4Q60A

Crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans atcc 17616, target efi-506586, open form, with bound pyrrole-2-carboxylate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
314
structure length
311
Chain Sequence
LYFQSMKRIQIIDSHTGGEPTRLVVSGFPSLGSGTMAERRDVLAREYDRYRTACILEPRGSDVLVGALLCEPVSPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIGPGVHRIETPVGTVEATLHDDLSVSVRNVLAYRHAKDVALDVPGYGPVRGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYVQAEGGIVPTIRGSAHLSAEATLLIEDDDPFRWGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF PROLINE RACEMASE Bmul_4447 FROM Burkholderia multivorans, TARGET EFI-506586
rcsb
source organism Burkholderia multivorans
molecule tags Isomerase
molecule keywords PROLINE RACEMASE
total genus 78
structure length 311
sequence length 314
chains with identical sequence B
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2014-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4q60A02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4q60A01
5H2YA 1XUBA 4K8LA 4JBDA 3EDNA 1YM5A 2AZPA 4LB0A 2PVZA 4JCIA 1BWZA 2GKJA 1TM0A 1SDJA 1S7JA 4J9XA 1U0KA 4K7XA 4IK0A 4IJZA 1QYAA 5HA4A 2PW0A 5IWEA 1U1XA 2Q9JA 1U1WA 1T6KA 1QY9A 3FVEA 1XUAA 4J9WA 5H2GA 2OTNA 4K7GB 2Q9HA 2GKEA 2H9FA 4DUNA 1GQZA 1W61A 3G7KA 4JUUA 4Q2HA 1U1VA 1W62A 3EKMA 3EJXA 5M47A 4Q60A 4JD7A
chains in the Genus database with same CATH superfamily
1I74A 1XUBA 4K8LA 3DEVA 4RPAA 4JBDA 2LT2A 2ZXPA 4IJZA 2QB8A 2PW0A 4GL6A 2ZXOA 4JUUA 1W62A 1K20A 4Q60A 5H2YA 2KW7A 4OA3A 3W5WA 2KPTA 4LB0A 2PVZA 2GKJA 2ENXA 1TM0A 1SDJA 1S7JA 4J9XA 1U0KA 4K7XA 4IK0A 1QYAA 5HA4A 1IR6A 1U1XA 3FVEA 1XUAA 5H2GA 4LG3A 2H9FA 1GQZA 4Q2HA 1U1VA 3EJXA 3PVHA 3ICJA 4JCIA 2QB7A 3PTJA 2ZVFA 5IWEA 2Q9JA 1U1WA 1T6KA 1WPPA 2EB0A 2OTNA 4DUNA 2Q9HA 2GKEA 4PY9A 1K23A 3G7KA 3EKMA 4LS9A 3G98A 3EDNA 3IGHX 1YM5A 2AZPA 1BWZA 5ANPA 2HAWA 2YMAA 2ZXRA 2IW4A 1QY9A 2QB6A 3PW9A 4J9WA 1WPMA 4K7GB 1W61A 5M47A 2MPBA 4JD7A 3WQZA
chains in the Genus database with same CATH topology
1I74A 1XUBA 4K8LA 3DEVA 4RPAA 4JBDA 2LT2A 2ZXPA 4IJZA 2QB8A 2PW0A 4GL6A 2ZXOA 4JUUA 1W62A 1K20A 4Q60A 5H2YA 2KW7A 4OA3A 3W5WA 2KPTA 4LB0A 2PVZA 2GKJA 2ENXA 1TM0A 1SDJA 1S7JA 4J9XA 1U0KA 4K7XA 4IK0A 1QYAA 5HA4A 1IR6A 1U1XA 3FVEA 1XUAA 5H2GA 4LG3A 2H9FA 1GQZA 4Q2HA 1U1VA 3EJXA 3PVHA 3ICJA 4JCIA 2QB7A 3PTJA 2ZVFA 5IWEA 2Q9JA 1U1WA 1T6KA 1WPPA 2EB0A 2OTNA 4DUNA 2Q9HA 2GKEA 4PY9A 1K23A 3G7KA 3EKMA 4LS9A 3G98A 3EDNA 3IGHX 1YM5A 2AZPA 1BWZA 5ANPA 2HAWA 2YMAA 2ZXRA 2IW4A 1QY9A 2QB6A 3PW9A 4J9WA 1WPMA 4K7GB 1W61A 5M47A 2MPBA 4JD7A 3WQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2Y A;  1XUB A;  4K8L A;  4JBD A;  3EDN A;  1YM5 A;  2AZP A;  4LB0 A;  2PVZ A;  4JCI A;  1BWZ A;  2GKJ A;  1TM0 A;  1SDJ A;  1S7J A;  4J9X A;  1U0K A;  4K7X A;  4IK0 A;  4IJZ A;  1QYA A;  5HA4 A;  2PW0 A;  5IWE A;  1U1X A;  2Q9J A;  1U1W A;  1T6K A;  1QY9 A;  3FVE A;  1XUA A;  4J9W A;  5H2G A;  2OTN A;  4K7G B;  2Q9H A;  2GKE A;  2H9F A;  4DUN A;  1GQZ A;  1W61 A;  3G7K A;  4JUU A;  4Q2H A;  1U1V A;  1W62 A;  3EKM A;  3EJX A;  5M47 A;  4Q60 A;  4JD7 A; 
#chains in the Genus database with same CATH topology
 1I74 A;  1XUB A;  4K8L A;  3DEV A;  4RPA A;  4JBD A;  2LT2 A;  2ZXP A;  4IJZ A;  2QB8 A;  2PW0 A;  4GL6 A;  2ZXO A;  4JUU A;  1W62 A;  1K20 A;  4Q60 A;  5H2Y A;  2KW7 A;  4OA3 A;  3W5W A;  2KPT A;  4LB0 A;  2PVZ A;  2GKJ A;  2ENX A;  1TM0 A;  1SDJ A;  1S7J A;  4J9X A;  1U0K A;  4K7X A;  4IK0 A;  1QYA A;  5HA4 A;  1IR6 A;  1U1X A;  3FVE A;  1XUA A;  5H2G A;  4LG3 A;  2H9F A;  1GQZ A;  4Q2H A;  1U1V A;  3EJX A;  3PVH A;  3ICJ A;  4JCI A;  2QB7 A;  3PTJ A;  2ZVF A;  5IWE A;  2Q9J A;  1U1W A;  1T6K A;  1WPP A;  2EB0 A;  2OTN A;  4DUN A;  2Q9H A;  2GKE A;  4PY9 A;  1K23 A;  3G7K A;  3EKM A;  4LS9 A;  3G98 A;  3EDN A;  3IGH X;  1YM5 A;  2AZP A;  1BWZ A;  5ANP A;  2HAW A;  2YMA A;  2ZXR A;  2IW4 A;  1QY9 A;  2QB6 A;  3PW9 A;  4J9W A;  1WPM A;  4K7G B;  1W61 A;  5M47 A;  2MPB A;  4JD7 A;  3WQZ A; 
#chains in the Genus database with same CATH homology
 1I74 A;  1XUB A;  4K8L A;  3DEV A;  4RPA A;  4JBD A;  2LT2 A;  2ZXP A;  4IJZ A;  2QB8 A;  2PW0 A;  4GL6 A;  2ZXO A;  4JUU A;  1W62 A;  1K20 A;  4Q60 A;  5H2Y A;  2KW7 A;  4OA3 A;  3W5W A;  2KPT A;  4LB0 A;  2PVZ A;  2GKJ A;  2ENX A;  1TM0 A;  1SDJ A;  1S7J A;  4J9X A;  1U0K A;  4K7X A;  4IK0 A;  1QYA A;  5HA4 A;  1IR6 A;  1U1X A;  3FVE A;  1XUA A;  5H2G A;  4LG3 A;  2H9F A;  1GQZ A;  4Q2H A;  1U1V A;  3EJX A;  3PVH A;  3ICJ A;  4JCI A;  2QB7 A;  3PTJ A;  2ZVF A;  5IWE A;  2Q9J A;  1U1W A;  1T6K A;  1WPP A;  2EB0 A;  2OTN A;  4DUN A;  2Q9H A;  2GKE A;  4PY9 A;  1K23 A;  3G7K A;  3EKM A;  4LS9 A;  3G98 A;  3EDN A;  3IGH X;  1YM5 A;  2AZP A;  1BWZ A;  5ANP A;  2HAW A;  2YMA A;  2ZXR A;  2IW4 A;  1QY9 A;  2QB6 A;  3PW9 A;  4J9W A;  1WPM A;  4K7G B;  1W61 A;  5M47 A;  2MPB A;  4JD7 A;  3WQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...