4Q60A

Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans atcc 17616, target efi-506586, open form, with bound pyrrole-2-carboxylate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
311
Chain Sequence
LYFQSMKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREYDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKDVALDVPGYGPVRGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYVQAEGGIVPTIRGSAHLSAEATLLIEDDDPFRWGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLINE RACEMASE
publication title CRYSTAL STRUCTURE OF PROLINE RACEMASE Bmul_4447 FROM Burkholderia multivorans, TARGET EFI-506586
rcsb
source organism Burkholderia multivorans
molecule tags Isomerase
total genus 78
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2014-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4q60A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4q60A01
2GKJA 1U1WA 1S7JA 5IWEA 2Q9JA 3EJXA 1T6KA 1XUBA 2Q9HA 5H2YA 5M47A 1U1XA 4JUUA 4IK0A 4K7XA 1U1VA 2GKEA 2AZPA 5H2GA 1TM0A 1U0KA 3EDNA 4JD7A 3FVEA 4Q2HA 4J9XA 4J9WA 3EKMA 4LB0A 4Q60A 1QYAA 1SDJA 4K7GB 4K8LA 1W62A 4JCIA 5HA4A 3G7KA 1YM5A 2H9FA 1BWZA 1QY9A 2PVZA 4DUNA 4JBDA 1GQZA 2OTNA 1W61A 2PW0A 1XUAA 4IJZA
chains in the Genus database with same CATH superfamily
1S7JA 3EJXA 1T6KA 2Q9HA 4JUUA 2IW4A 1I74A 1U0KA 2QB6A 3G98A 4JCIA 3PW9A 2H9FA 2QB8A 2PVZA 2ZXRA 3PVHA 3W5WA 1XUAA 2GKJA 4LG3A 2Q9JA 2QB7A 1WPMA 1XUBA 4IK0A 2GKEA 2ZXPA 3DEVA 5H2GA 1TM0A 3EDNA 4JD7A 2HAWA 4Q2HA 1QYAA 4K7GB 4K8LA 1WPPA 2KPTA 2ZVFA 1BWZA 1QY9A 2PW0A 1U1WA 4PY9A 3WQZA 3ICJA 5IWEA 1U1XA 2ENXA 4GL6A 3PTJA 4K7XA 1U1VA 2AZPA 2YMAA 5ANPA 4LS9A 3FVEA 2LT2A 1K20A 4Q60A 2EB0A 1SDJA 1W62A 5HA4A 3G7KA 2MPBA 1YM5A 4JBDA 1W61A 5H2YA 4OA3A 5M47A 1IR6A 1K23A 4J9XA 4J9WA 3EKMA 4LB0A 3IGHX 4RPAA 4DUNA 2KW7A 1GQZA 2ZXOA 2OTNA 4IJZA
chains in the Genus database with same CATH topology
1S7JA 3EJXA 1T6KA 2Q9HA 4JUUA 2IW4A 1I74A 1U0KA 2QB6A 3G98A 4JCIA 3PW9A 2H9FA 2QB8A 2PVZA 2ZXRA 3PVHA 3W5WA 1XUAA 2GKJA 4LG3A 2Q9JA 2QB7A 1WPMA 1XUBA 4IK0A 2GKEA 2ZXPA 3DEVA 5H2GA 1TM0A 3EDNA 4JD7A 2HAWA 4Q2HA 1QYAA 4K7GB 4K8LA 1WPPA 2KPTA 2ZVFA 1BWZA 1QY9A 2PW0A 1U1WA 4PY9A 3WQZA 3ICJA 5IWEA 1U1XA 2ENXA 4GL6A 3PTJA 4K7XA 1U1VA 2AZPA 2YMAA 5ANPA 4LS9A 3FVEA 2LT2A 1K20A 4Q60A 2EB0A 1SDJA 1W62A 5HA4A 3G7KA 2MPBA 1YM5A 4JBDA 1W61A 5H2YA 4OA3A 5M47A 1IR6A 1K23A 4J9XA 4J9WA 3EKMA 4LB0A 3IGHX 4RPAA 4DUNA 2KW7A 1GQZA 2ZXOA 2OTNA 4IJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKJ A;  1U1W A;  1S7J A;  5IWE A;  2Q9J A;  3EJX A;  1T6K A;  1XUB A;  2Q9H A;  5H2Y A;  5M47 A;  1U1X A;  4JUU A;  4IK0 A;  4K7X A;  1U1V A;  2GKE A;  2AZP A;  5H2G A;  1TM0 A;  1U0K A;  3EDN A;  4JD7 A;  3FVE A;  4Q2H A;  4J9X A;  4J9W A;  3EKM A;  4LB0 A;  4Q60 A;  1QYA A;  1SDJ A;  4K7G B;  4K8L A;  1W62 A;  4JCI A;  5HA4 A;  3G7K A;  1YM5 A;  2H9F A;  1BWZ A;  1QY9 A;  2PVZ A;  4DUN A;  4JBD A;  1GQZ A;  2OTN A;  1W61 A;  2PW0 A;  1XUA A;  4IJZ A; 
#chains in the Genus database with same CATH topology
 1S7J A;  3EJX A;  1T6K A;  2Q9H A;  4JUU A;  2IW4 A;  1I74 A;  1U0K A;  2QB6 A;  3G98 A;  4JCI A;  3PW9 A;  2H9F A;  2QB8 A;  2PVZ A;  2ZXR A;  3PVH A;  3W5W A;  1XUA A;  2GKJ A;  4LG3 A;  2Q9J A;  2QB7 A;  1WPM A;  1XUB A;  4IK0 A;  2GKE A;  2ZXP A;  3DEV A;  5H2G A;  1TM0 A;  3EDN A;  4JD7 A;  2HAW A;  4Q2H A;  1QYA A;  4K7G B;  4K8L A;  1WPP A;  2KPT A;  2ZVF A;  1BWZ A;  1QY9 A;  2PW0 A;  1U1W A;  4PY9 A;  3WQZ A;  3ICJ A;  5IWE A;  1U1X A;  2ENX A;  4GL6 A;  3PTJ A;  4K7X A;  1U1V A;  2AZP A;  2YMA A;  5ANP A;  4LS9 A;  3FVE A;  2LT2 A;  1K20 A;  4Q60 A;  2EB0 A;  1SDJ A;  1W62 A;  5HA4 A;  3G7K A;  2MPB A;  1YM5 A;  4JBD A;  1W61 A;  5H2Y A;  4OA3 A;  5M47 A;  1IR6 A;  1K23 A;  4J9X A;  4J9W A;  3EKM A;  4LB0 A;  3IGH X;  4RPA A;  4DUN A;  2KW7 A;  1GQZ A;  2ZXO A;  2OTN A;  4IJZ A; 
#chains in the Genus database with same CATH homology
 1S7J A;  3EJX A;  1T6K A;  2Q9H A;  4JUU A;  2IW4 A;  1I74 A;  1U0K A;  2QB6 A;  3G98 A;  4JCI A;  3PW9 A;  2H9F A;  2QB8 A;  2PVZ A;  2ZXR A;  3PVH A;  3W5W A;  1XUA A;  2GKJ A;  4LG3 A;  2Q9J A;  2QB7 A;  1WPM A;  1XUB A;  4IK0 A;  2GKE A;  2ZXP A;  3DEV A;  5H2G A;  1TM0 A;  3EDN A;  4JD7 A;  2HAW A;  4Q2H A;  1QYA A;  4K7G B;  4K8L A;  1WPP A;  2KPT A;  2ZVF A;  1BWZ A;  1QY9 A;  2PW0 A;  1U1W A;  4PY9 A;  3WQZ A;  3ICJ A;  5IWE A;  1U1X A;  2ENX A;  4GL6 A;  3PTJ A;  4K7X A;  1U1V A;  2AZP A;  2YMA A;  5ANP A;  4LS9 A;  3FVE A;  2LT2 A;  1K20 A;  4Q60 A;  2EB0 A;  1SDJ A;  1W62 A;  5HA4 A;  3G7K A;  2MPB A;  1YM5 A;  4JBD A;  1W61 A;  5H2Y A;  4OA3 A;  5M47 A;  1IR6 A;  1K23 A;  4J9X A;  4J9W A;  3EKM A;  4LB0 A;  3IGH X;  4RPA A;  4DUN A;  2KW7 A;  1GQZ A;  2ZXO A;  2OTN A;  4IJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...