4Q60A

Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans atcc 17616, target efi-506586, open form, with bound pyrrole-2-carboxylate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
311
Chain Sequence
LYFQSMKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREYDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKDVALDVPGYGPVRGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYVQAEGGIVPTIRGSAHLSAEATLLIEDDDPFRWGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF PROLINE RACEMASE Bmul_4447 FROM Burkholderia multivorans, TARGET EFI-506586
rcsb
source organism Burkholderia multivorans
molecule tags Isomerase
molecule keywords PROLINE RACEMASE
total genus 78
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2014-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4q60A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4q60A01
2PVZA 1W62A 1T6KA 4LB0A 1U0KA 1XUBA 2Q9HA 4IJZA 1GQZA 4JD7A 4DUNA 2GKEA 1TM0A 5H2GA 4JBDA 1U1XA 2OTNA 4K7GB 4Q2HA 5HA4A 1U1WA 3EDNA 4J9XA 4IK0A 4JUUA 1YM5A 2Q9JA 3EKMA 1SDJA 1XUAA 3FVEA 4JCIA 4K7XA 1U1VA 2H9FA 1QY9A 1QYAA 3EJXA 5IWEA 5M47A 4Q60A 5H2YA 4J9WA 4K8LA 1W61A 2GKJA 2PW0A 1BWZA 3G7KA 2AZPA 1S7JA
chains in the Genus database with same CATH superfamily
2PVZA 1W62A 1T6KA 2Q9HA 1GQZA 4JD7A 4LS9A 4JBDA 2OTNA 1K20A 4J9XA 4IK0A 1WPPA 1YM5A 2Q9JA 1XUAA 4JCIA 4PY9A 3IGHX 3PVHA 4J9WA 2EB0A 2GKJA 1BWZA 1U0KA 2ZXPA 5HA4A 1U1WA 2ENXA 4GL6A 3EKMA 5M47A 1W61A 2PW0A 3PW9A 4DUNA 2IW4A 4LB0A 3WQZA 1XUBA 4RPAA 2YMAA 5H2GA 2QB8A 4K7GB 1K23A 2QB7A 2HAWA 3PTJA 3DEVA 1SDJA 2MPBA 2LT2A 2QB6A 3EJXA 2ZXOA 3ICJA 2ZVFA 4IJZA 5ANPA 2GKEA 4OA3A 1I74A 1TM0A 1U1XA 2KW7A 2ZXRA 4Q2HA 3EDNA 4LG3A 4JUUA 2KPTA 3G98A 1IR6A 3FVEA 4K7XA 1U1VA 2H9FA 1QY9A 1QYAA 5IWEA 4Q60A 5H2YA 4K8LA 3W5WA 1WPMA 3G7KA 2AZPA 1S7JA
chains in the Genus database with same CATH topology
2PVZA 1W62A 1T6KA 2Q9HA 1GQZA 4JD7A 4LS9A 4JBDA 2OTNA 1K20A 4J9XA 4IK0A 1WPPA 1YM5A 2Q9JA 1XUAA 4JCIA 4PY9A 3IGHX 3PVHA 4J9WA 2EB0A 2GKJA 1BWZA 1U0KA 2ZXPA 5HA4A 1U1WA 2ENXA 4GL6A 3EKMA 5M47A 1W61A 2PW0A 3PW9A 4DUNA 2IW4A 4LB0A 3WQZA 1XUBA 4RPAA 2YMAA 5H2GA 2QB8A 4K7GB 1K23A 2QB7A 2HAWA 3PTJA 3DEVA 1SDJA 2MPBA 2LT2A 2QB6A 3EJXA 2ZXOA 3ICJA 2ZVFA 4IJZA 5ANPA 2GKEA 4OA3A 1I74A 1TM0A 1U1XA 2KW7A 2ZXRA 4Q2HA 3EDNA 4LG3A 4JUUA 2KPTA 3G98A 1IR6A 3FVEA 4K7XA 1U1VA 2H9FA 1QY9A 1QYAA 5IWEA 4Q60A 5H2YA 4K8LA 3W5WA 1WPMA 3G7KA 2AZPA 1S7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVZ A;  1W62 A;  1T6K A;  4LB0 A;  1U0K A;  1XUB A;  2Q9H A;  4IJZ A;  1GQZ A;  4JD7 A;  4DUN A;  2GKE A;  1TM0 A;  5H2G A;  4JBD A;  1U1X A;  2OTN A;  4K7G B;  4Q2H A;  5HA4 A;  1U1W A;  3EDN A;  4J9X A;  4IK0 A;  4JUU A;  1YM5 A;  2Q9J A;  3EKM A;  1SDJ A;  1XUA A;  3FVE A;  4JCI A;  4K7X A;  1U1V A;  2H9F A;  1QY9 A;  1QYA A;  3EJX A;  5IWE A;  5M47 A;  4Q60 A;  5H2Y A;  4J9W A;  4K8L A;  1W61 A;  2GKJ A;  2PW0 A;  1BWZ A;  3G7K A;  2AZP A;  1S7J A; 
#chains in the Genus database with same CATH topology
 2PVZ A;  1W62 A;  1T6K A;  2Q9H A;  1GQZ A;  4JD7 A;  4LS9 A;  4JBD A;  2OTN A;  1K20 A;  4J9X A;  4IK0 A;  1WPP A;  1YM5 A;  2Q9J A;  1XUA A;  4JCI A;  4PY9 A;  3IGH X;  3PVH A;  4J9W A;  2EB0 A;  2GKJ A;  1BWZ A;  1U0K A;  2ZXP A;  5HA4 A;  1U1W A;  2ENX A;  4GL6 A;  3EKM A;  5M47 A;  1W61 A;  2PW0 A;  3PW9 A;  4DUN A;  2IW4 A;  4LB0 A;  3WQZ A;  1XUB A;  4RPA A;  2YMA A;  5H2G A;  2QB8 A;  4K7G B;  1K23 A;  2QB7 A;  2HAW A;  3PTJ A;  3DEV A;  1SDJ A;  2MPB A;  2LT2 A;  2QB6 A;  3EJX A;  2ZXO A;  3ICJ A;  2ZVF A;  4IJZ A;  5ANP A;  2GKE A;  4OA3 A;  1I74 A;  1TM0 A;  1U1X A;  2KW7 A;  2ZXR A;  4Q2H A;  3EDN A;  4LG3 A;  4JUU A;  2KPT A;  3G98 A;  1IR6 A;  3FVE A;  4K7X A;  1U1V A;  2H9F A;  1QY9 A;  1QYA A;  5IWE A;  4Q60 A;  5H2Y A;  4K8L A;  3W5W A;  1WPM A;  3G7K A;  2AZP A;  1S7J A; 
#chains in the Genus database with same CATH homology
 2PVZ A;  1W62 A;  1T6K A;  2Q9H A;  1GQZ A;  4JD7 A;  4LS9 A;  4JBD A;  2OTN A;  1K20 A;  4J9X A;  4IK0 A;  1WPP A;  1YM5 A;  2Q9J A;  1XUA A;  4JCI A;  4PY9 A;  3IGH X;  3PVH A;  4J9W A;  2EB0 A;  2GKJ A;  1BWZ A;  1U0K A;  2ZXP A;  5HA4 A;  1U1W A;  2ENX A;  4GL6 A;  3EKM A;  5M47 A;  1W61 A;  2PW0 A;  3PW9 A;  4DUN A;  2IW4 A;  4LB0 A;  3WQZ A;  1XUB A;  4RPA A;  2YMA A;  5H2G A;  2QB8 A;  4K7G B;  1K23 A;  2QB7 A;  2HAW A;  3PTJ A;  3DEV A;  1SDJ A;  2MPB A;  2LT2 A;  2QB6 A;  3EJX A;  2ZXO A;  3ICJ A;  2ZVF A;  4IJZ A;  5ANP A;  2GKE A;  4OA3 A;  1I74 A;  1TM0 A;  1U1X A;  2KW7 A;  2ZXR A;  4Q2H A;  3EDN A;  4LG3 A;  4JUU A;  2KPT A;  3G98 A;  1IR6 A;  3FVE A;  4K7X A;  1U1V A;  2H9F A;  1QY9 A;  1QYA A;  5IWE A;  4Q60 A;  5H2Y A;  4K8L A;  3W5W A;  1WPM A;  3G7K A;  2AZP A;  1S7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...