4Q5RA

Crystal structure of glutathione s-transferase bla g 5
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
PSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal Structure of Glutathione S-transferase Bla g 5
rcsb
source organism Blattella germanica
molecule tags Transferase
total genus 74
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4q5rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4q5rA01
1K3OA 2LS5A 5CYYA 2FY6A 1Z9HA 18GSA 3Q74A 4DEJA 5IPGA 4ECJA 2D2ZA 3L9SA 2F9SA 4TR0A 2LKUA 2NPBA 3CSHA 3FYGA 3TKSE 4WR4A 3M9KA 2VLTA 3ME7A 1AC1A 4DVCA 2QC7A 2JSZA 1SL2B 4XS1A 2CT6A 1AW9A 3L0HA 5ECNB 4N0ZA 2GSTA 1XVWA 3TRXA 4G10A 3C73A 1OE8A 5DVBA 5B6NA 5JCWA 3IA1A 4KDYA 4H86A 2HQTA 4IKHA 1HNCA 3NOFA 1PX7A 1YEXA 3QCPA 4KUNA 4NXIA 2DLXA 2ALBA 1F3AA 2HSMB 4IP6A 3TB2A 4BVYA 1EP7A 3DYRA 2F51A 1PD21 3LGCA 5F05A 2GGTA 1TXXA 3HCZA 1BYEA 2YZUA 5ELGA 2MMOA 1MD3A 4PNFA 2VLVA 4TR4A 4XRDA 1FAAA 2MZCA 2V2GA 2GT6A 4G0LA 2I4AA 2M46A 5DALA 4I8BA 3DD3A 4BWSA 4MP4A 2H6XA 4KAEA 4MLYA 1TW9A 3DIEA 1YDKA 2WCIA 2H6ZA 4P3YB 4ZBBA 2EC4A 4XS4A 2OBIA 3BD2A 5F8BA 1PSQA 1O8XA 2WZ9A 1T7PB 4TR1B 3GKXA 2VL3A 2JADA 2H74A 3LQ7A 3I43A 1LU4A 5KN2A 5ECSA 3GTUA 4O5RA 4I5QA 2KLXA 1X5EA 5H5QA 1UVZA 2CVBA 2YV9A 5KEJA 5F06A 5A4WA 2L5LA 4MK3A 1N8JA 1XXUA 5AISA 2HSHA 2OADA 5D9TA 1NSWA 1FB6A 4AF2A 3QPMA 2HT9A 4G2EA 3ZFBA 3BJ5A 1AQVA 2XBIA 2N5BA 2DJ2A 4IQ1A 4AJ6A 1LJRA 3BOAA 3ZLPA 2VUPA 2K8SA 3I69A 1GRXA 2XBQA 3TRQA 1T4ZA 2K18A 5F0GA 6GSTA 5IO0A 5ECKB 1K0MA 1V58A 2HFDA 3FW2A 1DBYA 5DAKB 3F6DA 4ZL8A 2JZSA 3F6FA 2G0FA 2KHPA 5FWGA 1ERTA 2AJQB 4J57E 2RM5A 4F82A 1JZWA 4BL7B 5JWRB 4EC0A 4TXOB 1F2EA 2V6OA 3W8JA 1HNAA 4ZBAA 4V1Ag 1PMTA 3TRPA 1QK8A 1SYRA 4V1Ap 1Z7RA 1YZXA 2H6YA 2CAIA 3CTGA 4MF6A 4XS6A 1ABAA 2B5XA 3PR8A 3GH6A 1TTZA 3LWAA 2VLUA 3E0UA 4QQ7A 2ES7A 2B7KA 1M2BA 2VL9A 4OD7A 4GQFA 3KZQA 4MMMA 3ZVJD 1FW1A 1OC8A 3GIXA 4MJAA 3VWVA 1A2JA 2XPDA 3TKSA 3GHAA 2M72A 1YF1A 1Z7PA 4ZL9A 3U6VA 4G19A 2YZHA 4IHUA 3I6AA 3TKRA 2P31A 4NAXA 3KP8A 3HVXA 1NM3A 3C71A 2FWEA 2OA7A 1XCCA 1EEMA 3GV1A 1J0FA 3FZ5A 3PINA 4OWYA 5CP1A 4EF0A 4YAVA 4HJMA 3RDWA 2KOKA 3GA4A 1EOHA 2I1UA 4MJEA 5ABRA 4D73B 5C04A 3KIJA 3GKKA 5ENUA 1ACVA 5FT3A 3FRCA 5JCGA 1C72A 5ECRB 2FA4A 2HZFA 3ERFA 1AAZA 1PGTA 2C0GA 1BEDA 4F03A 1GSUA 4K7NA 2IL3A 5IMDA 4WBJA 1GSFA 1MDJA 1SU9A 2BTOT 2TRXA 3FR9A 4EVMA 3GX8A 1HNBA 1CQGA 3OR5A 3KP9A 4X1UA 1J08A 1M2DA 1PRXA 4NWYA 4KH7A 1U6TA 4TKYA 1K0OA 1YEPA 2H01A 3J7Yb 5KN3A 4QL9A 4EDYA 1EOGA 4IQAA 1QGVA 4CDOA 3NZNA 3MAKA 3GFKA 5D9WA 2YWIA 3IC8A 2PGTA 3EU4A 4HU9A 3EU3A 2H1AA 3M9JA 2MMAA 4BWQA 1WIKA 4ZILA 1GLPA 1XW5A 1T3BA 4GWRA 2ZCTA 2E2MA 2WDUA 4GCIA 3VI5A 5CREA 2YV7A 5J5NA 1TRVA 2IFQB 1CQHA 4CW9A 4N10A 4MF7A 1YY7A 1NW2A 13GSA 2VM2A 1G6YA 1SYXA 1XIYA 3D21A 5LNKe 3FZ4A 1OE7A 2LSTA 3RPPA 1S3CA 2HZEB 4MJCA 2H73A 2L5OA 1TRWA 4HU7A 3G9BA 3KEBA 5EY6A 2V41A 2QKEA 1GSEA 2H19A 3VI7A 1RK4A 1XOBA 1EGOA 2LEGA 4K2DA 2V1MA 1OC9A 3ZZXA 5D96A 3DMLA 1TK0B 3F0IA 3M3MA 2IJYA 4ILFA 2P5RA 5ECPB 4PQIA 4X0XA 3DGQA 4N0VA 2H0HA 3QDNA 1ERWA 17GSA 3VLNA 6GSUA 2AAWA 3UL3A 2B5EA 2A4VA 3CTFA 2PUKC 1JZOA 1Z5YE 3HVSA 5H5RA 1O85A 1WRYA 4ECIA 4ZB9A 5G5FA 3UARA 2PMTA 5IMVA 2DIZA 2C0DA 2GVPA 4HQSA 2H1BA 3JCML 2LJRA 4GSSA 2LRNA 2FHEA 2NBSA 1M99A 2MBTA 1ZL9A 5DALB 2E7PA 3VURA 2L4CA 1BAYA 2WJUA 1B8XA 1VF2A 2IMEA 1HQOA 5HR2A 1X9SB 3HDCA 3CBUA 3LEFA 1VGLA 1TDIA 3IOSA 3ZMLA 1JFUA 4GRFA 5A4VA 1V2AA 2GQLA 6GSYA 3LXTA 2MYGA 4K6XA 4AJ7A 6GSSA 4YAPA 4I6XA 2YPMA 5COHA 4EL1A 2H72A 5ECQB 1YQ1A 4GF0A 1QXHA 4XRAA 1Y25A 2F8AA 4EO3A 2BMXA 3F8UA 1XWGA 4MA9A 2JL4A 3FR6A 4YQVA 2HRNA 1G6WA 1GTUA 1NHOA 4O32A 3CXGA 3UIWA 2I3YA 3SWLA 4G0IA 1TRUA 3HYPA 3TJFA 1ZCPA 4NMUA 4E8EA 4F0BA 3I9V2 4GXZA 3IHQA 1X5CA 2AB6A 3IDVA 4ZB6A 2RIIA 5CO3A 1HYUA 2FNOA 1EV9A 2FWFA 3TOUA 1WWJA 3KCMA 1NHYA 5G5EA 4L5OA 3FZAA 5DJLA 5HR1A 2AUVA 2DJ1A 2DMMA 2NTOA 4I97A 1VF3A 2DJ0A 2R3XA 4F9ZA 3WGEA 4PQHA 4DSRA 1T1VA 1V40A 4WEYA 5INYA 3GRXA 2CQ9A 3HJPA 1SD9A 10GSA 2XPEA 2H76A 3ZREA 1DE2A 2LNSA 1SKSB 4K0GA 1DUGA 2EIRA 2F3MA 1SENA 2L59A 1QFNA 2LUSA 3S9FA 3IE3A 3FK8A 4ZL7A 1XW6A 2WS2A 2OE3A 1B9YC 1YKAA 3ZITA 3TJKA 1GNEA 2KP1A 4IJIA 4IS0A 4WR5A 4FIWA 1XPVA 1YJ6A 5HR0A 4KB3A 4N11A 14GSA 2XC2A 4EKZA 1GSYA 1G7OA 3DVXA 3DEXA 3D5JA 2B1KA 5B7CA 1F37A 3ZVJA 5DJMA 3WT1A 1M7TA 4HQZA 4F0CA 4J56E 1A0FA 3VWXA 3UEMA 1MDIA 2GZPA 3N5OA 4FYCA 3CMIA 1U3IA 3MSZA 4MZWA 5BMUA 1XWCA 5KN0A 3EMPA 2VAFA 3QFBC 2A2SA 3LSZA 5F07A 1TOFA 2LNTA 3CYNA 5IQYA 2LJAA 4ZBDA 2VL2A 5G31A 3F4RA 2X8GA 3KTLA 3DVWA 1FB0A 4CHSA 5JWOB 4JZQA 2B7JA 3L9VA 2YCDA 3WD6A 2DSAA 3W8SA 1A23A 5B8BA 5IMCA 3MWHA 1SK0A 1EV4A 1IYIA 3ZRDA 4RUVA 2P0GA 4I2TA 1A8YA 2VCTA 4AGSA 1GTAA 3FY7A 5IOXA 5H5SA 4KGIA 5HFKA 3EINA 4MZBA 3RHCA 3GNJA 4EDZA 4OMVA 3ED3A 4GQCA 1ZYEA 5J9BA 3FZ9A 2B6MA 3LXZA 3K8NA 5IMAA 5HQPA 1ERVA 4TVEA 4KCAA 1GNWA 19GSA 3IAS2 5HFIA 2PN8A 4BVXB 5DDLA 2H1GA 5B6MA 3HJOA 1ZGNA 3CSIA 4WETA 1U87A 4L8EA 5ECIB 3LYPA 2H0GA 2CZ2A 2HSMA 4Q5RA 1Z6NA 1GL8A 4YQUA 2BJXA 6GSVA 4TOPA 2WB9A 2K8VA 5J41A 5LCZA 5GAPD 2A2RA 4PXOA 3APOA 4NHWA 3FR3A 4GLTA 5AN1A 3QFAC 2YJ7A 4PUFC 2B1LA 2GZYA 2RM6A 2XHFA 5L71A 1N2AA 3HY2A 1PA3A 4ZB8A 2NDOA 4RI7A 1FHEA 2Z9SA 2L6DA 4OO4A 3ZIVA 1X5DA 2GLRA 4YH2A 5E4WA 3D6IA 3EURA 2C1YA 3CSJA 3APQA 5ELAA 1GWCA 3DWVA 2YN1A 4LMVA 1TI3A 3QAVA 4AJ8A 1A0RP 4X43A 2HRKB 5C00A 1Z3EA 3F3RA 3H4KA 3TGZA 1SK2A 2YJHA 5B8AA 2OKAA 2PPTA 2IMKA 3D0ZA 3VPTA 2LRTA 3TKQA 2HLSA 1SKRB 4K9ZA 4ML6A 2HRAA 3ZL5A 1IYHA 2HSYA 1SKWB 3UMAA 4WKWA 4DSSB 4IELA 1FOVA 5CRWA 22GSA 4OCEA 5DCGA 4LLRA 2C4JA 2HSNB 1H4OA 3EYTA 5G1KA 1KEBA 2V32A 4ULXA 1VF1A 4PX1A 1R4WA 2JZRA 1KNGA 4LA1A 1G0TA 1JLWA 5DAKA 3J7Yk 5EVOA 2N5AA 4E8HA 2V6KA 5IMZA 5DQYA 5ID2B 2VCVA 2CAQA 2VO4A 1XOAA 3EVIA 3TJBA 4BL7A 1V98A 4TXOA 4HJ2A 1U3AA 2K6VA 1M9BA 4POBA 4IJ3A 2R5GA 1B4QA 2IN3A 16GSA 3HJMA 2LRCA 3CRTA 4JR4A 1PN9A 2YOIA 4V2MA 6GSWA 2GT5A 2FLSA 3FEUA 4JR6A 3C8EA 2FD3A 2ON5A 2PERA 3RHBA 2AV4A 4NPBA 2C0EA 2L57A 5HR3A 1W4VA 2HXKA 4KSMA 20GSA 1T00A 3C7MA 4V2NA 3DKSA 3Q18A 1XZOA 5CAXA 1GSQA 3UVTA 1A24A 5G2ZA 2H71A 2C3TA 4GTUA 2X99A 5G30A 3IAM2 2DJKA 3GUSA 4TN8A 3KH9A 4ZXGA 3D4TA 2OBKA 1BG5A 4USSA 3O3TA 2C0FA 1GUMA 2X8CA 4JEDA 1J9BA 2E2GA 2O89A 1TKDB 5IIZA 3O76A 2R2JA 4HI7A 4FYUA 3WGDA 4D73A 3IPZA 3TCOA 4O92A 4POMA 4KF9A 3TUEA 3LORA 1XFLA 2GQMA 2H30A 1GUKA 4BVYB 1OAZA 3ZTLA 5JWQB 1SJ6A 1T4YA 1GUHA 1XBSA 5GZZB 4OFNA 4ECCA 1BQ7A 2PVOC 5AGYA 2DJJA 1A8LA 3EWLA 4L5LA 1R5AA 3C1RA 3QR6A 2L4QA 3L78A 3F3QA 4ML1A 4GSNA 3QMXA 4JBBA 4FYBA 3TOTA 3GKMA 3ERWA 1LBKA 1I9DA 1ERUA 1AXDA 4LMWA 3H1NA 4IN0A 1BX9A 4Q5NA 2IPAA 3DRNA 9GSSA 3SBCA 5ECLB 3HA9A 3IRAA 2MBSA 4DSQA 4XS4B 4GSTA 4MCUA 2RLIA 4MJBA 2JZTA 1WJKA 1PKZA 2NVLA 3TJJA 3KGKA 1R7HA 1G7EA 1QQ2A 1PL2A 4V2LA 2MMZA 1XW9A 2FA8A 2GTUA 3GTUB 2O8VB 3GYKA 4PQ1A 1THOA 1F6MC 3W6GA 5FHIA 2X8HA 5D9VA 2YWOA 2MMNA 3F4TA 2IFQA 3NIVA 1QMVA 3UVHA 3M1GA 3UAPA 4XHMA 5D73A 1ON4A 3UOMA 3QAGA 3HD5A 4EE0A 1PQNA 4WXTA 1TK5B 2CV4A 3MDKA 3RAZA 3KH7A 3AY8A 4HDEA 2H8LA 2GSQA 1OC3A 3HVVA 1FVJA 3TKPA 5HFGA 5CRDA 3LG6A 2HZEA 3GL5A 1O6JA 1WPIA 3PH9A 2VIMA 3ERGA 3F4SA 1PL1A 3US3A 1OKDA 4PNGA 3U5RE 1RW1A 1XWKA 1XVQA 5J3RA 3F9UA 1M2AA 2H66A 3P8WA 2FGXA 2QGVA 5GAND 4K1FA 4TRXA 4RI6A 3QD9A 3FKFA 5E59A 3GX0A 3LFLA 2GS3A 2RUFA 2REMA 5D8IA 1GTBA 2LJKA 2WFCA 2WULA 3L4NA 4KSOA 8GSSA 4JU5A 2CX3A 2DIYA 4HZ4A 2PWJA 3VPQA 1Q98A 4LL1B 4O7HA 2YP6A 3GMFA 4MPGA 1HD2A 3IXRA 3RPNA 4FO5A 4WBRD 3BCIA 1F3BA 2UZ8A 5IOWA 4ZIJA 4YQMA 2EIOA 4RQXA 5AIVA 1AUCA 1R26A 3GH9A 2C3QA 1SJIA 1K3LA 4LL4B 3CRUA 4BPYA 1X9MB 2GZZA 3R3EA 4IVFA 4XCSA 4MH2A 1GULA 4XTSA 3TKSC 4ID0A 4Q5FA 1X9WB 1O81A 4KW6A 3IC4A 1MTCA 3C1SA 3IV4A 1TU8A 3D4MA 1T8EB 1K0AA 1K0DA 1GP1A 2O87A 4XIHA 5GSTA 4IP1A 2LQQA 4N30A 4EUYA 2TIRA 1ILOA 4PGTA 2LQOA 2IMIA 3IBHA 1RQMA 3KJYA 3DXBA 5A4UA 3BCKA 3F63A 1H75A 4TR3A 11GSA 12GSA 2L6CA 1ZZYA 2KP2A 2J9HA 3ZMKA 4K8MA 2ZUPA 3EMXA 3V1WA 4KNDA 1THXA 1B9XC 3LYKA 3PGTA 2J23A 4PTSA 3ISOA 1YKCA 4NV5A 2OE1A 5JCUA 2VCWA 3P7XA 1OKTA 3QAWA 2HNLA 4L0UA 4KX4A 2HE3A 4WF4A 3LJRA 1GLQA 2O7KA 1SK1A 4JE1A 1EZKA 2DC5A 4TXVA 1V57A 2AYTA 4IGJA 5DQSA 3ZYWA 2VCZA 2B5YA 2ZNMA 1QUWA 5ECMB 4KDUA 1AIUA 2CVDA 1TU7A 3L9UA 5G1LA 3IK7A 3A3TA 4G0KA 3GSTA 5ECOB 3KD0A 3A5WA 1EEJA 3GURA 4POKA 4KCEA 1V9WA 2CVKA 5D93A 1R5PA 4HEA2 4PURA 2HYXA 4ACSA 1VRSD 1UC7A 4L0WA 4QL7A 2R4VA 3IR4A 3KXOA 1GTIA 2JSYA 4MPFA 2CA8A 2HI7A 2ON7A 3KMNA 1AQWA 1ML6A 3P2AA 1OC9B 2YWNA 4BA7A 1M0UA 1MD4A 2IMDA 2P5QA 4TR1A 1TP9A 2YNXA 4J2FA 1Z6MA 3H8QA 5CNWA 2C80A 3KM6A 1B48A 2LV3A 2N5FA 4OO5A 2WGRA 4ECBA 6GSXA 4IBPA 4K0NA 1TI1A 1GSSA 3VWUA 5AIXA 2H1DA 2PBJA 3WGXA 3MNGA 3A2XA 2YANA 1VF4A 2EIQA 1KTEA 1ZMAA 2QSIA 4F2IA 1DSBA 3QOUA 1YF0A 4HUAA 2H0IA 1K3YA 1E2YA 3IK9A 2PU9C 1UA5A 4HOJA 3KTBA 1Q4JA 4KE3A 5IMFA 1DE1A 3O6TA 3Q6OA 4OFTA 1JZRA 5DCHA 2GDRA 2PVQA 1K0NA 3M8NA 3TJGA 2RUEA 4K7OA 1XWAA 3D22A 2VCXA 2X64A 2OJLA 4WF5A 3GKNA 3BBYA 3H79A 3HZ8A 3G7JA 2C3NA 1OVNA 1SJZA 1K0BA 3VFIA 1I5GA 1EP8A 3EE2A 2VD0A 1AQXA 4MABA 1PX6A 1PKWA 2C8UA 1S3DA 1KBNA 1SL1B 4BVXA 4OFMA 1OYJA 2GSRA 1MEKA 4RQRA 2JU5A 4Z7XA 3UBLA 3HZ4A 3ZFLA 1A2LA 2WRTA 4MZCA 1O7UA 1SL0B 3APSA 3HHVA 1X0RA 3A2WA 3UJ1A 3Q19A 1TJDA 5GSSA 4HZ2A 2E0QA 5EPFA 1BJXA 3N9JA 2H70A 4EXJA 2HRFA 3RBTA 2O85A 3M0FA 1E6BA 2R6KA 5IM9A 2FWGA 3TDGA 4TW5A 1USBA 4FQUA 5A5KA 3ZIJA 2CX4A 2IWTA 1URMA 2AHEA 2K9FA 4POLA 1TRSA 2JACA 4KDXA 1EGRA 4MH3A 1TK8B 4FH8A 1WMJA 4NHZA 1UN2A 1O8WA 3E9JB 1O73A 4JRRA 1B4PA 3VK9A 1Y6EA 2HRKA 4NV2A 1GSDA 5D9XA 2VM1A 2FCHA 1JLVA 4ISDA 1WE0A 3UBKA 1S3AA 1FVKA 2OE0A 1WOUA 3ME8A 3A2VA 1XWBA 2VCQA 3EC3A 1EWXA 2GQKA 4MDCA 1JZDA 2M80A 5J9CA 5IPHA 1ST9A 3GN3A 2OACA 3VWWA 2R37A 4DSSA 5IO2A 3E3EA 3KMOA 2H75A 5J4UA 2F8FA 3R2QA 5ECHB 4MF5A 1JHBA 2LTKA 3GL3A 1FO5A 4K7IA 2FUG2 1ZOFA 5CRGA 5EL8A 2VD1A 4G9HA 2DJ3A 2KUCA 4IW9A 5LD0A 2I9HA 3PPUA 3HXSA 4PUAA 2B3SA 1GH2A 1WP0A 2IIYA 3G7YA 5ID2A 3HKRA 4HS1A 5CRHA 1MDKA 1U88A 1F9MA 4I2UA 1ZYQB 1K0CA 5KN1A 3WYWA 3P90A 2DMLA 3WT2A 4OCFA 2IMFA 2FWHA 2GSSA 1SD8A 2DBCA 2TRCP 3G7IA 3H93A 2G2QA 2VL2C 2VOCA 3FHKA 2CZ3A 2I81A 5DBQA 1FG4A 7GSSA 1W89A 2YWMA 1A2MA 4Q5QA 1M9AA 3GSSA 4KA0A
chains in the Genus database with same CATH superfamily
1K3OA 2LS5A 1ZYPA 5CYYA 2FY6A 1Z9HA 18GSA 3Q74A 4DEJA 5IPGA 4ECJA 2D2ZA 3L9SA 2F9SA 4TR0A 2LKUA 2NPBA 3CSHA 3FYGA 3TKSE 4WR4A 3M9KA 2VLTA 3ME7A 3MIXA 1AC1A 4DVCA 2QC7A 2JSZA 1SL2B 4XS1A 2CT6A 4YKFA 1AW9A 3L0HA 5ECNB 4N0ZA 2GSTA 2WZSA 1XVWA 3TRXA 4G10A 3C73A 1ZYNA 1OE8A 5DVBA 5B6NA 5JCWA 3IA1A 4KDYA 4H86A 2HQTA 4IKHA 1HNCA 3NOFA 1PX7A 1YEXA 3QCPA 4KUNA 4NXIA 2DLXA 2ALBA 1F3AA 2HSMB 4IP6A 3TB2A 4BVYA 1EP7A 3DYRA 2F51A 1PD21 3LGCA 5F05A 5A1NA 1TXXA 2GGTA 3HCZA 1BYEA 2YZUA 5ELGA 2MMOA 1MD3A 4PNFA 2VLVA 4TR4A 3RGBC 4XRDA 1FAAA 2MZCA 2V2GA 2GT6A 4G0LA 2I4AA 4PHZC 2M46A 5DALA 4I8BA 3DD3A 4BWSA 4MP4A 2H6XA 4KAEA 4MLYA 3DIEA 2R0PA 1YDKA 2WCIA 2H6ZA 4P3YB 4ZBBA 2EC4A 4XS4A 2OBIA 3BD2A 5F8BA 2DKHA 1PSQA 2WVXA 3RFRC 1O8XA 2WZ9A 1T7PB 4TR1B 3GKXA 2VL3A 2JADA 2H74A 3CHXC 1PN0A 3LQ7A 3I43A 1LU4A 5KN2A 5ECSA 3GTUA 4O5RA 4I5QA 2KLXA 1XG8A 1X5EA 5H5QA 1UVZA 2CVBA 2YV9A 5KEJA 5F06A 5A4WA 2L5LA 4MK3A 1N8JA 1XXUA 5AISA 2HSHA 2OADA 5D9TA 1NSWA 1FB6A 4AF2A 3QPMA 2HT9A 4G2EA 3ZFBA 3BJ5A 1AQVA 2XBIA 2N5BA 2DJ2A 4IQ1A 4AJ6A 1LJRA 3BOAA 4AKIA 3ZLPA 2VUPA 2K8SA 3I69A 1GRXA 2XBQA 3TRQA 1T4ZA 2K18A 5F0GA 6GSTA 5IO0A 5ECKB 1K0MA 1V58A 2HFDA 3FW2A 1DBYA 5DAKB 3F6DA 4ZL8A 2JZSA 3F6FA 2G0FA 2KHPA 5FWGA 1ERTA 2AJQB 4J57E 2RM5A 4F82A 1JZWA 4BL7B 5JWRB 4EC0A 4TXOB 1F2EA 2V6OA 3W8JA 1HNAA 4ZBAA 4V1Ag 1PMTA 4CY8A 3TRPA 1QK8A 1SYRA 4V1Ap 1Z7RA 1YZXA 1S4BP 2H6YA 2CAIA 3CTGA 4MF6A 4XS6A 1ABAA 2B5XA 3PR8A 3GH6A 1TTZA 3LWAA 2VLUA 3E0UA 2O36A 4QQ7A 2ES7A 2B7KA 1M2BA 2VL9A 4OD7A 4GQFA 3KZQA 4MMMA 3ZVJD 1FW1A 1OC8A 3GIXA 4MJAA 3VWVA 1A2JA 2XPDA 3TKSA 3GHAA 2M72A 1YF1A 1Z7PA 4ZL9A 3U6VA 3HMJG 4G19A 2YZHA 4IHUA 3I6AA 3TKRA 4Z2UA 2P31A 4NAXA 3KP8A 3HVXA 1NM3A 3C71A 2FWEA 2OA7A 1XCCA 1EEMA 3GV1A 1J0FA 3FZ5A 2EFCA 3PINA 4OWYA 5CP1A 4EF0A 4YAVA 4HJMA 3RDWA 3GA4A 2KOKA 2QA2A 1EOHA 2I1UA 4MJEA 5ABRA 4D73B 5C04A 3KIJA 3GKKA 5ENUA 1ACVA 5FT3A 3FRCA 5JCGA 1C72A 5ECRB 2FA4A 2HZFA 3ERFA 1AAZA 1PGTA 2C0GA 1BEDA 4F03A 1GSUA 4K7NA 2IL3A 5IMDA 4WBJA 1GSFA 1MDJA 1SU9A 2BTOT 2TRXA 3FR9A 4EVMA 3GX8A 1S3RA 1HNBA 1CQGA 3OR5A 2A4HA 3KP9A 4X1UA 1J08A 1M2DA 1PRXA 3A5IA 4NWYA 4KH7A 1U6TA 4TKYA 4PI0C 1K0OA 1YEPA 2H01A 3J7Yb 5KN3A 4QL9A 4EDYA 1EOGA 4IQAA 1QGVA 4CDOA 3NZNA 3MAKA 3GFKA 2A2PA 5D9WA 2YWIA 2DKIA 3IC8A 2PGTA 3EU4A 4HU9A 3EU3A 2H1AA 3M9JA 2MMAA 4BWQA 1WIKA 4ZILA 1GLPA 1XW5A 1T3BA 4GWRA 2ZCTA 2E2MA 2WDUA 4GCIA 3VI5A 5CREA 2YV7A 5J5NA 1TRVA 2IFQB 1CQHA 4CW9A 4N10A 4MF7A 1YY7A 1NW2A 13GSA 2VM2A 1G6YA 1SYXA 1XIYA 3D21A 3FMWA 5LNKe 3FZ4A 1OE7A 2LSTA 3RPPA 1S3CA 2HZEB 4MJCA 2H73A 2L5OA 1TRWA 4HU7A 3G9BA 3KEBA 5EY6A 1M3IA 2V41A 2QKEA 1GSEA 2H19A 3VI7A 1RK4A 1XOBA 3LW9A 1EGOA 2LEGA 4K2DA 2V1MA 1OC9A 3ZZXA 5D96A 3DMLA 1TK0B 3F0IA 3M3MA 2IJYA 4ILFA 2P5RA 5ECPB 4PQIA 4X0XA 3DGQA 2WW3A 4N0VA 2H0HA 3QDNA 1ERWA 17GSA 3VLNA 6GSUA 2AAWA 3UL3A 2B5EA 2A4VA 3CTFA 2PUKC 1JZOA 1Z5YE 3HVSA 2X49A 5H5RA 3CWGA 1O85A 1WRYA 4ECIA 4ZB9A 5G5FA 3UARA 2PMTA 5IMVA 2DIZA 2C0DA 2GVPA 4HQSA 2H1BA 3JCML 2LJRA 4GSSA 2LRNA 2FHEA 2NBSA 1M99A 2MBTA 1ZL9A 5DALB 2E7PA 3VURA 2L4CA 1BAYA 2WJUA 4BIKA 1B8XA 1VF2A 2IMEA 1HQOA 5HR2A 1X9SB 3HDCA 3CBUA 2WVYA 3LEFA 4E68A 1VGLA 4EIPA 1TDIA 3IOSA 3ZMLA 1JFUA 4GRFA 5A4VA 1V2AA 2GQLA 6GSYA 3LXTA 2MYGA 4K6XA 4AJ7A 6GSSA 4YAPA 4I6XA 2YPMA 5COHA 4EL1A 2H72A 5ECQB 2O3EA 1YQ1A 4GF0A 2R0CA 1QXHA 4XRAA 1Y25A 2EFDA 2F8AA 4EO3A 2BMXA 3F8UA 1XWGA 4MA9A 2JL4A 3FR6A 4YQVA 2HRNA 1G6WA 1GTUA 1NHOA 4O32A 3CXGA 3UIWA 2I3YA 3SWLA 4G0IA 1TRUA 3HYPA 3TJFA 1ZCPA 4NMUA 4E8EA 4F0BA 3I9V2 4GXZA 3IHQA 1X5CA 2AB6A 3IDVA 4ZB6A 4O5UA 2RIIA 3MYDA 5CO3A 1HYUA 2FNOA 1EV9A 2FWFA 3TOUA 1WWJA 4YKGA 3KCMA 1NHYA 5G5EA 4L5OA 3FZAA 5DJLA 5HR1A 5J40A 2AUVA 2DJ1A 2DMMA 2NTOA 4I97A 1VF3A 2DJ0A 2R3XA 4F9ZA 3WGEA 4PQHA 4DSRA 1T1VA 1V40A 4WEYA 5INYA 3GRXA 2CQ9A 3HJPA 1SD9A 10GSA 2XPEA 2H76A 3ZREA 1DE2A 2LNSA 1SKSB 4K0GA 1DUGA 2EIRA 2F3MA 1SENA 2L59A 1QFNA 2LUSA 3S9FA 3IE3A 3FK8A 4ZL7A 1XW6A 2WS2A 2OE3A 2X4AA 1B9YC 1YKAA 3ZITA 3TJKA 4AKXB 1GNEA 5A5HA 2KP1A 4IJIA 4IS0A 4WR5A 4FIWA 1XPVA 1YJ6A 5HR0A 4KB3A 4N11A 14GSA 2XC2A 4EKZA 2WW0A 1GSYA 1G7OA 3DVXA 3DEXA 3D5JA 2B1KA 5B7CA 1F37A 3ZVJA 5DJMA 3WT1A 1M7TA 4HQZA 4F0CA 4J56E 1A0FA 3VWXA 3UEMA 1MDIA 2GZPA 3N5OA 4FYCA 2WW2A 3CMIA 1U3IA 3MSZA 4MZWA 5BMUA 1XWCA 5KN0A 3EMPA 2VAFA 3QFBC 2A2SA 3LSZA 5F07A 1TOFA 2LNTA 3CYNA 5IQYA 2LJAA 4ZBDA 2VL2A 5G31A 3F4RA 2X8GA 3KTLA 3DVWA 1FB0A 4CHSA 5JWOB 4JZQA 2B7JA 3L9VA 2YCDA 3WD6A 2DSAA 3W8SA 1A23A 4ZB7A 5B8BA 5IMCA 3MWHA 1SK0A 1EV4A 1IYIA 3ZRDA 4RUVA 2P0GA 4I2TA 1A8YA 2VCTA 4AGSA 1GTAA 3FY7A 5IOXA 2UV8G 5H5SA 4KGIA 5HFKA 5BRTA 3EINA 4MZBA 3RHCA 3GNJA 4EDZA 5J4VA 4OMVA 3ED3A 4GQCA 1ZYEA 5J9BA 3FZ9A 2B6MA 3LXZA 3K8NA 5IMAA 5HQPA 1ERVA 4TVEA 4KCAA 1GNWA 19GSA 3IAS2 5HFIA 2PN8A 4BVXB 5DDLA 2H1GA 5A34A 5B6MA 3HJOA 1ZGNA 3CSIA 4WETA 1U87A 4L8EA 5ECIB 3LYPA 2H0GA 2CZ2A 2HSMA 2QA1A 4Q5RA 1Z6NA 1GL8A 4YQUA 2BJXA 6GSVA 4TOPA 2WB9A 2K8VA 5J41A 1BG1A 5LCZA 3TU3B 5GAPD 2A2RA 4PXOA 3APOA 4NHWA 3FR3A 4GLTA 5AN1A 3QFAC 2YJ7A 4PUFC 2B1LA 2GZYA 2RM6A 2XHFA 5L71A 1N2AA 3HY2A 1FOHA 1PA3A 4ZB8A 2NDOA 4RI7A 1FHEA 2Z9SA 2L6DA 4OO4A 3ZIVA 1X5DA 2GLRA 4YH2A 5E4WA 3D6IA 3EURA 2C1YA 3CSJA 3APQA 5ELAA 1GWCA 3DWVA 2YN1A 4LMVA 1TI3A 3QAVA 4AJ8A 1A0RP 4X43A 2HRKB 5C00A 1Z3EA 3F3RA 3H4KA 3TGZA 1SK2A 2YJHA 2O5VA 5B8AA 2OKAA 2PPTA 2IMKA 3D0ZA 1TXUA 3VPTA 2LRTA 3TKQA 2OT3A 2HLSA 1SKRB 4K9ZA 4ML6A 2HRAA 2WVZA 3ZL5A 1IYHA 2HSYA 1SKWB 3UMAA 4WKWA 4DSSB 4IELA 1FOVA 5CRWA 22GSA 4OCEA 5DCGA 4LLRA 2C4JA 2HSNB 1H4OA 3EYTA 5G1KA 1KEBA 2V32A 4ULXA 1VF1A 4PX1A 1R4WA 2JZRA 1KNGA 4LA1A 1G0TA 1JLWA 5DAKA 3J7Yk 1SVLA 5EVOA 2N5AA 4E8HA 2V6KA 5IMZA 5DQYA 5ID2B 2VCVA 2CAQA 2VO4A 1XOAA 3EVIA 3TJBA 4BL7A 1V98A 4TXOA 4HJ2A 1U3AA 2K6VA 1M9BA 4POBA 4IJ3A 2R5GA 1B4QA 2IN3A 16GSA 3HJMA 2LRCA 3CRTA 4JR4A 1PN9A 2YOIA 4V2MA 6GSWA 5J47A 2FLSA 2GT5A 3FEUA 4JR6A 3C8EA 4QMKA 2FD3A 2ON5A 2PERA 3RHBA 2AV4A 4NPBA 2C0EA 4K5RA 2L57A 5HR3A 1W4VA 2HXKA 4KSMA 20GSA 1T00A 3C7MA 4V2NA 3DKSA 3Q18A 1XZOA 5CAXA 1GSQA 3UVTA 1A24A 5G2ZA 2H71A 2C3TA 1YVLA 4GTUA 2X99A 5G30A 3IAM2 2DJKA 3GUSA 4TN8A 3KH9A 4ZXGA 3D4TA 2OBKA 1BG5A 4USSA 3O3TA 2C0FA 1GUMA 2X8CA 4JEDA 1J9BA 2E2GA 2O89A 1TKDB 5IIZA 3O76A 2EFEA 2R2JA 4HI7A 4FYUA 3WGDA 4D73A 3IPZA 3TCOA 4O92A 4POMA 4KF9A 3TUEA 1XFLA 2GQMA 2H30A 3LORA 1GUKA 4BVYB 1OAZA 4X4JA 3ZTLA 5JWQB 5A1NB 1SJ6A 1T4YA 1GUHA 1XBSA 5GZZB 4OFNA 4ECCA 1BQ7A 2PVOC 5AGYA 2DJJA 1A8LA 3EWLA 4L5LA 1R5AA 3C1RA 3QR6A 2L4QA 3L78A 3F3QA 4KA0A 4ML1A 4GSNA 4JBBA 3QMXA 4FYBA 4CY6A 3TOTA 3GKMA 3ERWA 1LBKA 1I9DA 1ERUA 4PI2C 1AXDA 4LMWA 3H1NA 4IN0A 1BX9A 4Q5NA 2IPAA 3DRNA 9GSSA 3SBCA 1M3JA 5ECLB 3HA9A 3IRAA 2MBSA 4DSQA 4XS4B 4GSTA 4MCUA 2WVXB 2RLIA 4MJBA 2JZTA 1WJKA 1PKZA 2NVLA 3TJJA 3KGKA 1R7HA 1G7EA 1QQ2A 1PL2A 4V2LA 2MMZA 1XW9A 2FA8A 2GTUA 3GTUB 2O8VB 3GYKA 4Z2RA 4PQ1A 1THOA 1F6MC 3W6GA 5FHIA 2X8HA 5D9VA 2YWOA 4ICYA 2MMNA 3F4TA 2IFQA 3NIVA 1QMVA 3UVHA 3M1GA 4MNNA 3UAPA 4XHMA 5D73A 1ON4A 3UOMA 3QAGA 3HD5A 4EE0A 1PQNA 4WXTA 1TK5B 2CV4A 3MDKA 3RAZA 3KH7A 3AY8A 4HDEA 2H8LA 2GSQA 1OC3A 3HVVA 1FVJA 3TKPA 5HFGA 5CRDA 3LG6A 2HZEA 3GL5A 1O6JA 1WPIA 3PH9A 2VIMA 3ERGA 3F4SA 1N25A 1PL1A 3US3A 1OKDA 4PNGA 3U5RE 1RW1A 1XWKA 1XVQA 5J3RA 3F9UA 1M2AA 2H66A 3P8WA 2FGXA 2QGVA 5GAND 4K1FA 4TRXA 4RI6A 3QD9A 1I1IP 3FKFA 4GDFA 5E59A 3GX0A 3LFLA 2GS3A 2RUFA 2REMA 5D8IA 1GTBA 2LJKA 2WFCA 2WULA 5A34B 3L4NA 4KSOA 8GSSA 4JU5A 2CX3A 2DIYA 4HZ4A 2PWJA 3VPQA 1Q98A 4LL1B 4O7HA 2YP6A 3GMFA 4MPGA 1HD2A 3IXRA 3RPNA 4FO5A 4WBRD 3BCIA 1F3BA 2UZ8A 5IOWA 4ZIJA 4YQMA 2EIOA 4RQXA 5AIVA 1AUCA 1R26A 3GH9A 2C3QA 1SJIA 1K3LA 4LL4B 3CRUA 4BPYA 1X9MB 2GZZA 3R3EA 4IVFA 4XCSA 4MH2A 1GULA 4XTSA 3TKSC 4ID0A 4Q5FA 1X9WB 1O81A 4KW6A 3IC4A 1MTCA 3C1SA 3IV4A 1TU8A 3D4MA 1T8EB 1K0AA 1K0DA 1GP1A 2O87A 4XIHA 5GSTA 4IP1A 2LQQA 4N30A 4EUYA 2TIRA 4N3ZA 1ILOA 4PGTA 2LQOA 2IMIA 3IBHA 1RQMA 3KJYA 3DXBA 5A4UA 3BCKA 3F63A 1H75A 1Y1UA 4TR3A 11GSA 12GSA 2L6CA 1ZZYA 2KP2A 2J9HA 3ZMKA 4K8MA 2ZUPA 3EMXA 3V1WA 4KNDA 1THXA 1B9XC 3LYKA 3PGTA 2J23A 4PTSA 3ISOA 1YKCA 4NV5A 2OE1A 5JCUA 2VCWA 3P7XA 1OKTA 3CQFA 3QAWA 2HNLA 4L0UA 4KX4A 2HE3A 4WF4A 3LJRA 1GLQA 2O7KA 1SK1A 2VKZG 4JE1A 1EZKA 2DC5A 4TXVA 1V57A 2AYTA 4IGJA 5DQSA 3ZYWA 2VCZA 2B5YA 2ZNMA 1QUWA 5ECMB 4KDUA 1AIUA 2CVDA 1TU7A 3L9UA 5G1LA 3IK7A 3A3TA 4G0KA 3GSTA 5ECOB 3KD0A 3A5WA 1EEJA 3GURA 4POKA 4KCEA 1V9WA 2R0GA 2CVKA 5D93A 4G01A 1R5PA 4HEA2 4PURA 2HYXA 4ACSA 4AKHA 1VRSD 4Z2TA 1UC7A 4L0WA 4QL7A 2R4VA 3IR4A 3KXOA 1GTIA 2JSYA 4MPFA 4W66A 2CA8A 2HI7A 2ON7A 3KMNA 1AQWA 1ML6A 3P2AA 1OC9B 2YWNA 4BA7A 1M0UA 1MD4A 2IMDA 1PFOA 2P5QA 4TR1A 1TP9A 4EIQA 4A5PA 2YNXA 4J2FA 1Z6MA 3H8QA 5CNWA 2C80A 3KM6A 1B48A 2LV3A 2N5FA 4OO5A 2WGRA 4ECBA 6GSXA 4IBPA 4K0NA 1TI1A 1GSSA 1SVMA 3VWUA 5AIXA 2H1DA 2PBJA 3WGXA 3HVNA 3MNGA 3A2XA 2YANA 1VF4A 2EIQA 1KTEA 1ZMAA 2QSIA 4F2IA 1DSBA 3QOUA 1YF0A 4HUAA 5KOXA 2H0IA 1K3YA 1E2YA 1SVOA 3IK9A 2PU9C 1UA5A 4HOJA 3KTBA 1Q4JA 4KE3A 5IMFA 1DE1A 3O6TA 3Q6OA 4OFTA 1JZRA 5DCHA 2GDRA 2PVQA 1K0NA 3M8NA 3TJGA 2RUEA 4K7OA 1XWAA 3D22A 2VCXA 2X64A 2OJLA 4WF5A 3GKNA 3BBYA 3H79A 3HZ8A 3G7JA 2C3NA 1OVNA 1SJZA 1K0BA 4K2XA 3VFIA 1I5GA 1EP8A 3EE2A 2VD0A 1AQXA 4MABA 1PX6A 1PKWA 2C8UA 1S3DA 1KBNA 1SL1B 4BVXA 4OFMA 1OYJA 2GSRA 1MEKA 4RQRA 2JU5A 4Z7XA 3UBLA 3HZ4A 3ZFLA 1A2LA 4AKGA 1YEWC 2WRTA 4MZCA 1O7UA 1SL0B 3APSA 3HHVA 1X0RA 3A2WA 4O5QA 3UJ1A 3Q19A 1TJDA 5GSSA 4HZ2A 2E0QA 1BF5A 5EPFA 1BJXA 3N9JA 2H70A 4EXJA 2HRFA 3RBTA 2O85A 3M0FA 4HSCX 1E6BA 2R6KA 5IM9A 5J4YA 2FWGA 3TDGA 4TW5A 1USBA 4FQUA 3EPTA 4K5SA 5A5KA 3ZIJA 2CX4A 2IWTA 1URMA 2AHEA 2K9FA 4POLA 1TRSA 2JACA 4KDXA 1EGRA 4MH3A 1TK8B 4FH8A 1WMJA 4NHZA 1UN2A 1O8WA 3E9JB 1O73A 4JRRA 1B4PA 3VK9A 4AI6A 2EFHA 1Y6EA 2HRKA 4NV2A 1GSDA 5D9XA 2VM1A 2FCHA 1JLVA 4ISDA 1WE0A 3UBKA 1S3AA 1FVKA 2OE0A 1WOUA 3ME8A 3A2VA 1XWBA 2VCQA 5A5HB 3EC3A 1EWXA 2GQKA 4MDCA 4FXYP 1JZDA 2M80A 5J9CA 5IPHA 1ST9A 3GN3A 2OACA 3VWWA 2R37A 4DSSA 5IO2A 3E3EA 2WW1A 3KMOA 2H75A 5J4UA 2F8FA 3R2QA 5ECHB 2HSNA 4MF5A 1JHBA 2LTKA 3GL3A 1FO5A 4K7IA 2FUG2 1ZOFA 5CRGA 5EL8A 2VD1A 4G9HA 2DJ3A 2KUCA 4IW9A 5LD0A 5BMUB 2I9HA 3PPUA 3HXSA 4PUAA 2B3SA 1GH2A 1WP0A 5KOWA 2IIYA 3G7YA 5ID2A 3HKRA 4HS1A 5CRHA 1MDKA 1U88A 1F9MA 4I2UA 1ZYQB 1K0CA 5KN1A 3WYWA 3P90A 2DMLA 3WT2A 4OCFA 3IHGA 2IMFA 2FWHA 2GSSA 2H1LA 1SD8A 2DBCA 2TRCP 3G7IA 3H93A 2G2QA 2VL2C 2VOCA 3FHKA 2CZ3A 2I81A 5DBQA 1FG4A 7GSSA 1W89A 2YWMA 1A2MA 4Q5QA 1M9AA 3GSSA 1TW9A
chains in the Genus database with same CATH topology
1K3OA 2LS5A 1ZYPA 5CYYA 2FY6A 1Z9HA 18GSA 3Q74A 4DEJA 5IPGA 4ECJA 2D2ZA 3L9SA 2F9SA 4TR0A 2LKUA 2NPBA 3CSHA 3FYGA 3TKSE 4WR4A 3M9KA 2VLTA 3ME7A 3MIXA 1AC1A 4DVCA 2QC7A 2JSZA 1SL2B 4XS1A 2CT6A 4YKFA 1AW9A 3L0HA 5ECNB 4N0ZA 2GSTA 1XVWA 3TRXA 4G10A 3C73A 1ZYNA 1OE8A 5DVBA 5B6NA 5JCWA 3IA1A 4KDYA 4H86A 2HQTA 4IKHA 1HNCA 3NOFA 1PX7A 1YEXA 3QCPA 4KUNA 4NXIA 2DLXA 2ALBA 1F3AA 2HSMB 4IP6A 3TB2A 4BVYA 1EP7A 3DYRA 2F51A 1PD21 3LGCA 5F05A 5A1NA 1TXXA 2GGTA 3HCZA 1BYEA 2YZUA 5ELGA 2MMOA 1MD3A 4PNFA 2VLVA 4TR4A 4XRDA 1FAAA 2MZCA 2V2GA 2GT6A 4G0LA 2I4AA 2M46A 5DALA 4I8BA 3DD3A 4BWSA 4MP4A 2H6XA 4KAEA 4MLYA 3DIEA 2R0PA 1YDKA 2WCIA 2H6ZA 4P3YB 4ZBBA 2EC4A 4XS4A 2OBIA 3BD2A 5F8BA 2DKHA 1PSQA 1O8XA 2WZ9A 1T7PB 4TR1B 3GKXA 2VL3A 2JADA 2H74A 1PN0A 3LQ7A 3I43A 1LU4A 5KN2A 5ECSA 3GTUA 4O5RA 4I5QA 2KLXA 1X5EA 5H5QA 1UVZA 2CVBA 2YV9A 5KEJA 5F06A 5A4WA 2L5LA 4MK3A 1N8JA 1XXUA 5AISA 2HSHA 2OADA 5D9TA 1NSWA 1FB6A 4AF2A 3QPMA 2HT9A 4G2EA 3ZFBA 3BJ5A 1AQVA 2XBIA 2N5BA 2DJ2A 4IQ1A 4AJ6A 1LJRA 3BOAA 4AKIA 3ZLPA 2VUPA 2K8SA 3I69A 1GRXA 2XBQA 3TRQA 1T4ZA 2K18A 5F0GA 6GSTA 5IO0A 5ECKB 1K0MA 1V58A 2HFDA 3FW2A 1DBYA 5DAKB 3F6DA 4ZL8A 2JZSA 3F6FA 2G0FA 2KHPA 5FWGA 1ERTA 2AJQB 4J57E 2RM5A 4F82A 1JZWA 4BL7B 5JWRB 4EC0A 4TXOB 1F2EA 2V6OA 3W8JA 1HNAA 4ZBAA 4V1Ag 1PMTA 4CY8A 3TRPA 1QK8A 1SYRA 4V1Ap 1Z7RA 1YZXA 2H6YA 2CAIA 3CTGA 4MF6A 4XS6A 1ABAA 2B5XA 3PR8A 3GH6A 1TTZA 3LWAA 2VLUA 3E0UA 4QQ7A 2ES7A 2B7KA 1M2BA 2VL9A 4OD7A 4GQFA 3KZQA 4MMMA 3ZVJD 1FW1A 1OC8A 3GIXA 4MJAA 3VWVA 1A2JA 2XPDA 3TKSA 3GHAA 2M72A 1YF1A 1Z7PA 4ZL9A 3U6VA 3HMJG 4G19A 2YZHA 4IHUA 3I6AA 3TKRA 4Z2UA 2P31A 4NAXA 3KP8A 3HVXA 1NM3A 3C71A 2FWEA 2OA7A 1XCCA 1EEMA 3GV1A 1J0FA 3FZ5A 2EFCA 3PINA 4OWYA 5CP1A 4EF0A 4YAVA 4HJMA 3RDWA 3GA4A 2KOKA 2QA2A 1EOHA 2I1UA 4MJEA 5ABRA 4D73B 5C04A 3KIJA 3GKKA 5ENUA 1ACVA 5FT3A 3FRCA 5JCGA 1C72A 5ECRB 2FA4A 2HZFA 3ERFA 1AAZA 1PGTA 2C0GA 1BEDA 4F03A 1GSUA 4K7NA 2IL3A 5IMDA 4WBJA 1GSFA 1MDJA 1SU9A 2BTOT 2TRXA 3FR9A 4EVMA 3GX8A 1HNBA 1CQGA 3OR5A 2A4HA 3KP9A 4X1UA 1J08A 1M2DA 1PRXA 3A5IA 4NWYA 4KH7A 1U6TA 4TKYA 1K0OA 1YEPA 2H01A 3J7Yb 5KN3A 4QL9A 4EDYA 1EOGA 4IQAA 1QGVA 4CDOA 3NZNA 3MAKA 3GFKA 2A2PA 5D9WA 2YWIA 2DKIA 3IC8A 2PGTA 3EU4A 4HU9A 3EU3A 2H1AA 3M9JA 2MMAA 4BWQA 1WIKA 4ZILA 1GLPA 1XW5A 1T3BA 4GWRA 2ZCTA 2E2MA 2WDUA 4GCIA 3VI5A 5CREA 2YV7A 5J5NA 1TRVA 2IFQB 1CQHA 4CW9A 4N10A 4MF7A 1YY7A 1NW2A 13GSA 2VM2A 1G6YA 1SYXA 1XIYA 3D21A 3FMWA 5LNKe 3FZ4A 1OE7A 2LSTA 3RPPA 1S3CA 2HZEB 4MJCA 2H73A 2L5OA 1TRWA 4HU7A 3G9BA 3KEBA 5EY6A 2V41A 2QKEA 1GSEA 2H19A 3VI7A 1RK4A 1XOBA 3LW9A 1EGOA 2LEGA 4K2DA 2V1MA 1OC9A 3ZZXA 5D96A 3DMLA 1TK0B 3F0IA 3M3MA 2IJYA 4ILFA 2P5RA 5ECPB 4PQIA 4X0XA 3DGQA 4N0VA 2H0HA 3QDNA 1ERWA 17GSA 3VLNA 6GSUA 2AAWA 3UL3A 2B5EA 2A4VA 3CTFA 2PUKC 1JZOA 1Z5YE 3HVSA 2X49A 5H5RA 3CWGA 1O85A 1WRYA 4ECIA 4ZB9A 5G5FA 3UARA 2PMTA 5IMVA 2DIZA 2C0DA 2GVPA 4HQSA 2H1BA 3JCML 2LJRA 4GSSA 2LRNA 2FHEA 2NBSA 1M99A 2MBTA 1ZL9A 5DALB 2E7PA 3VURA 2L4CA 1BAYA 2WJUA 1B8XA 1VF2A 2IMEA 1HQOA 5HR2A 1X9SB 3HDCA 3CBUA 3LEFA 4E68A 1VGLA 4EIPA 1TDIA 3IOSA 3ZMLA 1JFUA 4GRFA 5A4VA 1V2AA 2GQLA 6GSYA 3LXTA 2MYGA 4K6XA 4AJ7A 6GSSA 4YAPA 4I6XA 2YPMA 5COHA 4EL1A 2H72A 5ECQB 1YQ1A 4GF0A 2R0CA 1QXHA 4XRAA 1Y25A 2EFDA 2F8AA 4EO3A 2BMXA 3F8UA 1XWGA 4MA9A 2JL4A 3FR6A 4YQVA 2HRNA 1G6WA 1GTUA 1NHOA 4O32A 3CXGA 3UIWA 2I3YA 3SWLA 4G0IA 1TRUA 3HYPA 3TJFA 1ZCPA 4NMUA 4E8EA 4F0BA 3I9V2 4GXZA 3IHQA 1X5CA 2AB6A 3IDVA 4ZB6A 4O5UA 2RIIA 3MYDA 5CO3A 1HYUA 2FNOA 1EV9A 2FWFA 3TOUA 1WWJA 4YKGA 3KCMA 1NHYA 5G5EA 4L5OA 3FZAA 5DJLA 5HR1A 5J40A 2AUVA 2DJ1A 2DMMA 2NTOA 4I97A 1VF3A 2DJ0A 2R3XA 4F9ZA 3WGEA 4PQHA 4DSRA 1T1VA 1V40A 4WEYA 5INYA 3GRXA 2CQ9A 3HJPA 1SD9A 10GSA 2XPEA 2H76A 3ZREA 1DE2A 2LNSA 1SKSB 4K0GA 1DUGA 2EIRA 2F3MA 1SENA 2L59A 1QFNA 2LUSA 3S9FA 3IE3A 3FK8A 4ZL7A 1XW6A 2WS2A 2OE3A 2X4AA 1B9YC 1YKAA 3ZITA 3TJKA 4AKXB 1GNEA 5A5HA 2KP1A 4IJIA 4IS0A 4WR5A 4FIWA 1XPVA 1YJ6A 5HR0A 4KB3A 4N11A 14GSA 2XC2A 4EKZA 1GSYA 1G7OA 3DVXA 3DEXA 3D5JA 2B1KA 5B7CA 1F37A 3ZVJA 5DJMA 3WT1A 1M7TA 4HQZA 4F0CA 4J56E 1A0FA 3VWXA 3UEMA 1MDIA 2GZPA 3N5OA 4FYCA 3CMIA 1U3IA 3MSZA 4MZWA 5BMUA 1XWCA 5KN0A 3EMPA 2VAFA 3QFBC 2A2SA 3LSZA 5F07A 1TOFA 2LNTA 3CYNA 5IQYA 2LJAA 4ZBDA 2VL2A 5G31A 3F4RA 2X8GA 3KTLA 3DVWA 1FB0A 4CHSA 5JWOB 4JZQA 2B7JA 3L9VA 2YCDA 3WD6A 2DSAA 3W8SA 1A23A 4ZB7A 5B8BA 5IMCA 3MWHA 1SK0A 1EV4A 1IYIA 3ZRDA 4RUVA 2P0GA 4I2TA 1A8YA 2VCTA 4AGSA 1GTAA 3FY7A 5IOXA 2UV8G 5H5SA 4KGIA 5HFKA 5BRTA 3EINA 4MZBA 3RHCA 3GNJA 4EDZA 5J4VA 4OMVA 3ED3A 4GQCA 1ZYEA 5J9BA 3FZ9A 2B6MA 3LXZA 3K8NA 5IMAA 5HQPA 1ERVA 4TVEA 4KCAA 1GNWA 19GSA 3IAS2 5HFIA 2PN8A 4BVXB 5DDLA 2H1GA 5A34A 5B6MA 3HJOA 1ZGNA 3CSIA 4WETA 1U87A 4L8EA 5ECIB 3LYPA 2H0GA 2CZ2A 2HSMA 2QA1A 4Q5RA 1Z6NA 1GL8A 4YQUA 2BJXA 6GSVA 4TOPA 2WB9A 2K8VA 5J41A 1BG1A 5LCZA 3TU3B 5GAPD 2A2RA 4PXOA 3APOA 4NHWA 3FR3A 4GLTA 5AN1A 3QFAC 2YJ7A 4PUFC 2B1LA 2GZYA 2RM6A 2XHFA 5L71A 1N2AA 3HY2A 1FOHA 1PA3A 4ZB8A 2NDOA 4RI7A 1FHEA 2Z9SA 2L6DA 4OO4A 3ZIVA 1X5DA 2GLRA 4YH2A 5E4WA 3D6IA 3EURA 2C1YA 3CSJA 3APQA 5ELAA 1GWCA 3DWVA 2YN1A 4LMVA 1TI3A 3QAVA 4AJ8A 1A0RP 4X43A 2HRKB 5C00A 1Z3EA 3F3RA 3H4KA 3TGZA 1SK2A 2YJHA 2O5VA 5B8AA 2OKAA 2PPTA 2IMKA 3D0ZA 1TXUA 3VPTA 2LRTA 3TKQA 2OT3A 2HLSA 1SKRB 4K9ZA 4ML6A 2HRAA 3ZL5A 1IYHA 2HSYA 1SKWB 3UMAA 4WKWA 4DSSB 4IELA 1FOVA 5CRWA 22GSA 4OCEA 5DCGA 4LLRA 2C4JA 2HSNB 1H4OA 3EYTA 5G1KA 1KEBA 2V32A 4ULXA 1VF1A 4PX1A 1R4WA 2JZRA 1KNGA 4LA1A 1G0TA 1JLWA 5DAKA 3J7Yk 1SVLA 5EVOA 2N5AA 4E8HA 2V6KA 5IMZA 5DQYA 5ID2B 2VCVA 2CAQA 2VO4A 1XOAA 3EVIA 3TJBA 4BL7A 1V98A 4TXOA 4HJ2A 1U3AA 2K6VA 1M9BA 4POBA 4IJ3A 2R5GA 1B4QA 2IN3A 16GSA 3HJMA 2LRCA 3CRTA 4JR4A 1PN9A 2YOIA 4V2MA 6GSWA 5J47A 2FLSA 2GT5A 3FEUA 4JR6A 3C8EA 4QMKA 2FD3A 2ON5A 2PERA 3RHBA 2AV4A 4NPBA 2C0EA 4K5RA 2L57A 5HR3A 1W4VA 2HXKA 4KSMA 20GSA 1T00A 3C7MA 4V2NA 3DKSA 3Q18A 1XZOA 5CAXA 1GSQA 3UVTA 1A24A 5G2ZA 2H71A 2C3TA 1YVLA 4GTUA 2X99A 5G30A 3IAM2 2DJKA 3GUSA 4TN8A 3KH9A 4ZXGA 3D4TA 2OBKA 1BG5A 4USSA 3O3TA 2C0FA 1GUMA 2X8CA 4JEDA 1J9BA 2E2GA 2O89A 1TKDB 5IIZA 3O76A 2EFEA 2R2JA 4HI7A 4FYUA 3WGDA 4D73A 3IPZA 3TCOA 4O92A 4POMA 4KF9A 3TUEA 3LORA 1XFLA 2GQMA 2H30A 1GUKA 4BVYB 1OAZA 4X4JA 3ZTLA 5JWQB 5A1NB 1SJ6A 1T4YA 1GUHA 1XBSA 5GZZB 4OFNA 4ECCA 1BQ7A 2PVOC 5AGYA 2DJJA 1A8LA 3EWLA 4L5LA 1R5AA 3C1RA 3QR6A 2L4QA 3L78A 3F3QA 4KA0A 4ML1A 4GSNA 4JBBA 3QMXA 4FYBA 4CY6A 3TOTA 3GKMA 3ERWA 1LBKA 1I9DA 1ERUA 1AXDA 4LMWA 3H1NA 4IN0A 1BX9A 4Q5NA 2IPAA 3DRNA 9GSSA 3SBCA 5ECLB 3HA9A 3IRAA 2MBSA 4DSQA 4XS4B 4GSTA 4MCUA 2RLIA 4MJBA 2JZTA 1WJKA 1PKZA 2NVLA 3TJJA 3KGKA 1R7HA 1G7EA 1QQ2A 1PL2A 4V2LA 2MMZA 1XW9A 2FA8A 2GTUA 3GTUB 2O8VB 3GYKA 4Z2RA 4PQ1A 1THOA 1F6MC 3W6GA 5FHIA 2X8HA 5D9VA 2YWOA 4ICYA 2MMNA 3F4TA 2IFQA 3NIVA 1QMVA 3UVHA 3M1GA 4MNNA 3UAPA 4XHMA 5D73A 1ON4A 3UOMA 3QAGA 3HD5A 4EE0A 1PQNA 4WXTA 1TK5B 2CV4A 3MDKA 3RAZA 3KH7A 3AY8A 4HDEA 2H8LA 2GSQA 1OC3A 3HVVA 1FVJA 3TKPA 5HFGA 5CRDA 3LG6A 2HZEA 3GL5A 1O6JA 1WPIA 3PH9A 2VIMA 3ERGA 3F4SA 1N25A 1PL1A 3US3A 1OKDA 4PNGA 3U5RE 1RW1A 1XWKA 1XVQA 5J3RA 3F9UA 1M2AA 2H66A 3P8WA 2FGXA 2QGVA 5GAND 4K1FA 4TRXA 4RI6A 3QD9A 3FKFA 4GDFA 5E59A 3GX0A 3LFLA 2GS3A 2RUFA 2REMA 5D8IA 1GTBA 2LJKA 2WFCA 2WULA 5A34B 3L4NA 4KSOA 8GSSA 4JU5A 2CX3A 2DIYA 4HZ4A 2PWJA 3VPQA 1Q98A 4LL1B 4O7HA 2YP6A 3GMFA 4MPGA 1HD2A 3IXRA 3RPNA 4FO5A 4WBRD 3BCIA 1F3BA 2UZ8A 5IOWA 4ZIJA 4YQMA 2EIOA 4RQXA 5AIVA 1AUCA 1R26A 3GH9A 2C3QA 1SJIA 1K3LA 4LL4B 3CRUA 4BPYA 1X9MB 2GZZA 3R3EA 4IVFA 4XCSA 4MH2A 1GULA 4XTSA 3TKSC 4ID0A 4Q5FA 1X9WB 1O81A 4KW6A 3IC4A 1MTCA 3C1SA 3IV4A 1TU8A 3D4MA 1T8EB 1K0AA 1K0DA 1GP1A 2O87A 4XIHA 5GSTA 4IP1A 2LQQA 4N30A 4EUYA 2TIRA 4N3ZA 1ILOA 4PGTA 2LQOA 2IMIA 3IBHA 1RQMA 3KJYA 3DXBA 5A4UA 3BCKA 3F63A 1H75A 1Y1UA 4TR3A 11GSA 12GSA 2L6CA 1ZZYA 2KP2A 2J9HA 3ZMKA 4K8MA 2ZUPA 3EMXA 3V1WA 4KNDA 1THXA 1B9XC 3LYKA 3PGTA 2J23A 4PTSA 3ISOA 1YKCA 4NV5A 2OE1A 5JCUA 2VCWA 3P7XA 1OKTA 3QAWA 2HNLA 4L0UA 4KX4A 2HE3A 4WF4A 3LJRA 1GLQA 2O7KA 1SK1A 2VKZG 4JE1A 1EZKA 2DC5A 4TXVA 1V57A 2AYTA 4IGJA 5DQSA 3ZYWA 2VCZA 2B5YA 2ZNMA 1QUWA 5ECMB 4KDUA 1AIUA 2CVDA 1TU7A 3L9UA 5G1LA 3IK7A 3A3TA 4G0KA 3GSTA 5ECOB 3KD0A 3A5WA 1EEJA 3GURA 4POKA 4KCEA 1V9WA 2R0GA 2CVKA 5D93A 4G01A 1R5PA 4HEA2 4PURA 2HYXA 4ACSA 4AKHA 1VRSD 4Z2TA 1UC7A 4L0WA 4QL7A 2R4VA 3IR4A 3KXOA 1GTIA 2JSYA 4MPFA 4W66A 2CA8A 2HI7A 2ON7A 3KMNA 1AQWA 1ML6A 3P2AA 1OC9B 2YWNA 4BA7A 1M0UA 1MD4A 2IMDA 2P5QA 4TR1A 1TP9A 4EIQA 4A5PA 2YNXA 4J2FA 1Z6MA 3H8QA 5CNWA 2C80A 3KM6A 1B48A 2LV3A 2N5FA 4OO5A 2WGRA 4ECBA 6GSXA 4IBPA 4K0NA 1TI1A 1GSSA 1SVMA 3VWUA 5AIXA 2H1DA 2PBJA 3WGXA 3MNGA 3A2XA 2YANA 1VF4A 2EIQA 1KTEA 1ZMAA 2QSIA 4F2IA 1DSBA 3QOUA 1YF0A 4HUAA 5KOXA 2H0IA 1K3YA 1E2YA 1SVOA 3IK9A 2PU9C 1UA5A 4HOJA 3KTBA 1Q4JA 4KE3A 5IMFA 1DE1A 3O6TA 3Q6OA 4OFTA 1JZRA 5DCHA 2GDRA 2PVQA 1K0NA 3M8NA 3TJGA 2RUEA 4K7OA 1XWAA 3D22A 2VCXA 2X64A 2OJLA 4WF5A 3GKNA 3BBYA 3H79A 3HZ8A 3G7JA 2C3NA 1OVNA 1SJZA 1K0BA 4K2XA 3VFIA 1I5GA 1EP8A 3EE2A 2VD0A 1AQXA 4MABA 1PX6A 1PKWA 2C8UA 1S3DA 1KBNA 1SL1B 4BVXA 4OFMA 1OYJA 2GSRA 1MEKA 4RQRA 2JU5A 4Z7XA 3UBLA 3HZ4A 3ZFLA 1A2LA 4AKGA 2WRTA 4MZCA 1O7UA 1SL0B 3APSA 3HHVA 1X0RA 3A2WA 4O5QA 3UJ1A 3Q19A 1TJDA 5GSSA 4HZ2A 2E0QA 1BF5A 5EPFA 1BJXA 3N9JA 2H70A 4EXJA 2HRFA 3RBTA 2O85A 3M0FA 1E6BA 2R6KA 5IM9A 5J4YA 2FWGA 3TDGA 4TW5A 1USBA 4FQUA 3EPTA 4K5SA 5A5KA 3ZIJA 2CX4A 2IWTA 1URMA 2AHEA 2K9FA 4POLA 1TRSA 2JACA 4KDXA 1EGRA 4MH3A 1TK8B 4FH8A 1WMJA 4NHZA 1UN2A 1O8WA 3E9JB 1O73A 4JRRA 1B4PA 3VK9A 4AI6A 2EFHA 1Y6EA 2HRKA 4NV2A 1GSDA 5D9XA 2VM1A 2FCHA 1JLVA 4ISDA 1WE0A 3UBKA 1S3AA 1FVKA 2OE0A 1WOUA 3ME8A 3A2VA 1XWBA 2VCQA 5A5HB 3EC3A 1EWXA 2GQKA 4MDCA 1JZDA 2M80A 5J9CA 5IPHA 1ST9A 3GN3A 2OACA 3VWWA 2R37A 4DSSA 5IO2A 3E3EA 3KMOA 2H75A 5J4UA 2F8FA 3R2QA 5ECHB 2HSNA 4MF5A 1JHBA 2LTKA 3GL3A 1FO5A 4K7IA 2FUG2 1ZOFA 5CRGA 5EL8A 2VD1A 4G9HA 2DJ3A 2KUCA 4IW9A 5LD0A 5BMUB 2I9HA 3PPUA 3HXSA 4PUAA 2B3SA 1GH2A 1WP0A 5KOWA 2IIYA 3G7YA 5ID2A 3HKRA 4HS1A 5CRHA 1MDKA 1U88A 1F9MA 4I2UA 1ZYQB 1K0CA 5KN1A 3WYWA 3P90A 2DMLA 3WT2A 4OCFA 3IHGA 2IMFA 2FWHA 2GSSA 2H1LA 1SD8A 2DBCA 2TRCP 3G7IA 3H93A 2G2QA 2VL2C 2VOCA 3FHKA 2CZ3A 2I81A 5DBQA 1FG4A 7GSSA 1W89A 2YWMA 1A2MA 4Q5QA 1M9AA 3GSSA 1TW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3O A;  2LS5 A;  5CYY A;  2FY6 A;  1Z9H A;  18GS A;  3Q74 A;  4DEJ A;  5IPG A;  4ECJ A;  2D2Z A;  3L9S A;  2F9S A;  4TR0 A;  2LKU A;  2NPB A;  3CSH A;  3FYG A;  3TKS E;  4WR4 A;  3M9K A;  2VLT A;  3ME7 A;  1AC1 A;  4DVC A;  2QC7 A;  2JSZ A;  1SL2 B;  4XS1 A;  2CT6 A;  1AW9 A;  3L0H A;  5ECN B;  4N0Z A;  2GST A;  1XVW A;  3TRX A;  4G10 A;  3C73 A;  1OE8 A;  5DVB A;  5B6N A;  5JCW A;  3IA1 A;  4KDY A;  4H86 A;  2HQT A;  4IKH A;  1HNC A;  3NOF A;  1PX7 A;  1YEX A;  3QCP A;  4KUN A;  4NXI A;  2DLX A;  2ALB A;  1F3A A;  2HSM B;  4IP6 A;  3TB2 A;  4BVY A;  1EP7 A;  3DYR A;  2F51 A;  1PD2 1;  3LGC A;  5F05 A;  2GGT A;  1TXX A;  3HCZ A;  1BYE A;  2YZU A;  5ELG A;  2MMO A;  1MD3 A;  4PNF A;  2VLV A;  4TR4 A;  4XRD A;  1FAA A;  2MZC A;  2V2G A;  2GT6 A;  4G0L A;  2I4A A;  2M46 A;  5DAL A;  4I8B A;  3DD3 A;  4BWS A;  4MP4 A;  2H6X A;  4KAE A;  4MLY A;  1TW9 A;  3DIE A;  1YDK A;  2WCI A;  2H6Z A;  4P3Y B;  4ZBB A;  2EC4 A;  4XS4 A;  2OBI A;  3BD2 A;  5F8B A;  1PSQ A;  1O8X A;  2WZ9 A;  1T7P B;  4TR1 B;  3GKX A;  2VL3 A;  2JAD A;  2H74 A;  3LQ7 A;  3I43 A;  1LU4 A;  5KN2 A;  5ECS A;  3GTU A;  4O5R A;  4I5Q A;  2KLX A;  1X5E A;  5H5Q A;  1UVZ A;  2CVB A;  2YV9 A;  5KEJ A;  5F06 A;  5A4W A;  2L5L A;  4MK3 A;  1N8J A;  1XXU A;  5AIS A;  2HSH A;  2OAD A;  5D9T A;  1NSW A;  1FB6 A;  4AF2 A;  3QPM A;  2HT9 A;  4G2E A;  3ZFB A;  3BJ5 A;  1AQV A;  2XBI A;  2N5B A;  2DJ2 A;  4IQ1 A;  4AJ6 A;  1LJR A;  3BOA A;  3ZLP A;  2VUP A;  2K8S A;  3I69 A;  1GRX A;  2XBQ A;  3TRQ A;  1T4Z A;  2K18 A;  5F0G A;  6GST A;  5IO0 A;  5ECK B;  1K0M A;  1V58 A;  2HFD A;  3FW2 A;  1DBY A;  5DAK B;  3F6D A;  4ZL8 A;  2JZS A;  3F6F A;  2G0F A;  2KHP A;  5FWG A;  1ERT A;  2AJQ B;  4J57 E;  2RM5 A;  4F82 A;  1JZW A;  4BL7 B;  5JWR B;  4EC0 A;  4TXO B;  1F2E A;  2V6O A;  3W8J A;  1HNA A;  4ZBA A;  4V1A g;  1PMT A;  3TRP A;  1QK8 A;  1SYR A;  4V1A p;  1Z7R A;  1YZX A;  2H6Y A;  2CAI A;  3CTG A;  4MF6 A;  4XS6 A;  1ABA A;  2B5X A;  3PR8 A;  3GH6 A;  1TTZ A;  3LWA A;  2VLU A;  3E0U A;  4QQ7 A;  2ES7 A;  2B7K A;  1M2B A;  2VL9 A;  4OD7 A;  4GQF A;  3KZQ A;  4MMM A;  3ZVJ D;  1FW1 A;  1OC8 A;  3GIX A;  4MJA A;  3VWV A;  1A2J A;  2XPD A;  3TKS A;  3GHA A;  2M72 A;  1YF1 A;  1Z7P A;  4ZL9 A;  3U6V A;  4G19 A;  2YZH A;  4IHU A;  3I6A A;  3TKR A;  2P31 A;  4NAX A;  3KP8 A;  3HVX A;  1NM3 A;  3C71 A;  2FWE A;  2OA7 A;  1XCC A;  1EEM A;  3GV1 A;  1J0F A;  3FZ5 A;  3PIN A;  4OWY A;  5CP1 A;  4EF0 A;  4YAV A;  4HJM A;  3RDW A;  2KOK A;  3GA4 A;  1EOH A;  2I1U A;  4MJE A;  5ABR A;  4D73 B;  5C04 A;  3KIJ A;  3GKK A;  5ENU A;  1ACV A;  5FT3 A;  3FRC A;  5JCG A;  1C72 A;  5ECR B;  2FA4 A;  2HZF A;  3ERF A;  1AAZ A;  1PGT A;  2C0G A;  1BED A;  4F03 A;  1GSU A;  4K7N A;  2IL3 A;  5IMD A;  4WBJ A;  1GSF A;  1MDJ A;  1SU9 A;  2BTO T;  2TRX A;  3FR9 A;  4EVM A;  3GX8 A;  1HNB A;  1CQG A;  3OR5 A;  3KP9 A;  4X1U A;  1J08 A;  1M2D A;  1PRX A;  4NWY A;  4KH7 A;  1U6T A;  4TKY A;  1K0O A;  1YEP A;  2H01 A;  3J7Y b;  5KN3 A;  4QL9 A;  4EDY A;  1EOG A;  4IQA A;  1QGV A;  4CDO A;  3NZN A;  3MAK A;  3GFK A;  5D9W A;  2YWI A;  3IC8 A;  2PGT A;  3EU4 A;  4HU9 A;  3EU3 A;  2H1A A;  3M9J A;  2MMA A;  4BWQ A;  1WIK A;  4ZIL A;  1GLP A;  1XW5 A;  1T3B A;  4GWR A;  2ZCT A;  2E2M A;  2WDU A;  4GCI A;  3VI5 A;  5CRE A;  2YV7 A;  5J5N A;  1TRV A;  2IFQ B;  1CQH A;  4CW9 A;  4N10 A;  4MF7 A;  1YY7 A;  1NW2 A;  13GS A;  2VM2 A;  1G6Y A;  1SYX A;  1XIY A;  3D21 A;  5LNK e;  3FZ4 A;  1OE7 A;  2LST A;  3RPP A;  1S3C A;  2HZE B;  4MJC A;  2H73 A;  2L5O A;  1TRW A;  4HU7 A;  3G9B A;  3KEB A;  5EY6 A;  2V41 A;  2QKE A;  1GSE A;  2H19 A;  3VI7 A;  1RK4 A;  1XOB A;  1EGO A;  2LEG A;  4K2D A;  2V1M A;  1OC9 A;  3ZZX A;  5D96 A;  3DML A;  1TK0 B;  3F0I A;  3M3M A;  2IJY A;  4ILF A;  2P5R A;  5ECP B;  4PQI A;  4X0X A;  3DGQ A;  4N0V A;  2H0H A;  3QDN A;  1ERW A;  17GS A;  3VLN A;  6GSU A;  2AAW A;  3UL3 A;  2B5E A;  2A4V A;  3CTF A;  2PUK C;  1JZO A;  1Z5Y E;  3HVS A;  5H5R A;  1O85 A;  1WRY A;  4ECI A;  4ZB9 A;  5G5F A;  3UAR A;  2PMT A;  5IMV A;  2DIZ A;  2C0D A;  2GVP A;  4HQS A;  2H1B A;  3JCM L;  2LJR A;  4GSS A;  2LRN A;  2FHE A;  2NBS A;  1M99 A;  2MBT A;  1ZL9 A;  5DAL B;  2E7P A;  3VUR A;  2L4C A;  1BAY A;  2WJU A;  1B8X A;  1VF2 A;  2IME A;  1HQO A;  5HR2 A;  1X9S B;  3HDC A;  3CBU A;  3LEF A;  1VGL A;  1TDI A;  3IOS A;  3ZML A;  1JFU A;  4GRF A;  5A4V A;  1V2A A;  2GQL A;  6GSY A;  3LXT A;  2MYG A;  4K6X A;  4AJ7 A;  6GSS A;  4YAP A;  4I6X A;  2YPM A;  5COH A;  4EL1 A;  2H72 A;  5ECQ B;  1YQ1 A;  4GF0 A;  1QXH A;  4XRA A;  1Y25 A;  2F8A A;  4EO3 A;  2BMX A;  3F8U A;  1XWG A;  4MA9 A;  2JL4 A;  3FR6 A;  4YQV A;  2HRN A;  1G6W A;  1GTU A;  1NHO A;  4O32 A;  3CXG A;  3UIW A;  2I3Y A;  3SWL A;  4G0I A;  1TRU A;  3HYP A;  3TJF A;  1ZCP A;  4NMU A;  4E8E A;  4F0B A;  3I9V 2;  4GXZ A;  3IHQ A;  1X5C A;  2AB6 A;  3IDV A;  4ZB6 A;  2RII A;  5CO3 A;  1HYU A;  2FNO A;  1EV9 A;  2FWF A;  3TOU A;  1WWJ A;  3KCM A;  1NHY A;  5G5E A;  4L5O A;  3FZA A;  5DJL A;  5HR1 A;  2AUV A;  2DJ1 A;  2DMM A;  2NTO A;  4I97 A;  1VF3 A;  2DJ0 A;  2R3X A;  4F9Z A;  3WGE A;  4PQH A;  4DSR A;  1T1V A;  1V40 A;  4WEY A;  5INY A;  3GRX A;  2CQ9 A;  3HJP A;  1SD9 A;  10GS A;  2XPE A;  2H76 A;  3ZRE A;  1DE2 A;  2LNS A;  1SKS B;  4K0G A;  1DUG A;  2EIR A;  2F3M A;  1SEN A;  2L59 A;  1QFN A;  2LUS A;  3S9F A;  3IE3 A;  3FK8 A;  4ZL7 A;  1XW6 A;  2WS2 A;  2OE3 A;  1B9Y C;  1YKA A;  3ZIT A;  3TJK A;  1GNE A;  2KP1 A;  4IJI A;  4IS0 A;  4WR5 A;  4FIW A;  1XPV A;  1YJ6 A;  5HR0 A;  4KB3 A;  4N11 A;  14GS A;  2XC2 A;  4EKZ A;  1GSY A;  1G7O A;  3DVX A;  3DEX A;  3D5J A;  2B1K A;  5B7C A;  1F37 A;  3ZVJ A;  5DJM A;  3WT1 A;  1M7T A;  4HQZ A;  4F0C A;  4J56 E;  1A0F A;  3VWX A;  3UEM A;  1MDI A;  2GZP A;  3N5O A;  4FYC A;  3CMI A;  1U3I A;  3MSZ A;  4MZW A;  5BMU A;  1XWC A;  5KN0 A;  3EMP A;  2VAF A;  3QFB C;  2A2S A;  3LSZ A;  5F07 A;  1TOF A;  2LNT A;  3CYN A;  5IQY A;  2LJA A;  4ZBD A;  2VL2 A;  5G31 A;  3F4R A;  2X8G A;  3KTL A;  3DVW A;  1FB0 A;  4CHS A;  5JWO B;  4JZQ A;  2B7J A;  3L9V A;  2YCD A;  3WD6 A;  2DSA A;  3W8S A;  1A23 A;  5B8B A;  5IMC A;  3MWH A;  1SK0 A;  1EV4 A;  1IYI A;  3ZRD A;  4RUV A;  2P0G A;  4I2T A;  1A8Y A;  2VCT A;  4AGS A;  1GTA A;  3FY7 A;  5IOX A;  5H5S A;  4KGI A;  5HFK A;  3EIN A;  4MZB A;  3RHC A;  3GNJ A;  4EDZ A;  4OMV A;  3ED3 A;  4GQC A;  1ZYE A;  5J9B A;  3FZ9 A;  2B6M A;  3LXZ A;  3K8N A;  5IMA A;  5HQP A;  1ERV A;  4TVE A;  4KCA A;  1GNW A;  19GS A;  3IAS 2;  5HFI A;  2PN8 A;  4BVX B;  5DDL A;  2H1G A;  5B6M A;  3HJO A;  1ZGN A;  3CSI A;  4WET A;  1U87 A;  4L8E A;  5ECI B;  3LYP A;  2H0G A;  2CZ2 A;  2HSM A;  4Q5R A;  1Z6N A;  1GL8 A;  4YQU A;  2BJX A;  6GSV A;  4TOP A;  2WB9 A;  2K8V A;  5J41 A;  5LCZ A;  5GAP D;  2A2R A;  4PXO A;  3APO A;  4NHW A;  3FR3 A;  4GLT A;  5AN1 A;  3QFA C;  2YJ7 A;  4PUF C;  2B1L A;  2GZY A;  2RM6 A;  2XHF A;  5L71 A;  1N2A A;  3HY2 A;  1PA3 A;  4ZB8 A;  2NDO A;  4RI7 A;  1FHE A;  2Z9S A;  2L6D A;  4OO4 A;  3ZIV A;  1X5D A;  2GLR A;  4YH2 A;  5E4W A;  3D6I A;  3EUR A;  2C1Y A;  3CSJ A;  3APQ A;  5ELA A;  1GWC A;  3DWV A;  2YN1 A;  4LMV A;  1TI3 A;  3QAV A;  4AJ8 A;  1A0R P;  4X43 A;  2HRK B;  5C00 A;  1Z3E A;  3F3R A;  3H4K A;  3TGZ A;  1SK2 A;  2YJH A;  5B8A A;  2OKA A;  2PPT A;  2IMK A;  3D0Z A;  3VPT A;  2LRT A;  3TKQ A;  2HLS A;  1SKR B;  4K9Z A;  4ML6 A;  2HRA A;  3ZL5 A;  1IYH A;  2HSY A;  1SKW B;  3UMA A;  4WKW A;  4DSS B;  4IEL A;  1FOV A;  5CRW A;  22GS A;  4OCE A;  5DCG A;  4LLR A;  2C4J A;  2HSN B;  1H4O A;  3EYT A;  5G1K A;  1KEB A;  2V32 A;  4ULX A;  1VF1 A;  4PX1 A;  1R4W A;  2JZR A;  1KNG A;  4LA1 A;  1G0T A;  1JLW A;  5DAK A;  3J7Y k;  5EVO A;  2N5A A;  4E8H A;  2V6K A;  5IMZ A;  5DQY A;  5ID2 B;  2VCV A;  2CAQ A;  2VO4 A;  1XOA A;  3EVI A;  3TJB A;  4BL7 A;  1V98 A;  4TXO A;  4HJ2 A;  1U3A A;  2K6V A;  1M9B A;  4POB A;  4IJ3 A;  2R5G A;  1B4Q A;  2IN3 A;  16GS A;  3HJM A;  2LRC A;  3CRT A;  4JR4 A;  1PN9 A;  2YOI A;  4V2M A;  6GSW A;  2GT5 A;  2FLS A;  3FEU A;  4JR6 A;  3C8E A;  2FD3 A;  2ON5 A;  2PER A;  3RHB A;  2AV4 A;  4NPB A;  2C0E A;  2L57 A;  5HR3 A;  1W4V A;  2HXK A;  4KSM A;  20GS A;  1T00 A;  3C7M A;  4V2N A;  3DKS A;  3Q18 A;  1XZO A;  5CAX A;  1GSQ A;  3UVT A;  1A24 A;  5G2Z A;  2H71 A;  2C3T A;  4GTU A;  2X99 A;  5G30 A;  3IAM 2;  2DJK A;  3GUS A;  4TN8 A;  3KH9 A;  4ZXG A;  3D4T A;  2OBK A;  1BG5 A;  4USS A;  3O3T A;  2C0F A;  1GUM A;  2X8C A;  4JED A;  1J9B A;  2E2G A;  2O89 A;  1TKD B;  5IIZ A;  3O76 A;  2R2J A;  4HI7 A;  4FYU A;  3WGD A;  4D73 A;  3IPZ A;  3TCO A;  4O92 A;  4POM A;  4KF9 A;  3TUE A;  3LOR A;  1XFL A;  2GQM A;  2H30 A;  1GUK A;  4BVY B;  1OAZ A;  3ZTL A;  5JWQ B;  1SJ6 A;  1T4Y A;  1GUH A;  1XBS A;  5GZZ B;  4OFN A;  4ECC A;  1BQ7 A;  2PVO C;  5AGY A;  2DJJ A;  1A8L A;  3EWL A;  4L5L A;  1R5A A;  3C1R A;  3QR6 A;  2L4Q A;  3L78 A;  3F3Q A;  4ML1 A;  4GSN A;  3QMX A;  4JBB A;  4FYB A;  3TOT A;  3GKM A;  3ERW A;  1LBK A;  1I9D A;  1ERU A;  1AXD A;  4LMW A;  3H1N A;  4IN0 A;  1BX9 A;  4Q5N A;  2IPA A;  3DRN A;  9GSS A;  3SBC A;  5ECL B;  3HA9 A;  3IRA A;  2MBS A;  4DSQ A;  4XS4 B;  4GST A;  4MCU A;  2RLI A;  4MJB A;  2JZT A;  1WJK A;  1PKZ A;  2NVL A;  3TJJ A;  3KGK A;  1R7H A;  1G7E A;  1QQ2 A;  1PL2 A;  4V2L A;  2MMZ A;  1XW9 A;  2FA8 A;  2GTU A;  3GTU B;  2O8V B;  3GYK A;  4PQ1 A;  1THO A;  1F6M C;  3W6G A;  5FHI A;  2X8H A;  5D9V A;  2YWO A;  2MMN A;  3F4T A;  2IFQ A;  3NIV A;  1QMV A;  3UVH A;  3M1G A;  3UAP A;  4XHM A;  5D73 A;  1ON4 A;  3UOM A;  3QAG A;  3HD5 A;  4EE0 A;  1PQN A;  4WXT A;  1TK5 B;  2CV4 A;  3MDK A;  3RAZ A;  3KH7 A;  3AY8 A;  4HDE A;  2H8L A;  2GSQ A;  1OC3 A;  3HVV A;  1FVJ A;  3TKP A;  5HFG A;  5CRD A;  3LG6 A;  2HZE A;  3GL5 A;  1O6J A;  1WPI A;  3PH9 A;  2VIM A;  3ERG A;  3F4S A;  1PL1 A;  3US3 A;  1OKD A;  4PNG A;  3U5R E;  1RW1 A;  1XWK A;  1XVQ A;  5J3R A;  3F9U A;  1M2A A;  2H66 A;  3P8W A;  2FGX A;  2QGV A;  5GAN D;  4K1F A;  4TRX A;  4RI6 A;  3QD9 A;  3FKF A;  5E59 A;  3GX0 A;  3LFL A;  2GS3 A;  2RUF A;  2REM A;  5D8I A;  1GTB A;  2LJK A;  2WFC A;  2WUL A;  3L4N A;  4KSO A;  8GSS A;  4JU5 A;  2CX3 A;  2DIY A;  4HZ4 A;  2PWJ A;  3VPQ A;  1Q98 A;  4LL1 B;  4O7H A;  2YP6 A;  3GMF A;  4MPG A;  1HD2 A;  3IXR A;  3RPN A;  4FO5 A;  4WBR D;  3BCI A;  1F3B A;  2UZ8 A;  5IOW A;  4ZIJ A;  4YQM A;  2EIO A;  4RQX A;  5AIV A;  1AUC A;  1R26 A;  3GH9 A;  2C3Q A;  1SJI A;  1K3L A;  4LL4 B;  3CRU A;  4BPY A;  1X9M B;  2GZZ A;  3R3E A;  4IVF A;  4XCS A;  4MH2 A;  1GUL A;  4XTS A;  3TKS C;  4ID0 A;  4Q5F A;  1X9W B;  1O81 A;  4KW6 A;  3IC4 A;  1MTC A;  3C1S A;  3IV4 A;  1TU8 A;  3D4M A;  1T8E B;  1K0A A;  1K0D A;  1GP1 A;  2O87 A;  4XIH A;  5GST A;  4IP1 A;  2LQQ A;  4N30 A;  4EUY A;  2TIR A;  1ILO A;  4PGT A;  2LQO A;  2IMI A;  3IBH A;  1RQM A;  3KJY A;  3DXB A;  5A4U A;  3BCK A;  3F63 A;  1H75 A;  4TR3 A;  11GS A;  12GS A;  2L6C A;  1ZZY A;  2KP2 A;  2J9H A;  3ZMK A;  4K8M A;  2ZUP A;  3EMX A;  3V1W A;  4KND A;  1THX A;  1B9X C;  3LYK A;  3PGT A;  2J23 A;  4PTS A;  3ISO A;  1YKC A;  4NV5 A;  2OE1 A;  5JCU A;  2VCW A;  3P7X A;  1OKT A;  3QAW A;  2HNL A;  4L0U A;  4KX4 A;  2HE3 A;  4WF4 A;  3LJR A;  1GLQ A;  2O7K A;  1SK1 A;  4JE1 A;  1EZK A;  2DC5 A;  4TXV A;  1V57 A;  2AYT A;  4IGJ A;  5DQS A;  3ZYW A;  2VCZ A;  2B5Y A;  2ZNM A;  1QUW A;  5ECM B;  4KDU A;  1AIU A;  2CVD A;  1TU7 A;  3L9U A;  5G1L A;  3IK7 A;  3A3T A;  4G0K A;  3GST A;  5ECO B;  3KD0 A;  3A5W A;  1EEJ A;  3GUR A;  4POK A;  4KCE A;  1V9W A;  2CVK A;  5D93 A;  1R5P A;  4HEA 2;  4PUR A;  2HYX A;  4ACS A;  1VRS D;  1UC7 A;  4L0W A;  4QL7 A;  2R4V A;  3IR4 A;  3KXO A;  1GTI A;  2JSY A;  4MPF A;  2CA8 A;  2HI7 A;  2ON7 A;  3KMN A;  1AQW A;  1ML6 A;  3P2A A;  1OC9 B;  2YWN A;  4BA7 A;  1M0U A;  1MD4 A;  2IMD A;  2P5Q A;  4TR1 A;  1TP9 A;  2YNX A;  4J2F A;  1Z6M A;  3H8Q A;  5CNW A;  2C80 A;  3KM6 A;  1B48 A;  2LV3 A;  2N5F A;  4OO5 A;  2WGR A;  4ECB A;  6GSX A;  4IBP A;  4K0N A;  1TI1 A;  1GSS A;  3VWU A;  5AIX A;  2H1D A;  2PBJ A;  3WGX A;  3MNG A;  3A2X A;  2YAN A;  1VF4 A;  2EIQ A;  1KTE A;  1ZMA A;  2QSI A;  4F2I A;  1DSB A;  3QOU A;  1YF0 A;  4HUA A;  2H0I A;  1K3Y A;  1E2Y A;  3IK9 A;  2PU9 C;  1UA5 A;  4HOJ A;  3KTB A;  1Q4J A;  4KE3 A;  5IMF A;  1DE1 A;  3O6T A;  3Q6O A;  4OFT A;  1JZR A;  5DCH A;  2GDR A;  2PVQ A;  1K0N A;  3M8N A;  3TJG A;  2RUE A;  4K7O A;  1XWA A;  3D22 A;  2VCX A;  2X64 A;  2OJL A;  4WF5 A;  3GKN A;  3BBY A;  3H79 A;  3HZ8 A;  3G7J A;  2C3N A;  1OVN A;  1SJZ A;  1K0B A;  3VFI A;  1I5G A;  1EP8 A;  3EE2 A;  2VD0 A;  1AQX A;  4MAB A;  1PX6 A;  1PKW A;  2C8U A;  1S3D A;  1KBN A;  1SL1 B;  4BVX A;  4OFM A;  1OYJ A;  2GSR A;  1MEK A;  4RQR A;  2JU5 A;  4Z7X A;  3UBL A;  3HZ4 A;  3ZFL A;  1A2L A;  2WRT A;  4MZC A;  1O7U A;  1SL0 B;  3APS A;  3HHV A;  1X0R A;  3A2W A;  3UJ1 A;  3Q19 A;  1TJD A;  5GSS A;  4HZ2 A;  2E0Q A;  5EPF A;  1BJX A;  3N9J A;  2H70 A;  4EXJ A;  2HRF A;  3RBT A;  2O85 A;  3M0F A;  1E6B A;  2R6K A;  5IM9 A;  2FWG A;  3TDG A;  4TW5 A;  1USB A;  4FQU A;  5A5K A;  3ZIJ A;  2CX4 A;  2IWT A;  1URM A;  2AHE A;  2K9F A;  4POL A;  1TRS A;  2JAC A;  4KDX A;  1EGR A;  4MH3 A;  1TK8 B;  4FH8 A;  1WMJ A;  4NHZ A;  1UN2 A;  1O8W A;  3E9J B;  1O73 A;  4JRR A;  1B4P A;  3VK9 A;  1Y6E A;  2HRK A;  4NV2 A;  1GSD A;  5D9X A;  2VM1 A;  2FCH A;  1JLV A;  4ISD A;  1WE0 A;  3UBK A;  1S3A A;  1FVK A;  2OE0 A;  1WOU A;  3ME8 A;  3A2V A;  1XWB A;  2VCQ A;  3EC3 A;  1EWX A;  2GQK A;  4MDC A;  1JZD A;  2M80 A;  5J9C A;  5IPH A;  1ST9 A;  3GN3 A;  2OAC A;  3VWW A;  2R37 A;  4DSS A;  5IO2 A;  3E3E A;  3KMO A;  2H75 A;  5J4U A;  2F8F A;  3R2Q A;  5ECH B;  4MF5 A;  1JHB A;  2LTK A;  3GL3 A;  1FO5 A;  4K7I A;  2FUG 2;  1ZOF A;  5CRG A;  5EL8 A;  2VD1 A;  4G9H A;  2DJ3 A;  2KUC A;  4IW9 A;  5LD0 A;  2I9H A;  3PPU A;  3HXS A;  4PUA A;  2B3S A;  1GH2 A;  1WP0 A;  2IIY A;  3G7Y A;  5ID2 A;  3HKR A;  4HS1 A;  5CRH A;  1MDK A;  1U88 A;  1F9M A;  4I2U A;  1ZYQ B;  1K0C A;  5KN1 A;  3WYW A;  3P90 A;  2DML A;  3WT2 A;  4OCF A;  2IMF A;  2FWH A;  2GSS A;  1SD8 A;  2DBC A;  2TRC P;  3G7I A;  3H93 A;  2G2Q A;  2VL2 C;  2VOC A;  3FHK A;  2CZ3 A;  2I81 A;  5DBQ A;  1FG4 A;  7GSS A;  1W89 A;  2YWM A;  1A2M A;  4Q5Q A;  1M9A A;  3GSS A;  4KA0 A; 
#chains in the Genus database with same CATH topology
 1K3O A;  2LS5 A;  1ZYP A;  5CYY A;  2FY6 A;  1Z9H A;  18GS A;  3Q74 A;  4DEJ A;  5IPG A;  4ECJ A;  2D2Z A;  3L9S A;  2F9S A;  4TR0 A;  2LKU A;  2NPB A;  3CSH A;  3FYG A;  3TKS E;  4WR4 A;  3M9K A;  2VLT A;  3ME7 A;  3MIX A;  1AC1 A;  4DVC A;  2QC7 A;  2JSZ A;  1SL2 B;  4XS1 A;  2CT6 A;  4YKF A;  1AW9 A;  3L0H A;  5ECN B;  4N0Z A;  2GST A;  2WZS A;  1XVW A;  3TRX A;  4G10 A;  3C73 A;  1ZYN A;  1OE8 A;  5DVB A;  5B6N A;  5JCW A;  3IA1 A;  4KDY A;  4H86 A;  2HQT A;  4IKH A;  1HNC A;  3NOF A;  1PX7 A;  1YEX A;  3QCP A;  4KUN A;  4NXI A;  2DLX A;  2ALB A;  1F3A A;  2HSM B;  4IP6 A;  3TB2 A;  4BVY A;  1EP7 A;  3DYR A;  2F51 A;  1PD2 1;  3LGC A;  5F05 A;  5A1N A;  1TXX A;  2GGT A;  3HCZ A;  1BYE A;  2YZU A;  5ELG A;  2MMO A;  1MD3 A;  4PNF A;  2VLV A;  4TR4 A;  3RGB C;  4XRD A;  1FAA A;  2MZC A;  2V2G A;  2GT6 A;  4G0L A;  2I4A A;  4PHZ C;  2M46 A;  5DAL A;  4I8B A;  3DD3 A;  4BWS A;  4MP4 A;  2H6X A;  4KAE A;  4MLY A;  3DIE A;  2R0P A;  1YDK A;  2WCI A;  2H6Z A;  4P3Y B;  4ZBB A;  2EC4 A;  4XS4 A;  2OBI A;  3BD2 A;  5F8B A;  2DKH A;  1PSQ A;  2WVX A;  3RFR C;  1O8X A;  2WZ9 A;  1T7P B;  4TR1 B;  3GKX A;  2VL3 A;  2JAD A;  2H74 A;  3CHX C;  1PN0 A;  3LQ7 A;  3I43 A;  1LU4 A;  5KN2 A;  5ECS A;  3GTU A;  4O5R A;  4I5Q A;  2KLX A;  1XG8 A;  1X5E A;  5H5Q A;  1UVZ A;  2CVB A;  2YV9 A;  5KEJ A;  5F06 A;  5A4W A;  2L5L A;  4MK3 A;  1N8J A;  1XXU A;  5AIS A;  2HSH A;  2OAD A;  5D9T A;  1NSW A;  1FB6 A;  4AF2 A;  3QPM A;  2HT9 A;  4G2E A;  3ZFB A;  3BJ5 A;  1AQV A;  2XBI A;  2N5B A;  2DJ2 A;  4IQ1 A;  4AJ6 A;  1LJR A;  3BOA A;  4AKI A;  3ZLP A;  2VUP A;  2K8S A;  3I69 A;  1GRX A;  2XBQ A;  3TRQ A;  1T4Z A;  2K18 A;  5F0G A;  6GST A;  5IO0 A;  5ECK B;  1K0M A;  1V58 A;  2HFD A;  3FW2 A;  1DBY A;  5DAK B;  3F6D A;  4ZL8 A;  2JZS A;  3F6F A;  2G0F A;  2KHP A;  5FWG A;  1ERT A;  2AJQ B;  4J57 E;  2RM5 A;  4F82 A;  1JZW A;  4BL7 B;  5JWR B;  4EC0 A;  4TXO B;  1F2E A;  2V6O A;  3W8J A;  1HNA A;  4ZBA A;  4V1A g;  1PMT A;  4CY8 A;  3TRP A;  1QK8 A;  1SYR A;  4V1A p;  1Z7R A;  1YZX A;  1S4B P;  2H6Y A;  2CAI A;  3CTG A;  4MF6 A;  4XS6 A;  1ABA A;  2B5X A;  3PR8 A;  3GH6 A;  1TTZ A;  3LWA A;  2VLU A;  3E0U A;  2O36 A;  4QQ7 A;  2ES7 A;  2B7K A;  1M2B A;  2VL9 A;  4OD7 A;  4GQF A;  3KZQ A;  4MMM A;  3ZVJ D;  1FW1 A;  1OC8 A;  3GIX A;  4MJA A;  3VWV A;  1A2J A;  2XPD A;  3TKS A;  3GHA A;  2M72 A;  1YF1 A;  1Z7P A;  4ZL9 A;  3U6V A;  3HMJ G;  4G19 A;  2YZH A;  4IHU A;  3I6A A;  3TKR A;  4Z2U A;  2P31 A;  4NAX A;  3KP8 A;  3HVX A;  1NM3 A;  3C71 A;  2FWE A;  2OA7 A;  1XCC A;  1EEM A;  3GV1 A;  1J0F A;  3FZ5 A;  2EFC A;  3PIN A;  4OWY A;  5CP1 A;  4EF0 A;  4YAV A;  4HJM A;  3RDW A;  3GA4 A;  2KOK A;  2QA2 A;  1EOH A;  2I1U A;  4MJE A;  5ABR A;  4D73 B;  5C04 A;  3KIJ A;  3GKK A;  5ENU A;  1ACV A;  5FT3 A;  3FRC A;  5JCG A;  1C72 A;  5ECR B;  2FA4 A;  2HZF A;  3ERF A;  1AAZ A;  1PGT A;  2C0G A;  1BED A;  4F03 A;  1GSU A;  4K7N A;  2IL3 A;  5IMD A;  4WBJ A;  1GSF A;  1MDJ A;  1SU9 A;  2BTO T;  2TRX A;  3FR9 A;  4EVM A;  3GX8 A;  1S3R A;  1HNB A;  1CQG A;  3OR5 A;  2A4H A;  3KP9 A;  4X1U A;  1J08 A;  1M2D A;  1PRX A;  3A5I A;  4NWY A;  4KH7 A;  1U6T A;  4TKY A;  4PI0 C;  1K0O A;  1YEP A;  2H01 A;  3J7Y b;  5KN3 A;  4QL9 A;  4EDY A;  1EOG A;  4IQA A;  1QGV A;  4CDO A;  3NZN A;  3MAK A;  3GFK A;  2A2P A;  5D9W A;  2YWI A;  2DKI A;  3IC8 A;  2PGT A;  3EU4 A;  4HU9 A;  3EU3 A;  2H1A A;  3M9J A;  2MMA A;  4BWQ A;  1WIK A;  4ZIL A;  1GLP A;  1XW5 A;  1T3B A;  4GWR A;  2ZCT A;  2E2M A;  2WDU A;  4GCI A;  3VI5 A;  5CRE A;  2YV7 A;  5J5N A;  1TRV A;  2IFQ B;  1CQH A;  4CW9 A;  4N10 A;  4MF7 A;  1YY7 A;  1NW2 A;  13GS A;  2VM2 A;  1G6Y A;  1SYX A;  1XIY A;  3D21 A;  3FMW A;  5LNK e;  3FZ4 A;  1OE7 A;  2LST A;  3RPP A;  1S3C A;  2HZE B;  4MJC A;  2H73 A;  2L5O A;  1TRW A;  4HU7 A;  3G9B A;  3KEB A;  5EY6 A;  1M3I A;  2V41 A;  2QKE A;  1GSE A;  2H19 A;  3VI7 A;  1RK4 A;  1XOB A;  3LW9 A;  1EGO A;  2LEG A;  4K2D A;  2V1M A;  1OC9 A;  3ZZX A;  5D96 A;  3DML A;  1TK0 B;  3F0I A;  3M3M A;  2IJY A;  4ILF A;  2P5R A;  5ECP B;  4PQI A;  4X0X A;  3DGQ A;  2WW3 A;  4N0V A;  2H0H A;  3QDN A;  1ERW A;  17GS A;  3VLN A;  6GSU A;  2AAW A;  3UL3 A;  2B5E A;  2A4V A;  3CTF A;  2PUK C;  1JZO A;  1Z5Y E;  3HVS A;  2X49 A;  5H5R A;  3CWG A;  1O85 A;  1WRY A;  4ECI A;  4ZB9 A;  5G5F A;  3UAR A;  2PMT A;  5IMV A;  2DIZ A;  2C0D A;  2GVP A;  4HQS A;  2H1B A;  3JCM L;  2LJR A;  4GSS A;  2LRN A;  2FHE A;  2NBS A;  1M99 A;  2MBT A;  1ZL9 A;  5DAL B;  2E7P A;  3VUR A;  2L4C A;  1BAY A;  2WJU A;  4BIK A;  1B8X A;  1VF2 A;  2IME A;  1HQO A;  5HR2 A;  1X9S B;  3HDC A;  3CBU A;  2WVY A;  3LEF A;  4E68 A;  1VGL A;  4EIP A;  1TDI A;  3IOS A;  3ZML A;  1JFU A;  4GRF A;  5A4V A;  1V2A A;  2GQL A;  6GSY A;  3LXT A;  2MYG A;  4K6X A;  4AJ7 A;  6GSS A;  4YAP A;  4I6X A;  2YPM A;  5COH A;  4EL1 A;  2H72 A;  5ECQ B;  2O3E A;  1YQ1 A;  4GF0 A;  2R0C A;  1QXH A;  4XRA A;  1Y25 A;  2EFD A;  2F8A A;  4EO3 A;  2BMX A;  3F8U A;  1XWG A;  4MA9 A;  2JL4 A;  3FR6 A;  4YQV A;  2HRN A;  1G6W A;  1GTU A;  1NHO A;  4O32 A;  3CXG A;  3UIW A;  2I3Y A;  3SWL A;  4G0I A;  1TRU A;  3HYP A;  3TJF A;  1ZCP A;  4NMU A;  4E8E A;  4F0B A;  3I9V 2;  4GXZ A;  3IHQ A;  1X5C A;  2AB6 A;  3IDV A;  4ZB6 A;  4O5U A;  2RII A;  3MYD A;  5CO3 A;  1HYU A;  2FNO A;  1EV9 A;  2FWF A;  3TOU A;  1WWJ A;  4YKG A;  3KCM A;  1NHY A;  5G5E A;  4L5O A;  3FZA A;  5DJL A;  5HR1 A;  5J40 A;  2AUV A;  2DJ1 A;  2DMM A;  2NTO A;  4I97 A;  1VF3 A;  2DJ0 A;  2R3X A;  4F9Z A;  3WGE A;  4PQH A;  4DSR A;  1T1V A;  1V40 A;  4WEY A;  5INY A;  3GRX A;  2CQ9 A;  3HJP A;  1SD9 A;  10GS A;  2XPE A;  2H76 A;  3ZRE A;  1DE2 A;  2LNS A;  1SKS B;  4K0G A;  1DUG A;  2EIR A;  2F3M A;  1SEN A;  2L59 A;  1QFN A;  2LUS A;  3S9F A;  3IE3 A;  3FK8 A;  4ZL7 A;  1XW6 A;  2WS2 A;  2OE3 A;  2X4A A;  1B9Y C;  1YKA A;  3ZIT A;  3TJK A;  4AKX B;  1GNE A;  5A5H A;  2KP1 A;  4IJI A;  4IS0 A;  4WR5 A;  4FIW A;  1XPV A;  1YJ6 A;  5HR0 A;  4KB3 A;  4N11 A;  14GS A;  2XC2 A;  4EKZ A;  2WW0 A;  1GSY A;  1G7O A;  3DVX A;  3DEX A;  3D5J A;  2B1K A;  5B7C A;  1F37 A;  3ZVJ A;  5DJM A;  3WT1 A;  1M7T A;  4HQZ A;  4F0C A;  4J56 E;  1A0F A;  3VWX A;  3UEM A;  1MDI A;  2GZP A;  3N5O A;  4FYC A;  2WW2 A;  3CMI A;  1U3I A;  3MSZ A;  4MZW A;  5BMU A;  1XWC A;  5KN0 A;  3EMP A;  2VAF A;  3QFB C;  2A2S A;  3LSZ A;  5F07 A;  1TOF A;  2LNT A;  3CYN A;  5IQY A;  2LJA A;  4ZBD A;  2VL2 A;  5G31 A;  3F4R A;  2X8G A;  3KTL A;  3DVW A;  1FB0 A;  4CHS A;  5JWO B;  4JZQ A;  2B7J A;  3L9V A;  2YCD A;  3WD6 A;  2DSA A;  3W8S A;  1A23 A;  4ZB7 A;  5B8B A;  5IMC A;  3MWH A;  1SK0 A;  1EV4 A;  1IYI A;  3ZRD A;  4RUV A;  2P0G A;  4I2T A;  1A8Y A;  2VCT A;  4AGS A;  1GTA A;  3FY7 A;  5IOX A;  2UV8 G;  5H5S A;  4KGI A;  5HFK A;  5BRT A;  3EIN A;  4MZB A;  3RHC A;  3GNJ A;  4EDZ A;  5J4V A;  4OMV A;  3ED3 A;  4GQC A;  1ZYE A;  5J9B A;  3FZ9 A;  2B6M A;  3LXZ A;  3K8N A;  5IMA A;  5HQP A;  1ERV A;  4TVE A;  4KCA A;  1GNW A;  19GS A;  3IAS 2;  5HFI A;  2PN8 A;  4BVX B;  5DDL A;  2H1G A;  5A34 A;  5B6M A;  3HJO A;  1ZGN A;  3CSI A;  4WET A;  1U87 A;  4L8E A;  5ECI B;  3LYP A;  2H0G A;  2CZ2 A;  2HSM A;  2QA1 A;  4Q5R A;  1Z6N A;  1GL8 A;  4YQU A;  2BJX A;  6GSV A;  4TOP A;  2WB9 A;  2K8V A;  5J41 A;  1BG1 A;  5LCZ A;  3TU3 B;  5GAP D;  2A2R A;  4PXO A;  3APO A;  4NHW A;  3FR3 A;  4GLT A;  5AN1 A;  3QFA C;  2YJ7 A;  4PUF C;  2B1L A;  2GZY A;  2RM6 A;  2XHF A;  5L71 A;  1N2A A;  3HY2 A;  1FOH A;  1PA3 A;  4ZB8 A;  2NDO A;  4RI7 A;  1FHE A;  2Z9S A;  2L6D A;  4OO4 A;  3ZIV A;  1X5D A;  2GLR A;  4YH2 A;  5E4W A;  3D6I A;  3EUR A;  2C1Y A;  3CSJ A;  3APQ A;  5ELA A;  1GWC A;  3DWV A;  2YN1 A;  4LMV A;  1TI3 A;  3QAV A;  4AJ8 A;  1A0R P;  4X43 A;  2HRK B;  5C00 A;  1Z3E A;  3F3R A;  3H4K A;  3TGZ A;  1SK2 A;  2YJH A;  2O5V A;  5B8A A;  2OKA A;  2PPT A;  2IMK A;  3D0Z A;  1TXU A;  3VPT A;  2LRT A;  3TKQ A;  2OT3 A;  2HLS A;  1SKR B;  4K9Z A;  4ML6 A;  2HRA A;  2WVZ A;  3ZL5 A;  1IYH A;  2HSY A;  1SKW B;  3UMA A;  4WKW A;  4DSS B;  4IEL A;  1FOV A;  5CRW A;  22GS A;  4OCE A;  5DCG A;  4LLR A;  2C4J A;  2HSN B;  1H4O A;  3EYT A;  5G1K A;  1KEB A;  2V32 A;  4ULX A;  1VF1 A;  4PX1 A;  1R4W A;  2JZR A;  1KNG A;  4LA1 A;  1G0T A;  1JLW A;  5DAK A;  3J7Y k;  1SVL A;  5EVO A;  2N5A A;  4E8H A;  2V6K A;  5IMZ A;  5DQY A;  5ID2 B;  2VCV A;  2CAQ A;  2VO4 A;  1XOA A;  3EVI A;  3TJB A;  4BL7 A;  1V98 A;  4TXO A;  4HJ2 A;  1U3A A;  2K6V A;  1M9B A;  4POB A;  4IJ3 A;  2R5G A;  1B4Q A;  2IN3 A;  16GS A;  3HJM A;  2LRC A;  3CRT A;  4JR4 A;  1PN9 A;  2YOI A;  4V2M A;  6GSW A;  5J47 A;  2FLS A;  2GT5 A;  3FEU A;  4JR6 A;  3C8E A;  4QMK A;  2FD3 A;  2ON5 A;  2PER A;  3RHB A;  2AV4 A;  4NPB A;  2C0E A;  4K5R A;  2L57 A;  5HR3 A;  1W4V A;  2HXK A;  4KSM A;  20GS A;  1T00 A;  3C7M A;  4V2N A;  3DKS A;  3Q18 A;  1XZO A;  5CAX A;  1GSQ A;  3UVT A;  1A24 A;  5G2Z A;  2H71 A;  2C3T A;  1YVL A;  4GTU A;  2X99 A;  5G30 A;  3IAM 2;  2DJK A;  3GUS A;  4TN8 A;  3KH9 A;  4ZXG A;  3D4T A;  2OBK A;  1BG5 A;  4USS A;  3O3T A;  2C0F A;  1GUM A;  2X8C A;  4JED A;  1J9B A;  2E2G A;  2O89 A;  1TKD B;  5IIZ A;  3O76 A;  2EFE A;  2R2J A;  4HI7 A;  4FYU A;  3WGD A;  4D73 A;  3IPZ A;  3TCO A;  4O92 A;  4POM A;  4KF9 A;  3TUE A;  1XFL A;  2GQM A;  2H30 A;  3LOR A;  1GUK A;  4BVY B;  1OAZ A;  4X4J A;  3ZTL A;  5JWQ B;  5A1N B;  1SJ6 A;  1T4Y A;  1GUH A;  1XBS A;  5GZZ B;  4OFN A;  4ECC A;  1BQ7 A;  2PVO C;  5AGY A;  2DJJ A;  1A8L A;  3EWL A;  4L5L A;  1R5A A;  3C1R A;  3QR6 A;  2L4Q A;  3L78 A;  3F3Q A;  4KA0 A;  4ML1 A;  4GSN A;  4JBB A;  3QMX A;  4FYB A;  4CY6 A;  3TOT A;  3GKM A;  3ERW A;  1LBK A;  1I9D A;  1ERU A;  4PI2 C;  1AXD A;  4LMW A;  3H1N A;  4IN0 A;  1BX9 A;  4Q5N A;  2IPA A;  3DRN A;  9GSS A;  3SBC A;  1M3J A;  5ECL B;  3HA9 A;  3IRA A;  2MBS A;  4DSQ A;  4XS4 B;  4GST A;  4MCU A;  2WVX B;  2RLI A;  4MJB A;  2JZT A;  1WJK A;  1PKZ A;  2NVL A;  3TJJ A;  3KGK A;  1R7H A;  1G7E A;  1QQ2 A;  1PL2 A;  4V2L A;  2MMZ A;  1XW9 A;  2FA8 A;  2GTU A;  3GTU B;  2O8V B;  3GYK A;  4Z2R A;  4PQ1 A;  1THO A;  1F6M C;  3W6G A;  5FHI A;  2X8H A;  5D9V A;  2YWO A;  4ICY A;  2MMN A;  3F4T A;  2IFQ A;  3NIV A;  1QMV A;  3UVH A;  3M1G A;  4MNN A;  3UAP A;  4XHM A;  5D73 A;  1ON4 A;  3UOM A;  3QAG A;  3HD5 A;  4EE0 A;  1PQN A;  4WXT A;  1TK5 B;  2CV4 A;  3MDK A;  3RAZ A;  3KH7 A;  3AY8 A;  4HDE A;  2H8L A;  2GSQ A;  1OC3 A;  3HVV A;  1FVJ A;  3TKP A;  5HFG A;  5CRD A;  3LG6 A;  2HZE A;  3GL5 A;  1O6J A;  1WPI A;  3PH9 A;  2VIM A;  3ERG A;  3F4S A;  1N25 A;  1PL1 A;  3US3 A;  1OKD A;  4PNG A;  3U5R E;  1RW1 A;  1XWK A;  1XVQ A;  5J3R A;  3F9U A;  1M2A A;  2H66 A;  3P8W A;  2FGX A;  2QGV A;  5GAN D;  4K1F A;  4TRX A;  4RI6 A;  3QD9 A;  1I1I P;  3FKF A;  4GDF A;  5E59 A;  3GX0 A;  3LFL A;  2GS3 A;  2RUF A;  2REM A;  5D8I A;  1GTB A;  2LJK A;  2WFC A;  2WUL A;  5A34 B;  3L4N A;  4KSO A;  8GSS A;  4JU5 A;  2CX3 A;  2DIY A;  4HZ4 A;  2PWJ A;  3VPQ A;  1Q98 A;  4LL1 B;  4O7H A;  2YP6 A;  3GMF A;  4MPG A;  1HD2 A;  3IXR A;  3RPN A;  4FO5 A;  4WBR D;  3BCI A;  1F3B A;  2UZ8 A;  5IOW A;  4ZIJ A;  4YQM A;  2EIO A;  4RQX A;  5AIV A;  1AUC A;  1R26 A;  3GH9 A;  2C3Q A;  1SJI A;  1K3L A;  4LL4 B;  3CRU A;  4BPY A;  1X9M B;  2GZZ A;  3R3E A;  4IVF A;  4XCS A;  4MH2 A;  1GUL A;  4XTS A;  3TKS C;  4ID0 A;  4Q5F A;  1X9W B;  1O81 A;  4KW6 A;  3IC4 A;  1MTC A;  3C1S A;  3IV4 A;  1TU8 A;  3D4M A;  1T8E B;  1K0A A;  1K0D A;  1GP1 A;  2O87 A;  4XIH A;  5GST A;  4IP1 A;  2LQQ A;  4N30 A;  4EUY A;  2TIR A;  4N3Z A;  1ILO A;  4PGT A;  2LQO A;  2IMI A;  3IBH A;  1RQM A;  3KJY A;  3DXB A;  5A4U A;  3BCK A;  3F63 A;  1H75 A;  1Y1U A;  4TR3 A;  11GS A;  12GS A;  2L6C A;  1ZZY A;  2KP2 A;  2J9H A;  3ZMK A;  4K8M A;  2ZUP A;  3EMX A;  3V1W A;  4KND A;  1THX A;  1B9X C;  3LYK A;  3PGT A;  2J23 A;  4PTS A;  3ISO A;  1YKC A;  4NV5 A;  2OE1 A;  5JCU A;  2VCW A;  3P7X A;  1OKT A;  3CQF A;  3QAW A;  2HNL A;  4L0U A;  4KX4 A;  2HE3 A;  4WF4 A;  3LJR A;  1GLQ A;  2O7K A;  1SK1 A;  2VKZ G;  4JE1 A;  1EZK A;  2DC5 A;  4TXV A;  1V57 A;  2AYT A;  4IGJ A;  5DQS A;  3ZYW A;  2VCZ A;  2B5Y A;  2ZNM A;  1QUW A;  5ECM B;  4KDU A;  1AIU A;  2CVD A;  1TU7 A;  3L9U A;  5G1L A;  3IK7 A;  3A3T A;  4G0K A;  3GST A;  5ECO B;  3KD0 A;  3A5W A;  1EEJ A;  3GUR A;  4POK A;  4KCE A;  1V9W A;  2R0G A;  2CVK A;  5D93 A;  4G01 A;  1R5P A;  4HEA 2;  4PUR A;  2HYX A;  4ACS A;  4AKH A;  1VRS D;  4Z2T A;  1UC7 A;  4L0W A;  4QL7 A;  2R4V A;  3IR4 A;  3KXO A;  1GTI A;  2JSY A;  4MPF A;  4W66 A;  2CA8 A;  2HI7 A;  2ON7 A;  3KMN A;  1AQW A;  1ML6 A;  3P2A A;  1OC9 B;  2YWN A;  4BA7 A;  1M0U A;  1MD4 A;  2IMD A;  1PFO A;  2P5Q A;  4TR1 A;  1TP9 A;  4EIQ A;  4A5P A;  2YNX A;  4J2F A;  1Z6M A;  3H8Q A;  5CNW A;  2C80 A;  3KM6 A;  1B48 A;  2LV3 A;  2N5F A;  4OO5 A;  2WGR A;  4ECB A;  6GSX A;  4IBP A;  4K0N A;  1TI1 A;  1GSS A;  1SVM A;  3VWU A;  5AIX A;  2H1D A;  2PBJ A;  3WGX A;  3HVN A;  3MNG A;  3A2X A;  2YAN A;  1VF4 A;  2EIQ A;  1KTE A;  1ZMA A;  2QSI A;  4F2I A;  1DSB A;  3QOU A;  1YF0 A;  4HUA A;  5KOX A;  2H0I A;  1K3Y A;  1E2Y A;  1SVO A;  3IK9 A;  2PU9 C;  1UA5 A;  4HOJ A;  3KTB A;  1Q4J A;  4KE3 A;  5IMF A;  1DE1 A;  3O6T A;  3Q6O A;  4OFT A;  1JZR A;  5DCH A;  2GDR A;  2PVQ A;  1K0N A;  3M8N A;  3TJG A;  2RUE A;  4K7O A;  1XWA A;  3D22 A;  2VCX A;  2X64 A;  2OJL A;  4WF5 A;  3GKN A;  3BBY A;  3H79 A;  3HZ8 A;  3G7J A;  2C3N A;  1OVN A;  1SJZ A;  1K0B A;  4K2X A;  3VFI A;  1I5G A;  1EP8 A;  3EE2 A;  2VD0 A;  1AQX A;  4MAB A;  1PX6 A;  1PKW A;  2C8U A;  1S3D A;  1KBN A;  1SL1 B;  4BVX A;  4OFM A;  1OYJ A;  2GSR A;  1MEK A;  4RQR A;  2JU5 A;  4Z7X A;  3UBL A;  3HZ4 A;  3ZFL A;  1A2L A;  4AKG A;  1YEW C;  2WRT A;  4MZC A;  1O7U A;  1SL0 B;  3APS A;  3HHV A;  1X0R A;  3A2W A;  4O5Q A;  3UJ1 A;  3Q19 A;  1TJD A;  5GSS A;  4HZ2 A;  2E0Q A;  1BF5 A;  5EPF A;  1BJX A;  3N9J A;  2H70 A;  4EXJ A;  2HRF A;  3RBT A;  2O85 A;  3M0F A;  4HSC X;  1E6B A;  2R6K A;  5IM9 A;  5J4Y A;  2FWG A;  3TDG A;  4TW5 A;  1USB A;  4FQU A;  3EPT A;  4K5S A;  5A5K A;  3ZIJ A;  2CX4 A;  2IWT A;  1URM A;  2AHE A;  2K9F A;  4POL A;  1TRS A;  2JAC A;  4KDX A;  1EGR A;  4MH3 A;  1TK8 B;  4FH8 A;  1WMJ A;  4NHZ A;  1UN2 A;  1O8W A;  3E9J B;  1O73 A;  4JRR A;  1B4P A;  3VK9 A;  4AI6 A;  2EFH A;  1Y6E A;  2HRK A;  4NV2 A;  1GSD A;  5D9X A;  2VM1 A;  2FCH A;  1JLV A;  4ISD A;  1WE0 A;  3UBK A;  1S3A A;  1FVK A;  2OE0 A;  1WOU A;  3ME8 A;  3A2V A;  1XWB A;  2VCQ A;  5A5H B;  3EC3 A;  1EWX A;  2GQK A;  4MDC A;  4FXY P;  1JZD A;  2M80 A;  5J9C A;  5IPH A;  1ST9 A;  3GN3 A;  2OAC A;  3VWW A;  2R37 A;  4DSS A;  5IO2 A;  3E3E A;  2WW1 A;  3KMO A;  2H75 A;  5J4U A;  2F8F A;  3R2Q A;  5ECH B;  2HSN A;  4MF5 A;  1JHB A;  2LTK A;  3GL3 A;  1FO5 A;  4K7I A;  2FUG 2;  1ZOF A;  5CRG A;  5EL8 A;  2VD1 A;  4G9H A;  2DJ3 A;  2KUC A;  4IW9 A;  5LD0 A;  5BMU B;  2I9H A;  3PPU A;  3HXS A;  4PUA A;  2B3S A;  1GH2 A;  1WP0 A;  5KOW A;  2IIY A;  3G7Y A;  5ID2 A;  3HKR A;  4HS1 A;  5CRH A;  1MDK A;  1U88 A;  1F9M A;  4I2U A;  1ZYQ B;  1K0C A;  5KN1 A;  3WYW A;  3P90 A;  2DML A;  3WT2 A;  4OCF A;  3IHG A;  2IMF A;  2FWH A;  2GSS A;  2H1L A;  1SD8 A;  2DBC A;  2TRC P;  3G7I A;  3H93 A;  2G2Q A;  2VL2 C;  2VOC A;  3FHK A;  2CZ3 A;  2I81 A;  5DBQ A;  1FG4 A;  7GSS A;  1W89 A;  2YWM A;  1A2M A;  4Q5Q A;  1M9A A;  3GSS A;  1TW9 A; 
#chains in the Genus database with same CATH homology
 1K3O A;  2LS5 A;  1ZYP A;  5CYY A;  2FY6 A;  1Z9H A;  18GS A;  3Q74 A;  4DEJ A;  5IPG A;  4ECJ A;  2D2Z A;  3L9S A;  2F9S A;  4TR0 A;  2LKU A;  2NPB A;  3CSH A;  3FYG A;  3TKS E;  4WR4 A;  3M9K A;  2VLT A;  3ME7 A;  3MIX A;  1AC1 A;  4DVC A;  2QC7 A;  2JSZ A;  1SL2 B;  4XS1 A;  2CT6 A;  4YKF A;  1AW9 A;  3L0H A;  5ECN B;  4N0Z A;  2GST A;  1XVW A;  3TRX A;  4G10 A;  3C73 A;  1ZYN A;  1OE8 A;  5DVB A;  5B6N A;  5JCW A;  3IA1 A;  4KDY A;  4H86 A;  2HQT A;  4IKH A;  1HNC A;  3NOF A;  1PX7 A;  1YEX A;  3QCP A;  4KUN A;  4NXI A;  2DLX A;  2ALB A;  1F3A A;  2HSM B;  4IP6 A;  3TB2 A;  4BVY A;  1EP7 A;  3DYR A;  2F51 A;  1PD2 1;  3LGC A;  5F05 A;  5A1N A;  1TXX A;  2GGT A;  3HCZ A;  1BYE A;  2YZU A;  5ELG A;  2MMO A;  1MD3 A;  4PNF A;  2VLV A;  4TR4 A;  4XRD A;  1FAA A;  2MZC A;  2V2G A;  2GT6 A;  4G0L A;  2I4A A;  2M46 A;  5DAL A;  4I8B A;  3DD3 A;  4BWS A;  4MP4 A;  2H6X A;  4KAE A;  4MLY A;  3DIE A;  2R0P A;  1YDK A;  2WCI A;  2H6Z A;  4P3Y B;  4ZBB A;  2EC4 A;  4XS4 A;  2OBI A;  3BD2 A;  5F8B A;  2DKH A;  1PSQ A;  1O8X A;  2WZ9 A;  1T7P B;  4TR1 B;  3GKX A;  2VL3 A;  2JAD A;  2H74 A;  1PN0 A;  3LQ7 A;  3I43 A;  1LU4 A;  5KN2 A;  5ECS A;  3GTU A;  4O5R A;  4I5Q A;  2KLX A;  1X5E A;  5H5Q A;  1UVZ A;  2CVB A;  2YV9 A;  5KEJ A;  5F06 A;  5A4W A;  2L5L A;  4MK3 A;  1N8J A;  1XXU A;  5AIS A;  2HSH A;  2OAD A;  5D9T A;  1NSW A;  1FB6 A;  4AF2 A;  3QPM A;  2HT9 A;  4G2E A;  3ZFB A;  3BJ5 A;  1AQV A;  2XBI A;  2N5B A;  2DJ2 A;  4IQ1 A;  4AJ6 A;  1LJR A;  3BOA A;  4AKI A;  3ZLP A;  2VUP A;  2K8S A;  3I69 A;  1GRX A;  2XBQ A;  3TRQ A;  1T4Z A;  2K18 A;  5F0G A;  6GST A;  5IO0 A;  5ECK B;  1K0M A;  1V58 A;  2HFD A;  3FW2 A;  1DBY A;  5DAK B;  3F6D A;  4ZL8 A;  2JZS A;  3F6F A;  2G0F A;  2KHP A;  5FWG A;  1ERT A;  2AJQ B;  4J57 E;  2RM5 A;  4F82 A;  1JZW A;  4BL7 B;  5JWR B;  4EC0 A;  4TXO B;  1F2E A;  2V6O A;  3W8J A;  1HNA A;  4ZBA A;  4V1A g;  1PMT A;  4CY8 A;  3TRP A;  1QK8 A;  1SYR A;  4V1A p;  1Z7R A;  1YZX A;  2H6Y A;  2CAI A;  3CTG A;  4MF6 A;  4XS6 A;  1ABA A;  2B5X A;  3PR8 A;  3GH6 A;  1TTZ A;  3LWA A;  2VLU A;  3E0U A;  4QQ7 A;  2ES7 A;  2B7K A;  1M2B A;  2VL9 A;  4OD7 A;  4GQF A;  3KZQ A;  4MMM A;  3ZVJ D;  1FW1 A;  1OC8 A;  3GIX A;  4MJA A;  3VWV A;  1A2J A;  2XPD A;  3TKS A;  3GHA A;  2M72 A;  1YF1 A;  1Z7P A;  4ZL9 A;  3U6V A;  3HMJ G;  4G19 A;  2YZH A;  4IHU A;  3I6A A;  3TKR A;  4Z2U A;  2P31 A;  4NAX A;  3KP8 A;  3HVX A;  1NM3 A;  3C71 A;  2FWE A;  2OA7 A;  1XCC A;  1EEM A;  3GV1 A;  1J0F A;  3FZ5 A;  2EFC A;  3PIN A;  4OWY A;  5CP1 A;  4EF0 A;  4YAV A;  4HJM A;  3RDW A;  3GA4 A;  2KOK A;  2QA2 A;  1EOH A;  2I1U A;  4MJE A;  5ABR A;  4D73 B;  5C04 A;  3KIJ A;  3GKK A;  5ENU A;  1ACV A;  5FT3 A;  3FRC A;  5JCG A;  1C72 A;  5ECR B;  2FA4 A;  2HZF A;  3ERF A;  1AAZ A;  1PGT A;  2C0G A;  1BED A;  4F03 A;  1GSU A;  4K7N A;  2IL3 A;  5IMD A;  4WBJ A;  1GSF A;  1MDJ A;  1SU9 A;  2BTO T;  2TRX A;  3FR9 A;  4EVM A;  3GX8 A;  1HNB A;  1CQG A;  3OR5 A;  2A4H A;  3KP9 A;  4X1U A;  1J08 A;  1M2D A;  1PRX A;  3A5I A;  4NWY A;  4KH7 A;  1U6T A;  4TKY A;  1K0O A;  1YEP A;  2H01 A;  3J7Y b;  5KN3 A;  4QL9 A;  4EDY A;  1EOG A;  4IQA A;  1QGV A;  4CDO A;  3NZN A;  3MAK A;  3GFK A;  2A2P A;  5D9W A;  2YWI A;  2DKI A;  3IC8 A;  2PGT A;  3EU4 A;  4HU9 A;  3EU3 A;  2H1A A;  3M9J A;  2MMA A;  4BWQ A;  1WIK A;  4ZIL A;  1GLP A;  1XW5 A;  1T3B A;  4GWR A;  2ZCT A;  2E2M A;  2WDU A;  4GCI A;  3VI5 A;  5CRE A;  2YV7 A;  5J5N A;  1TRV A;  2IFQ B;  1CQH A;  4CW9 A;  4N10 A;  4MF7 A;  1YY7 A;  1NW2 A;  13GS A;  2VM2 A;  1G6Y A;  1SYX A;  1XIY A;  3D21 A;  3FMW A;  5LNK e;  3FZ4 A;  1OE7 A;  2LST A;  3RPP A;  1S3C A;  2HZE B;  4MJC A;  2H73 A;  2L5O A;  1TRW A;  4HU7 A;  3G9B A;  3KEB A;  5EY6 A;  2V41 A;  2QKE A;  1GSE A;  2H19 A;  3VI7 A;  1RK4 A;  1XOB A;  3LW9 A;  1EGO A;  2LEG A;  4K2D A;  2V1M A;  1OC9 A;  3ZZX A;  5D96 A;  3DML A;  1TK0 B;  3F0I A;  3M3M A;  2IJY A;  4ILF A;  2P5R A;  5ECP B;  4PQI A;  4X0X A;  3DGQ A;  4N0V A;  2H0H A;  3QDN A;  1ERW A;  17GS A;  3VLN A;  6GSU A;  2AAW A;  3UL3 A;  2B5E A;  2A4V A;  3CTF A;  2PUK C;  1JZO A;  1Z5Y E;  3HVS A;  2X49 A;  5H5R A;  3CWG A;  1O85 A;  1WRY A;  4ECI A;  4ZB9 A;  5G5F A;  3UAR A;  2PMT A;  5IMV A;  2DIZ A;  2C0D A;  2GVP A;  4HQS A;  2H1B A;  3JCM L;  2LJR A;  4GSS A;  2LRN A;  2FHE A;  2NBS A;  1M99 A;  2MBT A;  1ZL9 A;  5DAL B;  2E7P A;  3VUR A;  2L4C A;  1BAY A;  2WJU A;  1B8X A;  1VF2 A;  2IME A;  1HQO A;  5HR2 A;  1X9S B;  3HDC A;  3CBU A;  3LEF A;  4E68 A;  1VGL A;  4EIP A;  1TDI A;  3IOS A;  3ZML A;  1JFU A;  4GRF A;  5A4V A;  1V2A A;  2GQL A;  6GSY A;  3LXT A;  2MYG A;  4K6X A;  4AJ7 A;  6GSS A;  4YAP A;  4I6X A;  2YPM A;  5COH A;  4EL1 A;  2H72 A;  5ECQ B;  1YQ1 A;  4GF0 A;  2R0C A;  1QXH A;  4XRA A;  1Y25 A;  2EFD A;  2F8A A;  4EO3 A;  2BMX A;  3F8U A;  1XWG A;  4MA9 A;  2JL4 A;  3FR6 A;  4YQV A;  2HRN A;  1G6W A;  1GTU A;  1NHO A;  4O32 A;  3CXG A;  3UIW A;  2I3Y A;  3SWL A;  4G0I A;  1TRU A;  3HYP A;  3TJF A;  1ZCP A;  4NMU A;  4E8E A;  4F0B A;  3I9V 2;  4GXZ A;  3IHQ A;  1X5C A;  2AB6 A;  3IDV A;  4ZB6 A;  4O5U A;  2RII A;  3MYD A;  5CO3 A;  1HYU A;  2FNO A;  1EV9 A;  2FWF A;  3TOU A;  1WWJ A;  4YKG A;  3KCM A;  1NHY A;  5G5E A;  4L5O A;  3FZA A;  5DJL A;  5HR1 A;  5J40 A;  2AUV A;  2DJ1 A;  2DMM A;  2NTO A;  4I97 A;  1VF3 A;  2DJ0 A;  2R3X A;  4F9Z A;  3WGE A;  4PQH A;  4DSR A;  1T1V A;  1V40 A;  4WEY A;  5INY A;  3GRX A;  2CQ9 A;  3HJP A;  1SD9 A;  10GS A;  2XPE A;  2H76 A;  3ZRE A;  1DE2 A;  2LNS A;  1SKS B;  4K0G A;  1DUG A;  2EIR A;  2F3M A;  1SEN A;  2L59 A;  1QFN A;  2LUS A;  3S9F A;  3IE3 A;  3FK8 A;  4ZL7 A;  1XW6 A;  2WS2 A;  2OE3 A;  2X4A A;  1B9Y C;  1YKA A;  3ZIT A;  3TJK A;  4AKX B;  1GNE A;  5A5H A;  2KP1 A;  4IJI A;  4IS0 A;  4WR5 A;  4FIW A;  1XPV A;  1YJ6 A;  5HR0 A;  4KB3 A;  4N11 A;  14GS A;  2XC2 A;  4EKZ A;  1GSY A;  1G7O A;  3DVX A;  3DEX A;  3D5J A;  2B1K A;  5B7C A;  1F37 A;  3ZVJ A;  5DJM A;  3WT1 A;  1M7T A;  4HQZ A;  4F0C A;  4J56 E;  1A0F A;  3VWX A;  3UEM A;  1MDI A;  2GZP A;  3N5O A;  4FYC A;  3CMI A;  1U3I A;  3MSZ A;  4MZW A;  5BMU A;  1XWC A;  5KN0 A;  3EMP A;  2VAF A;  3QFB C;  2A2S A;  3LSZ A;  5F07 A;  1TOF A;  2LNT A;  3CYN A;  5IQY A;  2LJA A;  4ZBD A;  2VL2 A;  5G31 A;  3F4R A;  2X8G A;  3KTL A;  3DVW A;  1FB0 A;  4CHS A;  5JWO B;  4JZQ A;  2B7J A;  3L9V A;  2YCD A;  3WD6 A;  2DSA A;  3W8S A;  1A23 A;  4ZB7 A;  5B8B A;  5IMC A;  3MWH A;  1SK0 A;  1EV4 A;  1IYI A;  3ZRD A;  4RUV A;  2P0G A;  4I2T A;  1A8Y A;  2VCT A;  4AGS A;  1GTA A;  3FY7 A;  5IOX A;  2UV8 G;  5H5S A;  4KGI A;  5HFK A;  5BRT A;  3EIN A;  4MZB A;  3RHC A;  3GNJ A;  4EDZ A;  5J4V A;  4OMV A;  3ED3 A;  4GQC A;  1ZYE A;  5J9B A;  3FZ9 A;  2B6M A;  3LXZ A;  3K8N A;  5IMA A;  5HQP A;  1ERV A;  4TVE A;  4KCA A;  1GNW A;  19GS A;  3IAS 2;  5HFI A;  2PN8 A;  4BVX B;  5DDL A;  2H1G A;  5A34 A;  5B6M A;  3HJO A;  1ZGN A;  3CSI A;  4WET A;  1U87 A;  4L8E A;  5ECI B;  3LYP A;  2H0G A;  2CZ2 A;  2HSM A;  2QA1 A;  4Q5R A;  1Z6N A;  1GL8 A;  4YQU A;  2BJX A;  6GSV A;  4TOP A;  2WB9 A;  2K8V A;  5J41 A;  1BG1 A;  5LCZ A;  3TU3 B;  5GAP D;  2A2R A;  4PXO A;  3APO A;  4NHW A;  3FR3 A;  4GLT A;  5AN1 A;  3QFA C;  2YJ7 A;  4PUF C;  2B1L A;  2GZY A;  2RM6 A;  2XHF A;  5L71 A;  1N2A A;  3HY2 A;  1FOH A;  1PA3 A;  4ZB8 A;  2NDO A;  4RI7 A;  1FHE A;  2Z9S A;  2L6D A;  4OO4 A;  3ZIV A;  1X5D A;  2GLR A;  4YH2 A;  5E4W A;  3D6I A;  3EUR A;  2C1Y A;  3CSJ A;  3APQ A;  5ELA A;  1GWC A;  3DWV A;  2YN1 A;  4LMV A;  1TI3 A;  3QAV A;  4AJ8 A;  1A0R P;  4X43 A;  2HRK B;  5C00 A;  1Z3E A;  3F3R A;  3H4K A;  3TGZ A;  1SK2 A;  2YJH A;  2O5V A;  5B8A A;  2OKA A;  2PPT A;  2IMK A;  3D0Z A;  1TXU A;  3VPT A;  2LRT A;  3TKQ A;  2OT3 A;  2HLS A;  1SKR B;  4K9Z A;  4ML6 A;  2HRA A;  3ZL5 A;  1IYH A;  2HSY A;  1SKW B;  3UMA A;  4WKW A;  4DSS B;  4IEL A;  1FOV A;  5CRW A;  22GS A;  4OCE A;  5DCG A;  4LLR A;  2C4J A;  2HSN B;  1H4O A;  3EYT A;  5G1K A;  1KEB A;  2V32 A;  4ULX A;  1VF1 A;  4PX1 A;  1R4W A;  2JZR A;  1KNG A;  4LA1 A;  1G0T A;  1JLW A;  5DAK A;  3J7Y k;  1SVL A;  5EVO A;  2N5A A;  4E8H A;  2V6K A;  5IMZ A;  5DQY A;  5ID2 B;  2VCV A;  2CAQ A;  2VO4 A;  1XOA A;  3EVI A;  3TJB A;  4BL7 A;  1V98 A;  4TXO A;  4HJ2 A;  1U3A A;  2K6V A;  1M9B A;  4POB A;  4IJ3 A;  2R5G A;  1B4Q A;  2IN3 A;  16GS A;  3HJM A;  2LRC A;  3CRT A;  4JR4 A;  1PN9 A;  2YOI A;  4V2M A;  6GSW A;  5J47 A;  2FLS A;  2GT5 A;  3FEU A;  4JR6 A;  3C8E A;  4QMK A;  2FD3 A;  2ON5 A;  2PER A;  3RHB A;  2AV4 A;  4NPB A;  2C0E A;  4K5R A;  2L57 A;  5HR3 A;  1W4V A;  2HXK A;  4KSM A;  20GS A;  1T00 A;  3C7M A;  4V2N A;  3DKS A;  3Q18 A;  1XZO A;  5CAX A;  1GSQ A;  3UVT A;  1A24 A;  5G2Z A;  2H71 A;  2C3T A;  1YVL A;  4GTU A;  2X99 A;  5G30 A;  3IAM 2;  2DJK A;  3GUS A;  4TN8 A;  3KH9 A;  4ZXG A;  3D4T A;  2OBK A;  1BG5 A;  4USS A;  3O3T A;  2C0F A;  1GUM A;  2X8C A;  4JED A;  1J9B A;  2E2G A;  2O89 A;  1TKD B;  5IIZ A;  3O76 A;  2EFE A;  2R2J A;  4HI7 A;  4FYU A;  3WGD A;  4D73 A;  3IPZ A;  3TCO A;  4O92 A;  4POM A;  4KF9 A;  3TUE A;  3LOR A;  1XFL A;  2GQM A;  2H30 A;  1GUK A;  4BVY B;  1OAZ A;  4X4J A;  3ZTL A;  5JWQ B;  5A1N B;  1SJ6 A;  1T4Y A;  1GUH A;  1XBS A;  5GZZ B;  4OFN A;  4ECC A;  1BQ7 A;  2PVO C;  5AGY A;  2DJJ A;  1A8L A;  3EWL A;  4L5L A;  1R5A A;  3C1R A;  3QR6 A;  2L4Q A;  3L78 A;  3F3Q A;  4KA0 A;  4ML1 A;  4GSN A;  4JBB A;  3QMX A;  4FYB A;  4CY6 A;  3TOT A;  3GKM A;  3ERW A;  1LBK A;  1I9D A;  1ERU A;  1AXD A;  4LMW A;  3H1N A;  4IN0 A;  1BX9 A;  4Q5N A;  2IPA A;  3DRN A;  9GSS A;  3SBC A;  5ECL B;  3HA9 A;  3IRA A;  2MBS A;  4DSQ A;  4XS4 B;  4GST A;  4MCU A;  2RLI A;  4MJB A;  2JZT A;  1WJK A;  1PKZ A;  2NVL A;  3TJJ A;  3KGK A;  1R7H A;  1G7E A;  1QQ2 A;  1PL2 A;  4V2L A;  2MMZ A;  1XW9 A;  2FA8 A;  2GTU A;  3GTU B;  2O8V B;  3GYK A;  4Z2R A;  4PQ1 A;  1THO A;  1F6M C;  3W6G A;  5FHI A;  2X8H A;  5D9V A;  2YWO A;  4ICY A;  2MMN A;  3F4T A;  2IFQ A;  3NIV A;  1QMV A;  3UVH A;  3M1G A;  4MNN A;  3UAP A;  4XHM A;  5D73 A;  1ON4 A;  3UOM A;  3QAG A;  3HD5 A;  4EE0 A;  1PQN A;  4WXT A;  1TK5 B;  2CV4 A;  3MDK A;  3RAZ A;  3KH7 A;  3AY8 A;  4HDE A;  2H8L A;  2GSQ A;  1OC3 A;  3HVV A;  1FVJ A;  3TKP A;  5HFG A;  5CRD A;  3LG6 A;  2HZE A;  3GL5 A;  1O6J A;  1WPI A;  3PH9 A;  2VIM A;  3ERG A;  3F4S A;  1N25 A;  1PL1 A;  3US3 A;  1OKD A;  4PNG A;  3U5R E;  1RW1 A;  1XWK A;  1XVQ A;  5J3R A;  3F9U A;  1M2A A;  2H66 A;  3P8W A;  2FGX A;  2QGV A;  5GAN D;  4K1F A;  4TRX A;  4RI6 A;  3QD9 A;  3FKF A;  4GDF A;  5E59 A;  3GX0 A;  3LFL A;  2GS3 A;  2RUF A;  2REM A;  5D8I A;  1GTB A;  2LJK A;  2WFC A;  2WUL A;  5A34 B;  3L4N A;  4KSO A;  8GSS A;  4JU5 A;  2CX3 A;  2DIY A;  4HZ4 A;  2PWJ A;  3VPQ A;  1Q98 A;  4LL1 B;  4O7H A;  2YP6 A;  3GMF A;  4MPG A;  1HD2 A;  3IXR A;  3RPN A;  4FO5 A;  4WBR D;  3BCI A;  1F3B A;  2UZ8 A;  5IOW A;  4ZIJ A;  4YQM A;  2EIO A;  4RQX A;  5AIV A;  1AUC A;  1R26 A;  3GH9 A;  2C3Q A;  1SJI A;  1K3L A;  4LL4 B;  3CRU A;  4BPY A;  1X9M B;  2GZZ A;  3R3E A;  4IVF A;  4XCS A;  4MH2 A;  1GUL A;  4XTS A;  3TKS C;  4ID0 A;  4Q5F A;  1X9W B;  1O81 A;  4KW6 A;  3IC4 A;  1MTC A;  3C1S A;  3IV4 A;  1TU8 A;  3D4M A;  1T8E B;  1K0A A;  1K0D A;  1GP1 A;  2O87 A;  4XIH A;  5GST A;  4IP1 A;  2LQQ A;  4N30 A;  4EUY A;  2TIR A;  4N3Z A;  1ILO A;  4PGT A;  2LQO A;  2IMI A;  3IBH A;  1RQM A;  3KJY A;  3DXB A;  5A4U A;  3BCK A;  3F63 A;  1H75 A;  1Y1U A;  4TR3 A;  11GS A;  12GS A;  2L6C A;  1ZZY A;  2KP2 A;  2J9H A;  3ZMK A;  4K8M A;  2ZUP A;  3EMX A;  3V1W A;  4KND A;  1THX A;  1B9X C;  3LYK A;  3PGT A;  2J23 A;  4PTS A;  3ISO A;  1YKC A;  4NV5 A;  2OE1 A;  5JCU A;  2VCW A;  3P7X A;  1OKT A;  3QAW A;  2HNL A;  4L0U A;  4KX4 A;  2HE3 A;  4WF4 A;  3LJR A;  1GLQ A;  2O7K A;  1SK1 A;  2VKZ G;  4JE1 A;  1EZK A;  2DC5 A;  4TXV A;  1V57 A;  2AYT A;  4IGJ A;  5DQS A;  3ZYW A;  2VCZ A;  2B5Y A;  2ZNM A;  1QUW A;  5ECM B;  4KDU A;  1AIU A;  2CVD A;  1TU7 A;  3L9U A;  5G1L A;  3IK7 A;  3A3T A;  4G0K A;  3GST A;  5ECO B;  3KD0 A;  3A5W A;  1EEJ A;  3GUR A;  4POK A;  4KCE A;  1V9W A;  2R0G A;  2CVK A;  5D93 A;  4G01 A;  1R5P A;  4HEA 2;  4PUR A;  2HYX A;  4ACS A;  4AKH A;  1VRS D;  4Z2T A;  1UC7 A;  4L0W A;  4QL7 A;  2R4V A;  3IR4 A;  3KXO A;  1GTI A;  2JSY A;  4MPF A;  4W66 A;  2CA8 A;  2HI7 A;  2ON7 A;  3KMN A;  1AQW A;  1ML6 A;  3P2A A;  1OC9 B;  2YWN A;  4BA7 A;  1M0U A;  1MD4 A;  2IMD A;  2P5Q A;  4TR1 A;  1TP9 A;  4EIQ A;  4A5P A;  2YNX A;  4J2F A;  1Z6M A;  3H8Q A;  5CNW A;  2C80 A;  3KM6 A;  1B48 A;  2LV3 A;  2N5F A;  4OO5 A;  2WGR A;  4ECB A;  6GSX A;  4IBP A;  4K0N A;  1TI1 A;  1GSS A;  1SVM A;  3VWU A;  5AIX A;  2H1D A;  2PBJ A;  3WGX A;  3MNG A;  3A2X A;  2YAN A;  1VF4 A;  2EIQ A;  1KTE A;  1ZMA A;  2QSI A;  4F2I A;  1DSB A;  3QOU A;  1YF0 A;  4HUA A;  5KOX A;  2H0I A;  1K3Y A;  1E2Y A;  1SVO A;  3IK9 A;  2PU9 C;  1UA5 A;  4HOJ A;  3KTB A;  1Q4J A;  4KE3 A;  5IMF A;  1DE1 A;  3O6T A;  3Q6O A;  4OFT A;  1JZR A;  5DCH A;  2GDR A;  2PVQ A;  1K0N A;  3M8N A;  3TJG A;  2RUE A;  4K7O A;  1XWA A;  3D22 A;  2VCX A;  2X64 A;  2OJL A;  4WF5 A;  3GKN A;  3BBY A;  3H79 A;  3HZ8 A;  3G7J A;  2C3N A;  1OVN A;  1SJZ A;  1K0B A;  4K2X A;  3VFI A;  1I5G A;  1EP8 A;  3EE2 A;  2VD0 A;  1AQX A;  4MAB A;  1PX6 A;  1PKW A;  2C8U A;  1S3D A;  1KBN A;  1SL1 B;  4BVX A;  4OFM A;  1OYJ A;  2GSR A;  1MEK A;  4RQR A;  2JU5 A;  4Z7X A;  3UBL A;  3HZ4 A;  3ZFL A;  1A2L A;  4AKG A;  2WRT A;  4MZC A;  1O7U A;  1SL0 B;  3APS A;  3HHV A;  1X0R A;  3A2W A;  4O5Q A;  3UJ1 A;  3Q19 A;  1TJD A;  5GSS A;  4HZ2 A;  2E0Q A;  1BF5 A;  5EPF A;  1BJX A;  3N9J A;  2H70 A;  4EXJ A;  2HRF A;  3RBT A;  2O85 A;  3M0F A;  1E6B A;  2R6K A;  5IM9 A;  5J4Y A;  2FWG A;  3TDG A;  4TW5 A;  1USB A;  4FQU A;  3EPT A;  4K5S A;  5A5K A;  3ZIJ A;  2CX4 A;  2IWT A;  1URM A;  2AHE A;  2K9F A;  4POL A;  1TRS A;  2JAC A;  4KDX A;  1EGR A;  4MH3 A;  1TK8 B;  4FH8 A;  1WMJ A;  4NHZ A;  1UN2 A;  1O8W A;  3E9J B;  1O73 A;  4JRR A;  1B4P A;  3VK9 A;  4AI6 A;  2EFH A;  1Y6E A;  2HRK A;  4NV2 A;  1GSD A;  5D9X A;  2VM1 A;  2FCH A;  1JLV A;  4ISD A;  1WE0 A;  3UBK A;  1S3A A;  1FVK A;  2OE0 A;  1WOU A;  3ME8 A;  3A2V A;  1XWB A;  2VCQ A;  5A5H B;  3EC3 A;  1EWX A;  2GQK A;  4MDC A;  1JZD A;  2M80 A;  5J9C A;  5IPH A;  1ST9 A;  3GN3 A;  2OAC A;  3VWW A;  2R37 A;  4DSS A;  5IO2 A;  3E3E A;  3KMO A;  2H75 A;  5J4U A;  2F8F A;  3R2Q A;  5ECH B;  2HSN A;  4MF5 A;  1JHB A;  2LTK A;  3GL3 A;  1FO5 A;  4K7I A;  2FUG 2;  1ZOF A;  5CRG A;  5EL8 A;  2VD1 A;  4G9H A;  2DJ3 A;  2KUC A;  4IW9 A;  5LD0 A;  5BMU B;  2I9H A;  3PPU A;  3HXS A;  4PUA A;  2B3S A;  1GH2 A;  1WP0 A;  5KOW A;  2IIY A;  3G7Y A;  5ID2 A;  3HKR A;  4HS1 A;  5CRH A;  1MDK A;  1U88 A;  1F9M A;  4I2U A;  1ZYQ B;  1K0C A;  5KN1 A;  3WYW A;  3P90 A;  2DML A;  3WT2 A;  4OCF A;  3IHG A;  2IMF A;  2FWH A;  2GSS A;  2H1L A;  1SD8 A;  2DBC A;  2TRC P;  3G7I A;  3H93 A;  2G2Q A;  2VL2 C;  2VOC A;  3FHK A;  2CZ3 A;  2I81 A;  5DBQ A;  1FG4 A;  7GSS A;  1W89 A;  2YWM A;  1A2M A;  4Q5Q A;  1M9A A;  3GSS A;  1TW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...