4Q5TA

Crystal structure of an atmb (putative membrane lipoprotein) from streptococcus mutans ua159 at 1.91 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
257
structure length
257
Chain Sequence
GQKNDKNTLTVGVMTMTDSDKERWDKIEELLKKENIKLKFKEFTDYSQPNKALKNGEIDINSFQHYNFLNNWNKENKGDLVTVAETYISPINLFSGTENGKAKYSSAKEIPNGGQIAIPNDATNESRALYVLQDAGLIKLNVSGDELATVKNIKSNPKNLDIKEVDASQTARNLASVDAAVVNNSYAVPAKIDFKTSLYKEKVNEGSKQWINIIAAQKNWKKSKKAAAIKKLIKAYHTDAVKKVIKKTAKGVDEPVWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein
publication title Crystal structure of an atmB (putative membrane lipoprotein) from Streptococcus mutans UA159 at 1.91 A resolution
rcsb
source organism Streptococcus mutans ua159
molecule tags Transport protein
total genus 85
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4q5tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4q5tA02
3TTLA 2LAOA 2ZYOA 4ZE9A 3O28A 3K0VA 2VHAA 4H6DA 2OCUA 4WKMA 3HPIA 2NXOA 3E9XA 2Y7PA 3TFLA 2HEUA 1IQ7A 5AA4A 3M3FA 2PYYA 3VVFA 4PFUA 4RY1A 1S9TA 1ATGA 3UP9A 1SQYA 4MFIA 2P1SA 4H5FA 3SEXA 4QRZA 3MVWA 2QS2A 1RKMA 1HSEA 5DT6A 3TQLA 2DWIA 4U4SA 3B6WA 2XXXA 3IJOB 1AL3A 4UACA 2Y84A 2I48A 1URGA 1KWHA 1A8FA 4QFKA 2QS3A 4R6KA 3T9VA 3K6WA 4QSCA 3GBAA 4GWOA 1D3KA 3K1MA 3O6HA 3CI8A 1Y3PA 4MLQA 1AIVA 2HQ0A 1QKAA 4ESWA 2XHDA 1UTBA 1FTKA 2H98A 4YKIA 4LQ5A 1B9JA 4NE4A 3MPLA 1O64A 4FEBA 4WEDA 2G29A 4XXUA 4RNSA 3PGFA 4RPNA 3H6WA 2ONSA 2VD2A 1FQBA 2DE3A 1LCFA 2AIXA 1B58A 2F34A 2PBWA 5I2KB 3OD7A 1SW2A 3K00A 3BFUA 1DMBA 2XXYA 2RC7A 3MP1A 1QUKA 3K02A 1I6BA 1JETA 2NOOA 4OFOA 3BFTA 5H8NA 1ZMGA 3KBRA 1OQHA 2RCAA 1NL5A 4LA9A 5L9OA 3MVYA 3H7MA 3U72A 1N0TA 4OXVA 1B5IA 1B7UA 1A7LA 3TEPA 1TFDA 2I4CA 4R2FA 1Y3QA 2P0SA 1DPPA 3I5OA 1AOVA 3K6XA 5CI5A 4NMYA 1CB6A 1M5EA 4EXLA 3O29A 1B0HA 3G7WA 2Z23A 1N3XA 3WAEA 2I3WA 4XKPA 2V25A 5AA2A 4I9DA 4NEDA 3M3LA 3MW0A 4G4PA 4BDOA 4F1YA 1UTHA 3W9WA 1S50A 3VLWA 2YLNA 2XXUA 3U8QA 2UVJA 1IEJA 3T96B 4LQ2A 1XT8A 4FORA 3CFXA 4ZE8A 4FATA 1LCTA 3GZGA 1ELJA 2DOJA 3THIA 4E0XA 3DP6A 1A40A 3OSRA 3JYRA 3CR9A 4BDNA 2HXWA 1J1NA 3QSLA 1FTLA 1FTOA 1P1UA 4OEUA 2F7CA 4G8MA 3Q28A 3MBPA 3IB1A 3PMXA 1DPEA 1YAEA 1GR2A 2Z8EA 3CG3A 3PUYE 4NTLA 1LAFE 4E0WA 1BKAA 3EN3A 4ZEIA 1MY4A 3TTNA 2A5TB 1EH3A 2HFBA 1IUDA 2ZNSA 2GRVA 5CBSA 3QUFA 4NF6A 2Q2CA 5I58A 4OEVA 4ZEKA 5DTBA 1NNPA 1DTGA 3DLNA 4IY6A 4NF4A 2DQVA 2A5SA 3VVDA 3MWBA 3PUVE 4KD5A 3AXFA 1N3WA 2UVIA 4R75A 5I56B 3HO7A 1MM7A 2HCAA 1US4A 4R6HA 1VFEA 2QRYA 1DTZA 3O6IA 1P1QA 2XXPA 4GL0A 2X7QA 4ELPA 3T66A 4NF5B 1L5TA 3USDA 1H44A 3FGSA 4HW8A 3N5LA 1QVSA 5DEXA 3Q27A 3FIRA 3OSQA 4POWA 1P1WA 5CM6A 4KCDA 1VR5A 1BLFA 3DP8A 3FASA 3ODBA 2O1LA 1MH4A 4GRKA 3C35A 4DXUA 3PU5A 1B51A 3W15C 3K01A 1SYIA 3HN0A 4JWOA 3IX1A 3TUSA 3OEMA 3IO6A 4YU0A 3ILUB 3FJMA 3TMGA 1LGBC 4ISUA 4O3AA 2AL5A 3PD9A 4Z7EA 3SEUA 2XXTA 4QF9A 2RF1A 4G68B 4F3PA 3IB0A 3QYTA 3SEVA 1QJMA 1LBCA 4OWDA 4I8CA 3ZKKA 1POTA 2IEEA 5I57B 2R6GE 4BLAA 1B3LA 3PPQA 1SYHA 4F31B 3K1PA 3I6VA 2O51A 4EUOA 3TCGA 3D4CA 3C32A 2F6GA 4NWDA 2B3FA 3K2DA 2RC9A 4FIMA 4FEDA 1XHYA 4NF8A 4GVOA 3OMBA 2E1SA 1A55A 1MPCA 2ONRA 5J1DA 1ZLQA 1HSJA 1SI1A 5H8QA 3S2VA 4F3SA 3DP4A 3KG2A 1O7TA 1PB8A 3LBSA 1B1HA 4Q0CA 5I2KA 3VXCA 1TXFA 4EXKA 1B3HA 5A5XB 4LZ5A 1FQDA 3TTMA 1O63A 4PETA 5L8DA 2NVUB 5M2VA 5KCJA 3RT6B 3S9EA 5K2YA 2Z8FA 4DZ1A 3PUWE 4F2QA 1OIBA 4ZDMA 5B70A 4I1DA 3JZJA 4G2ZA 4YKKA 5EHSA 1B7ZA 1LB9A 3FVKA 4AB6A 3C4MA 5CMKA 2CZLA 1B0LA 1HSLA 4PFYA 5K2XA 1IXGA 1EZ9A 4IGTA 1MM6A 1A8EA 2F36A 4ECFA 1RYOA 3TTRA 4F3BA 2DXYA 5EHMA 4ZEBA 1Y4CA 1IXHA 1CE2A 4U1OA 2R71A 5ITOA 3RPWA 3TODA 5LOMA 4MF3A 5JEIA 1B4ZA 1GV8A 1ANFA 4OFJA 4JBZA 1MS7A 3KN8A 4HS7A 4DCXA 3IR1A 3T9HB 1TWYA 3IORA 4H8JA 3N6TA 2ZYNA 4YKJA 3G3KA 1NNTA 2F97A 2UYEA 1LFIA 2R9JA 4DDDA 4R2BA 2HZKA 4ND9A 2F7BA 3Q25A 3GBBA 3MP6A 1P99A 3OENA 1USYH 3N26A 4PE5B 1GVCA 1MY0A 5HBCA 2XD2A 3CSGA 3UK4A 3OELA 3T9UA 4OYVA 4POXA 5TPAB 1MQJA 4M1VA 3S9LC 1DOTA 3IOTA 4PFTA 1NMUA 1M5BA 4DXBA 2RKMA 5I2NA 4Q30B 2B65A 4RJZA 1MQGA 3UA8A 3KEIA 1Q1KA 5H8FA 1JQFA 3V89B 4P0GA 5KDTB 1B3FA 2E0SA 3OO8A 1JW4A 3U93A 3TAJA 3H06B 3H4ZA 4KPTA 4I62A 5IAIA 1QW0A 1N04A 4EDPA 3RUMA 4TLLB 4F1UA 4F18A 3ZKLA 5TP9A 4U21A 2UVGA 4KR5A 4KI0E 1S7YA 3KOTA 3A3CA 3TTKA 3LSWA 4F2OA 3HCQA 3K6UA 3H6TA 3S9MC 4RK2A 1SW4A 3RQTA 3OXNA 3VDFA 4X9TA 4YICA 3KN3A 1YCJA 4TQUQ 3PMWA 3EHSA 3SKPA 1MDP1 3E3KA 3S9NC 4MBPA 3A3UA 3LSLA 2O7UA 3IOUA 4DXCA 2D21A 4F39A 3BKIB 2Q2AA 2H9BA 2O6AA 2ZMBA 3RNNA 2PMSA 1FW0A 3IB2A 3KGCA 1I6QA 1MDQA 4G68A 1RYXA 4H5GA 1DSNA 3BBRA 1QUIA 4G77A 4ELRA 4H65A 2XXRA 3CSBA 2OWSA 3KSJA 5I57A 3QXMA 5AA2D 3QK6A 1SVXB 1URSA 2O1MA 2I6EA 1BP5A 1OLCA 1Y4TA 3FZVA 1GGGA 4ESXA 2HAVA 4EQ9A 4ZZEA 3PD8A 2Y7IA 3B6QA 5FTHA 3UIFA 3SESA 3UORA 3IL1B 4M4GA 3FJ7A 4DLDA 3IOWA 2YPNA 3ZS6A 1B6HA 3K4UA 2QS1A 4OERA 2G93A 2Z8DA 1OMPA 5DVFA 3O6GA 1M5DA 5I84A 1H45A 4GOTA 4R73A 5A5XA 2F7AA 4THIA 3MP8A 3OO7A 3C33A 1Z7NE 1B05A 3TKDA 1JNFA 3GLBA 4YKPA 3M8UA 3PV0E 2ZNTA 4LVQA 2OZZA 4ELOA 1SD3A 1B4HA 1MXUA 4IO7A 5AA1A 1EZPA 4JXIA 1JEUA 3RLFE 2DS9A 4Q8RA 4OFLA 1USYE 3A09A 4KHZE 2ONKE 2Y7KA 1B2HA 1I6AA 1WDNA 2F78A 3MC2A 5CRYA 3CFZA 3UN6A 1ZJLA 3FUZA 2QMWA 3TCHA 1NKXA 1FQCA 3FD3A 2PVUA 2GHBA 3RY3A 4TLMB 1IZ1A 3T22A 3U92A 3TYHA 3TPAA 4F22A 5DYHA 1MQDA 3TZAA 4HCYA 1NFTA 1M5CA 4H8IA 4R74A 4IO3A 3RN8A 4ZZAA 4LONB 4JSOA 3T9XB 5JTYB 1VE4A 3T93B 1MPBA 4U2RA 3KN7A 2QS4A 2Q9TA 3S4UA 2D5WA 3MZ1A 2FNCA 3N94A 3JV9A 3TDJA 2YJPA 2XXIA 2OJTA 1BIYA 4MH5A 5DVJA 3W9VA 2I0BA 1P1OA 3MVXA 3L6HA 3UGWA 3PUXE 1NH8A 4U23A 1IIWA 2Z22A 2HZLA 4IO6A 4RXLA 1MY2A 3V83A 4XIGQ 3D4GA 3FV1A 1ZBMA 1LFHA 1ZIUA 2Y7WA 1SBPA 3LC8A 5H8NB 1JVXA 3HSTA 2DE4A 1OVBA 4IB2A 4KYSA 3VLVA 4YMBA 1LBBA 3FXRA 4OENA 5ICQA 4YZZA 3G3HA 5CMCA 2H5YA 5BUUA 3DELB 1R9LA 5KDTA 3M3KA 5FHMA 3VVEA 2HAUA 3ZSFA 1MPDA 1Q35A 1OQGA 1R6ZA 2AYSA 2QL3A 3O97A 2PX1A 1FQAA 3EQ1A 4IGRA 4MLVA 4IO5A 1B7HA 4GQOA 4OETA 1JVYA 3IO4A 4FJPA 1OLAA 3RT8A 1B32A 2Q89A 1URDA 1N76A 3CVGA 1B40A 2Q88A 3FVOA 4X1DA 1YPNA 2DYXA 1ZTYA 4YMAA 2FA7A 1SI0A 1B3EA 1MY3A 3MVZA 3HV1A 4H67A 3VE1B 4U22A 1FQEA 3GXAA 2V3TA 4YB6A 4HCWA 1XOCA 2NUVA 1NH7A 1D9YA 3VLUA 3KJ7A 1AH5A 3G3FA 2W7YA 2REJA 3FXQA 3WAFA 5ISUA 4H0WA 1MXWA 4IO4A 3LSXA 1Y1ZA 4U4XA 1I69A 2AL4A 2RINA 3PPRA 3B6TA 4NF6B 5I58B 3FVNA 2H25A 1OVTA 1Y3NA 2O7IA 5IKBA 1BTJA 3R26A 4DIGA 4NF4B 4GIZA 1QKBA 4IY5A 3O9PA 4RA1A 3KSXA 3KJTA 5AE4A 1B46A 4N07A 3V8XB 3LSFB 2RC8A 4XKQA 1MY1A 4PP0A 5CC2A 4ZS9A 3HHGA 4NWCA 4DE8A 2QPQA 2F5XA 2ESNA 4P11A 1UQWA 3G3GA 3KFMA 1ZU0A 3EHTA 5DEXB 4GXSB 1POY1 1PB7A 2BJJX 3RTFB 4F29A 3PPPA 5ITPA 5I59B 2OK2A 3CG1A 1Y20A 3IJXB 2A5TA 4LUBA 2P2AA 4GXAA 1SDXA 4R6YA 2DWAA 5CBRA 3CFLA 5FTIA 1XS5A 1LSTA 3OO9A 5ICTA 5AA3A 4EQBA 1T0KA 1MH3A 3H03A 2Q8JA 4BDLA 5I56A 3C34A 3MJNA 4GD5A 1MXVA 2X26A 2XX9A 2Y7RA 3G3IA 4OMBA 3G3JA 4OVJA 2VGQA 4HTGA 4G8HA 2DVZA 1VFDA 4LZ8A 4LP2B 3MAMA 4WEPA 2CMOA 4NF5A 5JTYA 4F1VA 2VOZA 3SETA 4R9FA 3C36A 5KZTA 1MRPA 4AB5A 3EPEA 1H43A 2XX8A 4TOZA 1WODA 1LLSA 1FTMA 4NF8B 4RPOA 5H8QB 3Q26A 3FXUA 4C0RA 1NNFA 2DXRA 2DSFA 3E4RA 4OZ9A 5H8HB 5H8SA 4OHNA 4OESA 3O2AA 2NWJA 3EHUA 1PEBA 1B52A 3QAXA 2QSXA 1EZOA 1TFAA 4N13A 3V5AA 2I49A 5KCJB 4RK9A 1FCKA 1IXCA 1IITA 4XKRA 4BDQA 4F3GA 4RYAA 5BWJA 3H6VA 4X48A 2DWJA 1AMFA 3LUYA 3VFJA 4G8NA 3H6UA 5F7VA 4ZEFA 4FE8A 4YB5A 4Z0IA 2XXHA 1N84A 2ABHA 2OLBA 4R72A 2PT2A 4IO2A 2GFEA 2ZYKA 1PC3A 2V84A 1SW5A 1VSOA 1QUJA 1PDAA 2QJEA 1UIUA 2KLFA 3KZGA 2UYFA 3MZ9A 1XC1A 3N6UA 3TQWA 3OEKA 1MXXA 1XVYA 4LZ7A 2XXQA 3MUQA 2I0CA 4UA8A 2XXWA 5JK4A 1MQIA 1PB9A 5B7DA 1ZKBA 3VXBA 2V93A 3PUZE 3CRBA 3IK6B 3K1NA 5AA4B 3KOSA 2ALUA 4LATA 4C1UA 2VP1A 1US5A 1N7XA 2V3UA 4QSDA 4QFNA 3EF7A 3MQ9A 1H76A 1LAHE 1PBPA 4JWXA 1MG1A 4WXJA 4YAHX 2THIA 1B5JA 2ZXTA 3SEYA 3VV5A 4BDRA 4OTEA 1JW1A 2IA4A 3SDFA 2DVCA 2VD3A 3IAZA 4KCCA 1JEVA 1EU8A 3MPKA 1D9VA 5I2NB 1SW1A 2X7PA 3L6GA 1Z7ME 3E13X 5H8FB 3FJGA 4GFRA 4YB7A 2F6PA 5FHNA 4BDMA 4DCYA 1UIVA 1P1NA 4FECA 3CIJA 4C1TA 1UTBB 4EF1A 3K6VA 2I58A 2REGA 2I4BA 3ILTB 2M8CA 5TP9B 2XXVA 3H3GA 4JDFA 3IOVA 3U94A 4L17A 3I3VA 2QMXA 1MQHA 3O66A 3PMVA 5CMBA 1LAXA 4PFWA 1B1XA 3HHFA 4GF8A 1FQFA 5TPAA 5HPQA 4XKNA 1TT1A 5I59A 1LB8A 4O3BA 2F35A 1B3GA 2DE2A 4F19A 1MXYA 3OO6A 1QULA 1XVXA 3ONMA 5FHOA 4KQPA 2GHAA 4KFQA 2ZNUA 3P7IA 4XTCQ 5CMMA 5L9MA 1IXIA 3ECRA 1R1NA 2ANJA 1LFGA 2I3VA 1Y1MA 2D3IA 4QHQA 4KYEA 4QFOA 3C9HA 4GLIA 2XX7A 2ZYMA 2H4IA 3TCFA 3LR1A 2O68A 4H1XA 2OBGA 5TU0A 4ELQA 1II5A 4EF2A 3FV2A 3QIMA 3FVGA 4KYDA 2OWTA 1H3DA 2V3QA 2O69A 5ELVA 4EQ7A 3F11A 1A54A 1A99A 4GL8A 3FATA 5AA2B 2F8DA 4N6PA 3C31A 2UXAA 1UTHB 2PT1A 3SERA 1JW5A 2UVHA 2DP8A 2FYIA 3RTWB 4JWYA 3QUJA 4G68C 1M5FA 5H8HA 1WVJA 3OOAA 4O3CA 1YTVA 4JSDA 3R6UA 3PPOA 1N7WA 3RGYA 1NNKA 5F1QA 1R9QA 4QFLA 1GTKA 3PPNA 3SEWA 1FTJA 3B7DA 4JB7A 4FAJA 4OQOA 1F9BA 4U1ZA 2B3BA 2RCBA 5L9SA 5HM4B 4QFPA 4QSEA 1LAGE 1B5HA 5DVIA 4Q5TA 2WKYA 1MXZA 3U1OA 2H99A 4ONYA 3Q29A 1Y9UA 3DM0A 1D4NA 3TELA 3R7XA 4ZECA 4K3FA 4AQ4A 2GH9A 4PQJA 5EYFA 4P0IA 2XD3A 4R9GA 1PBQA 2DWHA 4X1BA 4ZEDA 2O84X 3MZBA
chains in the Genus database with same CATH superfamily
3TTLA 2LAOA 2ZYOA 4ZE9A 3O28A 3K0VA 2VHAA 4H6DA 2OCUA 4WKMA 3HPIA 1LBZA 2NXOA 3E9XA 2Y7PA 3TFLA 2HEUA 1IQ7A 5AA4A 3M3FA 4IR8A 1FBCA 2PYYA 3VVFA 4PFUA 4RY1A 1S9TA 1ATGA 3UP9A 1SQYA 4MFIA 2P1SA 4H5FA 3SEXA 4GX3A 4QRZA 3MVWA 2QS2A 1RKMA 1HSEA 2MKZA 5DT6A 3TQLA 2DWIA 4U4SA 3B6WA 2XXXA 3IJOB 1AL3A 4I3YA 4DI3D 4UACA 2Y84A 2I48A 1FBHA 1URGA 3T1BA 1KWHA 1A8FA 4QFKA 2QS3A 4R6KA 3T9VA 3K6WA 4QSCA 3GBAA 2QVUA 1LBWA 4GWOA 1D3KA 3K1MA 1AWBA 3O6HA 3CI8A 1Y3PA 4MLQA 4PAIA 1AIVA 2HQ0A 4GWZA 1QKAA 4ESWA 2XHDA 4GWYA 1UTBA 1FTKA 2H98A 4YKIA 4UABA 4LQ5A 1B9JA 4NE4A 3MPLA 1O64A 4FEBA 4WEDA 2G29A 4XXUA 2Y5KA 4RNSA 3PGFA 4RPNA 3H6WA 2ONSA 2VD2A 3RPLB 1FQBA 2DE3A 1LCFA 2AIXA 1B58A 2F34A 2PBWA 5I2KB 3OD7A 4NAPA 1SW2A 3K00A 3BFUA 4MHFA 5EYHA 1DMBA 2XXYA 2RC7A 5EQ8A 3MP1A 1QUKA 3K02A 1I6BA 1JETA 2NOOA 4OFOA 1SPIA 3BFTA 5H8NA 5IM2A 1ZMGA 3KBRA 1OQHA 4OVSA 2RCAA 1NL5A 4LA9A 5A5LA 4N4UA 5EQAA 5L9OA 1G0IA 5IZ3B 4PC9A 3MVYA 3H7MA 3U72A 4H45A 5EQ9A 1N0TA 4PE3A 3BIGA 4OXVA 3E78A 1B5IA 1B7UA 1A7LA 2Q74A 3TEPA 1TFDA 1YZ0A 2I4CA 4R2FA 1Y3QA 2P0SA 1DPPA 3I5OA 1AOVA 3K6XA 1IMCA 2XA5A 4XEQA 5CI5A 1FPGA 4NMYA 1G0HA 2KQZA 1CB6A 1M5EA 4EXLA 1IMAA 3O29A 1B0HA 3G7WA 4PFRA 2Z23A 4P1EA 4P56A 1N3XA 3WAEA 4QBAA 2I3WA 4XKPA 2V25A 5AA2A 4MIJA 4I9DA 4NEDA 3M3LA 4XF5A 3MW0A 4G4PA 4BDOA 4F1YA 1LBYA 1UTHA 3W9WA 1S50A 3VLWA 3RYDA 2YLNA 2XXUA 3U8QA 2UVJA 3SZPA 1IEJA 3T96B 4LQ2A 1XT8A 4FORA 3CFXA 4ZE8A 4FATA 1LCTA 2PFZA 3GZGA 3LUZA 1ELJA 1NV6A 2DOJA 3THIA 4E0XA 3DP6A 1A40A 3OSRA 3JYRA 3CR9A 4BDNA 2HXWA 1J1NA 3QSLA 1FTLA 1FTOA 4P3LA 1P1UA 4OEUA 2F7CA 4G8MA 3Q28A 1K9YA 4I40A 3MBPA 4NQ8A 3IB1A 3MSTA 3PMXA 1DPEA 1YAEA 1GR2A 2Z8EA 3CG3A 3PUYE 4NTLA 1LAFE 4E0WA 1BKAA 3EN3A 4ZEIA 1MY4A 3TTNA 2A5TB 1EH3A 2HFBA 1IUDA 2ZNSA 2GRVA 5CBSA 3QUFA 4NF6A 2Q2CA 5I58A 4OEVA 1FPKA 4ZEKA 5DTBA 1NNPA 1DTGA 4P8BA 3DLNA 4N81A 4IY6A 4NF4A 2DQVA 2A5SA 4OVRA 4AS5A 3VVDA 2XWKA 3MWBA 4PCDA 3PUVE 4KD5A 3AXFA 1N3WA 3KBZA 2UVIA 4R75A 5I56B 3HO7A 1MM7A 2CEYA 2HCAA 1US4A 2B4LA 3HFUA 4N8YA 4DI4B 4R6HA 1VFEA 2QRYA 1DTZA 3O6IA 5I7IA 2FVZA 1P1QA 2XXPA 2XWOA 4GL0A 1LBVA 2X7QA 4ELPA 3T66A 4NF5B 1L5TA 3USDA 1RDXA 1H44A 3FGSA 3N5LA 4HW8A 1QVSA 1VDWA 5DEXA 3Q27A 3FIRA 3OSQA 4POWA 1P1WA 4PDHA 5CM6A 4KCDA 1D9QA 1VR5A 1BLFA 3DP8A 3FASA 3ODBA 2XXKA 2O1LA 1MH4A 4GRKA 3C35A 4DXUA 3PU5A 1B51A 3W15C 3K01A 1SYIA 3HN0A 4JWOA 3IX1A 3TUSA 3OEMA 4N6KA 3IO6A 4YU0A 3ILUB 3FJMA 5IZ1A 3TMGA 1LGBC 4PBHA 4ISUA 4O3AA 2AL5A 5J16A 3PD9A 4GWWA 4Z7EA 1JP4A 3SEUA 2XXTA 2WYPA 4QF9A 2RF1A 4G68B 4X8RA 4F3PA 3IB0A 3QYTA 3SEVA 1QJMA 4MNCA 1NV0A 1LBCA 4OWDA 2WYKA 4I8CA 1NV1A 3ZKKA 1POTA 2IEEA 5I57B 2R6GE 4BLAA 1B3LA 3PPQA 1SYHA 4F31B 3K1PA 2QFLA 3I6VA 2O51A 4EUOA 3TCGA 3D4CA 2VPNA 2FBPA 3C32A 2F6GA 4NWDA 2B3FA 3K2DA 2RC9A 4FIMA 4FEDA 1XHYA 4NF8A 4GVOA 2CZHA 3OMBA 2E1SA 4PTKA 1A55A 1MPCA 2ONRA 5J1DA 1ZLQA 1HSJA 1SI1A 5H8QA 3S2VA 4F3SA 3DP4A 3KG2A 1O7TA 1PB8A 3LBSA 1B1HA 4Q0CA 5I2KA 3VXCA 1TXFA 4QXDA 4EXKA 1B3HA 5A5XB 4LZ5A 1FQDA 3TTMA 1O63A 4PETA 1FSAA 5L8DA 2NVUB 5M2VA 5KCJA 3RT6B 3S9EA 5K2YA 1NUZA 2Z8FA 4DZ1A 3PUWE 4F2QA 1OIBA 4ZDMA 5B70A 5IZZA 4I1DA 3JZJA 4G2ZA 4YKKA 5EHSA 1B7ZA 1LB9A 3FVKA 3IFCA 4AB6A 3C4MA 5CMKA 2CZLA 4MX6A 1B0LA 1HSLA 4PFYA 5K2XA 1IXGA 1EZ9A 4IGTA 1MM6A 1A8EA 2F36A 4ECFA 1RYOA 2FHYA 3TTRA 4F3BA 2DXYA 1IMDA 5EHMA 4ZEBA 1Y4CA 1IXHA 1CE2A 4U1OA 1FPLA 2R71A 5ITOA 3RPWA 3TODA 4PBQA 5LOMA 1NV3A 4MF3A 5JEIA 1FJ6A 4NG7A 1B4ZA 1GV8A 1ANFA 4OFJA 4JBZA 1MS7A 3KN8A 4HS7A 4DCXA 3IR1A 3T9HB 1TWYA 3IORA 4H8JA 3N6TA 2ZYNA 4YKJA 1INPA 3G3KA 1NNTA 2F97A 2UYEA 2VT5A 1LFIA 2R9JA 4DDDA 4R2BA 2HZKA 4ND9A 2F7BA 3Q25A 3GBBA 3MP6A 4O94A 1P99A 3OENA 1USYH 3N26A 4PE5B 3FBPA 1GVCA 1MY0A 5HBCA 2XD2A 3CSGA 3UK4A 3OELA 3T9UA 4OYVA 4KXPA 4POXA 5TPAB 1MQJA 4M1VA 3S9LC 1DOTA 3IOTA 4PFTA 1NUYA 1NMUA 1M5BA 4DXBA 2RKMA 5I2NA 4Q30B 2B65A 4RJZA 1MQGA 3UA8A 3KEIA 1Q1KA 5H8FA 1JQFA 4AS4A 3V89B 4P0GA 5KDTB 1B3FA 2E0SA 3OO8A 1DBZA 1BK4A 1JW4A 3U93A 3TAJA 3H06B 3H4ZA 4KPTA 3ISPA 4I62A 5IAIA 4JVCA 1QW0A 1N04A 4EDPA 1RDZA 3RUMA 4TLLB 4F1UA 4F18A 3ZKLA 5TP9A 2L5VA 4U21A 5ET5A 4OA4A 2UVGA 4KR5A 4KI0E 1S7YA 3KOTA 3A3CA 3TTKA 4PAFA 3LSWA 4F2OA 3HCQA 3K6UA 3H6TA 3S9MC 4RK2A 1SW4A 3RQTA 3OXNA 3VDFA 1FRPA 4X9TA 4YICA 1NUWA 3KN3A 1KA0A 1YCJA 4TQUQ 3PMWA 3EHSA 3SKPA 1MDP1 3E3KA 3S9NC 4MBPA 3A3UA 3LSLA 2O7UA 3IOUA 4DXCA 2D21A 4NGUA 4F39A 3BKIB 2Q2AA 2H9BA 2O6AA 2ZMBA 4X04A 3RNNA 2PMSA 1Q9DA 1FW0A 3IB2A 3KGCA 2CEXA 4GX4A 1I6QA 1MDQA 4G68A 1RYXA 4H5GA 1EYJA 3B50A 1DSNA 3BBRA 2F3DA 1QUIA 4G77A 4ELRA 4H65A 2XXRA 3B8BA 3CSBA 2OWSA 3KSJA 5I57A 3QXMA 5AA2D 3QK6A 1SVXB 1URSA 2O1MA 2I6EA 1BP5A 1OLCA 1Y4TA 3FZVA 1GGGA 1EYIA 4PGNA 4ESXA 2HAVA 4EQ9A 4ZZEA 3PD8A 2HXRA 2Y7IA 3B6QA 5FTHA 3UIFA 3SESA 3UORA 3IL1B 4M4GA 3FJ7A 1QGXA 3IOWA 4DLDA 2YPNA 4GWSA 3ZS6A 1B6HA 3K4UA 2QS1A 2PFYA 4OERA 2G93A 2Z8DA 1OMPA 5DVFA 4MAGA 3O6GA 1M5DA 5I84A 1H45A 4GOTA 4R73A 4NF0A 5A5XA 2F7AA 4THIA 3MP8A 3OO7A 3C33A 1Z7NE 1B05A 3TKDA 1JNFA 3GLBA 4YKPA 3M8UA 3PV0E 2ZNTA 4LVQA 5ET6A 2OZZA 4ELOA 3IFAA 1SD3A 1B4HA 1MXUA 4IO7A 5AA1A 1EZPA 4JXIA 1JEUA 3RLFE 1KZ8A 2DS9A 4Q8RA 4OFLA 1USYE 3A09A 1FPIA 4KHZE 4LN5A 2ONKE 2Y7KA 1B2HA 1I6AA 1WDNA 2F78A 3MC2A 5CRYA 3CFZA 3UN6A 1ZJLA 3FUZA 2QMWA 3TCHA 1NKXA 1FQCA 3FD3A 2PVUA 2GHBA 3RY3A 4TLMB 1IZ1A 1FPEA 4PFIA 3T22A 3U92A 3TYHA 3TPAA 4F22A 5DYHA 1MQDA 3TZAA 4HCYA 1NFTA 1M5CA 1FBPA 4H8IA 4R74A 4IO3A 3RN8A 4ZZAA 4LONB 4JSOA 3T9XB 5JTYB 1VE4A 3T93B 1MPBA 4U2RA 3KN7A 2QS4A 2Q9TA 3S4UA 2D5WA 3MZ1A 2FNCA 3N94A 3JV9A 3TDJA 2YJPA 4NN3A 2XXIA 2OJTA 1BIYA 4MH5A 5DVJA 3W9VA 1IMFA 4MEVA 2I0BA 1P1OA 3MVXA 3L6HA 3UGWA 3PUXE 1NH8A 4U23A 4OVTA 1IIWA 2Z22A 5ESYA 2HZLA 4IO6A 4RXLA 2OWZA 1MY2A 3V83A 4XIGQ 3D4GA 3FV1A 1ZBMA 1LFHA 1ZIUA 2Y7WA 1SBPA 3E79A 3LC8A 5H8NB 5EQ7A 1YYZA 1JVXA 3HSTA 2DE4A 1OVBA 4IB2A 4KYSA 4MCOA 3VLVA 4YMBA 1LBBA 3FXRA 4MMPA 4OENA 2F3BA 5ICQA 4YZZA 3G3HA 5CMCA 2H5YA 5BUUA 2WEFA 3DELB 1R9LA 5KDTA 3M3KA 5FHMA 4OVPA 3VVEA 2HAUA 3ZSFA 1MPDA 1Q35A 4I3EA 1OQGA 3KC0A 1R6ZA 2AYSA 3KC1A 2QL3A 3O97A 2PX1A 1FQAA 2R8TA 3EQ1A 4IGRA 4MLVA 4IO5A 3BIHA 1B7HA 4GQOA 4OETA 1JVYA 3RPLA 3IO4A 4O7IA 1NUXA 4FJPA 1OLAA 3RT8A 1B32A 2Q89A 1URDA 1N76A 3CVGA 1B40A 2Q88A 3FVOA 4X1DA 1YPNA 2DYXA 5T3JA 1ZTYA 4YMAA 2FA7A 2BJIA 1SI0A 1B3EA 1MY3A 3MVZA 3HV1A 4H67A 3VE1B 4U22A 5F24A 4JVDA 4MNIA 5IZ3A 1FQEA 3GXAA 2V3TA 4YB6A 4HCWA 1XOCA 2NUVA 1NH7A 1D9YA 3VLUA 3KJ7A 1LEVA 1AH5A 3G3FA 2W7YA 5DW8A 2REJA 3FXQA 1XI6A 4G61A 3WAFA 5ISUA 4H0WA 1MXWA 1LBXA 4IO4A 3LSXA 1YXIA 1Y1ZA 5LTCA 4U4XA 1I69A 2AL4A 2RINA 3PPRA 3B6TA 4NF6B 5I58B 3FVNA 2H25A 1OVTA 1Y3NA 2O7IA 5IKBA 1BTJA 3R26A 4DIGA 4NF4B 4GIZA 1QKBA 4IY5A 3O9PA 4RA1A 3KSXA 4JVIA 3KJTA 5AE4A 3FXBA 1B46A 4N07A 2WX9A 2OX3A 3V8XB 3LSFB 4HE2A 4GWXA 2RC8A 4XKQA 4P9KA 1MY1A 4PP0A 4PFBA 5CC2A 4ZS9A 3HHGA 4NWCA 4DE8A 2QPQA 2F5XA 4OVQA 2XWIA 2ESNA 4P11A 4XFEA 1UQWA 3G3GA 2QVVA 3KFMA 1ZU0A 3EHTA 5DEXB 1FBGA 4GXSB 1POY1 1PB7A 2BJJX 3RTFB 4F29A 3PPPA 5ITPA 5I59B 2OK2A 3CG1A 1Y20A 3IJXB 1FPDA 2A5TA 4LUBA 4N6DA 2P2AA 4GXAA 1SDXA 3U65A 4R6YA 2DWAA 2VPOA 5CBRA 1EYKA 3CFLA 5FTIA 1XS5A 1LSTA 3OO9A 5ICTA 5AA3A 4EQBA 1T0KA 1FJ9A 1MH3A 3H03A 1NV4A 1FBEA 2Q8JA 4BDLA 5I56A 3C34A 3MYUA 3MJNA 4GD5A 1MXVA 2X26A 2XX9A 2Y7RA 2PCRA 3G3IA 4OMBA 3G3JA 4OVJA 2VGQA 4HTGA 4G8HA 2DVZA 1VFDA 4LZ8A 4LP2B 4HE1A 3MAMA 4WEPA 2CMOA 4NF5A 5JTYA 4F1VA 2VOZA 3SETA 4R9FA 3C36A 5KZTA 1MRPA 4AB5A 3EPEA 1FPFA 1H43A 2XX8A 4NHBA 3GYYA 3NOHA 4MJOA 4TOZA 1WODA 1LLSA 1FTMA 4NF8B 4RPOA 4FBPA 1FBFA 3CHGA 1FTAA 5H8QB 3QMFA 3Q26A 3FXUA 4C0RA 1NNFA 2DXRA 2HPGA 2DSFA 1FPBA 3E4RA 4OZ9A 1K9ZA 5H8HB 5H8SA 4OHNA 4OESA 3O2AA 2NWJA 3EHUA 1PEBA 1B52A 3QAXA 2QSXA 1EZOA 1TFAA 4N13A 3V5AA 2I49A 2P3VA 1IMBA 5KCJB 4RK9A 1FCKA 1IXCA 1IITA 4XKRA 4BDQA 4F3GA 1IMEA 4RYAA 4P1LA 5BWJA 3H6VA 4X48A 2DWJA 1AMFA 3LUYA 3VFJA 4G8NA 3H6UA 5F7VA 4ZEFA 4FE8A 4YB5A 4Z0IA 2XXHA 1N84A 2ABHA 2OLBA 4GX6A 2Q8MA 4O7MA 4R72A 2PT2A 4IO2A 2GFEA 2ZYKA 1PC3A 2V84A 1SW5A 1VSOA 1QUJA 1PDAA 2FIXA 4N8GA 2QJEA 1UIUA 2KLFA 3KZGA 2UYFA 3D1RA 3MZ9A 1XC1A 1DCUA 3N6UA 3TQWA 3OEKA 1MXXA 1XVYA 4LZ7A 2XXQA 3MUQA 2I0CA 4UA8A 2XXWA 5JK4A 1MQIA 1PB9A 5B7DA 1ZKBA 3VXBA 2V93A 3PUZE 3CRBA 1NV2A 3PTYA 3IK6B 3K1NA 5AA4B 3ROJA 3KOSA 2ALUA 2P3NA 4LATA 4C1UA 2VP1A 1US5A 1N7XA 2V3UA 4QSDA 2WBDA 4O8MA 1RDYA 4QFNA 3EF7A 3MQ9A 1H76A 1LAHE 1PBPA 4JWXA 4PDDA 2XWVA 1MG1A 4WXJA 4YAHX 2THIA 1B5JA 3EKIA 1NI9A 2ZXTA 3SEYA 3VV5A 4BDRA 4OTEA 4PGPA 4N15A 1JW1A 2IA4A 3SDFA 2DVCA 4NX1A 2VD3A 3IAZA 4KCCA 4MNPA 1JEVA 5FBPA 1EU8A 3MPKA 1D9VA 5I2NB 1SW1A 2X7PA 3L6GA 1Z7ME 4PF6A 3E13X 4HXVA 5H8FB 3FJGA 4GFRA 4YB7A 1FPJA 2F6PA 5FHNA 4BDMA 4DCYA 1UIVA 1P1NA 3A29A 4FECA 3CIJA 2ZZXA 4C1TA 1UTBB 4EF1A 3K6VA 2I58A 2REGA 2I4BA 3ILTB 2M8CA 2CZIA 5TP9B 2XXVA 3H3GA 2DDKA 4GBVA 4HE0A 5ET8A 4JDFA 3IOVA 3U94A 4L17A 3I3VA 2QMXA 1MQHA 3O66A 3PMVA 5CMBA 1LAXA 3LV0A 4PFWA 1B1XA 3HHFA 5ET7A 4GF8A 1FQFA 5TPAA 5HPQA 4XKNA 2HHMA 1TT1A 5I59A 1LB8A 4O3BA 2F35A 1B3GA 2DE2A 4F19A 1MXYA 3OO6A 1QULA 4H46A 1XVXA 5I3SA 3ONMA 5FHOA 4KQPA 1CNQA 2GHAA 2Y5LA 4KFQA 2ZNUA 3P7IA 4XTCQ 5CMMA 5L9MA 1IXIA 3ECRA 1R1NA 2ANJA 1LFGA 2I3VA 1Y1MA 2D3IA 4QHQA 4KYEA 4QFOA 3C9HA 4GLIA 2XX7A 1FBDA 2ZYMA 2H4IA 3TCFA 3LR1A 2O68A 5LDZA 4H1XA 4P47A 2ZZVA 2FIEA 5I5PA 2OBGA 5TU0A 4ELQA 1II5A 4EF2A 3FV2A 3QIMA 3FVGA 4KYDA 2OWTA 1H3DA 2V3QA 2V4CA 2O69A 5ELVA 4EQ7A 3F11A 1A54A 1A99A 4GL8A 3FATA 5AA2B 2F8DA 4N6PA 3C31A 2UXAA 1UTHB 2JJKA 2PT1A 4GWUA 2B4MA 3SERA 5IGAA 1JW5A 2UVHA 2DP8A 2FYIA 4PAKA 3RTWB 4JWYA 3QUJA 2CZKA 1NV5A 4PF8A 4G68C 1M5FA 5H8HA 1WVJA 3OOAA 2WBBA 4O3CA 2ZZWA 1YTVA 3T0JA 4JSDA 3R6UA 4N17A 3PPOA 1N7WA 3RGYA 1NNKA 5F1QA 1R9QA 4QFLA 1GTKA 3PPNA 3SEWA 1FTJA 3B7DA 4JB7A 4FAJA 4OQOA 1F9BA 4N91A 4U1ZA 2B3BA 2RCBA 5L9SA 5HM4B 4QFPA 4QSEA 1NV7A 1LAGE 2GQ1A 2KR0A 1B5HA 5DVIA 4Q5TA 2WKYA 5EYGA 1MXZA 1DK4A 1KA1A 3U1OA 4GBWA 2H99A 4ONYA 3Q29A 1Y9UA 3DM0A 1D4NA 3TELA 3R7XA 4ZECA 4K3FA 4AQ4A 2GH9A 2QVRA 4PQJA 5EYFA 4P0IA 2XD3A 4R9GA 1PBQA 2DWHA 4X1BA 4ZEDA 2O84X 4OANA 3MZBA
chains in the Genus database with same CATH topology
3TTLA 2LAOA 2ZYOA 4ZE9A 3O28A 3K0VA 2VHAA 4H6DA 2OCUA 4WKMA 3HPIA 2NXOA 3E9XA 2Y7PA 3TFLA 2HEUA 1IQ7A 5AA4A 3M3FA 2PYYA 3VVFA 4PFUA 4RY1A 1S9TA 1ATGA 3UP9A 1SQYA 4MFIA 2P1SA 4H5FA 3SEXA 4QRZA 3MVWA 2QS2A 1RKMA 1HSEA 5DT6A 3TQLA 2DWIA 4U4SA 3B6WA 2XXXA 3IJOB 1AL3A 4UACA 2Y84A 2I48A 1URGA 1KWHA 1A8FA 4QFKA 2QS3A 4R6KA 3T9VA 3K6WA 4QSCA 3GBAA 4GWOA 1D3KA 3K1MA 3O6HA 3CI8A 1Y3PA 4MLQA 1AIVA 2HQ0A 1QKAA 4ESWA 2XHDA 1UTBA 1FTKA 2H98A 4YKIA 4LQ5A 1B9JA 4NE4A 3MPLA 1O64A 4FEBA 4WEDA 2G29A 4XXUA 4RNSA 3PGFA 4RPNA 3H6WA 2ONSA 2VD2A 1FQBA 2DE3A 1LCFA 2AIXA 1B58A 2F34A 2PBWA 5I2KB 3OD7A 1SW2A 3K00A 3BFUA 1DMBA 2XXYA 2RC7A 3MP1A 1QUKA 3K02A 1I6BA 1JETA 2NOOA 4OFOA 3BFTA 5H8NA 1ZMGA 3KBRA 1OQHA 2RCAA 1NL5A 4LA9A 5L9OA 3MVYA 3H7MA 3U72A 1N0TA 4OXVA 1B5IA 1B7UA 1A7LA 3TEPA 1TFDA 2I4CA 4R2FA 1Y3QA 2P0SA 1DPPA 3I5OA 1AOVA 3K6XA 5CI5A 4NMYA 1CB6A 1M5EA 4EXLA 3O29A 1B0HA 3G7WA 2Z23A 1N3XA 3WAEA 2I3WA 4XKPA 2V25A 5AA2A 4I9DA 4NEDA 3M3LA 3MW0A 4G4PA 4BDOA 4F1YA 1UTHA 3W9WA 1S50A 3VLWA 2YLNA 2XXUA 3U8QA 2UVJA 1IEJA 3T96B 4LQ2A 1XT8A 4FORA 3CFXA 4ZE8A 4FATA 1LCTA 3GZGA 1ELJA 2DOJA 3THIA 4E0XA 3DP6A 1A40A 3OSRA 3JYRA 3CR9A 4BDNA 2HXWA 1J1NA 3QSLA 1FTLA 1FTOA 1P1UA 4OEUA 2F7CA 4G8MA 3Q28A 3MBPA 3IB1A 3PMXA 1DPEA 1YAEA 1GR2A 2Z8EA 3CG3A 3PUYE 4NTLA 1LAFE 4E0WA 1BKAA 3EN3A 4ZEIA 1MY4A 3TTNA 2A5TB 1EH3A 2HFBA 1IUDA 2ZNSA 2GRVA 5CBSA 3QUFA 4NF6A 2Q2CA 5I58A 4OEVA 4ZEKA 5DTBA 1NNPA 1DTGA 3DLNA 4IY6A 4NF4A 2DQVA 2A5SA 3VVDA 3MWBA 3PUVE 4KD5A 3AXFA 1N3WA 2UVIA 4R75A 5I56B 3HO7A 1MM7A 2HCAA 1US4A 4R6HA 1VFEA 2QRYA 1DTZA 3O6IA 1P1QA 2XXPA 4GL0A 2X7QA 4ELPA 3T66A 4NF5B 1L5TA 3USDA 1H44A 3FGSA 4HW8A 3N5LA 1QVSA 5DEXA 3Q27A 3FIRA 3OSQA 4POWA 1P1WA 5CM6A 4KCDA 1VR5A 1BLFA 3DP8A 3FASA 3ODBA 2O1LA 1MH4A 4GRKA 3C35A 4DXUA 3PU5A 1B51A 3W15C 3K01A 1SYIA 3HN0A 4JWOA 3IX1A 3TUSA 3OEMA 3IO6A 4YU0A 3ILUB 3FJMA 3TMGA 1LGBC 4ISUA 4O3AA 2AL5A 3PD9A 4Z7EA 3SEUA 2XXTA 4QF9A 2RF1A 4G68B 4F3PA 3IB0A 3QYTA 3SEVA 1QJMA 1LBCA 4OWDA 4I8CA 3ZKKA 1POTA 2IEEA 5I57B 2R6GE 4BLAA 1B3LA 3PPQA 1SYHA 4F31B 3K1PA 3I6VA 2O51A 4EUOA 3TCGA 3D4CA 3C32A 2F6GA 4NWDA 2B3FA 3K2DA 2RC9A 4FIMA 4FEDA 1XHYA 4NF8A 4GVOA 3OMBA 2E1SA 1A55A 1MPCA 2ONRA 5J1DA 1ZLQA 1HSJA 1SI1A 5H8QA 3S2VA 4F3SA 3DP4A 3KG2A 1O7TA 1PB8A 3LBSA 1B1HA 4Q0CA 5I2KA 3VXCA 1TXFA 4EXKA 1B3HA 5A5XB 4LZ5A 1FQDA 3TTMA 1O63A 4PETA 5L8DA 2NVUB 5M2VA 5KCJA 3RT6B 3S9EA 5K2YA 2Z8FA 4DZ1A 3PUWE 4F2QA 1OIBA 4ZDMA 5B70A 4I1DA 3JZJA 4G2ZA 4YKKA 5EHSA 1B7ZA 1LB9A 3FVKA 4AB6A 3C4MA 5CMKA 2CZLA 1B0LA 1HSLA 4PFYA 5K2XA 1IXGA 1EZ9A 4IGTA 1MM6A 1A8EA 2F36A 4ECFA 1RYOA 3TTRA 4F3BA 2DXYA 5EHMA 4ZEBA 1Y4CA 1IXHA 1CE2A 4U1OA 2R71A 5ITOA 3RPWA 3TODA 5LOMA 4MF3A 5JEIA 1B4ZA 1GV8A 1ANFA 4OFJA 4JBZA 1MS7A 3KN8A 4HS7A 4DCXA 3IR1A 3T9HB 1TWYA 3IORA 4H8JA 3N6TA 2ZYNA 4YKJA 3G3KA 1NNTA 2F97A 2UYEA 1LFIA 2R9JA 4DDDA 4R2BA 2HZKA 4ND9A 2F7BA 3Q25A 3GBBA 3MP6A 1P99A 3OENA 1USYH 3N26A 4PE5B 1GVCA 1MY0A 5HBCA 2XD2A 3CSGA 3UK4A 3OELA 3T9UA 4OYVA 4POXA 5TPAB 1MQJA 4M1VA 3S9LC 1DOTA 3IOTA 4PFTA 1NMUA 1M5BA 4DXBA 2RKMA 5I2NA 4Q30B 2B65A 4RJZA 1MQGA 3UA8A 3KEIA 1Q1KA 5H8FA 1JQFA 3V89B 4P0GA 5KDTB 1B3FA 2E0SA 3OO8A 1JW4A 3U93A 3TAJA 3H06B 3H4ZA 4KPTA 4I62A 5IAIA 1QW0A 1N04A 4EDPA 3RUMA 4TLLB 4F1UA 4F18A 3ZKLA 5TP9A 4U21A 2UVGA 4KR5A 4KI0E 1S7YA 3KOTA 3A3CA 3TTKA 3LSWA 4F2OA 3HCQA 3K6UA 3H6TA 3S9MC 4RK2A 1SW4A 3RQTA 3OXNA 3VDFA 4X9TA 4YICA 3KN3A 1YCJA 4TQUQ 3PMWA 3EHSA 3SKPA 1MDP1 3E3KA 3S9NC 4MBPA 3A3UA 3LSLA 2O7UA 3IOUA 4DXCA 2D21A 4F39A 3BKIB 2Q2AA 2H9BA 2O6AA 2ZMBA 3RNNA 2PMSA 1FW0A 3IB2A 3KGCA 1I6QA 1MDQA 4G68A 1RYXA 4H5GA 1DSNA 3BBRA 1QUIA 4G77A 4ELRA 4H65A 2XXRA 3CSBA 2OWSA 3KSJA 5I57A 3QXMA 5AA2D 3QK6A 1SVXB 1URSA 2O1MA 2I6EA 1BP5A 1OLCA 1Y4TA 3FZVA 1GGGA 4ESXA 2HAVA 4EQ9A 4ZZEA 3PD8A 2Y7IA 3B6QA 5FTHA 3UIFA 3SESA 3UORA 3IL1B 4M4GA 3FJ7A 4DLDA 3IOWA 2YPNA 3ZS6A 1B6HA 3K4UA 2QS1A 4OERA 2G93A 2Z8DA 1OMPA 5DVFA 3O6GA 1M5DA 5I84A 1H45A 4GOTA 4R73A 5A5XA 2F7AA 4THIA 3MP8A 3OO7A 3C33A 1Z7NE 1B05A 3TKDA 1JNFA 3GLBA 4YKPA 3M8UA 3PV0E 2ZNTA 4LVQA 2OZZA 4ELOA 1SD3A 1B4HA 1MXUA 4IO7A 5AA1A 1EZPA 4JXIA 1JEUA 3RLFE 2DS9A 4Q8RA 4OFLA 1USYE 3A09A 4KHZE 2ONKE 2Y7KA 1B2HA 1I6AA 1WDNA 2F78A 3MC2A 5CRYA 3CFZA 3UN6A 1ZJLA 3FUZA 2QMWA 3TCHA 1NKXA 1FQCA 3FD3A 2PVUA 2GHBA 3RY3A 4TLMB 1IZ1A 3T22A 3U92A 3TYHA 3TPAA 4F22A 5DYHA 1MQDA 3TZAA 4HCYA 1NFTA 1M5CA 4H8IA 4R74A 4IO3A 3RN8A 4ZZAA 4LONB 4JSOA 3T9XB 5JTYB 1VE4A 3T93B 1MPBA 4U2RA 3KN7A 2QS4A 2Q9TA 3S4UA 2D5WA 3MZ1A 2FNCA 3N94A 3JV9A 3TDJA 2YJPA 2XXIA 2OJTA 1BIYA 4MH5A 5DVJA 3W9VA 2I0BA 1P1OA 3MVXA 3L6HA 3UGWA 3PUXE 1NH8A 4U23A 1IIWA 2Z22A 2HZLA 4IO6A 4RXLA 1MY2A 3V83A 4XIGQ 3D4GA 3FV1A 1ZBMA 1LFHA 1ZIUA 2Y7WA 1SBPA 3LC8A 5H8NB 1JVXA 3HSTA 2DE4A 1OVBA 4IB2A 4KYSA 3VLVA 4YMBA 1LBBA 3FXRA 4OENA 5ICQA 4YZZA 3G3HA 5CMCA 2H5YA 5BUUA 3DELB 1R9LA 5KDTA 3M3KA 5FHMA 3VVEA 2HAUA 3ZSFA 1MPDA 1Q35A 1OQGA 1R6ZA 2AYSA 2QL3A 3O97A 2PX1A 1FQAA 3EQ1A 4IGRA 4MLVA 4IO5A 1B7HA 4GQOA 4OETA 1JVYA 3IO4A 4FJPA 1OLAA 3RT8A 1B32A 2Q89A 1URDA 1N76A 3CVGA 1B40A 2Q88A 3FVOA 4X1DA 1YPNA 2DYXA 1ZTYA 4YMAA 2FA7A 1SI0A 1B3EA 1MY3A 3MVZA 3HV1A 4H67A 3VE1B 4U22A 1FQEA 3GXAA 2V3TA 4YB6A 4HCWA 1XOCA 2NUVA 1NH7A 1D9YA 3VLUA 3KJ7A 1AH5A 3G3FA 2W7YA 2REJA 3FXQA 3WAFA 5ISUA 4H0WA 1MXWA 4IO4A 3LSXA 1Y1ZA 4U4XA 1I69A 2AL4A 2RINA 3PPRA 3B6TA 4NF6B 5I58B 3FVNA 2H25A 1OVTA 1Y3NA 2O7IA 5IKBA 1BTJA 3R26A 4DIGA 4NF4B 4GIZA 1QKBA 4IY5A 3O9PA 4RA1A 3KSXA 3KJTA 5AE4A 1B46A 4N07A 3V8XB 3LSFB 2RC8A 4XKQA 1MY1A 4PP0A 5CC2A 4ZS9A 3HHGA 4NWCA 4DE8A 2QPQA 2F5XA 2ESNA 4P11A 1UQWA 3G3GA 3KFMA 1ZU0A 3EHTA 5DEXB 4GXSB 1POY1 1PB7A 2BJJX 3RTFB 4F29A 3PPPA 5ITPA 5I59B 2OK2A 3CG1A 1Y20A 3IJXB 2A5TA 4LUBA 2P2AA 4GXAA 1SDXA 4R6YA 2DWAA 5CBRA 3CFLA 5FTIA 1XS5A 1LSTA 3OO9A 5ICTA 5AA3A 4EQBA 1T0KA 1MH3A 3H03A 2Q8JA 4BDLA 5I56A 3C34A 3MJNA 4GD5A 1MXVA 2X26A 2XX9A 2Y7RA 3G3IA 4OMBA 3G3JA 4OVJA 2VGQA 4HTGA 4G8HA 2DVZA 1VFDA 4LZ8A 4LP2B 3MAMA 4WEPA 2CMOA 4NF5A 5JTYA 4F1VA 2VOZA 3SETA 4R9FA 3C36A 5KZTA 1MRPA 4AB5A 3EPEA 1H43A 2XX8A 4TOZA 1WODA 1LLSA 1FTMA 4NF8B 4RPOA 5H8QB 3Q26A 3FXUA 4C0RA 1NNFA 2DXRA 2DSFA 3E4RA 4OZ9A 5H8HB 5H8SA 4OHNA 4OESA 3O2AA 2NWJA 3EHUA 1PEBA 1B52A 3QAXA 2QSXA 1EZOA 1TFAA 4N13A 3V5AA 2I49A 5KCJB 4RK9A 1FCKA 1IXCA 1IITA 4XKRA 4BDQA 4F3GA 4RYAA 5BWJA 3H6VA 4X48A 2DWJA 1AMFA 3LUYA 3VFJA 4G8NA 3H6UA 5F7VA 4ZEFA 4FE8A 4YB5A 4Z0IA 2XXHA 1N84A 2ABHA 2OLBA 4R72A 2PT2A 4IO2A 2GFEA 2ZYKA 1PC3A 2V84A 1SW5A 1VSOA 1QUJA 1PDAA 2QJEA 1UIUA 2KLFA 3KZGA 2UYFA 3MZ9A 1XC1A 3N6UA 3TQWA 3OEKA 1MXXA 1XVYA 4LZ7A 2XXQA 3MUQA 2I0CA 4UA8A 2XXWA 5JK4A 1MQIA 1PB9A 5B7DA 1ZKBA 3VXBA 2V93A 3PUZE 3CRBA 3IK6B 3K1NA 5AA4B 3KOSA 2ALUA 4LATA 4C1UA 2VP1A 1US5A 1N7XA 2V3UA 4QSDA 4QFNA 3EF7A 3MQ9A 1H76A 1LAHE 1PBPA 4JWXA 1MG1A 4WXJA 4YAHX 2THIA 1B5JA 2ZXTA 3SEYA 3VV5A 4BDRA 4OTEA 1JW1A 2IA4A 3SDFA 2DVCA 2VD3A 3IAZA 4KCCA 1JEVA 1EU8A 3MPKA 1D9VA 5I2NB 1SW1A 2X7PA 3L6GA 1Z7ME 3E13X 5H8FB 3FJGA 4GFRA 4YB7A 2F6PA 5FHNA 4BDMA 4DCYA 1UIVA 1P1NA 4FECA 3CIJA 4C1TA 1UTBB 4EF1A 3K6VA 2I58A 2REGA 2I4BA 3ILTB 2M8CA 5TP9B 2XXVA 3H3GA 4JDFA 3IOVA 3U94A 4L17A 3I3VA 2QMXA 1MQHA 3O66A 3PMVA 5CMBA 1LAXA 4PFWA 1B1XA 3HHFA 4GF8A 1FQFA 5TPAA 5HPQA 4XKNA 1TT1A 5I59A 1LB8A 4O3BA 2F35A 1B3GA 2DE2A 4F19A 1MXYA 3OO6A 1QULA 1XVXA 3ONMA 5FHOA 4KQPA 2GHAA 4KFQA 2ZNUA 3P7IA 4XTCQ 5CMMA 5L9MA 1IXIA 3ECRA 1R1NA 2ANJA 1LFGA 2I3VA 1Y1MA 2D3IA 4QHQA 4KYEA 4QFOA 3C9HA 4GLIA 2XX7A 2ZYMA 2H4IA 3TCFA 3LR1A 2O68A 4H1XA 2OBGA 5TU0A 4ELQA 1II5A 4EF2A 3FV2A 3QIMA 3FVGA 4KYDA 2OWTA 1H3DA 2V3QA 2O69A 5ELVA 4EQ7A 3F11A 1A54A 1A99A 4GL8A 3FATA 5AA2B 2F8DA 4N6PA 3C31A 2UXAA 1UTHB 2PT1A 3SERA 1JW5A 2UVHA 2DP8A 2FYIA 3RTWB 4JWYA 3QUJA 4G68C 1M5FA 5H8HA 1WVJA 3OOAA 4O3CA 1YTVA 4JSDA 3R6UA 3PPOA 1N7WA 3RGYA 1NNKA 5F1QA 1R9QA 4QFLA 1GTKA 3PPNA 3SEWA 1FTJA 3B7DA 4JB7A 4FAJA 4OQOA 1F9BA 4U1ZA 2B3BA 2RCBA 5L9SA 5HM4B 4QFPA 4QSEA 1LAGE 1B5HA 5DVIA 4Q5TA 2WKYA 1MXZA 3U1OA 2H99A 4ONYA 3Q29A 1Y9UA 3DM0A 1D4NA 3TELA 3R7XA 4ZECA 4K3FA 4AQ4A 2GH9A 4PQJA 5EYFA 4P0IA 2XD3A 4R9GA 1PBQA 2DWHA 4X1BA 4ZEDA 2O84X 3MZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTL A;  2LAO A;  2ZYO A;  4ZE9 A;  3O28 A;  3K0V A;  2VHA A;  4H6D A;  2OCU A;  4WKM A;  3HPI A;  2NXO A;  3E9X A;  2Y7P A;  3TFL A;  2HEU A;  1IQ7 A;  5AA4 A;  3M3F A;  2PYY A;  3VVF A;  4PFU A;  4RY1 A;  1S9T A;  1ATG A;  3UP9 A;  1SQY A;  4MFI A;  2P1S A;  4H5F A;  3SEX A;  4QRZ A;  3MVW A;  2QS2 A;  1RKM A;  1HSE A;  5DT6 A;  3TQL A;  2DWI A;  4U4S A;  3B6W A;  2XXX A;  3IJO B;  1AL3 A;  4UAC A;  2Y84 A;  2I48 A;  1URG A;  1KWH A;  1A8F A;  4QFK A;  2QS3 A;  4R6K A;  3T9V A;  3K6W A;  4QSC A;  3GBA A;  4GWO A;  1D3K A;  3K1M A;  3O6H A;  3CI8 A;  1Y3P A;  4MLQ A;  1AIV A;  2HQ0 A;  1QKA A;  4ESW A;  2XHD A;  1UTB A;  1FTK A;  2H98 A;  4YKI A;  4LQ5 A;  1B9J A;  4NE4 A;  3MPL A;  1O64 A;  4FEB A;  4WED A;  2G29 A;  4XXU A;  4RNS A;  3PGF A;  4RPN A;  3H6W A;  2ONS A;  2VD2 A;  1FQB A;  2DE3 A;  1LCF A;  2AIX A;  1B58 A;  2F34 A;  2PBW A;  5I2K B;  3OD7 A;  1SW2 A;  3K00 A;  3BFU A;  1DMB A;  2XXY A;  2RC7 A;  3MP1 A;  1QUK A;  3K02 A;  1I6B A;  1JET A;  2NOO A;  4OFO A;  3BFT A;  5H8N A;  1ZMG A;  3KBR A;  1OQH A;  2RCA A;  1NL5 A;  4LA9 A;  5L9O A;  3MVY A;  3H7M A;  3U72 A;  1N0T A;  4OXV A;  1B5I A;  1B7U A;  1A7L A;  3TEP A;  1TFD A;  2I4C A;  4R2F A;  1Y3Q A;  2P0S A;  1DPP A;  3I5O A;  1AOV A;  3K6X A;  5CI5 A;  4NMY A;  1CB6 A;  1M5E A;  4EXL A;  3O29 A;  1B0H A;  3G7W A;  2Z23 A;  1N3X A;  3WAE A;  2I3W A;  4XKP A;  2V25 A;  5AA2 A;  4I9D A;  4NED A;  3M3L A;  3MW0 A;  4G4P A;  4BDO A;  4F1Y A;  1UTH A;  3W9W A;  1S50 A;  3VLW A;  2YLN A;  2XXU A;  3U8Q A;  2UVJ A;  1IEJ A;  3T96 B;  4LQ2 A;  1XT8 A;  4FOR A;  3CFX A;  4ZE8 A;  4FAT A;  1LCT A;  3GZG A;  1ELJ A;  2DOJ A;  3THI A;  4E0X A;  3DP6 A;  1A40 A;  3OSR A;  3JYR A;  3CR9 A;  4BDN A;  2HXW A;  1J1N A;  3QSL A;  1FTL A;  1FTO A;  1P1U A;  4OEU A;  2F7C A;  4G8M A;  3Q28 A;  3MBP A;  3IB1 A;  3PMX A;  1DPE A;  1YAE A;  1GR2 A;  2Z8E A;  3CG3 A;  3PUY E;  4NTL A;  1LAF E;  4E0W A;  1BKA A;  3EN3 A;  4ZEI A;  1MY4 A;  3TTN A;  2A5T B;  1EH3 A;  2HFB A;  1IUD A;  2ZNS A;  2GRV A;  5CBS A;  3QUF A;  4NF6 A;  2Q2C A;  5I58 A;  4OEV A;  4ZEK A;  5DTB A;  1NNP A;  1DTG A;  3DLN A;  4IY6 A;  4NF4 A;  2DQV A;  2A5S A;  3VVD A;  3MWB A;  3PUV E;  4KD5 A;  3AXF A;  1N3W A;  2UVI A;  4R75 A;  5I56 B;  3HO7 A;  1MM7 A;  2HCA A;  1US4 A;  4R6H A;  1VFE A;  2QRY A;  1DTZ A;  3O6I A;  1P1Q A;  2XXP A;  4GL0 A;  2X7Q A;  4ELP A;  3T66 A;  4NF5 B;  1L5T A;  3USD A;  1H44 A;  3FGS A;  4HW8 A;  3N5L A;  1QVS A;  5DEX A;  3Q27 A;  3FIR A;  3OSQ A;  4POW A;  1P1W A;  5CM6 A;  4KCD A;  1VR5 A;  1BLF A;  3DP8 A;  3FAS A;  3ODB A;  2O1L A;  1MH4 A;  4GRK A;  3C35 A;  4DXU A;  3PU5 A;  1B51 A;  3W15 C;  3K01 A;  1SYI A;  3HN0 A;  4JWO A;  3IX1 A;  3TUS A;  3OEM A;  3IO6 A;  4YU0 A;  3ILU B;  3FJM A;  3TMG A;  1LGB C;  4ISU A;  4O3A A;  2AL5 A;  3PD9 A;  4Z7E A;  3SEU A;  2XXT A;  4QF9 A;  2RF1 A;  4G68 B;  4F3P A;  3IB0 A;  3QYT A;  3SEV A;  1QJM A;  1LBC A;  4OWD A;  4I8C A;  3ZKK A;  1POT A;  2IEE A;  5I57 B;  2R6G E;  4BLA A;  1B3L A;  3PPQ A;  1SYH A;  4F31 B;  3K1P A;  3I6V A;  2O51 A;  4EUO A;  3TCG A;  3D4C A;  3C32 A;  2F6G A;  4NWD A;  2B3F A;  3K2D A;  2RC9 A;  4FIM A;  4FED A;  1XHY A;  4NF8 A;  4GVO A;  3OMB A;  2E1S A;  1A55 A;  1MPC A;  2ONR A;  5J1D A;  1ZLQ A;  1HSJ A;  1SI1 A;  5H8Q A;  3S2V A;  4F3S A;  3DP4 A;  3KG2 A;  1O7T A;  1PB8 A;  3LBS A;  1B1H A;  4Q0C A;  5I2K A;  3VXC A;  1TXF A;  4EXK A;  1B3H A;  5A5X B;  4LZ5 A;  1FQD A;  3TTM A;  1O63 A;  4PET A;  5L8D A;  2NVU B;  5M2V A;  5KCJ A;  3RT6 B;  3S9E A;  5K2Y A;  2Z8F A;  4DZ1 A;  3PUW E;  4F2Q A;  1OIB A;  4ZDM A;  5B70 A;  4I1D A;  3JZJ A;  4G2Z A;  4YKK A;  5EHS A;  1B7Z A;  1LB9 A;  3FVK A;  4AB6 A;  3C4M A;  5CMK A;  2CZL A;  1B0L A;  1HSL A;  4PFY A;  5K2X A;  1IXG A;  1EZ9 A;  4IGT A;  1MM6 A;  1A8E A;  2F36 A;  4ECF A;  1RYO A;  3TTR A;  4F3B A;  2DXY A;  5EHM A;  4ZEB A;  1Y4C A;  1IXH A;  1CE2 A;  4U1O A;  2R71 A;  5ITO A;  3RPW A;  3TOD A;  5LOM A;  4MF3 A;  5JEI A;  1B4Z A;  1GV8 A;  1ANF A;  4OFJ A;  4JBZ A;  1MS7 A;  3KN8 A;  4HS7 A;  4DCX A;  3IR1 A;  3T9H B;  1TWY A;  3IOR A;  4H8J A;  3N6T A;  2ZYN A;  4YKJ A;  3G3K A;  1NNT A;  2F97 A;  2UYE A;  1LFI A;  2R9J A;  4DDD A;  4R2B A;  2HZK A;  4ND9 A;  2F7B A;  3Q25 A;  3GBB A;  3MP6 A;  1P99 A;  3OEN A;  1USY H;  3N26 A;  4PE5 B;  1GVC A;  1MY0 A;  5HBC A;  2XD2 A;  3CSG A;  3UK4 A;  3OEL A;  3T9U A;  4OYV A;  4POX A;  5TPA B;  1MQJ A;  4M1V A;  3S9L C;  1DOT A;  3IOT A;  4PFT A;  1NMU A;  1M5B A;  4DXB A;  2RKM A;  5I2N A;  4Q30 B;  2B65 A;  4RJZ A;  1MQG A;  3UA8 A;  3KEI A;  1Q1K A;  5H8F A;  1JQF A;  3V89 B;  4P0G A;  5KDT B;  1B3F A;  2E0S A;  3OO8 A;  1JW4 A;  3U93 A;  3TAJ A;  3H06 B;  3H4Z A;  4KPT A;  4I62 A;  5IAI A;  1QW0 A;  1N04 A;  4EDP A;  3RUM A;  4TLL B;  4F1U A;  4F18 A;  3ZKL A;  5TP9 A;  4U21 A;  2UVG A;  4KR5 A;  4KI0 E;  1S7Y A;  3KOT A;  3A3C A;  3TTK A;  3LSW A;  4F2O A;  3HCQ A;  3K6U A;  3H6T A;  3S9M C;  4RK2 A;  1SW4 A;  3RQT A;  3OXN A;  3VDF A;  4X9T A;  4YIC A;  3KN3 A;  1YCJ A;  4TQU Q;  3PMW A;  3EHS A;  3SKP A;  1MDP 1;  3E3K A;  3S9N C;  4MBP A;  3A3U A;  3LSL A;  2O7U A;  3IOU A;  4DXC A;  2D21 A;  4F39 A;  3BKI B;  2Q2A A;  2H9B A;  2O6A A;  2ZMB A;  3RNN A;  2PMS A;  1FW0 A;  3IB2 A;  3KGC A;  1I6Q A;  1MDQ A;  4G68 A;  1RYX A;  4H5G A;  1DSN A;  3BBR A;  1QUI A;  4G77 A;  4ELR A;  4H65 A;  2XXR A;  3CSB A;  2OWS A;  3KSJ A;  5I57 A;  3QXM A;  5AA2 D;  3QK6 A;  1SVX B;  1URS A;  2O1M A;  2I6E A;  1BP5 A;  1OLC A;  1Y4T A;  3FZV A;  1GGG A;  4ESX A;  2HAV A;  4EQ9 A;  4ZZE A;  3PD8 A;  2Y7I A;  3B6Q A;  5FTH A;  3UIF A;  3SES A;  3UOR A;  3IL1 B;  4M4G A;  3FJ7 A;  4DLD A;  3IOW A;  2YPN A;  3ZS6 A;  1B6H A;  3K4U A;  2QS1 A;  4OER A;  2G93 A;  2Z8D A;  1OMP A;  5DVF A;  3O6G A;  1M5D A;  5I84 A;  1H45 A;  4GOT A;  4R73 A;  5A5X A;  2F7A A;  4THI A;  3MP8 A;  3OO7 A;  3C33 A;  1Z7N E;  1B05 A;  3TKD A;  1JNF A;  3GLB A;  4YKP A;  3M8U A;  3PV0 E;  2ZNT A;  4LVQ A;  2OZZ A;  4ELO A;  1SD3 A;  1B4H A;  1MXU A;  4IO7 A;  5AA1 A;  1EZP A;  4JXI A;  1JEU A;  3RLF E;  2DS9 A;  4Q8R A;  4OFL A;  1USY E;  3A09 A;  4KHZ E;  2ONK E;  2Y7K A;  1B2H A;  1I6A A;  1WDN A;  2F78 A;  3MC2 A;  5CRY A;  3CFZ A;  3UN6 A;  1ZJL A;  3FUZ A;  2QMW A;  3TCH A;  1NKX A;  1FQC A;  3FD3 A;  2PVU A;  2GHB A;  3RY3 A;  4TLM B;  1IZ1 A;  3T22 A;  3U92 A;  3TYH A;  3TPA A;  4F22 A;  5DYH A;  1MQD A;  3TZA A;  4HCY A;  1NFT A;  1M5C A;  4H8I A;  4R74 A;  4IO3 A;  3RN8 A;  4ZZA A;  4LON B;  4JSO A;  3T9X B;  5JTY B;  1VE4 A;  3T93 B;  1MPB A;  4U2R A;  3KN7 A;  2QS4 A;  2Q9T A;  3S4U A;  2D5W A;  3MZ1 A;  2FNC A;  3N94 A;  3JV9 A;  3TDJ A;  2YJP A;  2XXI A;  2OJT A;  1BIY A;  4MH5 A;  5DVJ A;  3W9V A;  2I0B A;  1P1O A;  3MVX A;  3L6H A;  3UGW A;  3PUX E;  1NH8 A;  4U23 A;  1IIW A;  2Z22 A;  2HZL A;  4IO6 A;  4RXL A;  1MY2 A;  3V83 A;  4XIG Q;  3D4G A;  3FV1 A;  1ZBM A;  1LFH A;  1ZIU A;  2Y7W A;  1SBP A;  3LC8 A;  5H8N B;  1JVX A;  3HST A;  2DE4 A;  1OVB A;  4IB2 A;  4KYS A;  3VLV A;  4YMB A;  1LBB A;  3FXR A;  4OEN A;  5ICQ A;  4YZZ A;  3G3H A;  5CMC A;  2H5Y A;  5BUU A;  3DEL B;  1R9L A;  5KDT A;  3M3K A;  5FHM A;  3VVE A;  2HAU A;  3ZSF A;  1MPD A;  1Q35 A;  1OQG A;  1R6Z A;  2AYS A;  2QL3 A;  3O97 A;  2PX1 A;  1FQA A;  3EQ1 A;  4IGR A;  4MLV A;  4IO5 A;  1B7H A;  4GQO A;  4OET A;  1JVY A;  3IO4 A;  4FJP A;  1OLA A;  3RT8 A;  1B32 A;  2Q89 A;  1URD A;  1N76 A;  3CVG A;  1B40 A;  2Q88 A;  3FVO A;  4X1D A;  1YPN A;  2DYX A;  1ZTY A;  4YMA A;  2FA7 A;  1SI0 A;  1B3E A;  1MY3 A;  3MVZ A;  3HV1 A;  4H67 A;  3VE1 B;  4U22 A;  1FQE A;  3GXA A;  2V3T A;  4YB6 A;  4HCW A;  1XOC A;  2NUV A;  1NH7 A;  1D9Y A;  3VLU A;  3KJ7 A;  1AH5 A;  3G3F A;  2W7Y A;  2REJ A;  3FXQ A;  3WAF A;  5ISU A;  4H0W A;  1MXW A;  4IO4 A;  3LSX A;  1Y1Z A;  4U4X A;  1I69 A;  2AL4 A;  2RIN A;  3PPR A;  3B6T A;  4NF6 B;  5I58 B;  3FVN A;  2H25 A;  1OVT A;  1Y3N A;  2O7I A;  5IKB A;  1BTJ A;  3R26 A;  4DIG A;  4NF4 B;  4GIZ A;  1QKB A;  4IY5 A;  3O9P A;  4RA1 A;  3KSX A;  3KJT A;  5AE4 A;  1B46 A;  4N07 A;  3V8X B;  3LSF B;  2RC8 A;  4XKQ A;  1MY1 A;  4PP0 A;  5CC2 A;  4ZS9 A;  3HHG A;  4NWC A;  4DE8 A;  2QPQ A;  2F5X A;  2ESN A;  4P11 A;  1UQW A;  3G3G A;  3KFM A;  1ZU0 A;  3EHT A;  5DEX B;  4GXS B;  1POY 1;  1PB7 A;  2BJJ X;  3RTF B;  4F29 A;  3PPP A;  5ITP A;  5I59 B;  2OK2 A;  3CG1 A;  1Y20 A;  3IJX B;  2A5T A;  4LUB A;  2P2A A;  4GXA A;  1SDX A;  4R6Y A;  2DWA A;  5CBR A;  3CFL A;  5FTI A;  1XS5 A;  1LST A;  3OO9 A;  5ICT A;  5AA3 A;  4EQB A;  1T0K A;  1MH3 A;  3H03 A;  2Q8J A;  4BDL A;  5I56 A;  3C34 A;  3MJN A;  4GD5 A;  1MXV A;  2X26 A;  2XX9 A;  2Y7R A;  3G3I A;  4OMB A;  3G3J A;  4OVJ A;  2VGQ A;  4HTG A;  4G8H A;  2DVZ A;  1VFD A;  4LZ8 A;  4LP2 B;  3MAM A;  4WEP A;  2CMO A;  4NF5 A;  5JTY A;  4F1V A;  2VOZ A;  3SET A;  4R9F A;  3C36 A;  5KZT A;  1MRP A;  4AB5 A;  3EPE A;  1H43 A;  2XX8 A;  4TOZ A;  1WOD A;  1LLS A;  1FTM A;  4NF8 B;  4RPO A;  5H8Q B;  3Q26 A;  3FXU A;  4C0R A;  1NNF A;  2DXR A;  2DSF A;  3E4R A;  4OZ9 A;  5H8H B;  5H8S A;  4OHN A;  4OES A;  3O2A A;  2NWJ A;  3EHU A;  1PEB A;  1B52 A;  3QAX A;  2QSX A;  1EZO A;  1TFA A;  4N13 A;  3V5A A;  2I49 A;  5KCJ B;  4RK9 A;  1FCK A;  1IXC A;  1IIT A;  4XKR A;  4BDQ A;  4F3G A;  4RYA A;  5BWJ A;  3H6V A;  4X48 A;  2DWJ A;  1AMF A;  3LUY A;  3VFJ A;  4G8N A;  3H6U A;  5F7V A;  4ZEF A;  4FE8 A;  4YB5 A;  4Z0I A;  2XXH A;  1N84 A;  2ABH A;  2OLB A;  4R72 A;  2PT2 A;  4IO2 A;  2GFE A;  2ZYK A;  1PC3 A;  2V84 A;  1SW5 A;  1VSO A;  1QUJ A;  1PDA A;  2QJE A;  1UIU A;  2KLF A;  3KZG A;  2UYF A;  3MZ9 A;  1XC1 A;  3N6U A;  3TQW A;  3OEK A;  1MXX A;  1XVY A;  4LZ7 A;  2XXQ A;  3MUQ A;  2I0C A;  4UA8 A;  2XXW A;  5JK4 A;  1MQI A;  1PB9 A;  5B7D A;  1ZKB A;  3VXB A;  2V93 A;  3PUZ E;  3CRB A;  3IK6 B;  3K1N A;  5AA4 B;  3KOS A;  2ALU A;  4LAT A;  4C1U A;  2VP1 A;  1US5 A;  1N7X A;  2V3U A;  4QSD A;  4QFN A;  3EF7 A;  3MQ9 A;  1H76 A;  1LAH E;  1PBP A;  4JWX A;  1MG1 A;  4WXJ A;  4YAH X;  2THI A;  1B5J A;  2ZXT A;  3SEY A;  3VV5 A;  4BDR A;  4OTE A;  1JW1 A;  2IA4 A;  3SDF A;  2DVC A;  2VD3 A;  3IAZ A;  4KCC A;  1JEV A;  1EU8 A;  3MPK A;  1D9V A;  5I2N B;  1SW1 A;  2X7P A;  3L6G A;  1Z7M E;  3E13 X;  5H8F B;  3FJG A;  4GFR A;  4YB7 A;  2F6P A;  5FHN A;  4BDM A;  4DCY A;  1UIV A;  1P1N A;  4FEC A;  3CIJ A;  4C1T A;  1UTB B;  4EF1 A;  3K6V A;  2I58 A;  2REG A;  2I4B A;  3ILT B;  2M8C A;  5TP9 B;  2XXV A;  3H3G A;  4JDF A;  3IOV A;  3U94 A;  4L17 A;  3I3V A;  2QMX A;  1MQH A;  3O66 A;  3PMV A;  5CMB A;  1LAX A;  4PFW A;  1B1X A;  3HHF A;  4GF8 A;  1FQF A;  5TPA A;  5HPQ A;  4XKN A;  1TT1 A;  5I59 A;  1LB8 A;  4O3B A;  2F35 A;  1B3G A;  2DE2 A;  4F19 A;  1MXY A;  3OO6 A;  1QUL A;  1XVX A;  3ONM A;  5FHO A;  4KQP A;  2GHA A;  4KFQ A;  2ZNU A;  3P7I A;  4XTC Q;  5CMM A;  5L9M A;  1IXI A;  3ECR A;  1R1N A;  2ANJ A;  1LFG A;  2I3V A;  1Y1M A;  2D3I A;  4QHQ A;  4KYE A;  4QFO A;  3C9H A;  4GLI A;  2XX7 A;  2ZYM A;  2H4I A;  3TCF A;  3LR1 A;  2O68 A;  4H1X A;  2OBG A;  5TU0 A;  4ELQ A;  1II5 A;  4EF2 A;  3FV2 A;  3QIM A;  3FVG A;  4KYD A;  2OWT A;  1H3D A;  2V3Q A;  2O69 A;  5ELV A;  4EQ7 A;  3F11 A;  1A54 A;  1A99 A;  4GL8 A;  3FAT A;  5AA2 B;  2F8D A;  4N6P A;  3C31 A;  2UXA A;  1UTH B;  2PT1 A;  3SER A;  1JW5 A;  2UVH A;  2DP8 A;  2FYI A;  3RTW B;  4JWY A;  3QUJ A;  4G68 C;  1M5F A;  5H8H A;  1WVJ A;  3OOA A;  4O3C A;  1YTV A;  4JSD A;  3R6U A;  3PPO A;  1N7W A;  3RGY A;  1NNK A;  5F1Q A;  1R9Q A;  4QFL A;  1GTK A;  3PPN A;  3SEW A;  1FTJ A;  3B7D A;  4JB7 A;  4FAJ A;  4OQO A;  1F9B A;  4U1Z A;  2B3B A;  2RCB A;  5L9S A;  5HM4 B;  4QFP A;  4QSE A;  1LAG E;  1B5H A;  5DVI A;  4Q5T A;  2WKY A;  1MXZ A;  3U1O A;  2H99 A;  4ONY A;  3Q29 A;  1Y9U A;  3DM0 A;  1D4N A;  3TEL A;  3R7X A;  4ZEC A;  4K3F A;  4AQ4 A;  2GH9 A;  4PQJ A;  5EYF A;  4P0I A;  2XD3 A;  4R9G A;  1PBQ A;  2DWH A;  4X1B A;  4ZED A;  2O84 X;  3MZB A; 
#chains in the Genus database with same CATH topology
 3TTL A;  2LAO A;  2ZYO A;  4ZE9 A;  3O28 A;  3K0V A;  2VHA A;  4H6D A;  2OCU A;  4WKM A;  3HPI A;  1LBZ A;  2NXO A;  3E9X A;  2Y7P A;  3TFL A;  2HEU A;  1IQ7 A;  5AA4 A;  3M3F A;  4IR8 A;  1FBC A;  2PYY A;  3VVF A;  4PFU A;  4RY1 A;  1S9T A;  1ATG A;  3UP9 A;  1SQY A;  4MFI A;  2P1S A;  4H5F A;  3SEX A;  4GX3 A;  4QRZ A;  3MVW A;  2QS2 A;  1RKM A;  1HSE A;  2MKZ A;  5DT6 A;  3TQL A;  2DWI A;  4U4S A;  3B6W A;  2XXX A;  3IJO B;  1AL3 A;  4I3Y A;  4DI3 D;  4UAC A;  2Y84 A;  2I48 A;  1FBH A;  1URG A;  3T1B A;  1KWH A;  1A8F A;  4QFK A;  2QS3 A;  4R6K A;  3T9V A;  3K6W A;  4QSC A;  3GBA A;  2QVU A;  1LBW A;  4GWO A;  1D3K A;  3K1M A;  1AWB A;  3O6H A;  3CI8 A;  1Y3P A;  4MLQ A;  4PAI A;  1AIV A;  2HQ0 A;  4GWZ A;  1QKA A;  4ESW A;  2XHD A;  4GWY A;  1UTB A;  1FTK A;  2H98 A;  4YKI A;  4UAB A;  4LQ5 A;  1B9J A;  4NE4 A;  3MPL A;  1O64 A;  4FEB A;  4WED A;  2G29 A;  4XXU A;  2Y5K A;  4RNS A;  3PGF A;  4RPN A;  3H6W A;  2ONS A;  2VD2 A;  3RPL B;  1FQB A;  2DE3 A;  1LCF A;  2AIX A;  1B58 A;  2F34 A;  2PBW A;  5I2K B;  3OD7 A;  4NAP A;  1SW2 A;  3K00 A;  3BFU A;  4MHF A;  5EYH A;  1DMB A;  2XXY A;  2RC7 A;  5EQ8 A;  3MP1 A;  1QUK A;  3K02 A;  1I6B A;  1JET A;  2NOO A;  4OFO A;  1SPI A;  3BFT A;  5H8N A;  5IM2 A;  1ZMG A;  3KBR A;  1OQH A;  4OVS A;  2RCA A;  1NL5 A;  4LA9 A;  5A5L A;  4N4U A;  5EQA A;  5L9O A;  1G0I A;  5IZ3 B;  4PC9 A;  3MVY A;  3H7M A;  3U72 A;  4H45 A;  5EQ9 A;  1N0T A;  4PE3 A;  3BIG A;  4OXV A;  3E78 A;  1B5I A;  1B7U A;  1A7L A;  2Q74 A;  3TEP A;  1TFD A;  1YZ0 A;  2I4C A;  4R2F A;  1Y3Q A;  2P0S A;  1DPP A;  3I5O A;  1AOV A;  3K6X A;  1IMC A;  2XA5 A;  4XEQ A;  5CI5 A;  1FPG A;  4NMY A;  1G0H A;  2KQZ A;  1CB6 A;  1M5E A;  4EXL A;  1IMA A;  3O29 A;  1B0H A;  3G7W A;  4PFR A;  2Z23 A;  4P1E A;  4P56 A;  1N3X A;  3WAE A;  4QBA A;  2I3W A;  4XKP A;  2V25 A;  5AA2 A;  4MIJ A;  4I9D A;  4NED A;  3M3L A;  4XF5 A;  3MW0 A;  4G4P A;  4BDO A;  4F1Y A;  1LBY A;  1UTH A;  3W9W A;  1S50 A;  3VLW A;  3RYD A;  2YLN A;  2XXU A;  3U8Q A;  2UVJ A;  3SZP A;  1IEJ A;  3T96 B;  4LQ2 A;  1XT8 A;  4FOR A;  3CFX A;  4ZE8 A;  4FAT A;  1LCT A;  2PFZ A;  3GZG A;  3LUZ A;  1ELJ A;  1NV6 A;  2DOJ A;  3THI A;  4E0X A;  3DP6 A;  1A40 A;  3OSR A;  3JYR A;  3CR9 A;  4BDN A;  2HXW A;  1J1N A;  3QSL A;  1FTL A;  1FTO A;  4P3L A;  1P1U A;  4OEU A;  2F7C A;  4G8M A;  3Q28 A;  1K9Y A;  4I40 A;  3MBP A;  4NQ8 A;  3IB1 A;  3MST A;  3PMX A;  1DPE A;  1YAE A;  1GR2 A;  2Z8E A;  3CG3 A;  3PUY E;  4NTL A;  1LAF E;  4E0W A;  1BKA A;  3EN3 A;  4ZEI A;  1MY4 A;  3TTN A;  2A5T B;  1EH3 A;  2HFB A;  1IUD A;  2ZNS A;  2GRV A;  5CBS A;  3QUF A;  4NF6 A;  2Q2C A;  5I58 A;  4OEV A;  1FPK A;  4ZEK A;  5DTB A;  1NNP A;  1DTG A;  4P8B A;  3DLN A;  4N81 A;  4IY6 A;  4NF4 A;  2DQV A;  2A5S A;  4OVR A;  4AS5 A;  3VVD A;  2XWK A;  3MWB A;  4PCD A;  3PUV E;  4KD5 A;  3AXF A;  1N3W A;  3KBZ A;  2UVI A;  4R75 A;  5I56 B;  3HO7 A;  1MM7 A;  2CEY A;  2HCA A;  1US4 A;  2B4L A;  3HFU A;  4N8Y A;  4DI4 B;  4R6H A;  1VFE A;  2QRY A;  1DTZ A;  3O6I A;  5I7I A;  2FVZ A;  1P1Q A;  2XXP A;  2XWO A;  4GL0 A;  1LBV A;  2X7Q A;  4ELP A;  3T66 A;  4NF5 B;  1L5T A;  3USD A;  1RDX A;  1H44 A;  3FGS A;  3N5L A;  4HW8 A;  1QVS A;  1VDW A;  5DEX A;  3Q27 A;  3FIR A;  3OSQ A;  4POW A;  1P1W A;  4PDH A;  5CM6 A;  4KCD A;  1D9Q A;  1VR5 A;  1BLF A;  3DP8 A;  3FAS A;  3ODB A;  2XXK A;  2O1L A;  1MH4 A;  4GRK A;  3C35 A;  4DXU A;  3PU5 A;  1B51 A;  3W15 C;  3K01 A;  1SYI A;  3HN0 A;  4JWO A;  3IX1 A;  3TUS A;  3OEM A;  4N6K A;  3IO6 A;  4YU0 A;  3ILU B;  3FJM A;  5IZ1 A;  3TMG A;  1LGB C;  4PBH A;  4ISU A;  4O3A A;  2AL5 A;  5J16 A;  3PD9 A;  4GWW A;  4Z7E A;  1JP4 A;  3SEU A;  2XXT A;  2WYP A;  4QF9 A;  2RF1 A;  4G68 B;  4X8R A;  4F3P A;  3IB0 A;  3QYT A;  3SEV A;  1QJM A;  4MNC A;  1NV0 A;  1LBC A;  4OWD A;  2WYK A;  4I8C A;  1NV1 A;  3ZKK A;  1POT A;  2IEE A;  5I57 B;  2R6G E;  4BLA A;  1B3L A;  3PPQ A;  1SYH A;  4F31 B;  3K1P A;  2QFL A;  3I6V A;  2O51 A;  4EUO A;  3TCG A;  3D4C A;  2VPN A;  2FBP A;  3C32 A;  2F6G A;  4NWD A;  2B3F A;  3K2D A;  2RC9 A;  4FIM A;  4FED A;  1XHY A;  4NF8 A;  4GVO A;  2CZH A;  3OMB A;  2E1S A;  4PTK A;  1A55 A;  1MPC A;  2ONR A;  5J1D A;  1ZLQ A;  1HSJ A;  1SI1 A;  5H8Q A;  3S2V A;  4F3S A;  3DP4 A;  3KG2 A;  1O7T A;  1PB8 A;  3LBS A;  1B1H A;  4Q0C A;  5I2K A;  3VXC A;  1TXF A;  4QXD A;  4EXK A;  1B3H A;  5A5X B;  4LZ5 A;  1FQD A;  3TTM A;  1O63 A;  4PET A;  1FSA A;  5L8D A;  2NVU B;  5M2V A;  5KCJ A;  3RT6 B;  3S9E A;  5K2Y A;  1NUZ A;  2Z8F A;  4DZ1 A;  3PUW E;  4F2Q A;  1OIB A;  4ZDM A;  5B70 A;  5IZZ A;  4I1D A;  3JZJ A;  4G2Z A;  4YKK A;  5EHS A;  1B7Z A;  1LB9 A;  3FVK A;  3IFC A;  4AB6 A;  3C4M A;  5CMK A;  2CZL A;  4MX6 A;  1B0L A;  1HSL A;  4PFY A;  5K2X A;  1IXG A;  1EZ9 A;  4IGT A;  1MM6 A;  1A8E A;  2F36 A;  4ECF A;  1RYO A;  2FHY A;  3TTR A;  4F3B A;  2DXY A;  1IMD A;  5EHM A;  4ZEB A;  1Y4C A;  1IXH A;  1CE2 A;  4U1O A;  1FPL A;  2R71 A;  5ITO A;  3RPW A;  3TOD A;  4PBQ A;  5LOM A;  1NV3 A;  4MF3 A;  5JEI A;  1FJ6 A;  4NG7 A;  1B4Z A;  1GV8 A;  1ANF A;  4OFJ A;  4JBZ A;  1MS7 A;  3KN8 A;  4HS7 A;  4DCX A;  3IR1 A;  3T9H B;  1TWY A;  3IOR A;  4H8J A;  3N6T A;  2ZYN A;  4YKJ A;  1INP A;  3G3K A;  1NNT A;  2F97 A;  2UYE A;  2VT5 A;  1LFI A;  2R9J A;  4DDD A;  4R2B A;  2HZK A;  4ND9 A;  2F7B A;  3Q25 A;  3GBB A;  3MP6 A;  4O94 A;  1P99 A;  3OEN A;  1USY H;  3N26 A;  4PE5 B;  3FBP A;  1GVC A;  1MY0 A;  5HBC A;  2XD2 A;  3CSG A;  3UK4 A;  3OEL A;  3T9U A;  4OYV A;  4KXP A;  4POX A;  5TPA B;  1MQJ A;  4M1V A;  3S9L C;  1DOT A;  3IOT A;  4PFT A;  1NUY A;  1NMU A;  1M5B A;  4DXB A;  2RKM A;  5I2N A;  4Q30 B;  2B65 A;  4RJZ A;  1MQG A;  3UA8 A;  3KEI A;  1Q1K A;  5H8F A;  1JQF A;  4AS4 A;  3V89 B;  4P0G A;  5KDT B;  1B3F A;  2E0S A;  3OO8 A;  1DBZ A;  1BK4 A;  1JW4 A;  3U93 A;  3TAJ A;  3H06 B;  3H4Z A;  4KPT A;  3ISP A;  4I62 A;  5IAI A;  4JVC A;  1QW0 A;  1N04 A;  4EDP A;  1RDZ A;  3RUM A;  4TLL B;  4F1U A;  4F18 A;  3ZKL A;  5TP9 A;  2L5V A;  4U21 A;  5ET5 A;  4OA4 A;  2UVG A;  4KR5 A;  4KI0 E;  1S7Y A;  3KOT A;  3A3C A;  3TTK A;  4PAF A;  3LSW A;  4F2O A;  3HCQ A;  3K6U A;  3H6T A;  3S9M C;  4RK2 A;  1SW4 A;  3RQT A;  3OXN A;  3VDF A;  1FRP A;  4X9T A;  4YIC A;  1NUW A;  3KN3 A;  1KA0 A;  1YCJ A;  4TQU Q;  3PMW A;  3EHS A;  3SKP A;  1MDP 1;  3E3K A;  3S9N C;  4MBP A;  3A3U A;  3LSL A;  2O7U A;  3IOU A;  4DXC A;  2D21 A;  4NGU A;  4F39 A;  3BKI B;  2Q2A A;  2H9B A;  2O6A A;  2ZMB A;  4X04 A;  3RNN A;  2PMS A;  1Q9D A;  1FW0 A;  3IB2 A;  3KGC A;  2CEX A;  4GX4 A;  1I6Q A;  1MDQ A;  4G68 A;  1RYX A;  4H5G A;  1EYJ A;  3B50 A;  1DSN A;  3BBR A;  2F3D A;  1QUI A;  4G77 A;  4ELR A;  4H65 A;  2XXR A;  3B8B A;  3CSB A;  2OWS A;  3KSJ A;  5I57 A;  3QXM A;  5AA2 D;  3QK6 A;  1SVX B;  1URS A;  2O1M A;  2I6E A;  1BP5 A;  1OLC A;  1Y4T A;  3FZV A;  1GGG A;  1EYI A;  4PGN A;  4ESX A;  2HAV A;  4EQ9 A;  4ZZE A;  3PD8 A;  2HXR A;  2Y7I A;  3B6Q A;  5FTH A;  3UIF A;  3SES A;  3UOR A;  3IL1 B;  4M4G A;  3FJ7 A;  1QGX A;  3IOW A;  4DLD A;  2YPN A;  4GWS A;  3ZS6 A;  1B6H A;  3K4U A;  2QS1 A;  2PFY A;  4OER A;  2G93 A;  2Z8D A;  1OMP A;  5DVF A;  4MAG A;  3O6G A;  1M5D A;  5I84 A;  1H45 A;  4GOT A;  4R73 A;  4NF0 A;  5A5X A;  2F7A A;  4THI A;  3MP8 A;  3OO7 A;  3C33 A;  1Z7N E;  1B05 A;  3TKD A;  1JNF A;  3GLB A;  4YKP A;  3M8U A;  3PV0 E;  2ZNT A;  4LVQ A;  5ET6 A;  2OZZ A;  4ELO A;  3IFA A;  1SD3 A;  1B4H A;  1MXU A;  4IO7 A;  5AA1 A;  1EZP A;  4JXI A;  1JEU A;  3RLF E;  1KZ8 A;  2DS9 A;  4Q8R A;  4OFL A;  1USY E;  3A09 A;  1FPI A;  4KHZ E;  4LN5 A;  2ONK E;  2Y7K A;  1B2H A;  1I6A A;  1WDN A;  2F78 A;  3MC2 A;  5CRY A;  3CFZ A;  3UN6 A;  1ZJL A;  3FUZ A;  2QMW A;  3TCH A;  1NKX A;  1FQC A;  3FD3 A;  2PVU A;  2GHB A;  3RY3 A;  4TLM B;  1IZ1 A;  1FPE A;  4PFI A;  3T22 A;  3U92 A;  3TYH A;  3TPA A;  4F22 A;  5DYH A;  1MQD A;  3TZA A;  4HCY A;  1NFT A;  1M5C A;  1FBP A;  4H8I A;  4R74 A;  4IO3 A;  3RN8 A;  4ZZA A;  4LON B;  4JSO A;  3T9X B;  5JTY B;  1VE4 A;  3T93 B;  1MPB A;  4U2R A;  3KN7 A;  2QS4 A;  2Q9T A;  3S4U A;  2D5W A;  3MZ1 A;  2FNC A;  3N94 A;  3JV9 A;  3TDJ A;  2YJP A;  4NN3 A;  2XXI A;  2OJT A;  1BIY A;  4MH5 A;  5DVJ A;  3W9V A;  1IMF A;  4MEV A;  2I0B A;  1P1O A;  3MVX A;  3L6H A;  3UGW A;  3PUX E;  1NH8 A;  4U23 A;  4OVT A;  1IIW A;  2Z22 A;  5ESY A;  2HZL A;  4IO6 A;  4RXL A;  2OWZ A;  1MY2 A;  3V83 A;  4XIG Q;  3D4G A;  3FV1 A;  1ZBM A;  1LFH A;  1ZIU A;  2Y7W A;  1SBP A;  3E79 A;  3LC8 A;  5H8N B;  5EQ7 A;  1YYZ A;  1JVX A;  3HST A;  2DE4 A;  1OVB A;  4IB2 A;  4KYS A;  4MCO A;  3VLV A;  4YMB A;  1LBB A;  3FXR A;  4MMP A;  4OEN A;  2F3B A;  5ICQ A;  4YZZ A;  3G3H A;  5CMC A;  2H5Y A;  5BUU A;  2WEF A;  3DEL B;  1R9L A;  5KDT A;  3M3K A;  5FHM A;  4OVP A;  3VVE A;  2HAU A;  3ZSF A;  1MPD A;  1Q35 A;  4I3E A;  1OQG A;  3KC0 A;  1R6Z A;  2AYS A;  3KC1 A;  2QL3 A;  3O97 A;  2PX1 A;  1FQA A;  2R8T A;  3EQ1 A;  4IGR A;  4MLV A;  4IO5 A;  3BIH A;  1B7H A;  4GQO A;  4OET A;  1JVY A;  3RPL A;  3IO4 A;  4O7I A;  1NUX A;  4FJP A;  1OLA A;  3RT8 A;  1B32 A;  2Q89 A;  1URD A;  1N76 A;  3CVG A;  1B40 A;  2Q88 A;  3FVO A;  4X1D A;  1YPN A;  2DYX A;  5T3J A;  1ZTY A;  4YMA A;  2FA7 A;  2BJI A;  1SI0 A;  1B3E A;  1MY3 A;  3MVZ A;  3HV1 A;  4H67 A;  3VE1 B;  4U22 A;  5F24 A;  4JVD A;  4MNI A;  5IZ3 A;  1FQE A;  3GXA A;  2V3T A;  4YB6 A;  4HCW A;  1XOC A;  2NUV A;  1NH7 A;  1D9Y A;  3VLU A;  3KJ7 A;  1LEV A;  1AH5 A;  3G3F A;  2W7Y A;  5DW8 A;  2REJ A;  3FXQ A;  1XI6 A;  4G61 A;  3WAF A;  5ISU A;  4H0W A;  1MXW A;  1LBX A;  4IO4 A;  3LSX A;  1YXI A;  1Y1Z A;  5LTC A;  4U4X A;  1I69 A;  2AL4 A;  2RIN A;  3PPR A;  3B6T A;  4NF6 B;  5I58 B;  3FVN A;  2H25 A;  1OVT A;  1Y3N A;  2O7I A;  5IKB A;  1BTJ A;  3R26 A;  4DIG A;  4NF4 B;  4GIZ A;  1QKB A;  4IY5 A;  3O9P A;  4RA1 A;  3KSX A;  4JVI A;  3KJT A;  5AE4 A;  3FXB A;  1B46 A;  4N07 A;  2WX9 A;  2OX3 A;  3V8X B;  3LSF B;  4HE2 A;  4GWX A;  2RC8 A;  4XKQ A;  4P9K A;  1MY1 A;  4PP0 A;  4PFB A;  5CC2 A;  4ZS9 A;  3HHG A;  4NWC A;  4DE8 A;  2QPQ A;  2F5X A;  4OVQ A;  2XWI A;  2ESN A;  4P11 A;  4XFE A;  1UQW A;  3G3G A;  2QVV A;  3KFM A;  1ZU0 A;  3EHT A;  5DEX B;  1FBG A;  4GXS B;  1POY 1;  1PB7 A;  2BJJ X;  3RTF B;  4F29 A;  3PPP A;  5ITP A;  5I59 B;  2OK2 A;  3CG1 A;  1Y20 A;  3IJX B;  1FPD A;  2A5T A;  4LUB A;  4N6D A;  2P2A A;  4GXA A;  1SDX A;  3U65 A;  4R6Y A;  2DWA A;  2VPO A;  5CBR A;  1EYK A;  3CFL A;  5FTI A;  1XS5 A;  1LST A;  3OO9 A;  5ICT A;  5AA3 A;  4EQB A;  1T0K A;  1FJ9 A;  1MH3 A;  3H03 A;  1NV4 A;  1FBE A;  2Q8J A;  4BDL A;  5I56 A;  3C34 A;  3MYU A;  3MJN A;  4GD5 A;  1MXV A;  2X26 A;  2XX9 A;  2Y7R A;  2PCR A;  3G3I A;  4OMB A;  3G3J A;  4OVJ A;  2VGQ A;  4HTG A;  4G8H A;  2DVZ A;  1VFD A;  4LZ8 A;  4LP2 B;  4HE1 A;  3MAM A;  4WEP A;  2CMO A;  4NF5 A;  5JTY A;  4F1V A;  2VOZ A;  3SET A;  4R9F A;  3C36 A;  5KZT A;  1MRP A;  4AB5 A;  3EPE A;  1FPF A;  1H43 A;  2XX8 A;  4NHB A;  3GYY A;  3NOH A;  4MJO A;  4TOZ A;  1WOD A;  1LLS A;  1FTM A;  4NF8 B;  4RPO A;  4FBP A;  1FBF A;  3CHG A;  1FTA A;  5H8Q B;  3QMF A;  3Q26 A;  3FXU A;  4C0R A;  1NNF A;  2DXR A;  2HPG A;  2DSF A;  1FPB A;  3E4R A;  4OZ9 A;  1K9Z A;  5H8H B;  5H8S A;  4OHN A;  4OES A;  3O2A A;  2NWJ A;  3EHU A;  1PEB A;  1B52 A;  3QAX A;  2QSX A;  1EZO A;  1TFA A;  4N13 A;  3V5A A;  2I49 A;  2P3V A;  1IMB A;  5KCJ B;  4RK9 A;  1FCK A;  1IXC A;  1IIT A;  4XKR A;  4BDQ A;  4F3G A;  1IME A;  4RYA A;  4P1L A;  5BWJ A;  3H6V A;  4X48 A;  2DWJ A;  1AMF A;  3LUY A;  3VFJ A;  4G8N A;  3H6U A;  5F7V A;  4ZEF A;  4FE8 A;  4YB5 A;  4Z0I A;  2XXH A;  1N84 A;  2ABH A;  2OLB A;  4GX6 A;  2Q8M A;  4O7M A;  4R72 A;  2PT2 A;  4IO2 A;  2GFE A;  2ZYK A;  1PC3 A;  2V84 A;  1SW5 A;  1VSO A;  1QUJ A;  1PDA A;  2FIX A;  4N8G A;  2QJE A;  1UIU A;  2KLF A;  3KZG A;  2UYF A;  3D1R A;  3MZ9 A;  1XC1 A;  1DCU A;  3N6U A;  3TQW A;  3OEK A;  1MXX A;  1XVY A;  4LZ7 A;  2XXQ A;  3MUQ A;  2I0C A;  4UA8 A;  2XXW A;  5JK4 A;  1MQI A;  1PB9 A;  5B7D A;  1ZKB A;  3VXB A;  2V93 A;  3PUZ E;  3CRB A;  1NV2 A;  3PTY A;  3IK6 B;  3K1N A;  5AA4 B;  3ROJ A;  3KOS A;  2ALU A;  2P3N A;  4LAT A;  4C1U A;  2VP1 A;  1US5 A;  1N7X A;  2V3U A;  4QSD A;  2WBD A;  4O8M A;  1RDY A;  4QFN A;  3EF7 A;  3MQ9 A;  1H76 A;  1LAH E;  1PBP A;  4JWX A;  4PDD A;  2XWV A;  1MG1 A;  4WXJ A;  4YAH X;  2THI A;  1B5J A;  3EKI A;  1NI9 A;  2ZXT A;  3SEY A;  3VV5 A;  4BDR A;  4OTE A;  4PGP A;  4N15 A;  1JW1 A;  2IA4 A;  3SDF A;  2DVC A;  4NX1 A;  2VD3 A;  3IAZ A;  4KCC A;  4MNP A;  1JEV A;  5FBP A;  1EU8 A;  3MPK A;  1D9V A;  5I2N B;  1SW1 A;  2X7P A;  3L6G A;  1Z7M E;  4PF6 A;  3E13 X;  4HXV A;  5H8F B;  3FJG A;  4GFR A;  4YB7 A;  1FPJ A;  2F6P A;  5FHN A;  4BDM A;  4DCY A;  1UIV A;  1P1N A;  3A29 A;  4FEC A;  3CIJ A;  2ZZX A;  4C1T A;  1UTB B;  4EF1 A;  3K6V A;  2I58 A;  2REG A;  2I4B A;  3ILT B;  2M8C A;  2CZI A;  5TP9 B;  2XXV A;  3H3G A;  2DDK A;  4GBV A;  4HE0 A;  5ET8 A;  4JDF A;  3IOV A;  3U94 A;  4L17 A;  3I3V A;  2QMX A;  1MQH A;  3O66 A;  3PMV A;  5CMB A;  1LAX A;  3LV0 A;  4PFW A;  1B1X A;  3HHF A;  5ET7 A;  4GF8 A;  1FQF A;  5TPA A;  5HPQ A;  4XKN A;  2HHM A;  1TT1 A;  5I59 A;  1LB8 A;  4O3B A;  2F35 A;  1B3G A;  2DE2 A;  4F19 A;  1MXY A;  3OO6 A;  1QUL A;  4H46 A;  1XVX A;  5I3S A;  3ONM A;  5FHO A;  4KQP A;  1CNQ A;  2GHA A;  2Y5L A;  4KFQ A;  2ZNU A;  3P7I A;  4XTC Q;  5CMM A;  5L9M A;  1IXI A;  3ECR A;  1R1N A;  2ANJ A;  1LFG A;  2I3V A;  1Y1M A;  2D3I A;  4QHQ A;  4KYE A;  4QFO A;  3C9H A;  4GLI A;  2XX7 A;  1FBD A;  2ZYM A;  2H4I A;  3TCF A;  3LR1 A;  2O68 A;  5LDZ A;  4H1X A;  4P47 A;  2ZZV A;  2FIE A;  5I5P A;  2OBG A;  5TU0 A;  4ELQ A;  1II5 A;  4EF2 A;  3FV2 A;  3QIM A;  3FVG A;  4KYD A;  2OWT A;  1H3D A;  2V3Q A;  2V4C A;  2O69 A;  5ELV A;  4EQ7 A;  3F11 A;  1A54 A;  1A99 A;  4GL8 A;  3FAT A;  5AA2 B;  2F8D A;  4N6P A;  3C31 A;  2UXA A;  1UTH B;  2JJK A;  2PT1 A;  4GWU A;  2B4M A;  3SER A;  5IGA A;  1JW5 A;  2UVH A;  2DP8 A;  2FYI A;  4PAK A;  3RTW B;  4JWY A;  3QUJ A;  2CZK A;  1NV5 A;  4PF8 A;  4G68 C;  1M5F A;  5H8H A;  1WVJ A;  3OOA A;  2WBB A;  4O3C A;  2ZZW A;  1YTV A;  3T0J A;  4JSD A;  3R6U A;  4N17 A;  3PPO A;  1N7W A;  3RGY A;  1NNK A;  5F1Q A;  1R9Q A;  4QFL A;  1GTK A;  3PPN A;  3SEW A;  1FTJ A;  3B7D A;  4JB7 A;  4FAJ A;  4OQO A;  1F9B A;  4N91 A;  4U1Z A;  2B3B A;  2RCB A;  5L9S A;  5HM4 B;  4QFP A;  4QSE A;  1NV7 A;  1LAG E;  2GQ1 A;  2KR0 A;  1B5H A;  5DVI A;  4Q5T A;  2WKY A;  5EYG A;  1MXZ A;  1DK4 A;  1KA1 A;  3U1O A;  4GBW A;  2H99 A;  4ONY A;  3Q29 A;  1Y9U A;  3DM0 A;  1D4N A;  3TEL A;  3R7X A;  4ZEC A;  4K3F A;  4AQ4 A;  2GH9 A;  2QVR A;  4PQJ A;  5EYF A;  4P0I A;  2XD3 A;  4R9G A;  1PBQ A;  2DWH A;  4X1B A;  4ZED A;  2O84 X;  4OAN A;  3MZB A; 
#chains in the Genus database with same CATH homology
 3TTL A;  2LAO A;  2ZYO A;  4ZE9 A;  3O28 A;  3K0V A;  2VHA A;  4H6D A;  2OCU A;  4WKM A;  3HPI A;  2NXO A;  3E9X A;  2Y7P A;  3TFL A;  2HEU A;  1IQ7 A;  5AA4 A;  3M3F A;  2PYY A;  3VVF A;  4PFU A;  4RY1 A;  1S9T A;  1ATG A;  3UP9 A;  1SQY A;  4MFI A;  2P1S A;  4H5F A;  3SEX A;  4QRZ A;  3MVW A;  2QS2 A;  1RKM A;  1HSE A;  5DT6 A;  3TQL A;  2DWI A;  4U4S A;  3B6W A;  2XXX A;  3IJO B;  1AL3 A;  4UAC A;  2Y84 A;  2I48 A;  1URG A;  1KWH A;  1A8F A;  4QFK A;  2QS3 A;  4R6K A;  3T9V A;  3K6W A;  4QSC A;  3GBA A;  4GWO A;  1D3K A;  3K1M A;  3O6H A;  3CI8 A;  1Y3P A;  4MLQ A;  1AIV A;  2HQ0 A;  1QKA A;  4ESW A;  2XHD A;  1UTB A;  1FTK A;  2H98 A;  4YKI A;  4LQ5 A;  1B9J A;  4NE4 A;  3MPL A;  1O64 A;  4FEB A;  4WED A;  2G29 A;  4XXU A;  4RNS A;  3PGF A;  4RPN A;  3H6W A;  2ONS A;  2VD2 A;  1FQB A;  2DE3 A;  1LCF A;  2AIX A;  1B58 A;  2F34 A;  2PBW A;  5I2K B;  3OD7 A;  1SW2 A;  3K00 A;  3BFU A;  1DMB A;  2XXY A;  2RC7 A;  3MP1 A;  1QUK A;  3K02 A;  1I6B A;  1JET A;  2NOO A;  4OFO A;  3BFT A;  5H8N A;  1ZMG A;  3KBR A;  1OQH A;  2RCA A;  1NL5 A;  4LA9 A;  5L9O A;  3MVY A;  3H7M A;  3U72 A;  1N0T A;  4OXV A;  1B5I A;  1B7U A;  1A7L A;  3TEP A;  1TFD A;  2I4C A;  4R2F A;  1Y3Q A;  2P0S A;  1DPP A;  3I5O A;  1AOV A;  3K6X A;  5CI5 A;  4NMY A;  1CB6 A;  1M5E A;  4EXL A;  3O29 A;  1B0H A;  3G7W A;  2Z23 A;  1N3X A;  3WAE A;  2I3W A;  4XKP A;  2V25 A;  5AA2 A;  4I9D A;  4NED A;  3M3L A;  3MW0 A;  4G4P A;  4BDO A;  4F1Y A;  1UTH A;  3W9W A;  1S50 A;  3VLW A;  2YLN A;  2XXU A;  3U8Q A;  2UVJ A;  1IEJ A;  3T96 B;  4LQ2 A;  1XT8 A;  4FOR A;  3CFX A;  4ZE8 A;  4FAT A;  1LCT A;  3GZG A;  1ELJ A;  2DOJ A;  3THI A;  4E0X A;  3DP6 A;  1A40 A;  3OSR A;  3JYR A;  3CR9 A;  4BDN A;  2HXW A;  1J1N A;  3QSL A;  1FTL A;  1FTO A;  1P1U A;  4OEU A;  2F7C A;  4G8M A;  3Q28 A;  3MBP A;  3IB1 A;  3PMX A;  1DPE A;  1YAE A;  1GR2 A;  2Z8E A;  3CG3 A;  3PUY E;  4NTL A;  1LAF E;  4E0W A;  1BKA A;  3EN3 A;  4ZEI A;  1MY4 A;  3TTN A;  2A5T B;  1EH3 A;  2HFB A;  1IUD A;  2ZNS A;  2GRV A;  5CBS A;  3QUF A;  4NF6 A;  2Q2C A;  5I58 A;  4OEV A;  4ZEK A;  5DTB A;  1NNP A;  1DTG A;  3DLN A;  4IY6 A;  4NF4 A;  2DQV A;  2A5S A;  3VVD A;  3MWB A;  3PUV E;  4KD5 A;  3AXF A;  1N3W A;  2UVI A;  4R75 A;  5I56 B;  3HO7 A;  1MM7 A;  2HCA A;  1US4 A;  4R6H A;  1VFE A;  2QRY A;  1DTZ A;  3O6I A;  1P1Q A;  2XXP A;  4GL0 A;  2X7Q A;  4ELP A;  3T66 A;  4NF5 B;  1L5T A;  3USD A;  1H44 A;  3FGS A;  4HW8 A;  3N5L A;  1QVS A;  5DEX A;  3Q27 A;  3FIR A;  3OSQ A;  4POW A;  1P1W A;  5CM6 A;  4KCD A;  1VR5 A;  1BLF A;  3DP8 A;  3FAS A;  3ODB A;  2O1L A;  1MH4 A;  4GRK A;  3C35 A;  4DXU A;  3PU5 A;  1B51 A;  3W15 C;  3K01 A;  1SYI A;  3HN0 A;  4JWO A;  3IX1 A;  3TUS A;  3OEM A;  3IO6 A;  4YU0 A;  3ILU B;  3FJM A;  3TMG A;  1LGB C;  4ISU A;  4O3A A;  2AL5 A;  3PD9 A;  4Z7E A;  3SEU A;  2XXT A;  4QF9 A;  2RF1 A;  4G68 B;  4F3P A;  3IB0 A;  3QYT A;  3SEV A;  1QJM A;  1LBC A;  4OWD A;  4I8C A;  3ZKK A;  1POT A;  2IEE A;  5I57 B;  2R6G E;  4BLA A;  1B3L A;  3PPQ A;  1SYH A;  4F31 B;  3K1P A;  3I6V A;  2O51 A;  4EUO A;  3TCG A;  3D4C A;  3C32 A;  2F6G A;  4NWD A;  2B3F A;  3K2D A;  2RC9 A;  4FIM A;  4FED A;  1XHY A;  4NF8 A;  4GVO A;  3OMB A;  2E1S A;  1A55 A;  1MPC A;  2ONR A;  5J1D A;  1ZLQ A;  1HSJ A;  1SI1 A;  5H8Q A;  3S2V A;  4F3S A;  3DP4 A;  3KG2 A;  1O7T A;  1PB8 A;  3LBS A;  1B1H A;  4Q0C A;  5I2K A;  3VXC A;  1TXF A;  4EXK A;  1B3H A;  5A5X B;  4LZ5 A;  1FQD A;  3TTM A;  1O63 A;  4PET A;  5L8D A;  2NVU B;  5M2V A;  5KCJ A;  3RT6 B;  3S9E A;  5K2Y A;  2Z8F A;  4DZ1 A;  3PUW E;  4F2Q A;  1OIB A;  4ZDM A;  5B70 A;  4I1D A;  3JZJ A;  4G2Z A;  4YKK A;  5EHS A;  1B7Z A;  1LB9 A;  3FVK A;  4AB6 A;  3C4M A;  5CMK A;  2CZL A;  1B0L A;  1HSL A;  4PFY A;  5K2X A;  1IXG A;  1EZ9 A;  4IGT A;  1MM6 A;  1A8E A;  2F36 A;  4ECF A;  1RYO A;  3TTR A;  4F3B A;  2DXY A;  5EHM A;  4ZEB A;  1Y4C A;  1IXH A;  1CE2 A;  4U1O A;  2R71 A;  5ITO A;  3RPW A;  3TOD A;  5LOM A;  4MF3 A;  5JEI A;  1B4Z A;  1GV8 A;  1ANF A;  4OFJ A;  4JBZ A;  1MS7 A;  3KN8 A;  4HS7 A;  4DCX A;  3IR1 A;  3T9H B;  1TWY A;  3IOR A;  4H8J A;  3N6T A;  2ZYN A;  4YKJ A;  3G3K A;  1NNT A;  2F97 A;  2UYE A;  1LFI A;  2R9J A;  4DDD A;  4R2B A;  2HZK A;  4ND9 A;  2F7B A;  3Q25 A;  3GBB A;  3MP6 A;  1P99 A;  3OEN A;  1USY H;  3N26 A;  4PE5 B;  1GVC A;  1MY0 A;  5HBC A;  2XD2 A;  3CSG A;  3UK4 A;  3OEL A;  3T9U A;  4OYV A;  4POX A;  5TPA B;  1MQJ A;  4M1V A;  3S9L C;  1DOT A;  3IOT A;  4PFT A;  1NMU A;  1M5B A;  4DXB A;  2RKM A;  5I2N A;  4Q30 B;  2B65 A;  4RJZ A;  1MQG A;  3UA8 A;  3KEI A;  1Q1K A;  5H8F A;  1JQF A;  3V89 B;  4P0G A;  5KDT B;  1B3F A;  2E0S A;  3OO8 A;  1JW4 A;  3U93 A;  3TAJ A;  3H06 B;  3H4Z A;  4KPT A;  4I62 A;  5IAI A;  1QW0 A;  1N04 A;  4EDP A;  3RUM A;  4TLL B;  4F1U A;  4F18 A;  3ZKL A;  5TP9 A;  4U21 A;  2UVG A;  4KR5 A;  4KI0 E;  1S7Y A;  3KOT A;  3A3C A;  3TTK A;  3LSW A;  4F2O A;  3HCQ A;  3K6U A;  3H6T A;  3S9M C;  4RK2 A;  1SW4 A;  3RQT A;  3OXN A;  3VDF A;  4X9T A;  4YIC A;  3KN3 A;  1YCJ A;  4TQU Q;  3PMW A;  3EHS A;  3SKP A;  1MDP 1;  3E3K A;  3S9N C;  4MBP A;  3A3U A;  3LSL A;  2O7U A;  3IOU A;  4DXC A;  2D21 A;  4F39 A;  3BKI B;  2Q2A A;  2H9B A;  2O6A A;  2ZMB A;  3RNN A;  2PMS A;  1FW0 A;  3IB2 A;  3KGC A;  1I6Q A;  1MDQ A;  4G68 A;  1RYX A;  4H5G A;  1DSN A;  3BBR A;  1QUI A;  4G77 A;  4ELR A;  4H65 A;  2XXR A;  3CSB A;  2OWS A;  3KSJ A;  5I57 A;  3QXM A;  5AA2 D;  3QK6 A;  1SVX B;  1URS A;  2O1M A;  2I6E A;  1BP5 A;  1OLC A;  1Y4T A;  3FZV A;  1GGG A;  4ESX A;  2HAV A;  4EQ9 A;  4ZZE A;  3PD8 A;  2Y7I A;  3B6Q A;  5FTH A;  3UIF A;  3SES A;  3UOR A;  3IL1 B;  4M4G A;  3FJ7 A;  4DLD A;  3IOW A;  2YPN A;  3ZS6 A;  1B6H A;  3K4U A;  2QS1 A;  4OER A;  2G93 A;  2Z8D A;  1OMP A;  5DVF A;  3O6G A;  1M5D A;  5I84 A;  1H45 A;  4GOT A;  4R73 A;  5A5X A;  2F7A A;  4THI A;  3MP8 A;  3OO7 A;  3C33 A;  1Z7N E;  1B05 A;  3TKD A;  1JNF A;  3GLB A;  4YKP A;  3M8U A;  3PV0 E;  2ZNT A;  4LVQ A;  2OZZ A;  4ELO A;  1SD3 A;  1B4H A;  1MXU A;  4IO7 A;  5AA1 A;  1EZP A;  4JXI A;  1JEU A;  3RLF E;  2DS9 A;  4Q8R A;  4OFL A;  1USY E;  3A09 A;  4KHZ E;  2ONK E;  2Y7K A;  1B2H A;  1I6A A;  1WDN A;  2F78 A;  3MC2 A;  5CRY A;  3CFZ A;  3UN6 A;  1ZJL A;  3FUZ A;  2QMW A;  3TCH A;  1NKX A;  1FQC A;  3FD3 A;  2PVU A;  2GHB A;  3RY3 A;  4TLM B;  1IZ1 A;  3T22 A;  3U92 A;  3TYH A;  3TPA A;  4F22 A;  5DYH A;  1MQD A;  3TZA A;  4HCY A;  1NFT A;  1M5C A;  4H8I A;  4R74 A;  4IO3 A;  3RN8 A;  4ZZA A;  4LON B;  4JSO A;  3T9X B;  5JTY B;  1VE4 A;  3T93 B;  1MPB A;  4U2R A;  3KN7 A;  2QS4 A;  2Q9T A;  3S4U A;  2D5W A;  3MZ1 A;  2FNC A;  3N94 A;  3JV9 A;  3TDJ A;  2YJP A;  2XXI A;  2OJT A;  1BIY A;  4MH5 A;  5DVJ A;  3W9V A;  2I0B A;  1P1O A;  3MVX A;  3L6H A;  3UGW A;  3PUX E;  1NH8 A;  4U23 A;  1IIW A;  2Z22 A;  2HZL A;  4IO6 A;  4RXL A;  1MY2 A;  3V83 A;  4XIG Q;  3D4G A;  3FV1 A;  1ZBM A;  1LFH A;  1ZIU A;  2Y7W A;  1SBP A;  3LC8 A;  5H8N B;  1JVX A;  3HST A;  2DE4 A;  1OVB A;  4IB2 A;  4KYS A;  3VLV A;  4YMB A;  1LBB A;  3FXR A;  4OEN A;  5ICQ A;  4YZZ A;  3G3H A;  5CMC A;  2H5Y A;  5BUU A;  3DEL B;  1R9L A;  5KDT A;  3M3K A;  5FHM A;  3VVE A;  2HAU A;  3ZSF A;  1MPD A;  1Q35 A;  1OQG A;  1R6Z A;  2AYS A;  2QL3 A;  3O97 A;  2PX1 A;  1FQA A;  3EQ1 A;  4IGR A;  4MLV A;  4IO5 A;  1B7H A;  4GQO A;  4OET A;  1JVY A;  3IO4 A;  4FJP A;  1OLA A;  3RT8 A;  1B32 A;  2Q89 A;  1URD A;  1N76 A;  3CVG A;  1B40 A;  2Q88 A;  3FVO A;  4X1D A;  1YPN A;  2DYX A;  1ZTY A;  4YMA A;  2FA7 A;  1SI0 A;  1B3E A;  1MY3 A;  3MVZ A;  3HV1 A;  4H67 A;  3VE1 B;  4U22 A;  1FQE A;  3GXA A;  2V3T A;  4YB6 A;  4HCW A;  1XOC A;  2NUV A;  1NH7 A;  1D9Y A;  3VLU A;  3KJ7 A;  1AH5 A;  3G3F A;  2W7Y A;  2REJ A;  3FXQ A;  3WAF A;  5ISU A;  4H0W A;  1MXW A;  4IO4 A;  3LSX A;  1Y1Z A;  4U4X A;  1I69 A;  2AL4 A;  2RIN A;  3PPR A;  3B6T A;  4NF6 B;  5I58 B;  3FVN A;  2H25 A;  1OVT A;  1Y3N A;  2O7I A;  5IKB A;  1BTJ A;  3R26 A;  4DIG A;  4NF4 B;  4GIZ A;  1QKB A;  4IY5 A;  3O9P A;  4RA1 A;  3KSX A;  3KJT A;  5AE4 A;  1B46 A;  4N07 A;  3V8X B;  3LSF B;  2RC8 A;  4XKQ A;  1MY1 A;  4PP0 A;  5CC2 A;  4ZS9 A;  3HHG A;  4NWC A;  4DE8 A;  2QPQ A;  2F5X A;  2ESN A;  4P11 A;  1UQW A;  3G3G A;  3KFM A;  1ZU0 A;  3EHT A;  5DEX B;  4GXS B;  1POY 1;  1PB7 A;  2BJJ X;  3RTF B;  4F29 A;  3PPP A;  5ITP A;  5I59 B;  2OK2 A;  3CG1 A;  1Y20 A;  3IJX B;  2A5T A;  4LUB A;  2P2A A;  4GXA A;  1SDX A;  4R6Y A;  2DWA A;  5CBR A;  3CFL A;  5FTI A;  1XS5 A;  1LST A;  3OO9 A;  5ICT A;  5AA3 A;  4EQB A;  1T0K A;  1MH3 A;  3H03 A;  2Q8J A;  4BDL A;  5I56 A;  3C34 A;  3MJN A;  4GD5 A;  1MXV A;  2X26 A;  2XX9 A;  2Y7R A;  3G3I A;  4OMB A;  3G3J A;  4OVJ A;  2VGQ A;  4HTG A;  4G8H A;  2DVZ A;  1VFD A;  4LZ8 A;  4LP2 B;  3MAM A;  4WEP A;  2CMO A;  4NF5 A;  5JTY A;  4F1V A;  2VOZ A;  3SET A;  4R9F A;  3C36 A;  5KZT A;  1MRP A;  4AB5 A;  3EPE A;  1H43 A;  2XX8 A;  4TOZ A;  1WOD A;  1LLS A;  1FTM A;  4NF8 B;  4RPO A;  5H8Q B;  3Q26 A;  3FXU A;  4C0R A;  1NNF A;  2DXR A;  2DSF A;  3E4R A;  4OZ9 A;  5H8H B;  5H8S A;  4OHN A;  4OES A;  3O2A A;  2NWJ A;  3EHU A;  1PEB A;  1B52 A;  3QAX A;  2QSX A;  1EZO A;  1TFA A;  4N13 A;  3V5A A;  2I49 A;  5KCJ B;  4RK9 A;  1FCK A;  1IXC A;  1IIT A;  4XKR A;  4BDQ A;  4F3G A;  4RYA A;  5BWJ A;  3H6V A;  4X48 A;  2DWJ A;  1AMF A;  3LUY A;  3VFJ A;  4G8N A;  3H6U A;  5F7V A;  4ZEF A;  4FE8 A;  4YB5 A;  4Z0I A;  2XXH A;  1N84 A;  2ABH A;  2OLB A;  4R72 A;  2PT2 A;  4IO2 A;  2GFE A;  2ZYK A;  1PC3 A;  2V84 A;  1SW5 A;  1VSO A;  1QUJ A;  1PDA A;  2QJE A;  1UIU A;  2KLF A;  3KZG A;  2UYF A;  3MZ9 A;  1XC1 A;  3N6U A;  3TQW A;  3OEK A;  1MXX A;  1XVY A;  4LZ7 A;  2XXQ A;  3MUQ A;  2I0C A;  4UA8 A;  2XXW A;  5JK4 A;  1MQI A;  1PB9 A;  5B7D A;  1ZKB A;  3VXB A;  2V93 A;  3PUZ E;  3CRB A;  3IK6 B;  3K1N A;  5AA4 B;  3KOS A;  2ALU A;  4LAT A;  4C1U A;  2VP1 A;  1US5 A;  1N7X A;  2V3U A;  4QSD A;  4QFN A;  3EF7 A;  3MQ9 A;  1H76 A;  1LAH E;  1PBP A;  4JWX A;  1MG1 A;  4WXJ A;  4YAH X;  2THI A;  1B5J A;  2ZXT A;  3SEY A;  3VV5 A;  4BDR A;  4OTE A;  1JW1 A;  2IA4 A;  3SDF A;  2DVC A;  2VD3 A;  3IAZ A;  4KCC A;  1JEV A;  1EU8 A;  3MPK A;  1D9V A;  5I2N B;  1SW1 A;  2X7P A;  3L6G A;  1Z7M E;  3E13 X;  5H8F B;  3FJG A;  4GFR A;  4YB7 A;  2F6P A;  5FHN A;  4BDM A;  4DCY A;  1UIV A;  1P1N A;  4FEC A;  3CIJ A;  4C1T A;  1UTB B;  4EF1 A;  3K6V A;  2I58 A;  2REG A;  2I4B A;  3ILT B;  2M8C A;  5TP9 B;  2XXV A;  3H3G A;  4JDF A;  3IOV A;  3U94 A;  4L17 A;  3I3V A;  2QMX A;  1MQH A;  3O66 A;  3PMV A;  5CMB A;  1LAX A;  4PFW A;  1B1X A;  3HHF A;  4GF8 A;  1FQF A;  5TPA A;  5HPQ A;  4XKN A;  1TT1 A;  5I59 A;  1LB8 A;  4O3B A;  2F35 A;  1B3G A;  2DE2 A;  4F19 A;  1MXY A;  3OO6 A;  1QUL A;  1XVX A;  3ONM A;  5FHO A;  4KQP A;  2GHA A;  4KFQ A;  2ZNU A;  3P7I A;  4XTC Q;  5CMM A;  5L9M A;  1IXI A;  3ECR A;  1R1N A;  2ANJ A;  1LFG A;  2I3V A;  1Y1M A;  2D3I A;  4QHQ A;  4KYE A;  4QFO A;  3C9H A;  4GLI A;  2XX7 A;  2ZYM A;  2H4I A;  3TCF A;  3LR1 A;  2O68 A;  4H1X A;  2OBG A;  5TU0 A;  4ELQ A;  1II5 A;  4EF2 A;  3FV2 A;  3QIM A;  3FVG A;  4KYD A;  2OWT A;  1H3D A;  2V3Q A;  2O69 A;  5ELV A;  4EQ7 A;  3F11 A;  1A54 A;  1A99 A;  4GL8 A;  3FAT A;  5AA2 B;  2F8D A;  4N6P A;  3C31 A;  2UXA A;  1UTH B;  2PT1 A;  3SER A;  1JW5 A;  2UVH A;  2DP8 A;  2FYI A;  3RTW B;  4JWY A;  3QUJ A;  4G68 C;  1M5F A;  5H8H A;  1WVJ A;  3OOA A;  4O3C A;  1YTV A;  4JSD A;  3R6U A;  3PPO A;  1N7W A;  3RGY A;  1NNK A;  5F1Q A;  1R9Q A;  4QFL A;  1GTK A;  3PPN A;  3SEW A;  1FTJ A;  3B7D A;  4JB7 A;  4FAJ A;  4OQO A;  1F9B A;  4U1Z A;  2B3B A;  2RCB A;  5L9S A;  5HM4 B;  4QFP A;  4QSE A;  1LAG E;  1B5H A;  5DVI A;  4Q5T A;  2WKY A;  1MXZ A;  3U1O A;  2H99 A;  4ONY A;  3Q29 A;  1Y9U A;  3DM0 A;  1D4N A;  3TEL A;  3R7X A;  4ZEC A;  4K3F A;  4AQ4 A;  2GH9 A;  4PQJ A;  5EYF A;  4P0I A;  2XD3 A;  4R9G A;  1PBQ A;  2DWH A;  4X1B A;  4ZED A;  2O84 X;  3MZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...