9B A;  5H5S A;  1V9W A;  2X99 A;  2TIR A;  5IOW A;  1NW2 A;  4PTS A;  4WR5 A;  1SD9 A;  1GSS A;  2YJH A;  4PUA A;  1SL2 B;  3PGT A;  2YCD A;  2RII A;  3EU3 A;  2A4H A;  2EIR A;  4HZ4 A;  1K3Y A;  4KE3 A;  4ICY A;  4CW9 A;  5ECS A;  4Z7X A;  1TOF A;  3AY8 A;  2VCX A;  2YOI A;  3HY2 A;  5IO0 A;  5GST A;  5CRW A;  4BL7 B;  3TCO A;  4CY8 A;  2E7P A;  3KCM A;  1RW1 A;  3IE3 A;  1JFU A;  5IPH A;  3KTL A;  5D9V A;  5HFI A;  2FWH A;  2X4A A;  2JAD A;  4OFN A;  4K2X A;  1UC7 A;  1GSY A;  1XFL A;  5J4V A;  1EOH A;  2OA7 A;  4D73 B;  4X0X A;  2KP1 A;  3MNG A;  3GRX A;  4N11 A;  2X8H A;  2HSH A;  3BOA A;  5DVB A;  3D0Z A;  1AC1 A;  2WJU A;  1EGR A;  3C8E A;  2DJ3 A;  4TXO B;  1MD3 A;  1YQ1 A;  1GTI A;  1SYX A;  1TI3 A;  2VL3 A;  2VIM A;  4AI6 A;  3LJR A;  3WT1 A;  1OAZ A;  2P0G A;  3LXZ A;  1GLP A;  1NHO A;  17GS A;  4G10 A;  4XS6 A;  4EF0 A;  2L5O A;  3KMO A;  2MZC A;  3EUR A;  5CNW A;  6GSU A;  1AIU A;  1QFN A;  2ZUP A;  1SK0 A;  1MEK A;  2JSZ A;  4QMK A;  4TKY A;  3HKR A;  5EL8 A;  4I97 A;  3QCP A;  1TK0 B;  1FAA A;  5KEJ A;  1M2A A;  3LGC A;  4PQ1 A;  2YJ7 A;  2HLS A;  1F9M A;  5JWQ B;  3RBT A;  4ZB6 A;  3IV4 A;  2NDO A;  10GS A;  4MPG A;  3D22 A;  5J41 A;  2PUK C;  5COH A;  1JZW A;  4GRF A;  3VUR A;  4G0I A;  4O7H A;  2FGX A;  2IFQ B;  5J3R A;  4IP6 A;  5J9B A;  1M9A A;  3MYD A;  1TRS A;  4EIQ A;  2B6M A;  5B8B A;  4XCS A;  4ZL9 A;  5JWR B;  1SD8 A;  1ERU A;  1A0R P;  2AUV A;  3A2W A;  2OE0 A;  3DWV A;  3MAK A;  2C3Q A;  1TJD A;  4N30 A;  3WGE A;  3C71 A;  5D9T A;  4G01 A;  4BVY A;  3HVV A;  1BF5 A;  2YWO A;  1GUH A;  3IXR A;  2X8G A;  5CAX A;  2H0G A;  4YQV A;  3NIV A;  1N8J A;  3KP9 A;  1KTE A;  4TR3 A;  2R4V A;  5DCG A;  4V2M A;  2L57 A;  3DVW A;  3UL3 A;  1GSQ A;  1FOH A;  1VF1 A;  2WFC A;  4K5S A;  5ECP B;  4LMW A;  1C72 A;  1XXU A;  4KDY A;  2QGV A;  3UJ1 A;  3Q74 A;  5C04 A;  2B1K A;  2GSQ A;  4AKH A;  1EZK A;  2B3S A;  1FVK A;  5B7C A;  4OO5 A;  2NVL A;  3G7J A;  3F9U A;  3UMA A;  4MK3 A;  2M72 A;  3KJY A;  3IHQ A;  1A23 A;  1GNE A;  2HSY A;  3GH9 A;  5A4W A;  3GA4 A;  3EIN A;  3D6I A;  1U88 A;  2ZNM A;  4QQ7 A;  3ZIJ A;  1J0F A;  1VF4 A;  4NPB A;  3IDV A;  2DLX A;  1TXU A;  1ZYP A;  2YN1 A;  1DBY A;  3F8U A;  2NPB A;  2H0H A;  4QL9 A;  4EUY A;  1YJ6 A;  11GS A;  3ZVJ D;  3Q19 A;  1S3D A;  1JLV A;  1JZR A;  2FD3 A;  1BQ7 A;  5DDL A;  2CZ3 A;  2D2Z A;  4EC0 A;  2OE1 A;  4I8B A;  1Z6M A;  3DYR A;  4OFT A;  2IME A;  4EE0 A;  1ZYE A;  4XS4 A;  4IEL A;  1FOV A;  5J4Y A;  3DEX A;  2H6Y A;  3KGK A;  1PN9 A;  2XPD A;  4AF2 A;  4NWY A;  2O85 A;  5C00 A;  3N9J A;  2H1L A;  3DD3 A;  4DSQ A;  4TR0 A;  2VCV A;  2TRX A;  4POK A;  3VI5 A;  2HE3 A;  2DMM A;  4ILF A;  2YV7 A;  3GN3 A;  4IQA A;  1FB6 A;  4N0V A;  4BVX B;  2H01 A;  5ABR A;  1A8L A;  2HSN B;  2NTO A;  3GX0 A;  13GS A;  1MDK A;  2KHP A;  4HU7 A;  1EV9 A;  2MYG A;  3H93 A;  4IGJ A;  4PX1 A;  2M80 A;  4JR6 A;  2WGR A;  3JCM L;  4OCF A;  1G6Y A;  1Z9H A;  2H6X A;  3F4S A;  2H73 A;  4FO5 A;  1GTA A;  3PH9 A;  3EC3 A;  4F82 A;  1FO5 A;  4DEJ A;  4X43 A;  3RHB A;  1YEP A;  5AIS A;  3G9B A;  2OAD A;  4NV2 A;  4FIW A;  3FEU A;  4KDX A;  1R4W A;  3M0F A;  1MDJ A;  1V98 A;  5F8B A;  3VPQ A;  2G2Q A;  1M0U A;  4EL1 A;  3FR9 A;  4ECI A;  4K9Z A;  3ZFL A;  1LBK A;  3TJF A;  4O32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...