4Q5QA

Crystal structure of the glutathione s-transferase der p 8
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
SQPILGYWDIRGYAQPIRLLLTYSGVDFVDKRYQIGPAPDFDRSEWLNEKFNLGLDFPNLPYYIDGDMKMTQTFAILRYLGRKYKLNGSNDHEEIRISMAEQQTEDMMAAMIRVCYDANCDKLKPDYLKSLPDCLKLMSKFVGEHAFIAGANISYVDFNLYEYLCHVKVMVPEVFGQFENLKRYVERMESLPRVSDYIKKQQPKTFNAPTSKWNASYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal Structure of the Glutathione S-transferase Der p 8
rcsb
source organism Dermatophagoides pteronyssinus
molecule tags Transferase
total genus 79
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4q5qA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4q5qA01
1QK8A 1M7TA 1AAZA 4V2MA 5HR1A 5KN1A 1YF1A 2YP6A 2H30A 4LMWA 1TOFA 4F03A 2PUKC 2GZPA 4XS6A 5LCZA 3GN3A 1NHYA 4WETA 3F9UA 1T1VA 3TB2A 5A4WA 3BBYA 1TRVA 1PL2A 5IMZA 2B5YA 3FY7A 2RUFA 5DQYA 2HE3A 5HFIA 3CTFA 1Y6EA 1TP9A 1G7EA 2H8LA 2WCIA 4ZBDA 1R7HA 1VF3A 4HDEA 3HJPA 2HSMB 2IMFA 2I81A 4WF5A 2WS2A 3GHAA 4POLA 4KDYA 3ZYWA 3QCPA 1GTAA 4GF0A 4GRFA 1GSYA 4XS4B 4K0GA 1HD2A 5EY6A 1TRWA 3LG6A 4ZBBA 3J7Yb 4ZB6A 3F3RA 3HKRA 2IMKA 3IPZA 5DQSA 5DBQA 4G2EA 3VWUA 3GYKA 5INYA 2WZ9A 2X64A 3HZ4A 2HSMA 2HZFA 1GUMA 1G7OA 4ML1A 4AF2A 3VWWA 5J4UA 2H1DA 4XS4A 4GWRA 4L0WA 4PUAA 2LS5A 4K0NA 2ZCTA 3Q6OA 4PQIA 1OE8A 4IJ3A 1H4OA 4O7HA 4ZB9A 2G2QA 1MTCA 4HI7A 4MJEA 3QAVA 3MDKA 3F4SA 1MDKA 6GSUA 1G6WA 4Q5NA 4TR4A 4F0BA 1OKTA 3MSZA 5ECIB 3G7IA 2IPAA 3FK8A 2HZEB 1A0RP 2GZYA 5IMCA 4MP4A 2VCVA 1E6BA 1TI3A 1HNCA 3KM6A 3QDNA 2O7KA 2M80A 1TU8A 2V32A 4KAEA 2VLVA 3GNJA 4LL1B 4K6XA 4MZCA 3ZLPA 2H0GA 3DGQA 5H5RA 4POMA 4PNFA 1ERUA 1N8JA 5IMVA 3FR6A 2PGTA 3I6AA 1GSSA 1PQNA 2PVOC 1U6TA 2GDRA 2AB6A 1YJ6A 1USBA 2I1UA 3F4RA 3EYTA 3GA4A 4IBPA 3PPUA 5COHA 4GSSA 2X8HA 5IIZA 3VFIA 1EV4A 3WYWA 3KP8A 1SYXA 4KGIA 2LJKA 2F51A 1G6YA 1EV9A 3GX8A 2E0QA 3TDGA 1TK5B 2MZCA 2GQLA 2FA4A 2NPBA 3DWVA 2F8AA 2HRFA 4OFNA 2H73A 2KOKA 2C0GA 2J9HA 3A2VA 6GSSA 3DEXA 6GSWA 2E2MA 3VI5A 2GSTA 1X9MB 3H93A 3LGCA 1ST9A 3HXSA 1GNWA 2B5XA 4ECBA 1O8XA 3TKRA 3TJKA 2I3YA 2DLXA 5ENUA 2JSYA 3CSJA 3DRNA 5J41A 4GTUA 2H1GA 1XW6A 4NV2A 4EUYA 2WB9A 4TW5A 4KSMA 2JZRA 4K7IA 1FB0A 4FYBA 4ZIJA 1TK8B 3VWVA 2YJ7A 1GSFA 1VF1A 1O6JA 4MDCA 2PN8A 2XPDA 2LSTA 4F9ZA 1XW5A 2RM5A 3GKXA 5BMUA 4D73B 2HT9A 1SKWB 4TVEA 1TW9A 1A2MA 2C3TA 4V1Ap 1X5DA 2H71A 3HHVA 3EWLA 3D21A 1EP8A 4PGTA 3ZMKA 3DIEA 1OC9B 2REMA 4Q5FA 1K3OA 4POKA 1GNEA 1QFNA 1XCCA 4D73A 4WKWA 3MAKA 1GUHA 1LJRA 3IK9A 3ZREA 4FYCA 5DAKB 1JZDA 4NV5A 2FWHA 2V2GA 4GLTA 5G5FA 2DIZA 3UEMA 2L4CA 2HYXA 4OCEA 1UA5A 4N0VA 4MJAA 1SD8A 3F6DA 1OC9A 1VF2A 1FOVA 1GSDA 1K3YA 2B7JA 4KH7A 1YZXA 5ABRA 5ECSA 2QSIA 5IMFA 2HSNB 2MBSA 4J2FA 3CBUA 1DBYA 5DAKA 2NDOA 3W8SA 1NM3A 2R37A 1GWCA 1ON4A 3BCKA 2BJXA 4F0CA 12GSA 1C72A 3QFBC 3HVVA 2H75A 1EP7A 4G10A 1M0UA 2PMTA 4OWYA 1YQ1A 3E0UA 3TRXA 3LORA 1B9YC 2DJJA 1M2BA 1T8EB 3FZ9A 3KMNA 1RQMA 1TDIA 1X5EA 1FVJA 1ACVA 4GQFA 2OE0A 4V2LA 1EEJA 1TK0B 1ZYQB 2NVLA 2VCWA 1XOBA 1ZL9A 5HR3A 3HVSA 3KTLA 5FWGA 3I69A 2OACA 4WR4A 5HQPA 1XWCA 2KUCA 3EURA 4WXTA 3MWHA 1SK0A 2NBSA 2DJ0A 17GSA 4HZ2A 4HEA2 1R5AA 1OAZA 3D22A 2G0FA 1SENA 1ERVA 1QMVA 3ERWA 3TOUA 2VCTA 2MMNA 2L6CA 2K8SA 3A5WA 3HY2A 4BWQA 2B5EA 1T3BA 4ACSA 4FO5A 1UN2A 1R5PA 5J9BA 2GSQA 4DSRA 5L71A 1PGTA 1WP0A 3IC4A 5DVBA 4KX4A 2CAIA 4I97A 2VM2A 2FA8A 1BAYA 2H74A 2N5AA 2LJAA 4PX1A 4AGSA 3G9BA 5G2ZA 5CYYA 1PX7A 3C7MA 3KEBA 3C1SA 1KNGA 5G1KA 4IELA 3SBCA 4RQRA 5LNKe 4GQCA 3H8QA 1W4VA 3BCIA 4YQMA 1OKDA 1AUCA 3E3EA 2K18A 1I5GA 3RDWA 1SK2A 3GKMA 4N11A 2FD3A 1WJKA 2LEGA 4EE0A 2IN3A 2E2GA 4GXZA 2H19A 4NAXA 4AJ6A 5FHIA 4DSQA 3I43A 3F8UA 4KUNA 4MK3A 2FWEA 2L57A 2IJYA 2ALBA 4PQ1A 4GSNA 5D9VA 1FAAA 4TN8A 5ID2B 4PUFC 1PKWA 1F9MA 4XTSA 3UVHA 2XC2A 5ECHB 1B9XC 2P5RA 5DDLA 1XVQA 1B4PA 2YOIA 3KH9A 2VL2C 3KCMA 5GAND 5IO2A 3D4TA 5A4VA 2OKAA 3FZAA 2XPEA 4L0UA 5HR0A 4BA7A 4ILFA 2V1MA 2CZ3A 2YN1A 3RHCA 4P3YB 5ID2A 5CNWA 3U5RE 3G7JA 3N5OA 2C3NA 4EXJA 3VPQA 4RQXA 2DJ2A 1J0FA 4KW6A 3UIWA 4XRAA 1YEXA 4NWYA 1MDIA 4MA9A 1K0CA 2LTKA 4I6XA 2CVBA 3ME7A 3BOAA 2HLSA 3UAPA 2FWFA 2H1BA 1S3CA 2O87A 2DIYA 4RUVA 4BWSA 1MDJA 5DJMA 2MMAA 1T7PB 3ZVJA 1WOUA 1KBNA 3KH7A 4DEJA 1WIKA 5GSSA 1V9WA 4PQHA 3ZMLA 2QC7A 3L78A 2CA8A 3HYPA 1PD21 4BVXB 2AJQB 1NHOA 2VD1A 1X9WB 3PINA 3PH9A 2LKUA 2HRNA 4I2TA 4NHWA 1Z6MA 2FUG2 1O85A 3ZZXA 4RI7A 4CHSA 2WDUA 5D9WA 1JZOA 2IL3A 1MD3A 4YAVA 5J9CA 2DJKA 4ECCA 3FW2A 4CDOA 3M1GA 1JZWA 3UJ1A 4PNGA 5AISA 1Q98A 20GSA 4DSSB 4KSOA 3R2QA 4BVXA 4K9ZA 2GTUA 1B48A 4KCAA 3UMAA 5D8IA 4Q5QA 2KP1A 1A8LA 4G0KA 2H66A 1XFLA 4MPGA 2L4QA 4OMVA 4MH2A 3CRUA 1V40A 4MH3A 4QL9A 1SJ6A 2E7PA 3TJBA 3Q19A 8GSSA 3F0IA 4DSSA 2BTOT 4V2NA 2NTOA 4WR5A 5ECNB 1B4QA 3IAM2 6GSTA 3KJYA 1U88A 1LU4A 3VURA 3GV1A 2LV3A 3ZIVA 3ERFA 3IHQA 4IVFA 2F9SA 4E8EA 4ID0A 4ULXA 1G0TA 1J08A 1XOAA 3A3TA 3DVXA 1QGVA 5A5KA 3WGDA 1BX9A 2WJUA 1W89A 4TR1A 3CXGA 5ECPB 1THOA 1WPIA 2R2JA 3EU4A 1TRSA 3ZIJA 2DJ1A 3RPNA 4F82A 3LYKA 4MJCA 1EEMA 2OBIA 5JWOB 2FY6A 3OR5A 3APOA 5AGYA 5E4WA 3TKSC 3P8WA 5IOXA 4AJ7A 4OO5A 2VUPA 5H5SA 5J3RA 1SKRB 3PR8A 2YWMA 2IIYA 5A4UA 5B8BA 5KN3A 1FW1A 2C0FA 1K0MA 5D9TA 1OVNA 2GVPA 2C1YA 4HU9A 2JADA 2FLSA 3ME8A 1AW9A 3EMXA 4MCUA 2GZZA 3GL5A 4X1UA 3TCOA 2C0EA 2I9HA 1TRUA 5CREA 4KDXA 2DMLA 2H6ZA 5D96A 1ZYEA 1ABAA 3LXTA 2ZUPA 1DE1A 5JWRB 2IMEA 4HZ4A 5ECOB 2FHEA 3GX0A 2DJ3A 3FR3A 5F8BA 2YANA 2WULA 2HXKA 4ECJA 2OBKA 2C0DA 4KDUA 2B1LA 2FNOA 1EZKA 2B6MA 4TKYA 5IM9A 3FEUA 4WF4A 3TOTA 2VL2A 4J57E 1YKAA 4K2DA 2LQOA 5JWQB 3A2WA 1AIUA 1O8WA 3SWLA 4KF9A 1WRYA 1SK1A 4IGJA 4JE1A 2MMZA 2YV7A 1ZGNA 3FHKA 4HQSA 1F6MC 1GH2A 1A2JA 4KE3A 1F3AA 2CVKA 4NHZA 4MPFA 5D73A 3KGKA 2QGVA 4EVMA 2X8CA 1HNBA 1YF0A 3WD6A 2O85A 2VAFA 1BJXA 2GT6A 4RI6A 3HJMA 4ZB8A 4TR3A 3TJFA 1K0AA 2F3MA 3GSTA 3GIXA 2YWIA 5GAPD 4IW9A 2PPTA 2X99A 3KD0A 2LNTA 2R4VA 1R4WA 2VD0A 2V6KA 3WT1A 4I8BA 1KTEA 2P31A 2PWJA 1UC7A 2ES7A 3H4KA 1Z7PA 3O3TA 1ML6A 4EDZA 3GL3A 4NMUA 3DKSA 1A23A 2CX3A 4ISDA 4MZWA 1R26A 3LJRA 3ED3A 4EDYA 5DCHA 1MEKA 3VI7A 5IO0A 1FG4A 1XIYA 2RUEA 2OE3A 3TKSE 3IOSA 3P2AA 3QD9A 5IPGA 1GLQA 3EMPA 3WT2A 1H75A 1F3BA 2K9FA 4OFTA 2M72A 2C80A 3TKPA 4LA1A 2AUVA 4PURA 10GSA 3J7Yk 5ELAA 4JR4A 7GSSA 2RLIA 4XCSA 1A8YA 4O92A 4N10A 1U3AA 3HD5A 1X5CA 1M9BA 1WWJA 2LUSA 1SL1B 4BVYB 3FZ5A 1XWBA 3NIVA 5LD0A 3LQ7A 4HJMA 2O8VB 2OJLA 1KEBA 3IA1A 1M2AA 2RM6A 1AQXA 4ZL8A 1ZMAA 4GCIA 4L8EA 3FKFA 2BMXA 2EC4A 3HDCA 4OCFA 2GQKA 3R3EA 3ZTLA 4YQUA 4JR6A 5CRWA 4BVYA 2WGRA 3GSSA 3KP9A 2ON5A 5G5EA 3CSIA 1X9SB 2B1KA 4ZL9A 2YCDA 1PSQA 1EGOA 3D4MA 1A0FA 4G0IA 3ZL5A 6GSXA 3LSZA 5H5QA 2HFDA 1DUGA 2PU9C 1GTUA 1EOHA 2AAWA 5F07A 1V57A 3BJ5A 3W8JA 3DD3A 3VK9A 3S9FA 4OD7A 3TKSA 4N0ZA 4G0LA 2ON7A 1Y25A 1O7UA 1PA3A 5HFGA 4XS1A 2O89A 4Z7XA 3APQA 3UVTA 1YY7A 1GTIA 3VLNA 4NXIA 5KN2A 1PN9A 2GGTA 2GT5A 2JSZA 5CP1A 1Q4JA 1K3LA 9GSSA 3N9JA 3C71A 4TXOB 1U87A 2GLRA 1TI1A 4POBA 4MMMA 4I2UA 2XBIA 4HQZA 3UBLA 3LEFA 2VL3A 1VGLA 4ML6A 4ZXGA 2IFQA 4G19A 4IP6A 2C4JA 2JL4A 1RW1A 3L0HA 4LMVA 2LRCA 1WMJA 2UZ8A 2VCXA 1M9AA 2H01A 4TXOA 3DXBA 2VOCA 4IN0A 2J23A 4K7OA 3DMLA 4WBJA 4WEYA 1LBKA 3HJOA 1AC1A 1SJZA 5G1LA 1MD4A 1BYEA 3F4TA 1T4ZA 1V98A 1SL0B 1X0RA 3CRTA 13GSA 3O6TA 2QKEA 1XWKA 3CSHA 3Q18A 2HI7A 3TJJA 1JZRA 1CQGA 1Z7RA 4TOPA 2A4VA 3EE2A 3C8EA 4MF6A 1OC3A 2LJRA 3QOUA 1ZCPA 4GSTA 1N2AA 1THXA 5IPHA 4KA0A 2JU5A 3RAZA 2HQTA 6GSVA 1CQHA 4O5RA 4JZQA 1PRXA 4FYUA 1TXXA 3IE3A 4IS0A 5IMAA 2L6DA 5J5NA 4I5QA 4H86A 3BD2A 2WRTA 1UVZA 3ZRDA 4CW9A 3U6VA 3IC8A 5D9XA 3CYNA 1IYIA 3EC3A 1OYJA 2MBTA 1DSBA 1F2EA 3ZFLA 4YAPA 3TUEA 3CMIA 5IQYA 2YJHA 1XBSA 2CZ2A 4MF7A 4X43A 2FGXA 2VM1A 1TKDB 3D6IA 3V1WA 2JZSA 2D2ZA 3M8NA 1OC8A 3UBKA 5EL8A 4EC0A 2H0HA 3L9VA 2H0IA 1E2YA 1F37A 1RK4A 3EVIA 2IWTA 5IOWA 4K1FA 1SKSB 4TR1B 1A24A 5ELGA 1A2LA 3DVWA 4FIWA 1FO5A 4MF5A 1PL1A 5JCWA 5DALB 2HSHA 4FH8A 1TTZA 1B8XA 1URMA 4JU5A 3IXRA 1YKCA 2TRCP 2LNSA 2H70A 4DVCA 1K0OA 1DE2A 5GZZB 1QXHA 2PBJA 5C04A 1BG5A 4USSA 5ECQB 5ECRB 2I4AA 2A2RA 4MABA 3ZITA 2IMIA 4XIHA 1Z3EA 4IJIA 1V2AA 3ZVJD 3L9UA 2H72A 2VIMA 2R5GA 4FQUA 5B6MA 2YWOA 2F8FA 2R3XA 5DALA 4LLRA 2OA7A 3VWXA 3LYPA 1Z5YE 3W6GA 1XW9A 2HZEA 3GFKA 2XBQA 4XRDA 2TIRA 5KN0A 3FYGA 3Q74A 5GSTA 1U3IA 1EWXA 3FRCA 1JLVA 1SYRA 1QUWA 4EL1A 4X0XA 1FHEA 3D5JA 3LWAA 2C3QA 1ILOA 1JHBA 4F2IA 1XWGA 4JBBA 2HRAA 2CQ9A 3DYRA 2L5OA 3IAS2 2FWGA 1GSUA 2GQMA 2B7KA 3NZNA 3FZ4A 1BEDA 4E8HA 3P7XA 2H1AA 1IYHA 1VRSD 2EIQA 1ZZYA 1QQ2A 2H6YA 2MYGA 4L5LA 1ERTA 1HYUA 3QAGA 1K0NA 2CT6A 2Z9SA 5DJLA 3IBHA 4ZBAA 3E9JB 3O76A 3TRQA 4EKZA 4JEDA 3TKQA 5E59A 2AYTA 4NPBA 3APSA 4HU7A 2YNXA 2HRKB 2EIRA 2YPMA 2EIOA 2PVQA 5KEJA 3ISOA 4PTSA 3TRPA 2VCZA 3P90A 1GUKA 3M3MA 4AJ8A 4EF0A 1PX6A 5F0GA 1GL8A 5B8AA 3LXZA 4IHUA 2GSSA 4J56E 2VLTA 5IMDA 4MLYA 11GSA 3EINA 5FT3A 2TRXA 2CV4A 5G31A 4TRXA 1J9BA 2HRKA 1S3AA 2L59A 3QFAC 1M2DA 3QR6A 2DSAA 2K8VA 2VL9A 4QL7A 4BL7B 3QAWA 3MNGA 2KP2A 2V41A 3LFLA 4HJ2A 2CAQA 1AQVA 2XHFA 2GS3A 3EU3A 1SD9A 3M9JA 4N30A 4PXOA 4ECIA 2X8GA 5HR2A 4OFMA 5ECMB 5F06A 2FCHA 3IK7A 2L5LA 2LRNA 1TJDA 2N5BA 3H1NA 1XPVA 1AQWA 3WGEA 1I9DA 5AIVA 3I9V2 2N5FA 4BL7A 3NOFA 4HOJA 2R6KA 3L9SA 3K8NA 3UOMA 3G7YA 1ERWA 2VCQA 5AN1A 4YQVA 19GSA 2GSRA 3IV4A 1K0BA 4OO4A 3H79A 3TGZA 3A2XA 1EOGA 4LL4B 4ZL7A 1PMTA 1V58A 2K6VA 1SL2B 5HFKA 5EPFA 4QQ7A 1PKZA 3FR9A 1T4YA 2IMDA 2RIIA 2YV9A 3US3A 3GTUB 4IQ1A 16GSA 4Q5RA 2V6OA 3GH6A 2B3SA 2DC5A 3GRXA 5F05A 1XVWA 3GH9A 3QPMA 4MZBA 4HUAA 3F6FA 4TR0A 1EGRA 2DMMA 3C1RA 2CX4A 1GSEA 2KHPA 1GSQA 4K7NA 3GUSA 1O73A 2DBCA 4EO3A 22GSA 2PERA 2VO4A 2AV4A 3GTUA 2YZUA 3M9KA 3F3QA 2HSYA 5CRDA 3WGXA 3QMXA 2VLUA 3C73A 2A2SA 2KLXA 4MJBA 3TJGA 5EVOA 3D0ZA 3UL3A 4K8MA 5JCGA 3AY8A 3HZ8A 1VF4A 4WBRD 5ECKB 2WFCA 5CRHA 1OE7A 1YDKA 3IDVA 4ZILA 3HCZA 14GSA 2JZTA 1GLPA 1SJIA 1WE0A 2P5QA 5CRGA 1HQOA 2H6XA 5AIXA 3GURA 5DCGA 3RPPA 1T00A 2YZHA 3HA9A 2OADA 1S3DA 3GMFA 3HVXA 2JACA 5JCUA 1SU9A 2H76A 2LRTA 3JCML 3VPTA 1JLWA 2IFQB 1AXDA 3IRAA 3KMOA 1TU7A 5ECLB 4TXVA 2LQQA 2OE1A 3ZFBA 3RHBA 1FVKA 6GSYA 3M0FA 4IQAA 4L5OA 3ERGA 1YEPA 1ZOFA 1Z9HA 3KIJA 1O81A 4G9HA 4HS1A 1Z6NA 2P0GA 3IR4A 5B7CA 1GRXA 2AHEA 4KNDA 2M46A 3GKKA 3PGTA 5G30A 3UARA 1GULA 2CVDA 2ZNMA 3F63A 1M99A 1GP1A 4KB3A 5CO3A 5B6NA 5C00A 4YH2A 2MMOA 1NW2A 3CTGA 5D93A 1BQ7A 18GSA 4IKHA 3KZQA 1K0DA 1JFUA 3KXOA 5CAXA 4V1Ag 2C8UA 3KTBA 4IP1A 1NSWA 4O32A 3L4NA 4XHMA 3GKNA 1XWAA 2HNLA 1FB6A 1XXUA 1GTBA 1XZOA 4KCEA 1HNAA 3RBTA 2YWNA 4BPYA 4JRRA
chains in the Genus database with same CATH superfamily
4QMKA 1QK8A 1M7TA 1AAZA 4V2MA 5HR1A 5KN1A 1YF1A 2YP6A 2H30A 4LMWA 1TOFA 4F03A 2PUKC 2GZPA 4XS6A 5LCZA 3GN3A 1NHYA 4WETA 5J40A 5J4YA 3F9UA 1T1VA 3TB2A 5A4WA 3BBYA 1TRVA 1PL2A 4K5RA 5IMZA 2B5YA 3FY7A 2RUFA 5DQYA 2HE3A 4EIQA 5HFIA 3CTFA 1Y6EA 1TP9A 1G7EA 2H8LA 2WCIA 4ZBDA 1R7HA 1VF3A 4HDEA 3HJPA 2HSMB 2IMFA 2I81A 4WF5A 2WS2A 3GHAA 4POLA 4KDYA 3ZYWA 3QCPA 1GTAA 4GF0A 4GRFA 1GSYA 4XS4B 4K0GA 1HD2A 5EY6A 1TRWA 3LG6A 4ZBBA 3J7Yb 4ZB6A 3F3RA 1ZYPA 3HKRA 2IMKA 3IPZA 5DQSA 5DBQA 4G2EA 3VWUA 3GYKA 5INYA 2WZ9A 2X64A 3HZ4A 2HSMA 2HZFA 1GUMA 1G7OA 4ML1A 4AF2A 3VWWA 5J4UA 2H1DA 4XS4A 4GWRA 4L0WA 4PUAA 2LS5A 4K0NA 2ZCTA 3Q6OA 4PQIA 1OE8A 4IJ3A 1H4OA 4O7HA 4ZB9A 2G2QA 1MTCA 4HI7A 4MJEA 3QAVA 3MDKA 3F4SA 1MDKA 6GSUA 1G6WA 4Q5NA 4TR4A 4F0BA 1OKTA 3MSZA 5ECIB 3G7IA 2IPAA 3FK8A 2HZEB 1A0RP 2GZYA 5IMCA 4MP4A 3CHXC 2VCVA 1E6BA 1TI3A 1HNCA 3KM6A 3QDNA 2O7KA 2M80A 1TU8A 2V32A 4KAEA 2VLVA 3GNJA 4LL1B 4K6XA 4MZCA 3ZLPA 2H0GA 3DGQA 3RFRC 5H5RA 4POMA 4PNFA 1ERUA 1N8JA 5IMVA 3FR6A 2PGTA 4CY8A 3I6AA 1GSSA 1PQNA 2PVOC 1U6TA 2GDRA 2AB6A 1YJ6A 1USBA 2I1UA 3F4RA 3EYTA 3GA4A 4IBPA 3PPUA 5COHA 4GSSA 2X8HA 5IIZA 3VFIA 1EV4A 3WYWA 3KP8A 1SYXA 4KGIA 2LJKA 2F51A 1G6YA 1EV9A 3GX8A 2E0QA 3TDGA 1TK5B 2MZCA 2GQLA 2FA4A 2NPBA 3DWVA 2F8AA 2HRFA 4OFNA 2H73A 2KOKA 1SVMA 2C0GA 2J9HA 3A2VA 6GSSA 3DEXA 3FMWA 6GSWA 2E2MA 3VI5A 2GSTA 1X9MB 3H93A 3LGCA 1ST9A 5BMUB 3HXSA 1GNWA 2B5XA 4ECBA 1O8XA 3TKRA 3TJKA 2I3YA 2DLXA 5ENUA 2JSYA 3CSJA 3DRNA 5J41A 4GTUA 2H1GA 1XW6A 4NV2A 4EUYA 2WB9A 4TW5A 4KSMA 2JZRA 4K7IA 2EFCA 1FB0A 4FYBA 4ZIJA 2EFHA 1TK8B 3VWVA 2YJ7A 1GSFA 1VF1A 1O6JA 4MDCA 4EIPA 2PN8A 2XPDA 2LSTA 4F9ZA 1XW5A 2RM5A 3GKXA 5BMUA 4D73B 2HT9A 1SKWB 4E68A 4TVEA 1TW9A 1A2MA 2C3TA 4V1Ap 1X5DA 2H71A 3HHVA 3EWLA 3D21A 1EP8A 2H1LA 4PGTA 3ZMKA 3DIEA 3RGBC 1OC9B 2REMA 4Q5FA 1K3OA 4POKA 1GNEA 1QFNA 1XCCA 4D73A 4WKWA 3MAKA 1GUHA 1LJRA 3IK9A 3ZREA 4FYCA 5DAKB 1JZDA 4NV5A 2FWHA 2V2GA 4GLTA 5G5FA 2DIZA 3UEMA 2L4CA 2HYXA 4OCEA 1UA5A 4N0VA 4MJAA 2WVYA 1SD8A 3F6DA 1OC9A 1VF2A 1FOVA 1GSDA 1K3YA 2B7JA 4KH7A 1YZXA 5ABRA 5ECSA 2QSIA 5IMFA 2HSNB 3A5IA 2MBSA 4J2FA 3CBUA 1DBYA 2DKHA 5DAKA 2NDOA 3W8SA 1NM3A 2R37A 1GWCA 1ON4A 3BCKA 2BJXA 4F0CA 12GSA 1C72A 3QFBC 3HVVA 2H75A 1EP7A 4G10A 1M0UA 2PMTA 4OWYA 1YQ1A 3E0UA 3TRXA 3LORA 1ZYNA 1B9YC 2DJJA 1M2BA 1T8EB 3FZ9A 3KMNA 1RQMA 1M3IA 1TDIA 1X5EA 1FVJA 1ACVA 4GQFA 2OE0A 4V2LA 1EEJA 1TK0B 1ZYQB 2NVLA 2VCWA 4YKFA 1XOBA 1ZL9A 4AKHA 5HR3A 3HVSA 3KTLA 5FWGA 3I69A 2OACA 4WR4A 5HQPA 1XWCA 4Z2TA 2KUCA 3EURA 4WXTA 4PHZC 3MWHA 1SK0A 2NBSA 2DJ0A 1I1IP 17GSA 4HZ2A 4HEA2 4AKGA 1R5AA 1OAZA 3D22A 2G0FA 1SVOA 1SENA 1ERVA 1QMVA 3ERWA 3TOUA 2VCTA 2MMNA 2L6CA 2K8SA 3A5WA 3HY2A 4BWQA 2B5EA 1T3BA 4ACSA 4FO5A 1UN2A 1R5PA 5J9BA 2GSQA 4DSRA 5L71A 1PGTA 1WP0A 3IC4A 5DVBA 4KX4A 2CAIA 4I97A 2VM2A 2FA8A 1BAYA 2H74A 2N5AA 2LJAA 4PX1A 4AGSA 3G9BA 4FXYP 5G2ZA 5CYYA 1PX7A 3C7MA 3KEBA 3C1SA 1KNGA 5G1KA 4IELA 3SBCA 4RQRA 5LNKe 4GQCA 1BF5A 3H8QA 1W4VA 2EFDA 3BCIA 4YQMA 1OKDA 1AUCA 3E3EA 2K18A 1I5GA 4Z2RA 3RDWA 1SK2A 3GKMA 4N11A 2FD3A 1WJKA 2LEGA 4EE0A 2IN3A 2E2GA 4GXZA 2H19A 4NAXA 4AJ6A 5FHIA 4DSQA 3I43A 3F8UA 4KUNA 4MK3A 2FWEA 2L57A 2IJYA 2ALBA 4PQ1A 4GSNA 5D9VA 1FAAA 4TN8A 5ID2B 4PUFC 1PKWA 1F9MA 2WZSA 4XTSA 3UVHA 2XC2A 4HSCX 5ECHB 1B9XC 2WW2A 2P5RA 5DDLA 1XVQA 1B4PA 2YOIA 3KH9A 2VL2C 3KCMA 5GAND 5IO2A 3D4TA 5A4VA 2OKAA 3FZAA 2XPEA 4L0UA 5HR0A 4BA7A 4ILFA 2V1MA 2CZ3A 2YN1A 3RHCA 4P3YB 5ID2A 5CNWA 3U5RE 3G7JA 3N5OA 2C3NA 4EXJA 3VPQA 2VKZG 4RQXA 2DJ2A 1J0FA 4KW6A 3UIWA 4XRAA 1YEXA 4NWYA 1MDIA 4MA9A 1K0CA 2LTKA 4I6XA 2WW3A 5BRTA 2CVBA 3ME7A 3BOAA 1PFOA 2HLSA 3UAPA 2FWFA 2H1BA 1S3CA 2O87A 2DIYA 4RUVA 4BWSA 1MDJA 5DJMA 2MMAA 1T7PB 3ZVJA 1WOUA 1KBNA 3KH7A 4DEJA 1WIKA 5GSSA 1V9WA 4PQHA 3ZMLA 2QC7A 3L78A 2CA8A 3HYPA 1PD21 4BVXB 2AJQB 1NHOA 2VD1A 1X9WB 3PINA 3PH9A 2LKUA 2HRNA 4I2TA 4NHWA 1Z6MA 2FUG2 1O85A 3ZZXA 2WW1A 4RI7A 4CHSA 2WDUA 5D9WA 1JZOA 2IL3A 1MD3A 4YAVA 3EPTA 5J9CA 2DJKA 4ECCA 3FW2A 4CDOA 3M1GA 1JZWA 3UJ1A 1SVLA 4PNGA 5AISA 1Q98A 20GSA 4DSSB 4KSOA 3R2QA 4BVXA 4K9ZA 2GTUA 1B48A 4KCAA 3UMAA 5D8IA 4Q5QA 1S3RA 2KP1A 1A8LA 4G0KA 2H66A 1XFLA 4MPGA 2L4QA 4OMVA 4MH2A 3CRUA 3CQFA 1V40A 4MH3A 4QL9A 1SJ6A 2E7PA 3TJBA 3Q19A 8GSSA 3F0IA 4DSSA 2BTOT 4V2NA 4N3ZA 2NTOA 4WR5A 5ECNB 1B4QA 3IAM2 6GSTA 3KJYA 1U88A 1LU4A 3VURA 3GV1A 2LV3A 3ZIVA 3ERFA 3IHQA 4IVFA 2F9SA 4E8EA 4ID0A 4ULXA 3HVNA 1G0TA 1J08A 1XOAA 3A3TA 3DVXA 1QGVA 2UV8G 5A5KA 3WGDA 1BX9A 2WJUA 4AKXB 1W89A 4TR1A 3CXGA 5ECPB 1THOA 1WPIA 2R2JA 3EU4A 1TRSA 3ZIJA 2DJ1A 3RPNA 4F82A 3LYKA 4MJCA 1EEMA 2OBIA 5JWOB 2FY6A 3OR5A 3APOA 5AGYA 5E4WA 3TKSC 3P8WA 5IOXA 4AJ7A 4OO5A 2VUPA 5H5SA 5J3RA 1SKRB 3PR8A 2YWMA 2IIYA 5A4UA 5B8BA 5KN3A 1FW1A 2C0FA 1K0MA 5D9TA 1OVNA 1FOHA 2GVPA 1YVLA 2C1YA 4HU9A 2JADA 2FLSA 3ME8A 1AW9A 2DKIA 2R0GA 3EMXA 4MCUA 2GZZA 3GL5A 4X1UA 3TCOA 2C0EA 2I9HA 1TRUA 5CREA 4KDXA 2DMLA 2H6ZA 5D96A 1ZYEA 1ABAA 3LXTA 2ZUPA 1DE1A 2OT3A 5JWRB 2IMEA 4HZ4A 5ECOB 2FHEA 3GX0A 2DJ3A 3FR3A 5F8BA 2YANA 2WULA 2HXKA 4ECJA 2OBKA 2C0DA 4KDUA 2B1LA 2FNOA 1EZKA 2B6MA 4TKYA 5IM9A 3FEUA 4CY6A 4WF4A 3TOTA 2VL2A 4J57E 1YKAA 4K2DA 2LQOA 5JWQB 3A2WA 1AIUA 1O8WA 3SWLA 4KF9A 1WRYA 1SK1A 4IGJA 4JE1A 2MMZA 2YV7A 1ZGNA 3FHKA 4HQSA 1F6MC 1GH2A 1A2JA 4KE3A 1F3AA 2CVKA 2WVZA 4NHZA 4MPFA 5D73A 3KGKA 2QGVA 4EVMA 2WVXB 2X8CA 1HNBA 1YF0A 3WD6A 2O85A 2VAFA 1BJXA 2GT6A 4RI6A 3HJMA 4ZB8A 4TR3A 3TJFA 1K0AA 2F3MA 3GSTA 3GIXA 2YWIA 5GAPD 4IW9A 2PPTA 2X99A 3KD0A 2LNTA 2R4VA 1R4WA 2VD0A 2V6KA 3WT1A 4I8BA 1KTEA 2P31A 2PWJA 1UC7A 2ES7A 3H4KA 2WVXA 1Z7PA 3O3TA 2R0PA 1ML6A 4EDZA 4Z2UA 3GL3A 2X4AA 4NMUA 3DKSA 1A23A 2CX3A 4ISDA 4MZWA 1R26A 4ICYA 3LJRA 3ED3A 4EDYA 5DCHA 1MEKA 3VI7A 5IO0A 1FG4A 1XIYA 2RUEA 2O36A 2OE3A 3TKSE 3IOSA 3P2AA 3QD9A 5IPGA 1GLQA 3EMPA 3WT2A 1H75A 1F3BA 2K9FA 4OFTA 2M72A 2C80A 3TKPA 4LA1A 2AUVA 4PURA 10GSA 3J7Yk 5ELAA 4JR4A 7GSSA 2RLIA 4XCSA 1A8YA 4O92A 4N10A 1U3AA 3HD5A 1X5CA 1M9BA 1WWJA 2LUSA 1SL1B 4BVYB 3FZ5A 1XWBA 3NIVA 5LD0A 3LW9A 3LQ7A 4HJMA 2O8VB 2OJLA 1KEBA 3IA1A 1M2AA 2RM6A 1AQXA 4ZL8A 1ZMAA 4GCIA 4L8EA 3FKFA 2BMXA 2EC4A 3HDCA 4OCFA 2GQKA 3R3EA 3ZTLA 4YQUA 4JR6A 5CRWA 4BVYA 2WGRA 3GSSA 3KP9A 2ON5A 5G5EA 3CSIA 5J47A 1X9SB 2B1KA 4YKGA 4ZL9A 2YCDA 1PSQA 1EGOA 4AI6A 3D4MA 1A0FA 4G0IA 3ZL5A 6GSXA 3LSZA 5H5QA 1BG1A 2HFDA 1DUGA 2PU9C 1GTUA 4W66A 1EOHA 2AAWA 5F07A 1V57A 3BJ5A 3W8JA 3DD3A 3VK9A 3S9FA 4OD7A 3TKSA 4N0ZA 4G0LA 2ON7A 1Y25A 1O7UA 1PA3A 5HFGA 4XS1A 2O89A 4Z7XA 3APQA 3UVTA 1YY7A 1GTIA 3VLNA 4NXIA 5KN2A 1PN9A 2GGTA 2GT5A 2JSZA 5CP1A 1Q4JA 1K3LA 9GSSA 3N9JA 3C71A 4TXOB 1U87A 2GLRA 3IHGA 1TI1A 4POBA 4MMMA 4I2UA 2XBIA 4HQZA 3UBLA 3LEFA 2VL3A 1VGLA 4ML6A 4ZXGA 2IFQA 4G19A 4IP6A 2C4JA 2JL4A 4PI2C 1RW1A 3L0HA 4O5UA 4LMVA 2LRCA 1WMJA 2UZ8A 2VCXA 1M9AA 2H01A 4TXOA 3DXBA 2VOCA 4IN0A 2J23A 4K7OA 3DMLA 4WBJA 4WEYA 1LBKA 2O5VA 3HJOA 1AC1A 1SJZA 5G1LA 1MD4A 1BYEA 3F4TA 1T4ZA 1TXUA 1V98A 1SL0B 1X0RA 3CRTA 13GSA 3O6TA 2QKEA 1XWKA 4MNNA 1PN0A 3CSHA 3Q18A 1S4BP 2HI7A 3TJJA 1JZRA 1CQGA 1Z7RA 4TOPA 2A4VA 3EE2A 3C8EA 4MF6A 1OC3A 2LJRA 3QOUA 1ZCPA 4GSTA 1N2AA 1THXA 5IPHA 4KA0A 2JU5A 3RAZA 2HQTA 6GSVA 1CQHA 4O5RA 4JZQA 1PRXA 4FYUA 1TXXA 3IE3A 4IS0A 5IMAA 2L6DA 5J5NA 2EFEA 4I5QA 4H86A 3BD2A 2X49A 2WRTA 1UVZA 3ZRDA 4CW9A 3U6VA 3IC8A 5D9XA 3CYNA 1IYIA 3EC3A 1OYJA 2MBTA 1DSBA 1F2EA 3ZFLA 4YAPA 3TUEA 3CMIA 5IQYA 2YJHA 1XBSA 2CZ2A 4MF7A 4X43A 2FGXA 2VM1A 1TKDB 3D6IA 3V1WA 2O3EA 2D2ZA 2JZSA 3M8NA 1OC8A 3MIXA 3UBKA 5EL8A 4EC0A 2H0HA 3L9VA 2H0IA 1E2YA 1F37A 1RK4A 3EVIA 2IWTA 5IOWA 5KOWA 4K1FA 1SKSB 4TR1B 1A24A 5ELGA 1A2LA 3DVWA 4FIWA 1FO5A 4MF5A 1PL1A 5JCWA 5DALB 2HSHA 4FH8A 1TTZA 1B8XA 2QA1A 1URMA 4JU5A 3IXRA 1YKCA 2TRCP 2LNSA 2H70A 4DVCA 3MYDA 1K0OA 1DE2A 5GZZB 1QXHA 2PBJA 5C04A 1BG5A 4USSA 5ECQB 5ECRB 2I4AA 2A2RA 4MABA 3ZITA 2IMIA 4XIHA 1Z3EA 4IJIA 1V2AA 3ZVJD 3L9UA 2H72A 2VIMA 2R5GA 4FQUA 5B6MA 4GDFA 2YWOA 2F8FA 2R3XA 5DALA 4LLRA 2OA7A 3VWXA 3LYPA 1Z5YE 3W6GA 1XW9A 2HZEA 2R0CA 3GFKA 2XBQA 4XRDA 2TIRA 5KN0A 3FYGA 3Q74A 5GSTA 1U3IA 1EWXA 3FRCA 1JLVA 1SYRA 1QUWA 4EL1A 4X0XA 1FHEA 3D5JA 3LWAA 2C3QA 1ILOA 1JHBA 4F2IA 1XWGA 4JBBA 2HRAA 2CQ9A 3DYRA 2L5OA 3IAS2 4K2XA 2FWGA 1GSUA 2GQMA 2B7KA 3NZNA 3FZ4A 1BEDA 2QA2A 1YEWC 4E8HA 3P7XA 2H1AA 1IYHA 1VRSD 2EIQA 1ZZYA 3HMJG 1QQ2A 2H6YA 2MYGA 4L5LA 1ERTA 1HYUA 3QAGA 1K0NA 2CT6A 2Z9SA 5DJLA 3IBHA 4ZBAA 3E9JB 3O76A 3TRQA 4EKZA 4JEDA 3TKQA 5E59A 2AYTA 4NPBA 3APSA 4HU7A 2YNXA 2HRKB 2EIRA 4K5SA 2YPMA 2EIOA 2PVQA 5KEJA 3ISOA 4PTSA 3TRPA 2VCZA 3P90A 1GUKA 3M3MA 4AJ8A 4EF0A 1PX6A 5F0GA 1GL8A 5B8AA 4G01A 3LXZA 4IHUA 2GSSA 4J56E 2VLTA 5IMDA 4MLYA 11GSA 3EINA 5FT3A 2TRXA 2CV4A 5G31A 4TRXA 1J9BA 2HRKA 1S3AA 1M3JA 2L59A 3QFAC 1M2DA 3QR6A 2DSAA 2K8VA 2VL9A 4QL7A 4BL7B 3QAWA 3MNGA 2KP2A 2V41A 3LFLA 4HJ2A 2CAQA 1AQVA 2XHFA 2GS3A 3EU3A 1SD9A 3M9JA 4N30A 4PXOA 4ECIA 2X8GA 5HR2A 4OFMA 5ECMB 5F06A 2FCHA 3IK7A 2L5LA 2LRNA 1TJDA 2N5BA 3H1NA 1XPVA 1AQWA 3WGEA 1I9DA 5AIVA 3I9V2 2N5FA 4BL7A 3NOFA 1N25A 4HOJA 2R6KA 3L9SA 3K8NA 3UOMA 3G7YA 1ERWA 2VCQA 5AN1A 4YQVA 19GSA 2GSRA 3IV4A 4X4JA 1K0BA 4OO4A 3H79A 3TGZA 3A2XA 1EOGA 4LL4B 4ZL7A 1PMTA 1Y1UA 1V58A 2K6VA 1SL2B 5HFKA 5EPFA 4QQ7A 1PKZA 3FR9A 1T4YA 2IMDA 2RIIA 2YV9A 3US3A 3GTUB 4IQ1A 5KOXA 16GSA 4Q5RA 2A4HA 2V6OA 3GH6A 2B3SA 2DC5A 3GRXA 5F05A 1XVWA 3GH9A 3QPMA 2HSNA 4MZBA 4HUAA 3F6FA 4AKIA 4TR0A 1EGRA 2DMMA 3C1RA 2CX4A 1GSEA 2KHPA 1GSQA 4K7NA 3GUSA 1O73A 2DBCA 4EO3A 22GSA 2PERA 2VO4A 2AV4A 3GTUA 2YZUA 3M9KA 3F3QA 2HSYA 1XG8A 5CRDA 3WGXA 3QMXA 2VLUA 3C73A 2A2SA 2WW0A 2KLXA 4MJBA 3TJGA 5EVOA 3D0ZA 3UL3A 5A1NB 4K8MA 5A5HB 4O5QA 5JCGA 3AY8A 3HZ8A 1VF4A 4WBRD 5ECKB 2WFCA 5CRHA 5J4VA 1OE7A 1YDKA 3IDVA 4ZILA 3CWGA 3HCZA 14GSA 2JZTA 1GLPA 1SJIA 1WE0A 2P5QA 5CRGA 1HQOA 2H6XA 5AIXA 3GURA 4PI0C 5DCGA 3RPPA 1T00A 2YZHA 3HA9A 5A1NA 2OADA 5A5HA 1S3DA 3GMFA 3HVXA 2JACA 5JCUA 1SU9A 2H76A 2LRTA 3JCML 3VPTA 1JLWA 2IFQB 1AXDA 3IRAA 3KMOA 1TU7A 5ECLB 4TXVA 2LQQA 2OE1A 3ZFBA 3RHBA 1FVKA 4BIKA 6GSYA 3M0FA 4IQAA 4L5OA 3ERGA 1YEPA 1ZOFA 5A34B 1Z9HA 3KIJA 1O81A 4G9HA 4HS1A 1Z6NA 2P0GA 3IR4A 5B7CA 1GRXA 2AHEA 4KNDA 2M46A 3GKKA 3PGTA 5G30A 2A2PA 3UARA 1GULA 2CVDA 2ZNMA 3F63A 1M99A 1GP1A 4KB3A 5CO3A 5B6NA 5C00A 4YH2A 2MMOA 1NW2A 3CTGA 5D93A 1BQ7A 5A34A 4ZB7A 18GSA 4IKHA 3KZQA 1K0DA 1JFUA 3KXOA 3TU3B 5CAXA 4V1Ag 2C8UA 3KTBA 4IP1A 1NSWA 4O32A 3L4NA 4XHMA 3GKNA 1XWAA 2HNLA 1FB6A 4A5PA 1XXUA 1GTBA 1XZOA 4KCEA 1HNAA 3RBTA 2YWNA 4BPYA 4JRRA
chains in the Genus database with same CATH topology
4QMKA 1QK8A 1M7TA 1AAZA 4V2MA 5HR1A 5KN1A 1YF1A 2YP6A 2H30A 4LMWA 1TOFA 4F03A 2PUKC 2GZPA 4XS6A 5LCZA 3GN3A 1NHYA 4WETA 5J40A 5J4YA 3F9UA 1T1VA 3TB2A 5A4WA 3BBYA 1TRVA 1PL2A 4K5RA 5IMZA 2B5YA 3FY7A 2RUFA 5DQYA 2HE3A 4EIQA 5HFIA 3CTFA 1Y6EA 1TP9A 1G7EA 2H8LA 2WCIA 4ZBDA 1R7HA 1VF3A 4HDEA 3HJPA 2HSMB 2IMFA 2I81A 4WF5A 2WS2A 3GHAA 4POLA 4KDYA 3ZYWA 3QCPA 1GTAA 4GF0A 4GRFA 1GSYA 4XS4B 4K0GA 1HD2A 5EY6A 1TRWA 3LG6A 4ZBBA 3J7Yb 4ZB6A 3F3RA 1ZYPA 3HKRA 2IMKA 3IPZA 5DQSA 5DBQA 4G2EA 3VWUA 3GYKA 5INYA 2WZ9A 2X64A 3HZ4A 2HSMA 2HZFA 1GUMA 1G7OA 4ML1A 4AF2A 3VWWA 5J4UA 2H1DA 4XS4A 4GWRA 4L0WA 4PUAA 2LS5A 4K0NA 2ZCTA 3Q6OA 4PQIA 1OE8A 4IJ3A 1H4OA 4O7HA 4ZB9A 2G2QA 1MTCA 4HI7A 4MJEA 3QAVA 3MDKA 3F4SA 1MDKA 6GSUA 1G6WA 4Q5NA 4TR4A 4F0BA 1OKTA 3MSZA 5ECIB 3G7IA 2IPAA 3FK8A 2HZEB 1A0RP 2GZYA 5IMCA 4MP4A 2VCVA 1E6BA 1TI3A 1HNCA 3KM6A 3QDNA 2O7KA 2M80A 1TU8A 2V32A 4KAEA 2VLVA 3GNJA 4LL1B 4K6XA 4MZCA 3ZLPA 2H0GA 3DGQA 5H5RA 4POMA 4PNFA 1ERUA 1N8JA 5IMVA 3FR6A 2PGTA 4CY8A 3I6AA 1GSSA 1PQNA 2PVOC 1U6TA 2GDRA 2AB6A 1YJ6A 1USBA 2I1UA 3F4RA 3EYTA 3GA4A 4IBPA 3PPUA 5COHA 4GSSA 2X8HA 5IIZA 3VFIA 1EV4A 3WYWA 3KP8A 1SYXA 4KGIA 2LJKA 2F51A 1G6YA 1EV9A 3GX8A 2E0QA 3TDGA 1TK5B 2MZCA 2GQLA 2FA4A 2NPBA 3DWVA 2F8AA 2HRFA 4OFNA 2H73A 2KOKA 1SVMA 2C0GA 2J9HA 3A2VA 6GSSA 3DEXA 3FMWA 6GSWA 2E2MA 3VI5A 2GSTA 1X9MB 3H93A 3LGCA 1ST9A 5BMUB 3HXSA 1GNWA 2B5XA 4ECBA 1O8XA 3TKRA 3TJKA 2I3YA 2DLXA 5ENUA 2JSYA 3CSJA 3DRNA 5J41A 4GTUA 2H1GA 1XW6A 4NV2A 4EUYA 2WB9A 4TW5A 4KSMA 2JZRA 4K7IA 2EFCA 1FB0A 4FYBA 4ZIJA 2EFHA 1TK8B 3VWVA 2YJ7A 1GSFA 1VF1A 1O6JA 4MDCA 4EIPA 2PN8A 2XPDA 2LSTA 4F9ZA 1XW5A 2RM5A 3GKXA 5BMUA 4D73B 2HT9A 1SKWB 4E68A 4TVEA 1TW9A 1A2MA 2C3TA 4V1Ap 1X5DA 2H71A 3HHVA 3EWLA 3D21A 1EP8A 2H1LA 4PGTA 3ZMKA 3DIEA 1OC9B 2REMA 4Q5FA 1K3OA 4POKA 1GNEA 1QFNA 1XCCA 4D73A 4WKWA 3MAKA 1GUHA 1LJRA 3IK9A 3ZREA 4FYCA 5DAKB 1JZDA 4NV5A 2FWHA 2V2GA 4GLTA 5G5FA 2DIZA 3UEMA 2L4CA 2HYXA 4OCEA 1UA5A 4N0VA 4MJAA 1SD8A 3F6DA 1OC9A 1VF2A 1FOVA 1GSDA 1K3YA 2B7JA 4KH7A 1YZXA 5ABRA 5ECSA 2QSIA 5IMFA 2HSNB 3A5IA 2MBSA 4J2FA 3CBUA 1DBYA 2DKHA 5DAKA 2NDOA 3W8SA 1NM3A 2R37A 1GWCA 1ON4A 3BCKA 2BJXA 4F0CA 12GSA 1C72A 3QFBC 3HVVA 2H75A 1EP7A 4G10A 1M0UA 2PMTA 4OWYA 1YQ1A 3E0UA 3TRXA 3LORA 1ZYNA 1B9YC 2DJJA 1M2BA 1T8EB 3FZ9A 3KMNA 1RQMA 1TDIA 1X5EA 1FVJA 1ACVA 4GQFA 2OE0A 4V2LA 1EEJA 1TK0B 1ZYQB 2NVLA 2VCWA 4YKFA 1XOBA 1ZL9A 4AKHA 5HR3A 3HVSA 3KTLA 5FWGA 3I69A 2OACA 4WR4A 5HQPA 1XWCA 4Z2TA 2KUCA 3EURA 4WXTA 3MWHA 1SK0A 2NBSA 2DJ0A 17GSA 4HZ2A 4HEA2 4AKGA 1R5AA 1OAZA 3D22A 2G0FA 1SVOA 1SENA 1ERVA 1QMVA 3ERWA 3TOUA 2VCTA 2MMNA 2L6CA 2K8SA 3A5WA 3HY2A 4BWQA 2B5EA 1T3BA 4ACSA 4FO5A 1UN2A 1R5PA 5J9BA 2GSQA 4DSRA 5L71A 1PGTA 1WP0A 3IC4A 5DVBA 4KX4A 2CAIA 4I97A 2VM2A 2FA8A 1BAYA 2H74A 2N5AA 2LJAA 4PX1A 4AGSA 3G9BA 5G2ZA 5CYYA 1PX7A 3C7MA 3KEBA 3C1SA 1KNGA 5G1KA 4IELA 3SBCA 4RQRA 5LNKe 4GQCA 1BF5A 3H8QA 1W4VA 2EFDA 3BCIA 4YQMA 1OKDA 1AUCA 3E3EA 2K18A 1I5GA 4Z2RA 3RDWA 1SK2A 3GKMA 4N11A 2FD3A 1WJKA 2LEGA 4EE0A 2IN3A 2E2GA 4GXZA 2H19A 4NAXA 4AJ6A 5FHIA 4DSQA 3I43A 3F8UA 4KUNA 4MK3A 2FWEA 2L57A 2IJYA 2ALBA 4PQ1A 4GSNA 5D9VA 1FAAA 4TN8A 5ID2B 4PUFC 1PKWA 1F9MA 4XTSA 3UVHA 2XC2A 5ECHB 1B9XC 2P5RA 5DDLA 1XVQA 1B4PA 2YOIA 3KH9A 2VL2C 3KCMA 5GAND 5IO2A 3D4TA 5A4VA 2OKAA 3FZAA 2XPEA 4L0UA 5HR0A 4BA7A 4ILFA 2V1MA 2CZ3A 2YN1A 3RHCA 4P3YB 5ID2A 5CNWA 3U5RE 3G7JA 3N5OA 2C3NA 4EXJA 3VPQA 2VKZG 4RQXA 2DJ2A 1J0FA 4KW6A 3UIWA 4XRAA 1YEXA 4NWYA 1MDIA 4MA9A 1K0CA 2LTKA 4I6XA 5BRTA 2CVBA 3ME7A 3BOAA 2HLSA 3UAPA 2FWFA 2H1BA 1S3CA 2O87A 2DIYA 4RUVA 4BWSA 1MDJA 5DJMA 2MMAA 1T7PB 3ZVJA 1WOUA 1KBNA 3KH7A 4DEJA 1WIKA 5GSSA 1V9WA 4PQHA 3ZMLA 2QC7A 3L78A 2CA8A 3HYPA 1PD21 4BVXB 2AJQB 1NHOA 2VD1A 1X9WB 3PINA 3PH9A 2LKUA 2HRNA 4I2TA 4NHWA 1Z6MA 2FUG2 1O85A 3ZZXA 4RI7A 4CHSA 2WDUA 5D9WA 1JZOA 2IL3A 1MD3A 4YAVA 3EPTA 5J9CA 2DJKA 4ECCA 3FW2A 4CDOA 3M1GA 1JZWA 3UJ1A 1SVLA 4PNGA 5AISA 1Q98A 20GSA 4DSSB 4KSOA 3R2QA 4BVXA 4K9ZA 2GTUA 1B48A 4KCAA 3UMAA 5D8IA 4Q5QA 2KP1A 1A8LA 4G0KA 2H66A 1XFLA 4MPGA 2L4QA 4OMVA 4MH2A 3CRUA 1V40A 4MH3A 4QL9A 1SJ6A 2E7PA 3TJBA 3Q19A 8GSSA 3F0IA 4DSSA 2BTOT 4V2NA 4N3ZA 2NTOA 4WR5A 5ECNB 1B4QA 3IAM2 6GSTA 3KJYA 1U88A 1LU4A 3VURA 3GV1A 2LV3A 3ZIVA 3ERFA 3IHQA 4IVFA 2F9SA 4E8EA 4ID0A 4ULXA 1G0TA 1J08A 1XOAA 3A3TA 3DVXA 1QGVA 2UV8G 5A5KA 3WGDA 1BX9A 2WJUA 4AKXB 1W89A 4TR1A 3CXGA 5ECPB 1THOA 1WPIA 2R2JA 3EU4A 1TRSA 3ZIJA 2DJ1A 3RPNA 4F82A 3LYKA 4MJCA 1EEMA 2OBIA 5JWOB 2FY6A 3OR5A 3APOA 5AGYA 5E4WA 3TKSC 3P8WA 5IOXA 4AJ7A 4OO5A 2VUPA 5H5SA 5J3RA 1SKRB 3PR8A 2YWMA 2IIYA 5A4UA 5B8BA 5KN3A 1FW1A 2C0FA 1K0MA 5D9TA 1OVNA 1FOHA 2GVPA 1YVLA 2C1YA 4HU9A 2JADA 2FLSA 3ME8A 1AW9A 2DKIA 2R0GA 3EMXA 4MCUA 2GZZA 3GL5A 4X1UA 3TCOA 2C0EA 2I9HA 1TRUA 5CREA 4KDXA 2DMLA 2H6ZA 5D96A 1ZYEA 1ABAA 3LXTA 2ZUPA 1DE1A 2OT3A 5JWRB 2IMEA 4HZ4A 5ECOB 2FHEA 3GX0A 2DJ3A 3FR3A 5F8BA 2YANA 2WULA 2HXKA 4ECJA 2OBKA 2C0DA 4KDUA 2B1LA 2FNOA 1EZKA 2B6MA 4TKYA 5IM9A 3FEUA 4CY6A 4WF4A 3TOTA 2VL2A 4J57E 1YKAA 4K2DA 2LQOA 5JWQB 3A2WA 1AIUA 1O8WA 3SWLA 4KF9A 1WRYA 1SK1A 4IGJA 4JE1A 2MMZA 2YV7A 1ZGNA 3FHKA 4HQSA 1F6MC 1GH2A 1A2JA 4KE3A 1F3AA 2CVKA 4NHZA 4MPFA 5D73A 3KGKA 2QGVA 4EVMA 2X8CA 1HNBA 1YF0A 3WD6A 2O85A 2VAFA 1BJXA 2GT6A 4RI6A 3HJMA 4ZB8A 4TR3A 3TJFA 1K0AA 2F3MA 3GSTA 3GIXA 2YWIA 5GAPD 4IW9A 2PPTA 2X99A 3KD0A 2LNTA 2R4VA 1R4WA 2VD0A 2V6KA 3WT1A 4I8BA 1KTEA 2P31A 2PWJA 1UC7A 2ES7A 3H4KA 1Z7PA 3O3TA 2R0PA 1ML6A 4EDZA 4Z2UA 3GL3A 2X4AA 4NMUA 3DKSA 1A23A 2CX3A 4ISDA 4MZWA 1R26A 4ICYA 3LJRA 3ED3A 4EDYA 5DCHA 1MEKA 3VI7A 5IO0A 1FG4A 1XIYA 2RUEA 2OE3A 3TKSE 3IOSA 3P2AA 3QD9A 5IPGA 1GLQA 3EMPA 3WT2A 1H75A 1F3BA 2K9FA 4OFTA 2M72A 2C80A 3TKPA 4LA1A 2AUVA 4PURA 10GSA 3J7Yk 5ELAA 4JR4A 7GSSA 2RLIA 4XCSA 1A8YA 4O92A 4N10A 1U3AA 3HD5A 1X5CA 1M9BA 1WWJA 2LUSA 1SL1B 4BVYB 3FZ5A 1XWBA 3NIVA 5LD0A 3LW9A 3LQ7A 4HJMA 2O8VB 2OJLA 1KEBA 3IA1A 1M2AA 2RM6A 1AQXA 4ZL8A 1ZMAA 4GCIA 4L8EA 3FKFA 2BMXA 2EC4A 3HDCA 4OCFA 2GQKA 3R3EA 3ZTLA 4YQUA 4JR6A 5CRWA 4BVYA 2WGRA 3GSSA 3KP9A 2ON5A 5G5EA 3CSIA 5J47A 1X9SB 2B1KA 4YKGA 4ZL9A 2YCDA 1PSQA 1EGOA 4AI6A 3D4MA 1A0FA 4G0IA 3ZL5A 6GSXA 3LSZA 5H5QA 1BG1A 2HFDA 1DUGA 2PU9C 1GTUA 4W66A 1EOHA 2AAWA 5F07A 1V57A 3BJ5A 3W8JA 3DD3A 3VK9A 3S9FA 4OD7A 3TKSA 4N0ZA 4G0LA 2ON7A 1Y25A 1O7UA 1PA3A 5HFGA 4XS1A 2O89A 4Z7XA 3APQA 3UVTA 1YY7A 1GTIA 3VLNA 4NXIA 5KN2A 1PN9A 2GGTA 2GT5A 2JSZA 5CP1A 1Q4JA 1K3LA 9GSSA 3N9JA 3C71A 4TXOB 1U87A 2GLRA 3IHGA 1TI1A 4POBA 4MMMA 4I2UA 2XBIA 4HQZA 3UBLA 3LEFA 2VL3A 1VGLA 4ML6A 4ZXGA 2IFQA 4G19A 4IP6A 2C4JA 2JL4A 1RW1A 3L0HA 4O5UA 4LMVA 2LRCA 1WMJA 2UZ8A 2VCXA 1M9AA 2H01A 4TXOA 3DXBA 2VOCA 4IN0A 2J23A 4K7OA 3DMLA 4WBJA 4WEYA 1LBKA 2O5VA 3HJOA 1AC1A 1SJZA 5G1LA 1MD4A 1BYEA 3F4TA 1T4ZA 1TXUA 1V98A 1SL0B 1X0RA 3CRTA 13GSA 3O6TA 2QKEA 1XWKA 4MNNA 1PN0A 3CSHA 3Q18A 2HI7A 3TJJA 1JZRA 1CQGA 1Z7RA 4TOPA 2A4VA 3EE2A 3C8EA 4MF6A 1OC3A 2LJRA 3QOUA 1ZCPA 4GSTA 1N2AA 1THXA 5IPHA 4KA0A 2JU5A 3RAZA 2HQTA 6GSVA 1CQHA 4O5RA 4JZQA 1PRXA 4FYUA 1TXXA 3IE3A 4IS0A 5IMAA 2L6DA 5J5NA 2EFEA 4I5QA 4H86A 3BD2A 2X49A 2WRTA 1UVZA 3ZRDA 4CW9A 3U6VA 3IC8A 5D9XA 3CYNA 1IYIA 3EC3A 1OYJA 2MBTA 1DSBA 1F2EA 3ZFLA 4YAPA 3TUEA 3CMIA 5IQYA 2YJHA 1XBSA 2CZ2A 4MF7A 4X43A 2FGXA 2VM1A 1TKDB 3D6IA 3V1WA 2JZSA 2D2ZA 3M8NA 1OC8A 3MIXA 3UBKA 5EL8A 4EC0A 2H0HA 3L9VA 2H0IA 1E2YA 1F37A 1RK4A 3EVIA 2IWTA 5IOWA 5KOWA 4K1FA 1SKSB 4TR1B 1A24A 5ELGA 1A2LA 3DVWA 4FIWA 1FO5A 4MF5A 1PL1A 5JCWA 5DALB 2HSHA 4FH8A 1TTZA 1B8XA 2QA1A 1URMA 4JU5A 3IXRA 1YKCA 2TRCP 2LNSA 2H70A 4DVCA 3MYDA 1K0OA 1DE2A 5GZZB 1QXHA 2PBJA 5C04A 1BG5A 4USSA 5ECQB 5ECRB 2I4AA 2A2RA 4MABA 3ZITA 2IMIA 4XIHA 1Z3EA 4IJIA 1V2AA 3ZVJD 3L9UA 2H72A 2VIMA 2R5GA 4FQUA 5B6MA 4GDFA 2YWOA 2F8FA 2R3XA 5DALA 4LLRA 2OA7A 3VWXA 3LYPA 1Z5YE 3W6GA 1XW9A 2HZEA 2R0CA 3GFKA 2XBQA 4XRDA 2TIRA 5KN0A 3FYGA 3Q74A 5GSTA 1U3IA 1EWXA 3FRCA 1JLVA 1SYRA 1QUWA 4EL1A 4X0XA 1FHEA 3D5JA 3LWAA 2C3QA 1ILOA 1JHBA 4F2IA 1XWGA 4JBBA 2HRAA 2CQ9A 3DYRA 2L5OA 3IAS2 4K2XA 2FWGA 1GSUA 2GQMA 2B7KA 3NZNA 3FZ4A 1BEDA 2QA2A 4E8HA 3P7XA 2H1AA 1IYHA 1VRSD 2EIQA 1ZZYA 3HMJG 1QQ2A 2H6YA 2MYGA 4L5LA 1ERTA 1HYUA 3QAGA 1K0NA 2CT6A 2Z9SA 5DJLA 3IBHA 4ZBAA 3E9JB 3O76A 3TRQA 4EKZA 4JEDA 3TKQA 5E59A 2AYTA 4NPBA 3APSA 4HU7A 2YNXA 2HRKB 2EIRA 4K5SA 2YPMA 2EIOA 2PVQA 5KEJA 3ISOA 4PTSA 3TRPA 2VCZA 3P90A 1GUKA 3M3MA 4AJ8A 4EF0A 1PX6A 5F0GA 1GL8A 5B8AA 4G01A 3LXZA 4IHUA 2GSSA 4J56E 2VLTA 5IMDA 4MLYA 11GSA 3EINA 5FT3A 2TRXA 2CV4A 5G31A 4TRXA 1J9BA 2HRKA 1S3AA 2L59A 3QFAC 1M2DA 3QR6A 2DSAA 2K8VA 2VL9A 4QL7A 4BL7B 3QAWA 3MNGA 2KP2A 2V41A 3LFLA 4HJ2A 2CAQA 1AQVA 2XHFA 2GS3A 3EU3A 1SD9A 3M9JA 4N30A 4PXOA 4ECIA 2X8GA 5HR2A 4OFMA 5ECMB 5F06A 2FCHA 3IK7A 2L5LA 2LRNA 1TJDA 2N5BA 3H1NA 1XPVA 1AQWA 3WGEA 1I9DA 5AIVA 3I9V2 2N5FA 4BL7A 3NOFA 1N25A 4HOJA 2R6KA 3L9SA 3K8NA 3UOMA 3G7YA 1ERWA 2VCQA 5AN1A 4YQVA 19GSA 2GSRA 3IV4A 4X4JA 1K0BA 4OO4A 3H79A 3TGZA 3A2XA 1EOGA 4LL4B 4ZL7A 1PMTA 1Y1UA 1V58A 2K6VA 1SL2B 5HFKA 5EPFA 4QQ7A 1PKZA 3FR9A 1T4YA 2IMDA 2RIIA 2YV9A 3US3A 3GTUB 4IQ1A 5KOXA 16GSA 4Q5RA 2A4HA 2V6OA 3GH6A 2B3SA 2DC5A 3GRXA 5F05A 1XVWA 3GH9A 3QPMA 2HSNA 4MZBA 4HUAA 3F6FA 4AKIA 4TR0A 1EGRA 2DMMA 3C1RA 2CX4A 1GSEA 2KHPA 1GSQA 4K7NA 3GUSA 1O73A 2DBCA 4EO3A 22GSA 2PERA 2VO4A 2AV4A 3GTUA 2YZUA 3M9KA 3F3QA 2HSYA 5CRDA 3WGXA 3QMXA 2VLUA 3C73A 2A2SA 2KLXA 4MJBA 3TJGA 5EVOA 3D0ZA 3UL3A 5A1NB 4K8MA 5A5HB 4O5QA 5JCGA 3AY8A 3HZ8A 1VF4A 4WBRD 5ECKB 2WFCA 5CRHA 5J4VA 1OE7A 1YDKA 3IDVA 4ZILA 3CWGA 3HCZA 14GSA 2JZTA 1GLPA 1SJIA 1WE0A 2P5QA 5CRGA 1HQOA 2H6XA 5AIXA 3GURA 5DCGA 3RPPA 1T00A 2YZHA 3HA9A 5A1NA 2OADA 5A5HA 1S3DA 3GMFA 3HVXA 2JACA 5JCUA 1SU9A 2H76A 2LRTA 3JCML 3VPTA 1JLWA 2IFQB 1AXDA 3IRAA 3KMOA 1TU7A 5ECLB 4TXVA 2LQQA 2OE1A 3ZFBA 3RHBA 1FVKA 6GSYA 3M0FA 4IQAA 4L5OA 3ERGA 1YEPA 1ZOFA 5A34B 1Z9HA 3KIJA 1O81A 4G9HA 4HS1A 1Z6NA 2P0GA 3IR4A 5B7CA 1GRXA 2AHEA 4KNDA 2M46A 3GKKA 3PGTA 5G30A 2A2PA 3UARA 1GULA 2CVDA 2ZNMA 3F63A 1M99A 1GP1A 4KB3A 5CO3A 5B6NA 5C00A 4YH2A 2MMOA 1NW2A 3CTGA 5D93A 1BQ7A 5A34A 4ZB7A 18GSA 4IKHA 3KZQA 1K0DA 1JFUA 3KXOA 3TU3B 5CAXA 4V1Ag 2C8UA 3KTBA 4IP1A 1NSWA 4O32A 3L4NA 4XHMA 3GKNA 1XWAA 2HNLA 1FB6A 4A5PA 1XXUA 1GTBA 1XZOA 4KCEA 1HNAA 3RBTA 2YWNA 4BPYA 4JRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QK8 A;  1M7T A;  1AAZ A;  4V2M A;  5HR1 A;  5KN1 A;  1YF1 A;  2YP6 A;  2H30 A;  4LMW A;  1TOF A;  4F03 A;  2PUK C;  2GZP A;  4XS6 A;  5LCZ A;  3GN3 A;  1NHY A;  4WET A;  3F9U A;  1T1V A;  3TB2 A;  5A4W A;  3BBY A;  1TRV A;  1PL2 A;  5IMZ A;  2B5Y A;  3FY7 A;  2RUF A;  5DQY A;  2HE3 A;  5HFI A;  3CTF A;  1Y6E A;  1TP9 A;  1G7E A;  2H8L A;  2WCI A;  4ZBD A;  1R7H A;  1VF3 A;  4HDE A;  3HJP A;  2HSM B;  2IMF A;  2I81 A;  4WF5 A;  2WS2 A;  3GHA A;  4POL A;  4KDY A;  3ZYW A;  3QCP A;  1GTA A;  4GF0 A;  4GRF A;  1GSY A;  4XS4 B;  4K0G A;  1HD2 A;  5EY6 A;  1TRW A;  3LG6 A;  4ZBB A;  3J7Y b;  4ZB6 A;  3F3R A;  3HKR A;  2IMK A;  3IPZ A;  5DQS A;  5DBQ A;  4G2E A;  3VWU A;  3GYK A;  5INY A;  2WZ9 A;  2X64 A;  3HZ4 A;  2HSM A;  2HZF A;  1GUM A;  1G7O A;  4ML1 A;  4AF2 A;  3VWW A;  5J4U A;  2H1D A;  4XS4 A;  4GWR A;  4L0W A;  4PUA A;  2LS5 A;  4K0N A;  2ZCT A;  3Q6O A;  4PQI A;  1OE8 A;  4IJ3 A;  1H4O A;  4O7H A;  4ZB9 A;  2G2Q A;  1MTC A;  4HI7 A;  4MJE A;  3QAV A;  3MDK A;  3F4S A;  1MDK A;  6GSU A;  1G6W A;  4Q5N A;  4TR4 A;  4F0B A;  1OKT A;  3MSZ A;  5ECI B;  3G7I A;  2IPA A;  3FK8 A;  2HZE B;  1A0R P;  2GZY A;  5IMC A;  4MP4 A;  2VCV A;  1E6B A;  1TI3 A;  1HNC A;  3KM6 A;  3QDN A;  2O7K A;  2M80 A;  1TU8 A;  2V32 A;  4KAE A;  2VLV A;  3GNJ A;  4LL1 B;  4K6X A;  4MZC A;  3ZLP A;  2H0G A;  3DGQ A;  5H5R A;  4POM A;  4PNF A;  1ERU A;  1N8J A;  5IMV A;  3FR6 A;  2PGT A;  3I6A A;  1GSS A;  1PQN A;  2PVO C;  1U6T A;  2GDR A;  2AB6 A;  1YJ6 A;  1USB A;  2I1U A;  3F4R A;  3EYT A;  3GA4 A;  4IBP A;  3PPU A;  5COH A;  4GSS A;  2X8H A;  5IIZ A;  3VFI A;  1EV4 A;  3WYW A;  3KP8 A;  1SYX A;  4KGI A;  2LJK A;  2F51 A;  1G6Y A;  1EV9 A;  3GX8 A;  2E0Q A;  3TDG A;  1TK5 B;  2MZC A;  2GQL A;  2FA4 A;  2NPB A;  3DWV A;  2F8A A;  2HRF A;  4OFN A;  2H73 A;  2KOK A;  2C0G A;  2J9H A;  3A2V A;  6GSS A;  3DEX A;  6GSW A;  2E2M A;  3VI5 A;  2GST A;  1X9M B;  3H93 A;  3LGC A;  1ST9 A;  3HXS A;  1GNW A;  2B5X A;  4ECB A;  1O8X A;  3TKR A;  3TJK A;  2I3Y A;  2DLX A;  5ENU A;  2JSY A;  3CSJ A;  3DRN A;  5J41 A;  4GTU A;  2H1G A;  1XW6 A;  4NV2 A;  4EUY A;  2WB9 A;  4TW5 A;  4KSM A;  2JZR A;  4K7I A;  1FB0 A;  4FYB A;  4ZIJ A;  1TK8 B;  3VWV A;  2YJ7 A;  1GSF A;  1VF1 A;  1O6J A;  4MDC A;  2PN8 A;  2XPD A;  2LST A;  4F9Z A;  1XW5 A;  2RM5 A;  3GKX A;  5BMU A;  4D73 B;  2HT9 A;  1SKW B;  4TVE A;  1TW9 A;  1A2M A;  2C3T A;  4V1A p;  1X5D A;  2H71 A;  3HHV A;  3EWL A;  3D21 A;  1EP8 A;  4PGT A;  3ZMK A;  3DIE A;  1OC9 B;  2REM A;  4Q5F A;  1K3O A;  4POK A;  1GNE A;  1QFN A;  1XCC A;  4D73 A;  4WKW A;  3MAK A;  1GUH A;  1LJR A;  3IK9 A;  3ZRE A;  4FYC A;  5DAK B;  1JZD A;  4NV5 A;  2FWH A;  2V2G A;  4GLT A;  5G5F A;  2DIZ A;  3UEM A;  2L4C A;  2HYX A;  4OCE A;  1UA5 A;  4N0V A;  4MJA A;  1SD8 A;  3F6D A;  1OC9 A;  1VF2 A;  1FOV A;  1GSD A;  1K3Y A;  2B7J A;  4KH7 A;  1YZX A;  5ABR A;  5ECS A;  2QSI A;  5IMF A;  2HSN B;  2MBS A;  4J2F A;  3CBU A;  1DBY A;  5DAK A;  2NDO A;  3W8S A;  1NM3 A;  2R37 A;  1GWC A;  1ON4 A;  3BCK A;  2BJX A;  4F0C A;  12GS A;  1C72 A;  3QFB C;  3HVV A;  2H75 A;  1EP7 A;  4G10 A;  1M0U A;  2PMT A;  4OWY A;  1YQ1 A;  3E0U A;  3TRX A;  3LOR A;  1B9Y C;  2DJJ A;  1M2B A;  1T8E B;  3FZ9 A;  3KMN A;  1RQM A;  1TDI A;  1X5E A;  1FVJ A;  1ACV A;  4GQF A;  2OE0 A;  4V2L A;  1EEJ A;  1TK0 B;  1ZYQ B;  2NVL A;  2VCW A;  1XOB A;  1ZL9 A;  5HR3 A;  3HVS A;  3KTL A;  5FWG A;  3I69 A;  2OAC A;  4WR4 A;  5HQP A;  1XWC A;  2KUC A;  3EUR A;  4WXT A;  3MWH A;  1SK0 A;  2NBS A;  2DJ0 A;  17GS A;  4HZ2 A;  4HEA 2;  1R5A A;  1OAZ A;  3D22 A;  2G0F A;  1SEN A;  1ERV A;  1QMV A;  3ERW A;  3TOU A;  2VCT A;  2MMN A;  2L6C A;  2K8S A;  3A5W A;  3HY2 A;  4BWQ A;  2B5E A;  1T3B A;  4ACS A;  4FO5 A;  1UN2 A;  1R5P A;  5J9B A;  2GSQ A;  4DSR A;  5L71 A;  1PGT A;  1WP0 A;  3IC4 A;  5DVB A;  4KX4 A;  2CAI A;  4I97 A;  2VM2 A;  2FA8 A;  1BAY A;  2H74 A;  2N5A A;  2LJA A;  4PX1 A;  4AGS A;  3G9B A;  5G2Z A;  5CYY A;  1PX7 A;  3C7M A;  3KEB A;  3C1S A;  1KNG A;  5G1K A;  4IEL A;  3SBC A;  4RQR A;  5LNK e;  4GQC A;  3H8Q A;  1W4V A;  3BCI A;  4YQM A;  1OKD A;  1AUC A;  3E3E A;  2K18 A;  1I5G A;  3RDW A;  1SK2 A;  3GKM A;  4N11 A;  2FD3 A;  1WJK A;  2LEG A;  4EE0 A;  2IN3 A;  2E2G A;  4GXZ A;  2H19 A;  4NAX A;  4AJ6 A;  5FHI A;  4DSQ A;  3I43 A;  3F8U A;  4KUN A;  4MK3 A;  2FWE A;  2L57 A;  2IJY A;  2ALB A;  4PQ1 A;  4GSN A;  5D9V A;  1FAA A;  4TN8 A;  5ID2 B;  4PUF C;  1PKW A;  1F9M A;  4XTS A;  3UVH A;  2XC2 A;  5ECH B;  1B9X C;  2P5R A;  5DDL A;  1XVQ A;  1B4P A;  2YOI A;  3KH9 A;  2VL2 C;  3KCM A;  5GAN D;  5IO2 A;  3D4T A;  5A4V A;  2OKA A;  3FZA A;  2XPE A;  4L0U A;  5HR0 A;  4BA7 A;  4ILF A;  2V1M A;  2CZ3 A;  2YN1 A;  3RHC A;  4P3Y B;  5ID2 A;  5CNW A;  3U5R E;  3G7J A;  3N5O A;  2C3N A;  4EXJ A;  3VPQ A;  4RQX A;  2DJ2 A;  1J0F A;  4KW6 A;  3UIW A;  4XRA A;  1YEX A;  4NWY A;  1MDI A;  4MA9 A;  1K0C A;  2LTK A;  4I6X A;  2CVB A;  3ME7 A;  3BOA A;  2HLS A;  3UAP A;  2FWF A;  2H1B A;  1S3C A;  2O87 A;  2DIY A;  4RUV A;  4BWS A;  1MDJ A;  5DJM A;  2MMA A;  1T7P B;  3ZVJ A;  1WOU A;  1KBN A;  3KH7 A;  4DEJ A;  1WIK A;  5GSS A;  1V9W A;  4PQH A;  3ZML A;  2QC7 A;  3L78 A;  2CA8 A;  3HYP A;  1PD2 1;  4BVX B;  2AJQ B;  1NHO A;  2VD1 A;  1X9W B;  3PIN A;  3PH9 A;  2LKU A;  2HRN A;  4I2T A;  4NHW A;  1Z6M A;  2FUG 2;  1O85 A;  3ZZX A;  4RI7 A;  4CHS A;  2WDU A;  5D9W A;  1JZO A;  2IL3 A;  1MD3 A;  4YAV A;  5J9C A;  2DJK A;  4ECC A;  3FW2 A;  4CDO A;  3M1G A;  1JZW A;  3UJ1 A;  4PNG A;  5AIS A;  1Q98 A;  20GS A;  4DSS B;  4KSO A;  3R2Q A;  4BVX A;  4K9Z A;  2GTU A;  1B48 A;  4KCA A;  3UMA A;  5D8I A;  4Q5Q A;  2KP1 A;  1A8L A;  4G0K A;  2H66 A;  1XFL A;  4MPG A;  2L4Q A;  4OMV A;  4MH2 A;  3CRU A;  1V40 A;  4MH3 A;  4QL9 A;  1SJ6 A;  2E7P A;  3TJB A;  3Q19 A;  8GSS A;  3F0I A;  4DSS A;  2BTO T;  4V2N A;  2NTO A;  4WR5 A;  5ECN B;  1B4Q A;  3IAM 2;  6GST A;  3KJY A;  1U88 A;  1LU4 A;  3VUR A;  3GV1 A;  2LV3 A;  3ZIV A;  3ERF A;  3IHQ A;  4IVF A;  2F9S A;  4E8E A;  4ID0 A;  4ULX A;  1G0T A;  1J08 A;  1XOA A;  3A3T A;  3DVX A;  1QGV A;  5A5K A;  3WGD A;  1BX9 A;  2WJU A;  1W89 A;  4TR1 A;  3CXG A;  5ECP B;  1THO A;  1WPI A;  2R2J A;  3EU4 A;  1TRS A;  3ZIJ A;  2DJ1 A;  3RPN A;  4F82 A;  3LYK A;  4MJC A;  1EEM A;  2OBI A;  5JWO B;  2FY6 A;  3OR5 A;  3APO A;  5AGY A;  5E4W A;  3TKS C;  3P8W A;  5IOX A;  4AJ7 A;  4OO5 A;  2VUP A;  5H5S A;  5J3R A;  1SKR B;  3PR8 A;  2YWM A;  2IIY A;  5A4U A;  5B8B A;  5KN3 A;  1FW1 A;  2C0F A;  1K0M A;  5D9T A;  1OVN A;  2GVP A;  2C1Y A;  4HU9 A;  2JAD A;  2FLS A;  3ME8 A;  1AW9 A;  3EMX A;  4MCU A;  2GZZ A;  3GL5 A;  4X1U A;  3TCO A;  2C0E A;  2I9H A;  1TRU A;  5CRE A;  4KDX A;  2DML A;  2H6Z A;  5D96 A;  1ZYE A;  1ABA A;  3LXT A;  2ZUP A;  1DE1 A;  5JWR B;  2IME A;  4HZ4 A;  5ECO B;  2FHE A;  3GX0 A;  2DJ3 A;  3FR3 A;  5F8B A;  2YAN A;  2WUL A;  2HXK A;  4ECJ A;  2OBK A;  2C0D A;  4KDU A;  2B1L A;  2FNO A;  1EZK A;  2B6M A;  4TKY A;  5IM9 A;  3FEU A;  4WF4 A;  3TOT A;  2VL2 A;  4J57 E;  1YKA A;  4K2D A;  2LQO A;  5JWQ B;  3A2W A;  1AIU A;  1O8W A;  3SWL A;  4KF9 A;  1WRY A;  1SK1 A;  4IGJ A;  4JE1 A;  2MMZ A;  2YV7 A;  1ZGN A;  3FHK A;  4HQS A;  1F6M C;  1GH2 A;  1A2J A;  4KE3 A;  1F3A A;  2CVK A;  4NHZ A;  4MPF A;  5D73 A;  3KGK A;  2QGV A;  4EVM A;  2X8C A;  1HNB A;  1YF0 A;  3WD6 A;  2O85 A;  2VAF A;  1BJX A;  2GT6 A;  4RI6 A;  3HJM A;  4ZB8 A;  4TR3 A;  3TJF A;  1K0A A;  2F3M A;  3GST A;  3GIX A;  2YWI A;  5GAP D;  4IW9 A;  2PPT A;  2X99 A;  3KD0 A;  2LNT A;  2R4V A;  1R4W A;  2VD0 A;  2V6K A;  3WT1 A;  4I8B A;  1KTE A;  2P31 A;  2PWJ A;  1UC7 A;  2ES7 A;  3H4K A;  1Z7P A;  3O3T A;  1ML6 A;  4EDZ A;  3GL3 A;  4NMU A;  3DKS A;  1A23 A;  2CX3 A;  4ISD A;  4MZW A;  1R26 A;  3LJR A;  3ED3 A;  4EDY A;  5DCH A;  1MEK A;  3VI7 A;  5IO0 A;  1FG4 A;  1XIY A;  2RUE A;  2OE3 A;  3TKS E;  3IOS A;  3P2A A;  3QD9 A;  5IPG A;  1GLQ A;  3EMP A;  3WT2 A;  1H75 A;  1F3B A;  2K9F A;  4OFT A;  2M72 A;  2C80 A;  3TKP A;  4LA1 A;  2AUV A;  4PUR A;  10GS A;  3J7Y k;  5ELA A;  4JR4 A;  7GSS A;  2RLI A;  4XCS A;  1A8Y A;  4O92 A;  4N10 A;  1U3A A;  3HD5 A;  1X5C A;  1M9B A;  1WWJ A;  2LUS A;  1SL1 B;  4BVY B;  3FZ5 A;  1XWB A;  3NIV A;  5LD0 A;  3LQ7 A;  4HJM A;  2O8V B;  2OJL A;  1KEB A;  3IA1 A;  1M2A A;  2RM6 A;  1AQX A;  4ZL8 A;  1ZMA A;  4GCI A;  4L8E A;  3FKF A;  2BMX A;  2EC4 A;  3HDC A;  4OCF A;  2GQK A;  3R3E A;  3ZTL A;  4YQU A;  4JR6 A;  5CRW A;  4BVY A;  2WGR A;  3GSS A;  3KP9 A;  2ON5 A;  5G5E A;  3CSI A;  1X9S B;  2B1K A;  4ZL9 A;  2YCD A;  1PSQ A;  1EGO A;  3D4M A;  1A0F A;  4G0I A;  3ZL5 A;  6GSX A;  3LSZ A;  5H5Q A;  2HFD A;  1DUG A;  2PU9 C;  1GTU A;  1EOH A;  2AAW A;  5F07 A;  1V57 A;  3BJ5 A;  3W8J A;  3DD3 A;  3VK9 A;  3S9F A;  4OD7 A;  3TKS A;  4N0Z A;  4G0L A;  2ON7 A;  1Y25 A;  1O7U A;  1PA3 A;  5HFG A;  4XS1 A;  2O89 A;  4Z7X A;  3APQ A;  3UVT A;  1YY7 A;  1GTI A;  3VLN A;  4NXI A;  5KN2 A;  1PN9 A;  2GGT A;  2GT5 A;  2JSZ A;  5CP1 A;  1Q4J A;  1K3L A;  9GSS A;  3N9J A;  3C71 A;  4TXO B;  1U87 A;  2GLR A;  1TI1 A;  4POB A;  4MMM A;  4I2U A;  2XBI A;  4HQZ A;  3UBL A;  3LEF A;  2VL3 A;  1VGL A;  4ML6 A;  4ZXG A;  2IFQ A;  4G19 A;  4IP6 A;  2C4J A;  2JL4 A;  1RW1 A;  3L0H A;  4LMV A;  2LRC A;  1WMJ A;  2UZ8 A;  2VCX A;  1M9A A;  2H01 A;  4TXO A;  3DXB A;  2VOC A;  4IN0 A;  2J23 A;  4K7O A;  3DML A;  4WBJ A;  4WEY A;  1LBK A;  3HJO A;  1AC1 A;  1SJZ A;  5G1L A;  1MD4 A;  1BYE A;  3F4T A;  1T4Z A;  1V98 A;  1SL0 B;  1X0R A;  3CRT A;  13GS A;  3O6T A;  2QKE A;  1XWK A;  3CSH A;  3Q18 A;  2HI7 A;  3TJJ A;  1JZR A;  1CQG A;  1Z7R A;  4TOP A;  2A4V A;  3EE2 A;  3C8E A;  4MF6 A;  1OC3 A;  2LJR A;  3QOU A;  1ZCP A;  4GST A;  1N2A A;  1THX A;  5IPH A;  4KA0 A;  2JU5 A;  3RAZ A;  2HQT A;  6GSV A;  1CQH A;  4O5R A;  4JZQ A;  1PRX A;  4FYU A;  1TXX A;  3IE3 A;  4IS0 A;  5IMA A;  2L6D A;  5J5N A;  4I5Q A;  4H86 A;  3BD2 A;  2WRT A;  1UVZ A;  3ZRD A;  4CW9 A;  3U6V A;  3IC8 A;  5D9X A;  3CYN A;  1IYI A;  3EC3 A;  1OYJ A;  2MBT A;  1DSB A;  1F2E A;  3ZFL A;  4YAP A;  3TUE A;  3CMI A;  5IQY A;  2YJH A;  1XBS A;  2CZ2 A;  4MF7 A;  4X43 A;  2FGX A;  2VM1 A;  1TKD B;  3D6I A;  3V1W A;  2JZS A;  2D2Z A;  3M8N A;  1OC8 A;  3UBK A;  5EL8 A;  4EC0 A;  2H0H A;  3L9V A;  2H0I A;  1E2Y A;  1F37 A;  1RK4 A;  3EVI A;  2IWT A;  5IOW A;  4K1F A;  1SKS B;  4TR1 B;  1A24 A;  5ELG A;  1A2L A;  3DVW A;  4FIW A;  1FO5 A;  4MF5 A;  1PL1 A;  5JCW A;  5DAL B;  2HSH A;  4FH8 A;  1TTZ A;  1B8X A;  1URM A;  4JU5 A;  3IXR A;  1YKC A;  2TRC P;  2LNS A;  2H70 A;  4DVC A;  1K0O A;  1DE2 A;  5GZZ B;  1QXH A;  2PBJ A;  5C04 A;  1BG5 A;  4USS A;  5ECQ B;  5ECR B;  2I4A A;  2A2R A;  4MAB A;  3ZIT A;  2IMI A;  4XIH A;  1Z3E A;  4IJI A;  1V2A A;  3ZVJ D;  3L9U A;  2H72 A;  2VIM A;  2R5G A;  4FQU A;  5B6M A;  2YWO A;  2F8F A;  2R3X A;  5DAL A;  4LLR A;  2OA7 A;  3VWX A;  3LYP A;  1Z5Y E;  3W6G A;  1XW9 A;  2HZE A;  3GFK A;  2XBQ A;  4XRD A;  2TIR A;  5KN0 A;  3FYG A;  3Q74 A;  5GST A;  1U3I A;  1EWX A;  3FRC A;  1JLV A;  1SYR A;  1QUW A;  4EL1 A;  4X0X A;  1FHE A;  3D5J A;  3LWA A;  2C3Q A;  1ILO A;  1JHB A;  4F2I A;  1XWG A;  4JBB A;  2HRA A;  2CQ9 A;  3DYR A;  2L5O A;  3IAS 2;  2FWG A;  1GSU A;  2GQM A;  2B7K A;  3NZN A;  3FZ4 A;  1BED A;  4E8H A;  3P7X A;  2H1A A;  1IYH A;  1VRS D;  2EIQ A;  1ZZY A;  1QQ2 A;  2H6Y A;  2MYG A;  4L5L A;  1ERT A;  1HYU A;  3QAG A;  1K0N A;  2CT6 A;  2Z9S A;  5DJL A;  3IBH A;  4ZBA A;  3E9J B;  3O76 A;  3TRQ A;  4EKZ A;  4JED A;  3TKQ A;  5E59 A;  2AYT A;  4NPB A;  3APS A;  4HU7 A;  2YNX A;  2HRK B;  2EIR A;  2YPM A;  2EIO A;  2PVQ A;  5KEJ A;  3ISO A;  4PTS A;  3TRP A;  2VCZ A;  3P90 A;  1GUK A;  3M3M A;  4AJ8 A;  4EF0 A;  1PX6 A;  5F0G A;  1GL8 A;  5B8A A;  3LXZ A;  4IHU A;  2GSS A;  4J56 E;  2VLT A;  5IMD A;  4MLY A;  11GS A;  3EIN A;  5FT3 A;  2TRX A;  2CV4 A;  5G31 A;  4TRX A;  1J9B A;  2HRK A;  1S3A A;  2L59 A;  3QFA C;  1M2D A;  3QR6 A;  2DSA A;  2K8V A;  2VL9 A;  4QL7 A;  4BL7 B;  3QAW A;  3MNG A;  2KP2 A;  2V41 A;  3LFL A;  4HJ2 A;  2CAQ A;  1AQV A;  2XHF A;  2GS3 A;  3EU3 A;  1SD9 A;  3M9J A;  4N30 A;  4PXO A;  4ECI A;  2X8G A;  5HR2 A;  4OFM A;  5ECM B;  5F06 A;  2FCH A;  3IK7 A;  2L5L A;  2LRN A;  1TJD A;  2N5B A;  3H1N A;  1XPV A;  1AQW A;  3WGE A;  1I9D A;  5AIV A;  3I9V 2;  2N5F A;  4BL7 A;  3NOF A;  4HOJ A;  2R6K A;  3L9S A;  3K8N A;  3UOM A;  3G7Y A;  1ERW A;  2VCQ A;  5AN1 A;  4YQV A;  19GS A;  2GSR A;  3IV4 A;  1K0B A;  4OO4 A;  3H79 A;  3TGZ A;  3A2X A;  1EOG A;  4LL4 B;  4ZL7 A;  1PMT A;  1V58 A;  2K6V A;  1SL2 B;  5HFK A;  5EPF A;  4QQ7 A;  1PKZ A;  3FR9 A;  1T4Y A;  2IMD A;  2RII A;  2YV9 A;  3US3 A;  3GTU B;  4IQ1 A;  16GS A;  4Q5R A;  2V6O A;  3GH6 A;  2B3S A;  2DC5 A;  3GRX A;  5F05 A;  1XVW A;  3GH9 A;  3QPM A;  4MZB A;  4HUA A;  3F6F A;  4TR0 A;  1EGR A;  2DMM A;  3C1R A;  2CX4 A;  1GSE A;  2KHP A;  1GSQ A;  4K7N A;  3GUS A;  1O73 A;  2DBC A;  4EO3 A;  22GS A;  2PER A;  2VO4 A;  2AV4 A;  3GTU A;  2YZU A;  3M9K A;  3F3Q A;  2HSY A;  5CRD A;  3WGX A;  3QMX A;  2VLU A;  3C73 A;  2A2S A;  2KLX A;  4MJB A;  3TJG A;  5EVO A;  3D0Z A;  3UL3 A;  4K8M A;  5JCG A;  3AY8 A;  3HZ8 A;  1VF4 A;  4WBR D;  5ECK B;  2WFC A;  5CRH A;  1OE7 A;  1YDK A;  3IDV A;  4ZIL A;  3HCZ A;  14GS A;  2JZT A;  1GLP A;  1SJI A;  1WE0 A;  2P5Q A;  5CRG A;  1HQO A;  2H6X A;  5AIX A;  3GUR A;  5DCG A;  3RPP A;  1T00 A;  2YZH A;  3HA9 A;  2OAD A;  1S3D A;  3GMF A;  3HVX A;  2JAC A;  5JCU A;  1SU9 A;  2H76 A;  2LRT A;  3JCM L;  3VPT A;  1JLW A;  2IFQ B;  1AXD A;  3IRA A;  3KMO A;  1TU7 A;  5ECL B;  4TXV A;  2LQQ A;  2OE1 A;  3ZFB A;  3RHB A;  1FVK A;  6GSY A;  3M0F A;  4IQA A;  4L5O A;  3ERG A;  1YEP A;  1ZOF A;  1Z9H A;  3KIJ A;  1O81 A;  4G9H A;  4HS1 A;  1Z6N A;  2P0G A;  3IR4 A;  5B7C A;  1GRX A;  2AHE A;  4KND A;  2M46 A;  3GKK A;  3PGT A;  5G30 A;  3UAR A;  1GUL A;  2CVD A;  2ZNM A;  3F63 A;  1M99 A;  1GP1 A;  4KB3 A;  5CO3 A;  5B6N A;  5C00 A;  4YH2 A;  2MMO A;  1NW2 A;  3CTG A;  5D93 A;  1BQ7 A;  18GS A;  4IKH A;  3KZQ A;  1K0D A;  1JFU A;  3KXO A;  5CAX A;  4V1A g;  2C8U A;  3KTB A;  4IP1 A;  1NSW A;  4O32 A;  3L4N A;  4XHM A;  3GKN A;  1XWA A;  2HNL A;  1FB6 A;  1XXU A;  1GTB A;  1XZO A;  4KCE A;  1HNA A;  3RBT A;  2YWN A;  4BPY A;  4JRR A; 
#chains in the Genus database with same CATH topology
 4QMK A;  1QK8 A;  1M7T A;  1AAZ A;  4V2M A;  5HR1 A;  5KN1 A;  1YF1 A;  2YP6 A;  2H30 A;  4LMW A;  1TOF A;  4F03 A;  2PUK C;  2GZP A;  4XS6 A;  5LCZ A;  3GN3 A;  1NHY A;  4WET A;  5J40 A;  5J4Y A;  3F9U A;  1T1V A;  3TB2 A;  5A4W A;  3BBY A;  1TRV A;  1PL2 A;  4K5R A;  5IMZ A;  2B5Y A;  3FY7 A;  2RUF A;  5DQY A;  2HE3 A;  4EIQ A;  5HFI A;  3CTF A;  1Y6E A;  1TP9 A;  1G7E A;  2H8L A;  2WCI A;  4ZBD A;  1R7H A;  1VF3 A;  4HDE A;  3HJP A;  2HSM B;  2IMF A;  2I81 A;  4WF5 A;  2WS2 A;  3GHA A;  4POL A;  4KDY A;  3ZYW A;  3QCP A;  1GTA A;  4GF0 A;  4GRF A;  1GSY A;  4XS4 B;  4K0G A;  1HD2 A;  5EY6 A;  1TRW A;  3LG6 A;  4ZBB A;  3J7Y b;  4ZB6 A;  3F3R A;  1ZYP A;  3HKR A;  2IMK A;  3IPZ A;  5DQS A;  5DBQ A;  4G2E A;  3VWU A;  3GYK A;  5INY A;  2WZ9 A;  2X64 A;  3HZ4 A;  2HSM A;  2HZF A;  1GUM A;  1G7O A;  4ML1 A;  4AF2 A;  3VWW A;  5J4U A;  2H1D A;  4XS4 A;  4GWR A;  4L0W A;  4PUA A;  2LS5 A;  4K0N A;  2ZCT A;  3Q6O A;  4PQI A;  1OE8 A;  4IJ3 A;  1H4O A;  4O7H A;  4ZB9 A;  2G2Q A;  1MTC A;  4HI7 A;  4MJE A;  3QAV A;  3MDK A;  3F4S A;  1MDK A;  6GSU A;  1G6W A;  4Q5N A;  4TR4 A;  4F0B A;  1OKT A;  3MSZ A;  5ECI B;  3G7I A;  2IPA A;  3FK8 A;  2HZE B;  1A0R P;  2GZY A;  5IMC A;  4MP4 A;  3CHX C;  2VCV A;  1E6B A;  1TI3 A;  1HNC A;  3KM6 A;  3QDN A;  2O7K A;  2M80 A;  1TU8 A;  2V32 A;  4KAE A;  2VLV A;  3GNJ A;  4LL1 B;  4K6X A;  4MZC A;  3ZLP A;  2H0G A;  3DGQ A;  3RFR C;  5H5R A;  4POM A;  4PNF A;  1ERU A;  1N8J A;  5IMV A;  3FR6 A;  2PGT A;  4CY8 A;  3I6A A;  1GSS A;  1PQN A;  2PVO C;  1U6T A;  2GDR A;  2AB6 A;  1YJ6 A;  1USB A;  2I1U A;  3F4R A;  3EYT A;  3GA4 A;  4IBP A;  3PPU A;  5COH A;  4GSS A;  2X8H A;  5IIZ A;  3VFI A;  1EV4 A;  3WYW A;  3KP8 A;  1SYX A;  4KGI A;  2LJK A;  2F51 A;  1G6Y A;  1EV9 A;  3GX8 A;  2E0Q A;  3TDG A;  1TK5 B;  2MZC A;  2GQL A;  2FA4 A;  2NPB A;  3DWV A;  2F8A A;  2HRF A;  4OFN A;  2H73 A;  2KOK A;  1SVM A;  2C0G A;  2J9H A;  3A2V A;  6GSS A;  3DEX A;  3FMW A;  6GSW A;  2E2M A;  3VI5 A;  2GST A;  1X9M B;  3H93 A;  3LGC A;  1ST9 A;  5BMU B;  3HXS A;  1GNW A;  2B5X A;  4ECB A;  1O8X A;  3TKR A;  3TJK A;  2I3Y A;  2DLX A;  5ENU A;  2JSY A;  3CSJ A;  3DRN A;  5J41 A;  4GTU A;  2H1G A;  1XW6 A;  4NV2 A;  4EUY A;  2WB9 A;  4TW5 A;  4KSM A;  2JZR A;  4K7I A;  2EFC A;  1FB0 A;  4FYB A;  4ZIJ A;  2EFH A;  1TK8 B;  3VWV A;  2YJ7 A;  1GSF A;  1VF1 A;  1O6J A;  4MDC A;  4EIP A;  2PN8 A;  2XPD A;  2LST A;  4F9Z A;  1XW5 A;  2RM5 A;  3GKX A;  5BMU A;  4D73 B;  2HT9 A;  1SKW B;  4E68 A;  4TVE A;  1TW9 A;  1A2M A;  2C3T A;  4V1A p;  1X5D A;  2H71 A;  3HHV A;  3EWL A;  3D21 A;  1EP8 A;  2H1L A;  4PGT A;  3ZMK A;  3DIE A;  3RGB C;  1OC9 B;  2REM A;  4Q5F A;  1K3O A;  4POK A;  1GNE A;  1QFN A;  1XCC A;  4D73 A;  4WKW A;  3MAK A;  1GUH A;  1LJR A;  3IK9 A;  3ZRE A;  4FYC A;  5DAK B;  1JZD A;  4NV5 A;  2FWH A;  2V2G A;  4GLT A;  5G5F A;  2DIZ A;  3UEM A;  2L4C A;  2HYX A;  4OCE A;  1UA5 A;  4N0V A;  4MJA A;  2WVY A;  1SD8 A;  3F6D A;  1OC9 A;  1VF2 A;  1FOV A;  1GSD A;  1K3Y A;  2B7J A;  4KH7 A;  1YZX A;  5ABR A;  5ECS A;  2QSI A;  5IMF A;  2HSN B;  3A5I A;  2MBS A;  4J2F A;  3CBU A;  1DBY A;  2DKH A;  5DAK A;  2NDO A;  3W8S A;  1NM3 A;  2R37 A;  1GWC A;  1ON4 A;  3BCK A;  2BJX A;  4F0C A;  12GS A;  1C72 A;  3QFB C;  3HVV A;  2H75 A;  1EP7 A;  4G10 A;  1M0U A;  2PMT A;  4OWY A;  1YQ1 A;  3E0U A;  3TRX A;  3LOR A;  1ZYN A;  1B9Y C;  2DJJ A;  1M2B A;  1T8E B;  3FZ9 A;  3KMN A;  1RQM A;  1M3I A;  1TDI A;  1X5E A;  1FVJ A;  1ACV A;  4GQF A;  2OE0 A;  4V2L A;  1EEJ A;  1TK0 B;  1ZYQ B;  2NVL A;  2VCW A;  4YKF A;  1XOB A;  1ZL9 A;  4AKH A;  5HR3 A;  3HVS A;  3KTL A;  5FWG A;  3I69 A;  2OAC A;  4WR4 A;  5HQP A;  1XWC A;  4Z2T A;  2KUC A;  3EUR A;  4WXT A;  4PHZ C;  3MWH A;  1SK0 A;  2NBS A;  2DJ0 A;  1I1I P;  17GS A;  4HZ2 A;  4HEA 2;  4AKG A;  1R5A A;  1OAZ A;  3D22 A;  2G0F A;  1SVO A;  1SEN A;  1ERV A;  1QMV A;  3ERW A;  3TOU A;  2VCT A;  2MMN A;  2L6C A;  2K8S A;  3A5W A;  3HY2 A;  4BWQ A;  2B5E A;  1T3B A;  4ACS A;  4FO5 A;  1UN2 A;  1R5P A;  5J9B A;  2GSQ A;  4DSR A;  5L71 A;  1PGT A;  1WP0 A;  3IC4 A;  5DVB A;  4KX4 A;  2CAI A;  4I97 A;  2VM2 A;  2FA8 A;  1BAY A;  2H74 A;  2N5A A;  2LJA A;  4PX1 A;  4AGS A;  3G9B A;  4FXY P;  5G2Z A;  5CYY A;  1PX7 A;  3C7M A;  3KEB A;  3C1S A;  1KNG A;  5G1K A;  4IEL A;  3SBC A;  4RQR A;  5LNK e;  4GQC A;  1BF5 A;  3H8Q A;  1W4V A;  2EFD A;  3BCI A;  4YQM A;  1OKD A;  1AUC A;  3E3E A;  2K18 A;  1I5G A;  4Z2R A;  3RDW A;  1SK2 A;  3GKM A;  4N11 A;  2FD3 A;  1WJK A;  2LEG A;  4EE0 A;  2IN3 A;  2E2G A;  4GXZ A;  2H19 A;  4NAX A;  4AJ6 A;  5FHI A;  4DSQ A;  3I43 A;  3F8U A;  4KUN A;  4MK3 A;  2FWE A;  2L57 A;  2IJY A;  2ALB A;  4PQ1 A;  4GSN A;  5D9V A;  1FAA A;  4TN8 A;  5ID2 B;  4PUF C;  1PKW A;  1F9M A;  2WZS A;  4XTS A;  3UVH A;  2XC2 A;  4HSC X;  5ECH B;  1B9X C;  2WW2 A;  2P5R A;  5DDL A;  1XVQ A;  1B4P A;  2YOI A;  3KH9 A;  2VL2 C;  3KCM A;  5GAN D;  5IO2 A;  3D4T A;  5A4V A;  2OKA A;  3FZA A;  2XPE A;  4L0U A;  5HR0 A;  4BA7 A;  4ILF A;  2V1M A;  2CZ3 A;  2YN1 A;  3RHC A;  4P3Y B;  5ID2 A;  5CNW A;  3U5R E;  3G7J A;  3N5O A;  2C3N A;  4EXJ A;  3VPQ A;  2VKZ G;  4RQX A;  2DJ2 A;  1J0F A;  4KW6 A;  3UIW A;  4XRA A;  1YEX A;  4NWY A;  1MDI A;  4MA9 A;  1K0C A;  2LTK A;  4I6X A;  2WW3 A;  5BRT A;  2CVB A;  3ME7 A;  3BOA A;  1PFO A;  2HLS A;  3UAP A;  2FWF A;  2H1B A;  1S3C A;  2O87 A;  2DIY A;  4RUV A;  4BWS A;  1MDJ A;  5DJM A;  2MMA A;  1T7P B;  3ZVJ A;  1WOU A;  1KBN A;  3KH7 A;  4DEJ A;  1WIK A;  5GSS A;  1V9W A;  4PQH A;  3ZML A;  2QC7 A;  3L78 A;  2CA8 A;  3HYP A;  1PD2 1;  4BVX B;  2AJQ B;  1NHO A;  2VD1 A;  1X9W B;  3PIN A;  3PH9 A;  2LKU A;  2HRN A;  4I2T A;  4NHW A;  1Z6M A;  2FUG 2;  1O85 A;  3ZZX A;  2WW1 A;  4RI7 A;  4CHS A;  2WDU A;  5D9W A;  1JZO A;  2IL3 A;  1MD3 A;  4YAV A;  3EPT A;  5J9C A;  2DJK A;  4ECC A;  3FW2 A;  4CDO A;  3M1G A;  1JZW A;  3UJ1 A;  1SVL A;  4PNG A;  5AIS A;  1Q98 A;  20GS A;  4DSS B;  4KSO A;  3R2Q A;  4BVX A;  4K9Z A;  2GTU A;  1B48 A;  4KCA A;  3UMA A;  5D8I A;  4Q5Q A;  1S3R A;  2KP1 A;  1A8L A;  4G0K A;  2H66 A;  1XFL A;  4MPG A;  2L4Q A;  4OMV A;  4MH2 A;  3CRU A;  3CQF A;  1V40 A;  4MH3 A;  4QL9 A;  1SJ6 A;  2E7P A;  3TJB A;  3Q19 A;  8GSS A;  3F0I A;  4DSS A;  2BTO T;  4V2N A;  4N3Z A;  2NTO A;  4WR5 A;  5ECN B;  1B4Q A;  3IAM 2;  6GST A;  3KJY A;  1U88 A;  1LU4 A;  3VUR A;  3GV1 A;  2LV3 A;  3ZIV A;  3ERF A;  3IHQ A;  4IVF A;  2F9S A;  4E8E A;  4ID0 A;  4ULX A;  3HVN A;  1G0T A;  1J08 A;  1XOA A;  3A3T A;  3DVX A;  1QGV A;  2UV8 G;  5A5K A;  3WGD A;  1BX9 A;  2WJU A;  4AKX B;  1W89 A;  4TR1 A;  3CXG A;  5ECP B;  1THO A;  1WPI A;  2R2J A;  3EU4 A;  1TRS A;  3ZIJ A;  2DJ1 A;  3RPN A;  4F82 A;  3LYK A;  4MJC A;  1EEM A;  2OBI A;  5JWO B;  2FY6 A;  3OR5 A;  3APO A;  5AGY A;  5E4W A;  3TKS C;  3P8W A;  5IOX A;  4AJ7 A;  4OO5 A;  2VUP A;  5H5S A;  5J3R A;  1SKR B;  3PR8 A;  2YWM A;  2IIY A;  5A4U A;  5B8B A;  5KN3 A;  1FW1 A;  2C0F A;  1K0M A;  5D9T A;  1OVN A;  1FOH A;  2GVP A;  1YVL A;  2C1Y A;  4HU9 A;  2JAD A;  2FLS A;  3ME8 A;  1AW9 A;  2DKI A;  2R0G A;  3EMX A;  4MCU A;  2GZZ A;  3GL5 A;  4X1U A;  3TCO A;  2C0E A;  2I9H A;  1TRU A;  5CRE A;  4KDX A;  2DML A;  2H6Z A;  5D96 A;  1ZYE A;  1ABA A;  3LXT A;  2ZUP A;  1DE1 A;  2OT3 A;  5JWR B;  2IME A;  4HZ4 A;  5ECO B;  2FHE A;  3GX0 A;  2DJ3 A;  3FR3 A;  5F8B A;  2YAN A;  2WUL A;  2HXK A;  4ECJ A;  2OBK A;  2C0D A;  4KDU A;  2B1L A;  2FNO A;  1EZK A;  2B6M A;  4TKY A;  5IM9 A;  3FEU A;  4CY6 A;  4WF4 A;  3TOT A;  2VL2 A;  4J57 E;  1YKA A;  4K2D A;  2LQO A;  5JWQ B;  3A2W A;  1AIU A;  1O8W A;  3SWL A;  4KF9 A;  1WRY A;  1SK1 A;  4IGJ A;  4JE1 A;  2MMZ A;  2YV7 A;  1ZGN A;  3FHK A;  4HQS A;  1F6M C;  1GH2 A;  1A2J A;  4KE3 A;  1F3A A;  2CVK A;  2WVZ A;  4NHZ A;  4MPF A;  5D73 A;  3KGK A;  2QGV A;  4EVM A;  2WVX B;  2X8C A;  1HNB A;  1YF0 A;  3WD6 A;  2O85 A;  2VAF A;  1BJX A;  2GT6 A;  4RI6 A;  3HJM A;  4ZB8 A;  4TR3 A;  3TJF A;  1K0A A;  2F3M A;  3GST A;  3GIX A;  2YWI A;  5GAP D;  4IW9 A;  2PPT A;  2X99 A;  3KD0 A;  2LNT A;  2R4V A;  1R4W A;  2VD0 A;  2V6K A;  3WT1 A;  4I8B A;  1KTE A;  2P31 A;  2PWJ A;  1UC7 A;  2ES7 A;  3H4K A;  2WVX A;  1Z7P A;  3O3T A;  2R0P A;  1ML6 A;  4EDZ A;  4Z2U A;  3GL3 A;  2X4A A;  4NMU A;  3DKS A;  1A23 A;  2CX3 A;  4ISD A;  4MZW A;  1R26 A;  4ICY A;  3LJR A;  3ED3 A;  4EDY A;  5DCH A;  1MEK A;  3VI7 A;  5IO0 A;  1FG4 A;  1XIY A;  2RUE A;  2O36 A;  2OE3 A;  3TKS E;  3IOS A;  3P2A A;  3QD9 A;  5IPG A;  1GLQ A;  3EMP A;  3WT2 A;  1H75 A;  1F3B A;  2K9F A;  4OFT A;  2M72 A;  2C80 A;  3TKP A;  4LA1 A;  2AUV A;  4PUR A;  10GS A;  3J7Y k;  5ELA A;  4JR4 A;  7GSS A;  2RLI A;  4XCS A;  1A8Y A;  4O92 A;  4N10 A;  1U3A A;  3HD5 A;  1X5C A;  1M9B A;  1WWJ A;  2LUS A;  1SL1 B;  4BVY B;  3FZ5 A;  1XWB A;  3NIV A;  5LD0 A;  3LW9 A;  3LQ7 A;  4HJM A;  2O8V B;  2OJL A;  1KEB A;  3IA1 A;  1M2A A;  2RM6 A;  1AQX A;  4ZL8 A;  1ZMA A;  4GCI A;  4L8E A;  3FKF A;  2BMX A;  2EC4 A;  3HDC A;  4OCF A;  2GQK A;  3R3E A;  3ZTL A;  4YQU A;  4JR6 A;  5CRW A;  4BVY A;  2WGR A;  3GSS A;  3KP9 A;  2ON5 A;  5G5E A;  3CSI A;  5J47 A;  1X9S B;  2B1K A;  4YKG A;  4ZL9 A;  2YCD A;  1PSQ A;  1EGO A;  4AI6 A;  3D4M A;  1A0F A;  4G0I A;  3ZL5 A;  6GSX A;  3LSZ A;  5H5Q A;  1BG1 A;  2HFD A;  1DUG A;  2PU9 C;  1GTU A;  4W66 A;  1EOH A;  2AAW A;  5F07 A;  1V57 A;  3BJ5 A;  3W8J A;  3DD3 A;  3VK9 A;  3S9F A;  4OD7 A;  3TKS A;  4N0Z A;  4G0L A;  2ON7 A;  1Y25 A;  1O7U A;  1PA3 A;  5HFG A;  4XS1 A;  2O89 A;  4Z7X A;  3APQ A;  3UVT A;  1YY7 A;  1GTI A;  3VLN A;  4NXI A;  5KN2 A;  1PN9 A;  2GGT A;  2GT5 A;  2JSZ A;  5CP1 A;  1Q4J A;  1K3L A;  9GSS A;  3N9J A;  3C71 A;  4TXO B;  1U87 A;  2GLR A;  3IHG A;  1TI1 A;  4POB A;  4MMM A;  4I2U A;  2XBI A;  4HQZ A;  3UBL A;  3LEF A;  2VL3 A;  1VGL A;  4ML6 A;  4ZXG A;  2IFQ A;  4G19 A;  4IP6 A;  2C4J A;  2JL4 A;  4PI2 C;  1RW1 A;  3L0H A;  4O5U A;  4LMV A;  2LRC A;  1WMJ A;  2UZ8 A;  2VCX A;  1M9A A;  2H01 A;  4TXO A;  3DXB A;  2VOC A;  4IN0 A;  2J23 A;  4K7O A;  3DML A;  4WBJ A;  4WEY A;  1LBK A;  2O5V A;  3HJO A;  1AC1 A;  1SJZ A;  5G1L A;  1MD4 A;  1BYE A;  3F4T A;  1T4Z A;  1TXU A;  1V98 A;  1SL0 B;  1X0R A;  3CRT A;  13GS A;  3O6T A;  2QKE A;  1XWK A;  4MNN A;  1PN0 A;  3CSH A;  3Q18 A;  1S4B P;  2HI7 A;  3TJJ A;  1JZR A;  1CQG A;  1Z7R A;  4TOP A;  2A4V A;  3EE2 A;  3C8E A;  4MF6 A;  1OC3 A;  2LJR A;  3QOU A;  1ZCP A;  4GST A;  1N2A A;  1THX A;  5IPH A;  4KA0 A;  2JU5 A;  3RAZ A;  2HQT A;  6GSV A;  1CQH A;  4O5R A;  4JZQ A;  1PRX A;  4FYU A;  1TXX A;  3IE3 A;  4IS0 A;  5IMA A;  2L6D A;  5J5N A;  2EFE A;  4I5Q A;  4H86 A;  3BD2 A;  2X49 A;  2WRT A;  1UVZ A;  3ZRD A;  4CW9 A;  3U6V A;  3IC8 A;  5D9X A;  3CYN A;  1IYI A;  3EC3 A;  1OYJ A;  2MBT A;  1DSB A;  1F2E A;  3ZFL A;  4YAP A;  3TUE A;  3CMI A;  5IQY A;  2YJH A;  1XBS A;  2CZ2 A;  4MF7 A;  4X43 A;  2FGX A;  2VM1 A;  1TKD B;  3D6I A;  3V1W A;  2O3E A;  2D2Z A;  2JZS A;  3M8N A;  1OC8 A;  3MIX A;  3UBK A;  5EL8 A;  4EC0 A;  2H0H A;  3L9V A;  2H0I A;  1E2Y A;  1F37 A;  1RK4 A;  3EVI A;  2IWT A;  5IOW A;  5KOW A;  4K1F A;  1SKS B;  4TR1 B;  1A24 A;  5ELG A;  1A2L A;  3DVW A;  4FIW A;  1FO5 A;  4MF5 A;  1PL1 A;  5JCW A;  5DAL B;  2HSH A;  4FH8 A;  1TTZ A;  1B8X A;  2QA1 A;  1URM A;  4JU5 A;  3IXR A;  1YKC A;  2TRC P;  2LNS A;  2H70 A;  4DVC A;  3MYD A;  1K0O A;  1DE2 A;  5GZZ B;  1QXH A;  2PBJ A;  5C04 A;  1BG5 A;  4USS A;  5ECQ B;  5ECR B;  2I4A A;  2A2R A;  4MAB A;  3ZIT A;  2IMI A;  4XIH A;  1Z3E A;  4IJI A;  1V2A A;  3ZVJ D;  3L9U A;  2H72 A;  2VIM A;  2R5G A;  4FQU A;  5B6M A;  4GDF A;  2YWO A;  2F8F A;  2R3X A;  5DAL A;  4LLR A;  2OA7 A;  3VWX A;  3LYP A;  1Z5Y E;  3W6G A;  1XW9 A;  2HZE A;  2R0C A;  3GFK A;  2XBQ A;  4XRD A;  2TIR A;  5KN0 A;  3FYG A;  3Q74 A;  5GST A;  1U3I A;  1EWX A;  3FRC A;  1JLV A;  1SYR A;  1QUW A;  4EL1 A;  4X0X A;  1FHE A;  3D5J A;  3LWA A;  2C3Q A;  1ILO A;  1JHB A;  4F2I A;  1XWG A;  4JBB A;  2HRA A;  2CQ9 A;  3DYR A;  2L5O A;  3IAS 2;  4K2X A;  2FWG A;  1GSU A;  2GQM A;  2B7K A;  3NZN A;  3FZ4 A;  1BED A;  2QA2 A;  1YEW C;  4E8H A;  3P7X A;  2H1A A;  1IYH A;  1VRS D;  2EIQ A;  1ZZY A;  3HMJ G;  1QQ2 A;  2H6Y A;  2MYG A;  4L5L A;  1ERT A;  1HYU A;  3QAG A;  1K0N A;  2CT6 A;  2Z9S A;  5DJL A;  3IBH A;  4ZBA A;  3E9J B;  3O76 A;  3TRQ A;  4EKZ A;  4JED A;  3TKQ A;  5E59 A;  2AYT A;  4NPB A;  3APS A;  4HU7 A;  2YNX A;  2HRK B;  2EIR A;  4K5S A;  2YPM A;  2EIO A;  2PVQ A;  5KEJ A;  3ISO A;  4PTS A;  3TRP A;  2VCZ A;  3P90 A;  1GUK A;  3M3M A;  4AJ8 A;  4EF0 A;  1PX6 A;  5F0G A;  1GL8 A;  5B8A A;  4G01 A;  3LXZ A;  4IHU A;  2GSS A;  4J56 E;  2VLT A;  5IMD A;  4MLY A;  11GS A;  3EIN A;  5FT3 A;  2TRX A;  2CV4 A;  5G31 A;  4TRX A;  1J9B A;  2HRK A;  1S3A A;  1M3J A;  2L59 A;  3QFA C;  1M2D A;  3QR6 A;  2DSA A;  2K8V A;  2VL9 A;  4QL7 A;  4BL7 B;  3QAW A;  3MNG A;  2KP2 A;  2V41 A;  3LFL A;  4HJ2 A;  2CAQ A;  1AQV A;  2XHF A;  2GS3 A;  3EU3 A;  1SD9 A;  3M9J A;  4N30 A;  4PXO A;  4ECI A;  2X8G A;  5HR2 A;  4OFM A;  5ECM B;  5F06 A;  2FCH A;  3IK7 A;  2L5L A;  2LRN A;  1TJD A;  2N5B A;  3H1N A;  1XPV A;  1AQW A;  3WGE A;  1I9D A;  5AIV A;  3I9V 2;  2N5F A;  4BL7 A;  3NOF A;  1N25 A;  4HOJ A;  2R6K A;  3L9S A;  3K8N A;  3UOM A;  3G7Y A;  1ERW A;  2VCQ A;  5AN1 A;  4YQV A;  19GS A;  2GSR A;  3IV4 A;  4X4J A;  1K0B A;  4OO4 A;  3H79 A;  3TGZ A;  3A2X A;  1EOG A;  4LL4 B;  4ZL7 A;  1PMT A;  1Y1U A;  1V58 A;  2K6V A;  1SL2 B;  5HFK A;  5EPF A;  4QQ7 A;  1PKZ A;  3FR9 A;  1T4Y A;  2IMD A;  2RII A;  2YV9 A;  3US3 A;  3GTU B;  4IQ1 A;  5KOX A;  16GS A;  4Q5R A;  2A4H A;  2V6O A;  3GH6 A;  2B3S A;  2DC5 A;  3GRX A;  5F05 A;  1XVW A;  3GH9 A;  3QPM A;  2HSN A;  4MZB A;  4HUA A;  3F6F A;  4AKI A;  4TR0 A;  1EGR A;  2DMM A;  3C1R A;  2CX4 A;  1GSE A;  2KHP A;  1GSQ A;  4K7N A;  3GUS A;  1O73 A;  2DBC A;  4EO3 A;  22GS A;  2PER A;  2VO4 A;  2AV4 A;  3GTU A;  2YZU A;  3M9K A;  3F3Q A;  2HSY A;  1XG8 A;  5CRD A;  3WGX A;  3QMX A;  2VLU A;  3C73 A;  2A2S A;  2WW0 A;  2KLX A;  4MJB A;  3TJG A;  5EVO A;  3D0Z A;  3UL3 A;  5A1N B;  4K8M A;  5A5H B;  4O5Q A;  5JCG A;  3AY8 A;  3HZ8 A;  1VF4 A;  4WBR D;  5ECK B;  2WFC A;  5CRH A;  5J4V A;  1OE7 A;  1YDK A;  3IDV A;  4ZIL A;  3CWG A;  3HCZ A;  14GS A;  2JZT A;  1GLP A;  1SJI A;  1WE0 A;  2P5Q A;  5CRG A;  1HQO A;  2H6X A;  5AIX A;  3GUR A;  4PI0 C;  5DCG A;  3RPP A;  1T00 A;  2YZH A;  3HA9 A;  5A1N A;  2OAD A;  5A5H A;  1S3D A;  3GMF A;  3HVX A;  2JAC A;  5JCU A;  1SU9 A;  2H76 A;  2LRT A;  3JCM L;  3VPT A;  1JLW A;  2IFQ B;  1AXD A;  3IRA A;  3KMO A;  1TU7 A;  5ECL B;  4TXV A;  2LQQ A;  2OE1 A;  3ZFB A;  3RHB A;  1FVK A;  4BIK A;  6GSY A;  3M0F A;  4IQA A;  4L5O A;  3ERG A;  1YEP A;  1ZOF A;  5A34 B;  1Z9H A;  3KIJ A;  1O81 A;  4G9H A;  4HS1 A;  1Z6N A;  2P0G A;  3IR4 A;  5B7C A;  1GRX A;  2AHE A;  4KND A;  2M46 A;  3GKK A;  3PGT A;  5G30 A;  2A2P A;  3UAR A;  1GUL A;  2CVD A;  2ZNM A;  3F63 A;  1M99 A;  1GP1 A;  4KB3 A;  5CO3 A;  5B6N A;  5C00 A;  4YH2 A;  2MMO A;  1NW2 A;  3CTG A;  5D93 A;  1BQ7 A;  5A34 A;  4ZB7 A;  18GS A;  4IKH A;  3KZQ A;  1K0D A;  1JFU A;  3KXO A;  3TU3 B;  5CAX A;  4V1A g;  2C8U A;  3KTB A;  4IP1 A;  1NSW A;  4O32 A;  3L4N A;  4XHM A;  3GKN A;  1XWA A;  2HNL A;  1FB6 A;  4A5P A;  1XXU A;  1GTB A;  1XZO A;  4KCE A;  1HNA A;  3RBT A;  2YWN A;  4BPY A;  4JRR A; 
#chains in the Genus database with same CATH homology
 4QMK A;  1QK8 A;  1M7T A;  1AAZ A;  4V2M A;  5HR1 A;  5KN1 A;  1YF1 A;  2YP6 A;  2H30 A;  4LMW A;  1TOF A;  4F03 A;  2PUK C;  2GZP A;  4XS6 A;  5LCZ A;  3GN3 A;  1NHY A;  4WET A;  5J40 A;  5J4Y A;  3F9U A;  1T1V A;  3TB2 A;  5A4W A;  3BBY A;  1TRV A;  1PL2 A;  4K5R A;  5IMZ A;  2B5Y A;  3FY7 A;  2RUF A;  5DQY A;  2HE3 A;  4EIQ A;  5HFI A;  3CTF A;  1Y6E A;  1TP9 A;  1G7E A;  2H8L A;  2WCI A;  4ZBD A;  1R7H A;  1VF3 A;  4HDE A;  3HJP A;  2HSM B;  2IMF A;  2I81 A;  4WF5 A;  2WS2 A;  3GHA A;  4POL A;  4KDY A;  3ZYW A;  3QCP A;  1GTA A;  4GF0 A;  4GRF A;  1GSY A;  4XS4 B;  4K0G A;  1HD2 A;  5EY6 A;  1TRW A;  3LG6 A;  4ZBB A;  3J7Y b;  4ZB6 A;  3F3R A;  1ZYP A;  3HKR A;  2IMK A;  3IPZ A;  5DQS A;  5DBQ A;  4G2E A;  3VWU A;  3GYK A;  5INY A;  2WZ9 A;  2X64 A;  3HZ4 A;  2HSM A;  2HZF A;  1GUM A;  1G7O A;  4ML1 A;  4AF2 A;  3VWW A;  5J4U A;  2H1D A;  4XS4 A;  4GWR A;  4L0W A;  4PUA A;  2LS5 A;  4K0N A;  2ZCT A;  3Q6O A;  4PQI A;  1OE8 A;  4IJ3 A;  1H4O A;  4O7H A;  4ZB9 A;  2G2Q A;  1MTC A;  4HI7 A;  4MJE A;  3QAV A;  3MDK A;  3F4S A;  1MDK A;  6GSU A;  1G6W A;  4Q5N A;  4TR4 A;  4F0B A;  1OKT A;  3MSZ A;  5ECI B;  3G7I A;  2IPA A;  3FK8 A;  2HZE B;  1A0R P;  2GZY A;  5IMC A;  4MP4 A;  2VCV A;  1E6B A;  1TI3 A;  1HNC A;  3KM6 A;  3QDN A;  2O7K A;  2M80 A;  1TU8 A;  2V32 A;  4KAE A;  2VLV A;  3GNJ A;  4LL1 B;  4K6X A;  4MZC A;  3ZLP A;  2H0G A;  3DGQ A;  5H5R A;  4POM A;  4PNF A;  1ERU A;  1N8J A;  5IMV A;  3FR6 A;  2PGT A;  4CY8 A;  3I6A A;  1GSS A;  1PQN A;  2PVO C;  1U6T A;  2GDR A;  2AB6 A;  1YJ6 A;  1USB A;  2I1U A;  3F4R A;  3EYT A;  3GA4 A;  4IBP A;  3PPU A;  5COH A;  4GSS A;  2X8H A;  5IIZ A;  3VFI A;  1EV4 A;  3WYW A;  3KP8 A;  1SYX A;  4KGI A;  2LJK A;  2F51 A;  1G6Y A;  1EV9 A;  3GX8 A;  2E0Q A;  3TDG A;  1TK5 B;  2MZC A;  2GQL A;  2FA4 A;  2NPB A;  3DWV A;  2F8A A;  2HRF A;  4OFN A;  2H73 A;  2KOK A;  1SVM A;  2C0G A;  2J9H A;  3A2V A;  6GSS A;  3DEX A;  3FMW A;  6GSW A;  2E2M A;  3VI5 A;  2GST A;  1X9M B;  3H93 A;  3LGC A;  1ST9 A;  5BMU B;  3HXS A;  1GNW A;  2B5X A;  4ECB A;  1O8X A;  3TKR A;  3TJK A;  2I3Y A;  2DLX A;  5ENU A;  2JSY A;  3CSJ A;  3DRN A;  5J41 A;  4GTU A;  2H1G A;  1XW6 A;  4NV2 A;  4EUY A;  2WB9 A;  4TW5 A;  4KSM A;  2JZR A;  4K7I A;  2EFC A;  1FB0 A;  4FYB A;  4ZIJ A;  2EFH A;  1TK8 B;  3VWV A;  2YJ7 A;  1GSF A;  1VF1 A;  1O6J A;  4MDC A;  4EIP A;  2PN8 A;  2XPD A;  2LST A;  4F9Z A;  1XW5 A;  2RM5 A;  3GKX A;  5BMU A;  4D73 B;  2HT9 A;  1SKW B;  4E68 A;  4TVE A;  1TW9 A;  1A2M A;  2C3T A;  4V1A p;  1X5D A;  2H71 A;  3HHV A;  3EWL A;  3D21 A;  1EP8 A;  2H1L A;  4PGT A;  3ZMK A;  3DIE A;  1OC9 B;  2REM A;  4Q5F A;  1K3O A;  4POK A;  1GNE A;  1QFN A;  1XCC A;  4D73 A;  4WKW A;  3MAK A;  1GUH A;  1LJR A;  3IK9 A;  3ZRE A;  4FYC A;  5DAK B;  1JZD A;  4NV5 A;  2FWH A;  2V2G A;  4GLT A;  5G5F A;  2DIZ A;  3UEM A;  2L4C A;  2HYX A;  4OCE A;  1UA5 A;  4N0V A;  4MJA A;  1SD8 A;  3F6D A;  1OC9 A;  1VF2 A;  1FOV A;  1GSD A;  1K3Y A;  2B7J A;  4KH7 A;  1YZX A;  5ABR A;  5ECS A;  2QSI A;  5IMF A;  2HSN B;  3A5I A;  2MBS A;  4J2F A;  3CBU A;  1DBY A;  2DKH A;  5DAK A;  2NDO A;  3W8S A;  1NM3 A;  2R37 A;  1GWC A;  1ON4 A;  3BCK A;  2BJX A;  4F0C A;  12GS A;  1C72 A;  3QFB C;  3HVV A;  2H75 A;  1EP7 A;  4G10 A;  1M0U A;  2PMT A;  4OWY A;  1YQ1 A;  3E0U A;  3TRX A;  3LOR A;  1ZYN A;  1B9Y C;  2DJJ A;  1M2B A;  1T8E B;  3FZ9 A;  3KMN A;  1RQM A;  1TDI A;  1X5E A;  1FVJ A;  1ACV A;  4GQF A;  2OE0 A;  4V2L A;  1EEJ A;  1TK0 B;  1ZYQ B;  2NVL A;  2VCW A;  4YKF A;  1XOB A;  1ZL9 A;  4AKH A;  5HR3 A;  3HVS A;  3KTL A;  5FWG A;  3I69 A;  2OAC A;  4WR4 A;  5HQP A;  1XWC A;  4Z2T A;  2KUC A;  3EUR A;  4WXT A;  3MWH A;  1SK0 A;  2NBS A;  2DJ0 A;  17GS A;  4HZ2 A;  4HEA 2;  4AKG A;  1R5A A;  1OAZ A;  3D22 A;  2G0F A;  1SVO A;  1SEN A;  1ERV A;  1QMV A;  3ERW A;  3TOU A;  2VCT A;  2MMN A;  2L6C A;  2K8S A;  3A5W A;  3HY2 A;  4BWQ A;  2B5E A;  1T3B A;  4ACS A;  4FO5 A;  1UN2 A;  1R5P A;  5J9B A;  2GSQ A;  4DSR A;  5L71 A;  1PGT A;  1WP0 A;  3IC4 A;  5DVB A;  4KX4 A;  2CAI A;  4I97 A;  2VM2 A;  2FA8 A;  1BAY A;  2H74 A;  2N5A A;  2LJA A;  4PX1 A;  4AGS A;  3G9B A;  5G2Z A;  5CYY A;  1PX7 A;  3C7M A;  3KEB A;  3C1S A;  1KNG A;  5G1K A;  4IEL A;  3SBC A;  4RQR A;  5LNK e;  4GQC A;  1BF5 A;  3H8Q A;  1W4V A;  2EFD A;  3BCI A;  4YQM A;  1OKD A;  1AUC A;  3E3E A;  2K18 A;  1I5G A;  4Z2R A;  3RDW A;  1SK2 A;  3GKM A;  4N11 A;  2FD3 A;  1WJK A;  2LEG A;  4EE0 A;  2IN3 A;  2E2G A;  4GXZ A;  2H19 A;  4NAX A;  4AJ6 A;  5FHI A;  4DSQ A;  3I43 A;  3F8U A;  4KUN A;  4MK3 A;  2FWE A;  2L57 A;  2IJY A;  2ALB A;  4PQ1 A;  4GSN A;  5D9V A;  1FAA A;  4TN8 A;  5ID2 B;  4PUF C;  1PKW A;  1F9M A;  4XTS A;  3UVH A;  2XC2 A;  5ECH B;  1B9X C;  2P5R A;  5DDL A;  1XVQ A;  1B4P A;  2YOI A;  3KH9 A;  2VL2 C;  3KCM A;  5GAN D;  5IO2 A;  3D4T A;  5A4V A;  2OKA A;  3FZA A;  2XPE A;  4L0U A;  5HR0 A;  4BA7 A;  4ILF A;  2V1M A;  2CZ3 A;  2YN1 A;  3RHC A;  4P3Y B;  5ID2 A;  5CNW A;  3U5R E;  3G7J A;  3N5O A;  2C3N A;  4EXJ A;  3VPQ A;  2VKZ G;  4RQX A;  2DJ2 A;  1J0F A;  4KW6 A;  3UIW A;  4XRA A;  1YEX A;  4NWY A;  1MDI A;  4MA9 A;  1K0C A;  2LTK A;  4I6X A;  5BRT A;  2CVB A;  3ME7 A;  3BOA A;  2HLS A;  3UAP A;  2FWF A;  2H1B A;  1S3C A;  2O87 A;  2DIY A;  4RUV A;  4BWS A;  1MDJ A;  5DJM A;  2MMA A;  1T7P B;  3ZVJ A;  1WOU A;  1KBN A;  3KH7 A;  4DEJ A;  1WIK A;  5GSS A;  1V9W A;  4PQH A;  3ZML A;  2QC7 A;  3L78 A;  2CA8 A;  3HYP A;  1PD2 1;  4BVX B;  2AJQ B;  1NHO A;  2VD1 A;  1X9W B;  3PIN A;  3PH9 A;  2LKU A;  2HRN A;  4I2T A;  4NHW A;  1Z6M A;  2FUG 2;  1O85 A;  3ZZX A;  4RI7 A;  4CHS A;  2WDU A;  5D9W A;  1JZO A;  2IL3 A;  1MD3 A;  4YAV A;  3EPT A;  5J9C A;  2DJK A;  4ECC A;  3FW2 A;  4CDO A;  3M1G A;  1JZW A;  3UJ1 A;  1SVL A;  4PNG A;  5AIS A;  1Q98 A;  20GS A;  4DSS B;  4KSO A;  3R2Q A;  4BVX A;  4K9Z A;  2GTU A;  1B48 A;  4KCA A;  3UMA A;  5D8I A;  4Q5Q A;  2KP1 A;  1A8L A;  4G0K A;  2H66 A;  1XFL A;  4MPG A;  2L4Q A;  4OMV A;  4MH2 A;  3CRU A;  1V40 A;  4MH3 A;  4QL9 A;  1SJ6 A;  2E7P A;  3TJB A;  3Q19 A;  8GSS A;  3F0I A;  4DSS A;  2BTO T;  4V2N A;  4N3Z A;  2NTO A;  4WR5 A;  5ECN B;  1B4Q A;  3IAM 2;  6GST A;  3KJY A;  1U88 A;  1LU4 A;  3VUR A;  3GV1 A;  2LV3 A;  3ZIV A;  3ERF A;  3IHQ A;  4IVF A;  2F9S A;  4E8E A;  4ID0 A;  4ULX A;  1G0T A;  1J08 A;  1XOA A;  3A3T A;  3DVX A;  1QGV A;  2UV8 G;  5A5K A;  3WGD A;  1BX9 A;  2WJU A;  4AKX B;  1W89 A;  4TR1 A;  3CXG A;  5ECP B;  1THO A;  1WPI A;  2R2J A;  3EU4 A;  1TRS A;  3ZIJ A;  2DJ1 A;  3RPN A;  4F82 A;  3LYK A;  4MJC A;  1EEM A;  2OBI A;  5JWO B;  2FY6 A;  3OR5 A;  3APO A;  5AGY A;  5E4W A;  3TKS C;  3P8W A;  5IOX A;  4AJ7 A;  4OO5 A;  2VUP A;  5H5S A;  5J3R A;  1SKR B;  3PR8 A;  2YWM A;  2IIY A;  5A4U A;  5B8B A;  5KN3 A;  1FW1 A;  2C0F A;  1K0M A;  5D9T A;  1OVN A;  1FOH A;  2GVP A;  1YVL A;  2C1Y A;  4HU9 A;  2JAD A;  2FLS A;  3ME8 A;  1AW9 A;  2DKI A;  2R0G A;  3EMX A;  4MCU A;  2GZZ A;  3GL5 A;  4X1U A;  3TCO A;  2C0E A;  2I9H A;  1TRU A;  5CRE A;  4KDX A;  2DML A;  2H6Z A;  5D96 A;  1ZYE A;  1ABA A;  3LXT A;  2ZUP A;  1DE1 A;  2OT3 A;  5JWR B;  2IME A;  4HZ4 A;  5ECO B;  2FHE A;  3GX0 A;  2DJ3 A;  3FR3 A;  5F8B A;  2YAN A;  2WUL A;  2HXK A;  4ECJ A;  2OBK A;  2C0D A;  4KDU A;  2B1L A;  2FNO A;  1EZK A;  2B6M A;  4TKY A;  5IM9 A;  3FEU A;  4CY6 A;  4WF4 A;  3TOT A;  2VL2 A;  4J57 E;  1YKA A;  4K2D A;  2LQO A;  5JWQ B;  3A2W A;  1AIU A;  1O8W A;  3SWL A;  4KF9 A;  1WRY A;  1SK1 A;  4IGJ A;  4JE1 A;  2MMZ A;  2YV7 A;  1ZGN A;  3FHK A;  4HQS A;  1F6M C;  1GH2 A;  1A2J A;  4KE3 A;  1F3A A;  2CVK A;  4NHZ A;  4MPF A;  5D73 A;  3KGK A;  2QGV A;  4EVM A;  2X8C A;  1HNB A;  1YF0 A;  3WD6 A;  2O85 A;  2VAF A;  1BJX A;  2GT6 A;  4RI6 A;  3HJM A;  4ZB8 A;  4TR3 A;  3TJF A;  1K0A A;  2F3M A;  3GST A;  3GIX A;  2YWI A;  5GAP D;  4IW9 A;  2PPT A;  2X99 A;  3KD0 A;  2LNT A;  2R4V A;  1R4W A;  2VD0 A;  2V6K A;  3WT1 A;  4I8B A;  1KTE A;  2P31 A;  2PWJ A;  1UC7 A;  2ES7 A;  3H4K A;  1Z7P A;  3O3T A;  2R0P A;  1ML6 A;  4EDZ A;  4Z2U A;  3GL3 A;  2X4A A;  4NMU A;  3DKS A;  1A23 A;  2CX3 A;  4ISD A;  4MZW A;  1R26 A;  4ICY A;  3LJR A;  3ED3 A;  4EDY A;  5DCH A;  1MEK A;  3VI7 A;  5IO0 A;  1FG4 A;  1XIY A;  2RUE A;  2OE3 A;  3TKS E;  3IOS A;  3P2A A;  3QD9 A;  5IPG A;  1GLQ A;  3EMP A;  3WT2 A;  1H75 A;  1F3B A;  2K9F A;  4OFT A;  2M72 A;  2C80 A;  3TKP A;  4LA1 A;  2AUV A;  4PUR A;  10GS A;  3J7Y k;  5ELA A;  4JR4 A;  7GSS A;  2RLI A;  4XCS A;  1A8Y A;  4O92 A;  4N10 A;  1U3A A;  3HD5 A;  1X5C A;  1M9B A;  1WWJ A;  2LUS A;  1SL1 B;  4BVY B;  3FZ5 A;  1XWB A;  3NIV A;  5LD0 A;  3LW9 A;  3LQ7 A;  4HJM A;  2O8V B;  2OJL A;  1KEB A;  3IA1 A;  1M2A A;  2RM6 A;  1AQX A;  4ZL8 A;  1ZMA A;  4GCI A;  4L8E A;  3FKF A;  2BMX A;  2EC4 A;  3HDC A;  4OCF A;  2GQK A;  3R3E A;  3ZTL A;  4YQU A;  4JR6 A;  5CRW A;  4BVY A;  2WGR A;  3GSS A;  3KP9 A;  2ON5 A;  5G5E A;  3CSI A;  5J47 A;  1X9S B;  2B1K A;  4YKG A;  4ZL9 A;  2YCD A;  1PSQ A;  1EGO A;  4AI6 A;  3D4M A;  1A0F A;  4G0I A;  3ZL5 A;  6GSX A;  3LSZ A;  5H5Q A;  1BG1 A;  2HFD A;  1DUG A;  2PU9 C;  1GTU A;  4W66 A;  1EOH A;  2AAW A;  5F07 A;  1V57 A;  3BJ5 A;  3W8J A;  3DD3 A;  3VK9 A;  3S9F A;  4OD7 A;  3TKS A;  4N0Z A;  4G0L A;  2ON7 A;  1Y25 A;  1O7U A;  1PA3 A;  5HFG A;  4XS1 A;  2O89 A;  4Z7X A;  3APQ A;  3UVT A;  1YY7 A;  1GTI A;  3VLN A;  4NXI A;  5KN2 A;  1PN9 A;  2GGT A;  2GT5 A;  2JSZ A;  5CP1 A;  1Q4J A;  1K3L A;  9GSS A;  3N9J A;  3C71 A;  4TXO B;  1U87 A;  2GLR A;  3IHG A;  1TI1 A;  4POB A;  4MMM A;  4I2U A;  2XBI A;  4HQZ A;  3UBL A;  3LEF A;  2VL3 A;  1VGL A;  4ML6 A;  4ZXG A;  2IFQ A;  4G19 A;  4IP6 A;  2C4J A;  2JL4 A;  1RW1 A;  3L0H A;  4O5U A;  4LMV A;  2LRC A;  1WMJ A;  2UZ8 A;  2VCX A;  1M9A A;  2H01 A;  4TXO A;  3DXB A;  2VOC A;  4IN0 A;  2J23 A;  4K7O A;  3DML A;  4WBJ A;  4WEY A;  1LBK A;  2O5V A;  3HJO A;  1AC1 A;  1SJZ A;  5G1L A;  1MD4 A;  1BYE A;  3F4T A;  1T4Z A;  1TXU A;  1V98 A;  1SL0 B;  1X0R A;  3CRT A;  13GS A;  3O6T A;  2QKE A;  1XWK A;  4MNN A;  1PN0 A;  3CSH A;  3Q18 A;  2HI7 A;  3TJJ A;  1JZR A;  1CQG A;  1Z7R A;  4TOP A;  2A4V A;  3EE2 A;  3C8E A;  4MF6 A;  1OC3 A;  2LJR A;  3QOU A;  1ZCP A;  4GST A;  1N2A A;  1THX A;  5IPH A;  4KA0 A;  2JU5 A;  3RAZ A;  2HQT A;  6GSV A;  1CQH A;  4O5R A;  4JZQ A;  1PRX A;  4FYU A;  1TXX A;  3IE3 A;  4IS0 A;  5IMA A;  2L6D A;  5J5N A;  2EFE A;  4I5Q A;  4H86 A;  3BD2 A;  2X49 A;  2WRT A;  1UVZ A;  3ZRD A;  4CW9 A;  3U6V A;  3IC8 A;  5D9X A;  3CYN A;  1IYI A;  3EC3 A;  1OYJ A;  2MBT A;  1DSB A;  1F2E A;  3ZFL A;  4YAP A;  3TUE A;  3CMI A;  5IQY A;  2YJH A;  1XBS A;  2CZ2 A;  4MF7 A;  4X43 A;  2FGX A;  2VM1 A;  1TKD B;  3D6I A;  3V1W A;  2JZS A;  2D2Z A;  3M8N A;  1OC8 A;  3MIX A;  3UBK A;  5EL8 A;  4EC0 A;  2H0H A;  3L9V A;  2H0I A;  1E2Y A;  1F37 A;  1RK4 A;  3EVI A;  2IWT A;  5IOW A;  5KOW A;  4K1F A;  1SKS B;  4TR1 B;  1A24 A;  5ELG A;  1A2L A;  3DVW A;  4FIW A;  1FO5 A;  4MF5 A;  1PL1 A;  5JCW A;  5DAL B;  2HSH A;  4FH8 A;  1TTZ A;  1B8X A;  2QA1 A;  1URM A;  4JU5 A;  3IXR A;  1YKC A;  2TRC P;  2LNS A;  2H70 A;  4DVC A;  3MYD A;  1K0O A;  1DE2 A;  5GZZ B;  1QXH A;  2PBJ A;  5C04 A;  1BG5 A;  4USS A;  5ECQ B;  5ECR B;  2I4A A;  2A2R A;  4MAB A;  3ZIT A;  2IMI A;  4XIH A;  1Z3E A;  4IJI A;  1V2A A;  3ZVJ D;  3L9U A;  2H72 A;  2VIM A;  2R5G A;  4FQU A;  5B6M A;  4GDF A;  2YWO A;  2F8F A;  2R3X A;  5DAL A;  4LLR A;  2OA7 A;  3VWX A;  3LYP A;  1Z5Y E;  3W6G A;  1XW9 A;  2HZE A;  2R0C A;  3GFK A;  2XBQ A;  4XRD A;  2TIR A;  5KN0 A;  3FYG A;  3Q74 A;  5GST A;  1U3I A;  1EWX A;  3FRC A;  1JLV A;  1SYR A;  1QUW A;  4EL1 A;  4X0X A;  1FHE A;  3D5J A;  3LWA A;  2C3Q A;  1ILO A;  1JHB A;  4F2I A;  1XWG A;  4JBB A;  2HRA A;  2CQ9 A;  3DYR A;  2L5O A;  3IAS 2;  4K2X A;  2FWG A;  1GSU A;  2GQM A;  2B7K A;  3NZN A;  3FZ4 A;  1BED A;  2QA2 A;  4E8H A;  3P7X A;  2H1A A;  1IYH A;  1VRS D;  2EIQ A;  1ZZY A;  3HMJ G;  1QQ2 A;  2H6Y A;  2MYG A;  4L5L A;  1ERT A;  1HYU A;  3QAG A;  1K0N A;  2CT6 A;  2Z9S A;  5DJL A;  3IBH A;  4ZBA A;  3E9J B;  3O76 A;  3TRQ A;  4EKZ A;  4JED A;  3TKQ A;  5E59 A;  2AYT A;  4NPB A;  3APS A;  4HU7 A;  2YNX A;  2HRK B;  2EIR A;  4K5S A;  2YPM A;  2EIO A;  2PVQ A;  5KEJ A;  3ISO A;  4PTS A;  3TRP A;  2VCZ A;  3P90 A;  1GUK A;  3M3M A;  4AJ8 A;  4EF0 A;  1PX6 A;  5F0G A;  1GL8 A;  5B8A A;  4G01 A;  3LXZ A;  4IHU A;  2GSS A;  4J56 E;  2VLT A;  5IMD A;  4MLY A;  11GS A;  3EIN A;  5FT3 A;  2TRX A;  2CV4 A;  5G31 A;  4TRX A;  1J9B A;  2HRK A;  1S3A A;  2L59 A;  3QFA C;  1M2D A;  3QR6 A;  2DSA A;  2K8V A;  2VL9 A;  4QL7 A;  4BL7 B;  3QAW A;  3MNG A;  2KP2 A;  2V41 A;  3LFL A;  4HJ2 A;  2CAQ A;  1AQV A;  2XHF A;  2GS3 A;  3EU3 A;  1SD9 A;  3M9J A;  4N30 A;  4PXO A;  4ECI A;  2X8G A;  5HR2 A;  4OFM A;  5ECM B;  5F06 A;  2FCH A;  3IK7 A;  2L5L A;  2LRN A;  1TJD A;  2N5B A;  3H1N A;  1XPV A;  1AQW A;  3WGE A;  1I9D A;  5AIV A;  3I9V 2;  2N5F A;  4BL7 A;  3NOF A;  1N25 A;  4HOJ A;  2R6K A;  3L9S A;  3K8N A;  3UOM A;  3G7Y A;  1ERW A;  2VCQ A;  5AN1 A;  4YQV A;  19GS A;  2GSR A;  3IV4 A;  4X4J A;  1K0B A;  4OO4 A;  3H79 A;  3TGZ A;  3A2X A;  1EOG A;  4LL4 B;  4ZL7 A;  1PMT A;  1Y1U A;  1V58 A;  2K6V A;  1SL2 B;  5HFK A;  5EPF A;  4QQ7 A;  1PKZ A;  3FR9 A;  1T4Y A;  2IMD A;  2RII A;  2YV9 A;  3US3 A;  3GTU B;  4IQ1 A;  5KOX A;  16GS A;  4Q5R A;  2A4H A;  2V6O A;  3GH6 A;  2B3S A;  2DC5 A;  3GRX A;  5F05 A;  1XVW A;  3GH9 A;  3QPM A;  2HSN A;  4MZB A;  4HUA A;  3F6F A;  4AKI A;  4TR0 A;  1EGR A;  2DMM A;  3C1R A;  2CX4 A;  1GSE A;  2KHP A;  1GSQ A;  4K7N A;  3GUS A;  1O73 A;  2DBC A;  4EO3 A;  22GS A;  2PER A;  2VO4 A;  2AV4 A;  3GTU A;  2YZU A;  3M9K A;  3F3Q A;  2HSY A;  5CRD A;  3WGX A;  3QMX A;  2VLU A;  3C73 A;  2A2S A;  2KLX A;  4MJB A;  3TJG A;  5EVO A;  3D0Z A;  3UL3 A;  5A1N B;  4K8M A;  5A5H B;  4O5Q A;  5JCG A;  3AY8 A;  3HZ8 A;  1VF4 A;  4WBR D;  5ECK B;  2WFC A;  5CRH A;  5J4V A;  1OE7 A;  1YDK A;  3IDV A;  4ZIL A;  3CWG A;  3HCZ A;  14GS A;  2JZT A;  1GLP A;  1SJI A;  1WE0 A;  2P5Q A;  5CRG A;  1HQO A;  2H6X A;  5AIX A;  3GUR A;  5DCG A;  3RPP A;  1T00 A;  2YZH A;  3HA9 A;  5A1N A;  2OAD A;  5A5H A;  1S3D A;  3GMF A;  3HVX A;  2JAC A;  5JCU A;  1SU9 A;  2H76 A;  2LRT A;  3JCM L;  3VPT A;  1JLW A;  2IFQ B;  1AXD A;  3IRA A;  3KMO A;  1TU7 A;  5ECL B;  4TXV A;  2LQQ A;  2OE1 A;  3ZFB A;  3RHB A;  1FVK A;  6GSY A;  3M0F A;  4IQA A;  4L5O A;  3ERG A;  1YEP A;  1ZOF A;  5A34 B;  1Z9H A;  3KIJ A;  1O81 A;  4G9H A;  4HS1 A;  1Z6N A;  2P0G A;  3IR4 A;  5B7C A;  1GRX A;  2AHE A;  4KND A;  2M46 A;  3GKK A;  3PGT A;  5G30 A;  2A2P A;  3UAR A;  1GUL A;  2CVD A;  2ZNM A;  3F63 A;  1M99 A;  1GP1 A;  4KB3 A;  5CO3 A;  5B6N A;  5C00 A;  4YH2 A;  2MMO A;  1NW2 A;  3CTG A;  5D93 A;  1BQ7 A;  5A34 A;  4ZB7 A;  18GS A;  4IKH A;  3KZQ A;  1K0D A;  1JFU A;  3KXO A;  3TU3 B;  5CAX A;  4V1A g;  2C8U A;  3KTB A;  4IP1 A;  1NSW A;  4O32 A;  3L4N A;  4XHM A;  3GKN A;  1XWA A;  2HNL A;  1FB6 A;  4A5P A;  1XXU A;  1GTB A;  1XZO A;  4KCE A;  1HNA A;  3RBT A;  2YWN A;  4BPY A;  4JRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...