4Q66C

Structure of exomer bound to arf1.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
134
Chain Sequence
ILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVSFTVWDVGGLDRIRSLWRHYYRNTGVIFVVDSNDRSRIGEAREVMQLNEDELRVFANKQDLPEAMSAAEITEKLGWFIQATCATSGEGLYEGLEWLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chs5p
publication title Structural basis for membrane binding and remodeling by the exomer secretory vesicle cargo adaptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae r008
molecule tags Protein transport
total genus 29
structure length 134
sequence length 155
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q66C00
3L82B 1E9DA 2QP4A 4U02A 2ZS8A 3AP1A 3MSXA 3P4XA 3AP3A 1OIXA 2XNSA 3HU2A 3NWJA 3Q9LA 1L4UA 2WWGA 4X8HA 3T15A 1QHHB 3QSYA 4ACBA 1AJEA 3NTUA 3A4MA 1NF3A 2YV5A 1R7RA 4HLQB 2FJUA 1R5NA 2FOLA 3HPQA 1NSTA 2YINC 4V0ME 3QF4A 3GLGE 1Z6AA 2AD5A 4GT1A 4WZBE 1KO5A 3QENA 4EQ6B 1OFTA 2O52A 2CCGA 3TJZA 3VHXA 1R4AA 3AM1A 3FPAA 2J45A 1QDEA 2G9NA 1Q12A 2JLQA 4NZYA 2GJAA 4UXHA 4TWZA 4HB2A 1XDBA 4EDHA 5L3QA 4PSAA 2YJTD 5G53C 1N6RA 3V00A 1RYFA 3IDQA 5FH9A 1AKYA 1OW3B 3I72A 3LA6A 1Z83A 3LAWA 5H8WA 4CEHA 2WPDD 2WMNB 3BC1A 1R10A 1FPMA 3RANA 2IS6A 2Z4RA 4NKRA 1CU1A 1KY2A 3IHLA 2YKGA 4PZZA 1I4DD 4B3DA 3G82C 5C4MA 3U3JA 3LLUA 3U6BA 2JLVA 3VR1A 3PEYA 1UF9A 2BVNA 5JHGB 3RWOA 2QU8A 2OBLA 1PVOA 3D3QA 2VIIA 1U98A 1P62B 4UNQA 4PPFA 4TLBA 4LI0A 3MRSA 1AGPA 2QSZA 4ARZA 3LW7A 2JAQA 4NCNA 2CE2X 3A1UA 4TYWA 2EU8A 4L16A 4OI0A 1XEWY 5JLJA 3GLFB 4D81A 4AKEA 2NO9A 3PUWA 4P32A 2ZI9A 4CYMA 4MH0R 4DHEA 4EPYA 2IYXA 3UXMA 3CPEA 3L8YA 5DGXA 2O0HA 3BFXA 4H1VA 2ZR9A 4G1UC 3ZYCA 1XTRA 5KDOA 3SQWA 1KK3A 1UDXA 1D5CA 4PAOA 1IN6A 1X86B 2VH5R 3EASA 2JJ8A 5DE3A 4LYHA 4DSUA 3ZH9B 1E99A 1NIPA 5IRCD 3WRXC 4DCTA 4B48A 2RCNA 3MWYW 2IYVA 4PO1A 1ZIOA 5UKDA 1YZUA 4IDHA 4LJ5A 1HQCA 3OEEA 5E4FA 4MYCA 4M1WA 4BEBA 4DUGD 4Q47A 1E2HA 4C0HA 1H8HD 4LY6A 2NOAA 3H0KA 1SXJC 1DPFA 3BERA 2VSOA 2WMOB 1T3LA 2GEUA 2MSEB 4KLNA 4C7OA 1JEDA 4YMWA 4MGIR 4LJ7A 4QG7A 4PC1A 4BZPA 1PZNA 2IYZA 4B43A 2CEAA 1IQPA 3WRYC 1XPRA 1KKLA 5CLLA 3FE2A 2OHFA 3RRZA 1Q0UA 1GM5A 2V4ZA 4B75A 4AURA 4C0AC 3NKVA 4DBLC 2GWHA 2NPIA 4TLCA 1NKTA 3IEUA 4OK6A 1XU4A 5JI2E 2ZSDA 1E0JA 1E9EA 3RSLA 4BFXA 2WOOA 2F6RA 5A5GA 3TUZC 3R9XA 4P0TA 2HJGA 2UVQA 4OHXA 3UWOA 1E32A 4OHVA 3AVVA 3M0EA 5FTJA 5JRZA 4OL0A 1DAHA 3BIFA 5HZKA 1FQKA 4LOAA 3T35A 1E1RA 3FMPB 3R7WA 4ESHA 1YU9A 3CIOA 2IS4A 3V4FA 2FSHA 3CF0A 5K8TA 2D7CA 5AUOB 1OFIA 3AVTA 2A2ZA 3OZXA 5CK5A 2PJRA 1MO6A 2A5FA 1Z63A 2ORWA 1E9SA 2WICA 1OXSC 1XD8A 1E4YA 2HCBA 2G0NA 3O47A 2CJWA 4NYIR 1W0KA 1YZLA 4OK3A 5DYIA 3VKGA 4BLPA 4Q7MB 4JSTA 2RGBA 3IHWA 2GILA 4RZXA 4FWIB 4N3NA 1J8YF 3KXIA 3Q7QA 1HH4A 4OBEA 4EFMA 3AF1A 1U9IA 3SYKA 1T6NA 3A36A 3EXAA 4GPTA 2QTFA 2Q0HA 3TUIC 1DVRA 4KBFA 2O8EA 4OHWA 5J4HA 2QMHA 3NEYA 4I99A 5TB5A 1F5NA 1KI4A 2F43A 2OZEA 3RRNA 4MYTA 4KFUA 1G9XA 4US1R 2OCYC 2OLKA 4AIIA 1LNZA 1J70A 5J47A 4RCYA 3LDAA 3UG7A 3ASYA 2IYRA 4WXPA 1ESMA 1DADA 4ZI2A 4WVFA 2D2FA 4PHFA 4IEIA 2GJ8A 2ZRFA 2O5VA 1DAEA 4BLTA 3TVTA 2IA5A 2DFKB 3E5HA 3L0OA 1S8FA 2JA1A 1OH6A 3ZJYA 5CDFE 1XTJA 2HEIA 1ZC4A 2KWIA 4JBYA 2FFAA 2NQ2C 1G1MA 1G7RA 4JLJA 1QF9A 2VQSA 3LXRA 2NO6A 4A8JB 2JIZD 1ZC3A 5A4JA 2QTVB 4RSGA 2GK7A 1OJLA 4IVPA 4JJKA 5JECA 2R6GA 4FIDA 4CEIA 4RY2A 2J3EA 4FMDF 1DG1G 3TE6A 4AD8A 2RHMA 4KCGA 4TLEA 3D31A 4DLWA 3LFUA 1YZTA 1CRPA 4KHZA 2A3RA 2W6ID 1KHTA 3NHAA 4FWTA 3NBFA 2W00A 1QHHA 3CRQA 2BBWA 4TTPA 1ZNZA 2P0EA 3GP8A 4MYHA 3U61B 4BFYA 3K1JA 1JEEA 1M1YE 3NDBB 1Z3IX 2QSYA 3BJIC 3KZ1E 4EKDA 2Q21A 1VIYA 2QAGB 3PENA 1EFRD 5FBVB 3KQLA 3SQXA 3LBNA 5JRJA 2K5UA 4HSEA 2PLRA 4PO9A 4NU0A 5GJVC 3IGFA 2OEPA 2VP9A 2RH5A 4LHYA 5EP4A 2FU5C 1P9WA 5J4KA 1T9HA 3SYNA 4M1MA 2O8CB 4KVAA 1U99A 1GIAA 2XX3A 2GESA 3HWSA 4KYIB 1EFUA 2FFQA 1UAAA 5FFMA 1J7KA 3QY0A 2FSGA 4LK2A 1NKSA 3TQCA 2XSZD 4QM6A 3NXSA 2QBYB 4YMSA 3W3ZB 3OAAD 1KO8A 4HDCA 4TSFD 1TUIA 1O3YA 1FMLA 1F2TA 5KSPA 4U7DA 5L3RA 4FD2A 3C15C 2BMEA 4DT1A 1VG1A 2E9SA 2LKDA 4P4SB 721PA 1NSFA 2JGNA 3THOA 3QNUA 3O8BA 5FOUA 5J4YA 1GRRA 1S9HA 4EUNA 4EPVA 4DIEA 1UM8A 2QE7A 4XTRA 4ZDKA 1QG2A 2QGZA 2VRWA 5JFGA 1UADA 3AH8A 2XNDA 2ZUBA 4HAYA 3RABA 2QRNA 2GK6A 3KKOA 4GOJA 4E07A 1BYIA 2WJIA 1HY3A 3THWA 3CW2A 4KJZA 1NMXA 1W4CA 1K6MA 2ZYVX 5G41A 3RSOA 2EFDB 2N42A 4MRVA 421PA 2ORVA 2BCGY 4QJ3A 4CF7A 2FH5B 2ZXUA 1X8LA 4Q01A 1HTWA 2V54A 2HLDD 3WMEA 1DG3A 5FTKA 4JVMA 4QGHA 1E79D 5SZKB 3TBKA 4FCVA 4TYQA 3MWJA 5P21A 4MUBA 2OAP1 2QT1A 4MRSA 3OEHD 1U8YA 1BH2A 4ZCIA 2L0XA 2PX3A 1H8EA 3DM5A 3U4QA 3I8XA 4R2HA 4DLSA 2JASA 1CR2A 1WF3A 4QXAA 4DLTA 4PZYA 1PUIA 3Q72A 1KTVA 4OJQA 5SZHB 3CF2A 3B2EA 4QGAA 4MGZR 3BK7A 1CJTC 6Q21A 3OE7D 5KNBA 2FE4A 2ZI3A 3NVAA 3CH4B 2VA8A 3ZGXA 1IN5A 2X2FA 3KKNA 3VX4A 1P5ZB 1P2TA 4R7ZA 5CK4A 3AUYA 4WXRA 1G6OA 5LBIA 3B9QA 5H70A 2GVDC 1N25A 2GKSA 4HDOB 5BQ5A 1AKEA 2ECKA 3R20A 1TF2A 3N2IA 2ANBA 1J2JA 3PUZA 1TU3A 5EE3A 1T5LA 2GXUA 4ITRC 4RD4A 1CRQA 2R44A 3FWYA 4PSKA 2ZJZA 121PA 3NH9A 2VHTA 5LB2A 4LHVA 2WKRA 1J99A 2IYLD 3X1DA 3QEJA 2BWJA 1A1VA 1YHNA 5FPKA 1KDTA 2FDCA 1AA9A 4U00A 3EZ7A 1ZUNB 2ZSBA 3AQ4A 1P61B 3NHBA 2BHRA 3RS4A 5EUMA 3BH6A 2DB3A 2IK8A 4OJKA 1RKBA 2Q6TA 3U7FB 4CDGA 3Q7PA 5K8UA 2IF2A 2PCJA 1JJVA 1Q22A 2XGJA 3D8BA 4F93B 4DSOA 1VMAA 3DDCA 2VHQA 1G20E 4BFSA 3QXSA 2XJ9A 3R8FA 4C0BA 3GJ6A 3CX6A 3OFNA 4A92A 3BH7A 1US8A 5KPDA 1II8A 2XOKD 1R0WA 4L9WA 2A78A 1II9A 3GEHA 3QXJA 4BE7B 5LPNA 1WDTA 2PZGA 4ESVA 3KJGA 2IXGA 3EARA 1E98A 5IT5A 1YZGA 1SXJD 1W1WA 4BASA 1QHXA 4I1OA 5KSZA 4DB2A 1B23P 1Y3AA 2CHVA 5E3HA 4YMUA 3OIUA 4HLCA 3TRFA 1Z6TA 2OBNA 3A37A 2ONKA 4B33A 4AKIA 5AJWA 4D4KA 4KLZA 2EVWX 3KJIA 2KI5A 3I62A 1NBMD 3CWZA 1CKEA 1KDRA 2OO7A 3QPVA 4XWKA 1IBRA 1E9CA 1VIAA 1NRJB 2O8FB 3Q85A 4ZDIA 2MSCB 1GITA 4NTZA 5HR5A 2AFIE 2BCJQ 5J40A 4HAZA 1P2VA 1G3RA 1M34E 3AF2A 2R65A 3QVVA 1JAIA 4IXNA 4M53A 4Q7LA 1N3BA 5LD2B 2VYFA 3THYB 4L4UA 4QGGA 4DZZA 2QPAA 3VHLB 2WPDA 4EPWA 4JS0A 2REBA 2J0UA 5SZIA 3ADDA 4A8JA 4UQOA 1LV7A 1ZP6A 2O8DB 1XCGB 2FPKA 2CL6X 3QKSA 5M04A 1EFCA 3QIAA 1UJ2A 2XEXA 4ZDWA 3I5XA 4UNNA 3KUCA 2O8BA 2OFXA 1SVWA 1KZGB 1IOZA 3ZZTA 2QMOA 5FTMA 2J1LA 3T1VA 3MGCA 3SS8A 5BN4A 2AXPA 1IAQA 4XJXA 3W6NA 2WJJA 4P3YA 5FBWB 4KFRA 3K0FB 5FPSA 4DDUA 2OFWA 1OE0A 4IEEA 1JB1A 4F4CA 3H84A 3AVQA 5JJKA 1G7SA 3ADBA 2C95A 2GAOA 1LTQA 3LV8A 1W36D 3RAPR 2WKPA 2WZQA 2QAGA 3NH6A 4B3FX 2IT1A 5K8IA 3A1TA 1ODFA 2V3CC 1AZTA 1XP8A 4GMXA 4TL8A 3RLFA 3T5GA 1RYHA 4W5JA 2OXRA 3CBQA 1DARA 3KTAA 1KI3A 4EFNA 1IY0A 2EFCB 1U8ZA 3GEEA 2NTYC 3JVVA 2RGDA 4GFDA 2NMVA 2JJ2D 1QHIA 3CX7A 1TPZA 1OF1A 1QHGA 3BBPA 4EAQA 1JXMA 1Z6GA 2GCOB 2FEOA 4Q1BA 2KE5A 3P27A 4JLOA 3K9HA 2QA5A 1F2UB 1R6BX 1N0VC 3C41J 3W5IA 3ETLA 1EX6A 3RS7A 1N6HA 4JL8A 1SHKA 5TARA 4DUGA 1RPZA 5EE0A 3U5ZB 3M1IA 1H8HA 2V6IA 2FX3A 1I2MA 1TEVA 1Q21A 1W0JD 1E2EA 1OHHA 1P3JA 1IY1A 1G4UR 3EAQA 4B74A 1SVLA 3HU3A 3SYLA 3GLIE 1XJCA 2XXAB 1UEJA 1G8YA 5JS8A 1UPTA 3RS5A 4R2IA 2HT6A 4QNRA 4OHZA 2BV3A 3TW4A 2JATA 4AI6A 1XMVA 3FKSA 3FYHA 1CTQA 2PMKA 1Q1EA 4QBHA 3U44A 1P9NA 2YZ2A 4OQMA 3HDTA 2YC4C 2G77B 3RS0A 4FMCB 1HUQA 1EWRA 1MV5A 3DOEA 3MMPA 1R0ZA 1N6LA 2V1XA 5HE9A 1MO5A 4F4IA 2F9LA 3LX5A 1TQ6A 2ZTSA 3THXA 3P32A 4XIGS 4NCHA 1JBKA 3DMDA 2W0MA 2YWFA 2GBLA 4MDFA 2H7VA 1FX0A 1R5BA 5EJEA 5JZVA 4IDPA 1DTSA 2AWNA 2OCBA 4XVUA 1T8UA 2VBCA 2WVJA 3DOFA 1JECA 3AGQA 4LCBA 3Q5EA 2GXSA 3QBVA 4MGYR 3K70C 2V7QD 1M7BA 1UFQA 3FGNA 3GEIA 4I4LA 2I4IA 3O8DA 2V55B 1PV4A 2WBLC 3SEAA 2ZSFA 4LX0A 3K0AA 3NBYC 1AGRA 1HV8A 2QM7A 2QP3A 4XOIA 5F9HA 3MAAC 4MRPA 3EZ9A 4QOSA 1F48A 1JQJC 2JLYA 2P65A 4URXR 4HLDA 2BBOA 4IDOA 4CVNA 5TMPA 2AKAB 4CZ2A 1XMIA 1FTSA 2ZR7A 1SXJB 4LJ4A 4NYJR 1MO3A 4TMXA 4TL6A 5FPYA 2J7PD 1WCV1 4A9AA 1OYWA 2ZI6A 3PJRA 5DI3B 1WBBA 3FHOA 1X8JA 4GI7A 5EE5B 5EE1A 5B2ZA 2YWHA 2H17A 2IYTA 4Q9HA 1XD9A 5JJIA 4B3XA 2B6HA 1G291 1EXMA 2IYSA 2ZI5A 1KK2A 1HEIA 4C0JA 1XRJA 4Q9IA 4IFBA 2QTHA 3E2IA 2UKDA 4QBIA 1MT0A 2CHGA 3A1VA 1ZCBA 4V0NA 5G3ZA 1RRFA 3WYGA 1TF7A 3QF7A 5EZ6B 2NO7A 2ATVA 1KO7A 2REXB 1G7CA 3W8RA 2CMKA 2A7QA 1ZW6A 1SKQA 4JT4A 2OXCA 2C96A 5FR2A 4NYIQ 5C4GB 1S96A 2JIZA 4MRRA 1RC8A 4HDQB 1XCPA 3CNNA 4B3GA 4D0GA 4DLZA 3CF6R 3JZAA 2IX3A 4CT4B 2GXQA 2IHYA 5JI3E 2F3RA 2V1UA 4GRAA 2C98A 2J41A 4MQBA 4RCZA 1A7JA 4KO8A 1Z47A 1LW7A 2W6IA 5DH9A 5BW8A 3LQQA 3GLHA 1IN7A 1BMFD 4Q21A 1YVDA 1ZAKA 2DR3A 4BFWA 3AKDA 4IOLA 3GLGB 1SQ5A 3CRMA 2BJVA 1WE2A 1GILA 1KYIA 4ZKDA 2UZ3A 2NIPA 2JLRA 3VR6A 1W36B 1W48A 2LCFA 3FKQA 2RKOA 3UPUA 1M7HA 3PVSA 3LD9A 1GUAA 1EFRA 4G0NA 1G41A 2JJ1D 2PX0A 2G83A 4D80A 1L8QA 5GJBA 1QHNA 3X1YA 1K5GA 1YR6A 5JS7A 4OYHA 5FOTA 5FR1A 4BLQA 4NCIA 1E4VA 2WJGA 3CPHA 4X8LA 2AFHE 3I4LA 4O2LA 4G01B 2AWOA 4A2WA 2ZYWX 1NY5A 3IO5A 4TTRA 2JLWA 1KI6A 2E1RA 3LH5A 3CLVA 4MKGA 2WSSA 2Q9AA 1DAGA 4I81A 3OAAA 4B76A 3TGPA 2Q9BA 2X2EA 4TSFA 1U9IC 4B2PA 4M0LA 2GNOA 2W0SA 2QPOA 3EIQA 5D3QA 3SC3A 4A0GA 3QBTA 2RGXA 1HE8B 1NVUQ 5DLQC 4YLGA 2IF0A 2NO1A 2ZU0C 2G6BA 1CBUA 3TR0A 1S3SA 3S1AB 3VNVA 1N0UA 4PO8A 2NO0A 4TYPA 1GOTA 5J4LA 5JEEA 1KJYA 3LWNA 3L2OB 2D7DA 3U7EB 1YR7A 4JSYA 3P1JA 4Q9JA 3F0TA 1SVSA 2PT7A 2RGNA 2IYWA 4KV9A 4L8GA 3U3KA 1FTNA 2F7SA 3AUXA 4HZUA 4Q1FA 3PV0A 1J8MF 3B13B 2FSFA 1G3QA 2VEDA 2ZROA 4Y0VA 5DN6A 1SVIA 2GZDA 1JALA 3ND8A 4TQAA 4WOPA 1R2QA 2RAPA 3RNLA 4HB3A 4NH0A 4XTCS 1ZCAA 2ZJOA 2QNRA 2JDID 4ZO4A 2GCNA 5CYOA 3W9YA 5JMTA 2HLDA 3LNCA 1VHTA 4A0FA 2HF8A 1E79A 1XXHA 1SULA 2WM9B 5H1YA 1UKEA 4O0MA 1ELOA 4NE2A 2FZ4A 3OEHA 2PCLA 1E0SA 1RZ3A 3NDPA 3WMGA 2N1BA 4M8NE 3RC3A 2CE7A 3B1VA 1XEXB 3MG9A 2V8OA 3TIFA 4JT2A 1YKSA 3RC8A 3K0CA 1OH5A 3IO3A 2XAUA 3OE7A 5FOXA 1IY2A 2Z6VA 2R6FA 4C3ZA 4Q00A 4OI2A 1DS6A 4D2IA 2XTNA 1TX4B 3B6EA 2DY1A 1LS1A 1Q44A 1R0YA 1SKYE 2GHIA 3BWDD 5EE9A 4RVCA 2C99A 3CRW1 4IRUB 1OH8A 3EPHA 3B8HA 2XB2A 5L3SA 1N5IA 4Z54A 4LYJA 1YE8A 3TSZA 2WJYA 3WNDA 5EUQB 2XZOA 3GJ3A 1TQ4A 3EWAA 1C1YA 3LW8A 2R6CA 2CDNA 4JVLA 4PTLA 4US2R 4ZKEA 2VTKA 4W5HA 3QEOA 4JKYA 2EFHB 2WAYA 4JIMA 5B30A 5KYKA 2I1QA 4RKEA 4OI1A 2VLIA 2FNAA 4QHTA 3MWKA 4P4UA 3V9PA 4R71A 3QXCA 1P7CA 1X6VA 1KO1A 2J0VA 5GVRA 4HUQB 1ONBA 1N6PA 5BYKA 3TLXA 2ZYTX 4RD6A 4O3MA 2PMDA 3I3SR 4LRWA 4TZ6A 2ANCA 4ZDJA 3C5HA 1JR3A 2C04A 3GJ5A 3ZZ0A 3TMKA 5DSZA 3QOFA 2C9OA 3A6PC 3BB3A 3PG5A 3QKTA 2BBSA 3KDSE 1FL9A 5KU1A 3MJHA 4HUTA 2CXXA 4NONA 2XOKA 4PAMA 1KI1A 2ZRIA 3ZVRA 1GL9B 1EX7A 4DWJA 5EP1A 1M7GA 3LX8A 4I1UA 5FBRB 2R6DA 3BORA 2IHBA 2PBRA 4PHTA 8OHMA 2MMCA 2MMGA 4Q9KA 2FGKA 3N5CA 4NHOA 3VX3A 1CR1A 2CK3D 2YHSA 3TK1A 3LVRE 2A5DA 4F91B 1G5PA 3MFYA 1FUKA 2O0JA 5HPYB 2ZJ2A 4G5OA 4CRWB 1ZM9A 1OKKD 2F3TA 1NBMA 4IXMA 1QVAA 4Q7KA 1KK1A 5HCIA 3RDPA 1DAKA 2EQBA 2IYUA 3EA0A 2DFNA 3L8ZA 4WAUA 3WXMA 4IOJA 4BWYA 4JLNA 1CIPA 1N2CE 1E2IA 2OESA 4BZQA 4RJLA 3SU8A 1KSJA 1GNPA 1ZYUA 4EQ6A 3MLEA 4JVSB 4HAWA 3AV0B 3K9NA 4NBSA 1IJFA 1X1SA 5FOVA 1Q3TA 4II7A 3K0EA 5E7JA 2PEZA 2HF9A 1VDZA 1C4OA 4URUR 2AK3A 4Q4LA 3G0HA 4BPBA 3FFAA 1PLJA 2WOJA 3LRPA 1W2HA 4RZUA 4A2QA 1VYVA 3SR0A 3OESA 4NPHA 4DDTA 5JWOA 1LFDB 3CNOA 1FP6A 1KI7A 2W2XA 3G5UA 5DNYB 3B60A 4POAA 4GOKA 2WWXA 2Z4SA 3DZDA 3ZZUA 3IIKA 1LY1A 1OV4A 1X1RA 1WB9A 5B58C 4Q4HB 1G4AE 1W46A 4V0MA 4CT5A 4JMPA 1CP2A 1E2DA 1A5TA 4KU4A 4UNPA 4V0LA 2CL0X 2IWHA 2F1RA 1CJMA 1NLZA 1NVWQ 1ZRHA 2YC2C 3N2EA 4AKGA 1P2UA 1RFLA 3SDZA 2QY9A 4M1SA 4O2RA 4P31A 2VSXA 3X2SA 1U0HC 4W9MC 4L5BA 2GF0A 3VU9B 1KY3A 1IHUA 4LSGA 5SZJA 2F1HA 1X3SA 4FN5A 3TR5A 1G3MA 4ABYA 4AWXA 3QVUA 3QXXA 4DSNA 1WA5A 4PPNA 3RRYA 4LBWA 4HB4A 2QROA 3QKUA 1NVVQ 3LLMA 4Z1MA 4C0LA 1E2MA 2HXSA 3GLFA 3PUXA 4QGFA 1G17A 2P5SA 2OAQ1 1DEKA 4DCVA 621PA 2JJ2A 1NLFA 2VP4A 4D4JA 5C2JB 3ZD7A 4FI3C 4ASUD 2Q3HA 1E2GA 2CL7X 2C03A 3AVPA 3QJYA 4K8OA 4RZ3A 1D8TA 2R62A 3LY5A 3CRVA 3W34A 1ZU5A 5FTLA 2RGGA 1ZU4A 3NIBA 5BN3A 1G8GA 4TMWA 3EWSA 4XVQA 1GZSA 1P9RA 4YC7A 3FMFA 4M1KA 1GTVA 1U8AA 1W5SA 3SE0A 2R9VA 5GVSA 2F55A 2XZPA 1Z06A 4MUAA 2FV8A 3QG1A 5FUWA 4IDQA 1L7VC 5FOSA 1NVXQ 3EG5A 3SFVA 1MABB 2KB0A 4K46A 1F6BA 3K0SA 1OT3A 2ZE8A 3Q5DA 1E1QD 4RFSB 1U0JA 1KI9A 2EWVA 3A58B 4Q4JB 2W2VA 3L0IB 4Q03A 2HYDA 3CNLA 5F2EA 1OIVA 4LYFA 3TUJC 3KB1A 2P5TB 1NJFA 3EZFA 2IUUA 1BKDR 3SI7A 4BUJA 3RYTC 4UNRA 3QQ5A 2C77A 3A8TA 3AVOA 3PFIA 2ERXA 1I4TD 4RD0A 1NNEA 1DELA 1XD2B 4BLOA 4DLUA 4Q18A 2W2TA 3HPRA 4A8JC 2BM0A 1KOFA 1GSIA 1F3OA 4OHYA 2ONJA 4LPKA 4CGZA 2AX4A 1D2NA 3TKLA 5AUPB 2QZ4A 4B3BA 1W47A 2QQEA 1IXRC 3C8UA 1VCIA 1KMHB 3K9GA 821PA 3ZS9A 2ODWA 2REOA 4GMDA 3RVBA 1CLUA 3C4JA 3BH0A 2V7QA 5LB4A 1A2BA 1PLKA 1NN1A 2ZRCA 1XEXA 5BWMA 1W0KD 1MR3F 1M6NA 5HZHA 5EXTA 3B5JA 3L0PA 4XSGA 1XTIA 3I1FA 4OI4A 2JLSA 2GEDA 3SN6A 3BB1A 1Z8FA 4PC7A 3IEVA 1CS4C 3FOZA 3T1TA 2DPXA 5G3YA 4JLBA 3L43A 4XSHA 4QJ4A 2QAGC 4DEXA 4DLXA 3DO6A 5E7IA 3ZD6A 1DBSA 2AD1A 3A1WA 3N70A 3MCAA 2VP6A 3FVQA 2FA9A 3C5CA 3GLHE 1SVOA 2ZS9A 1T3SA 4MYUA 2BBTA 5EQTA 2J7PA 1YR8A 3CR7A 3WYAA 4HI0E 3UK6A 1E6CA 3CX8A 4A15A 3PXGA 1GRQA 4TYYA 1G21E 5AJVB 3W8NA 2H92A 4LHZA 1GP2A 3EIHA 5HTKA 1GDDA 5L3QB 1KNXA 2VP0A 4TQ9A 1WXQA 2ZRNA 2CVFA 2H18A 1E2PA 3MD0A 4JLKA 3D7MA 4BRUA 3KQHA 4M2LA 4A36A 1P2SA 2CCKA 2W58A 5AWFC 4CEHB 4JZKA 4AG6A 1GL7A 3UANA 3ZLJA 1E2KA 4BFTA 3EW9A 3O8RA 5AJXA 4C0QC 4EJSB 3F5FA 4WZAE 4ZCLA 3HJNA 1SGWA 2VHUA 1FOEB 2ODEA 4TMTA 3DEFA 1EESA 4KODA 1CJVC 3ZDQA 1FZQA 1KJWA 1NVVR 2VP5A 4MKFA 4RD3A 3K70B 3RS3A 3AVWA 1TADA 2BEJA 4QJ5A 3DHWC 1FMJA 2ZETA 1TUEA 3TNFA 3W5JA 1XMSA 4NYJQ 3KKMA 4KSCA 4A0HA 5KPJA 4TZ0A 2I1VB 4H9GA 4TN1A 1RRCA 5AR1A 2ZRPA 3HP1A 4ARZB 4DCUA 1BMFA 4NCKA 2GF9A 2KBFA 3ADKA 1NG9A 4C2UA 3GQBA 4DSTA 2QORA 3SJCA 1XWIA 2NZ8A 2W83A 2YWGA 3ZS8A 2GBLC 3CR8A 4LBZA 2B8WA 3W90A 4HAVA 3T06B 1WBDA 2R8RA 1GNQA 2ZU6A 2JJ1A 3J81k 3BE4A 1TF5A 2QMEA 2ZJAA 1CR0A 1JJ7A 4FCWA 3ZIAD 2ODNA 5JHHB 4H1UA 521PA 2FPMA 4AG5A 1WMSA 1SHZA 1XCMA 2ZQ5A 1ZUHA 5CLQA 1WRBA 1VCMA 3AKEA 4PQYA 3FTQA 2NGRA 3PR1A 4NCJA 1WP9A 3C14C 1CF4A 1W2GA 4OQNA 4A4DA 4FXPA 4KFTA 1RRPA 2H16A 3ZQJA 1A82A 1LS6A 2C8VA 1GVNB 2NPFA 4TYNA 1HE1C 2F1IA 4LJYA 2QPTA 3KL4A 2O8CA 2BEKA 3SJZA 3DZ8A 4JVNA 4GNKA 5C46F 1T0JB 5KUTA 1M2OB 2GDJA 3EC2A 1AIPA 3K09C 3EIEA 1E2NA 2QBYA 2BIFA 3AEZA 3FB4A 3BRWD 4D26A 4GOXA 1P4SA 1VCOA 1OXTA 2PZEA 2W6JD 4AYXA 3KXKA 1KK0A 4Q4HA 2X77A 1ZD1A 4D0NA 3GFTA 4P4SA 3CUEF 1OSNA 3R8CA 3IQXA 2ZRBA 5TY0A 3IIJA 1U0LA 3DPUA 4IVQA 5CIQA 4J0QA 3U60B 5BXQC 2ZM5A 2ZI4A 3WP1B 3KFXA 4JLVA 4URYR 4OK5A 4OKSA 1JPNA 4TT3D 4V0KA 5CIWA 3Q3JB 1VG9B 1DOAA 2G3YA 2JCSA 3VU9A 2QMUA 5JCZA 1Z6XA 1RE0A 3QPWA 2DHRA 4D4MA 2WJHA 3CPJB 5JCPA 2HJVA 4P4TA 5DI9A 3T34A 2ZAMA 1W49A 4DCNA 5F9FA 2IUTA 2JDIA 1T3HA 3ICEA 2B21A 3R7WB 5FI0B 1N6OA 1ZM4A 4PZLA 1OH7A 3AGPA 5KHOC 1JR6A 3EZ2A 1E2JA 2JEOA 2C9CA 3E1SA 3PUYA 5B57C 3EX7C 3K9LA 2ZRMA 3CONA 4PXAA 2CJWB 1JR3E 2VHCA 3SZRA 1P73A 3GLIB 4M9SA 4BFZA 4LZZA 2AXNA 4PHGA 1Z22A 2Z43A 1FNNA 2VHJA 1Z28A 4B44A 4IKEA 2AK2A 1XTKA 4TMKA 2WHXA 4F92B 4F7WA 1ZINA 5FPTA 1GRNA 1CXZA 4B3CA 4FMDB 1Q1ZA 1AS0A 2GA8A 2RMKA 4RFVA 4TL9A 3D6TB 4JKIA 4HEJA 3W6OA 4Q4JA 2OM2A 2ZVPX 2PLFA 2OFOA 2C2HA 4WW0A 2F43B 1I4LD 2ASEA 2FN4A 5FBQB 1EWQA 2FWRA 3ECCA 3CB4A 5FPHA 3GJXC 2DWOA 4BFVA 1E96A 5DHAA 3SBEA 1XZQA 4LC1A 5FTNA 1XD2A 3RS2A 4M1YA 3K09A 1G8PA 1G5RA 3HR7A 2VO1A 4Q4AB 3IPYA 2XITA 3KFVA 3Q8XB 1P72A 4GZMA 1Q20A 1MRSA 2ZRAA 4LC0A 4XD7D 3ICQB 1DAMA 1JAHA 4LUCA 1NN5A 4PHHA 3PEVA 1KMHA 1YR9A 1GG2A 1D6JA 3A4LA 3IQWA 4Y0AA 1U81A 4HLUA 3AF4A 2ZPTX 2ZS7A 2QGNA 3LVQE 2HUPA 5FOWA 1N0WA 4Q7JB 1E9AA 4WBSA 2G0TA 3CKLA 5F3WB 4WA7A 1Q3HA 5J4VA 4LYAA 1M74A 2OBMA 1UEIA 2LWIA 2GAAA 3KKQA 3VMFA 4B35A 4CEIB 2IC5A 1ZD9A 3GD7A 2E87A 3OHMA 1L4YA 2C78A 3UG6A 4B73A 2RGEA 1KNQA 1KSFX 2RGNC 2HT1A 5D3MB 5KSYA 2DFTA 2MSDB 3U3OA 5KDDA 2OCAA 3FMOB 4FCTA 4PX9A 4M9ZA 3GCGA 1Z0DA 1YRBA 1XEFA 4ZIRB 1TQDA 2CK3A 4B71A 1A4RA 4QBFA 2FSIA 1LF5A 2C9YA 2GEVA 1PLLA 1GKIA 4KSBA 2ERYA 4P33A 2RB4A 4URZR 3I92A 3ZVMA 2CBZA 1W4RA 1OKKA 5CITA 1AZSC 3FMIA 4F38A 1YZQA 4GDFA 4G3XA 2ZE5A 2UZIR 1RVDA 1DO2A 1S1MA 3P4YA 5GJWC 2Z83A 3IIMA 2ZRDA 4LBYA 3P26A 4B32A 1GKUB 5IDVA 4AK9A 4EPRA 4YDSA 3ZQ6A 1KIMA 4UXIA 2Q9CA 3GLFE 1OPXA 1IONA 1G18A 3K0CC 5HKKD 4E22A 4KAXA 4EJSA 2WAXA 4AYWA 2AR7A 1J90A 4AKHA 1XX6A 4HAUA 5CM9C 2WWWA 2LKCA 1Z0FA 1KSGA 1A2KC 1ZBDA 1I2DA 1F2TB 4W5WA 4X8MA 3THYA 3QI2A 4DT1B 1D9XA 1EK0A 3PIRA 4LGMA 4TTQA 2WWFA 1COWD 5KNCA 3KQUA 3UMFA 3I8SA 3FHCB 1IXSB 2O8DA 4FINA 1MOZA 2XSZA 2QRZA 4ERNA 2D62A 2RHDA 3ND9A 3P20A 4CIDA 2O8FA 2J5XA 1QHYA 2EFGA 1K8RA 3BB4A 1AS2A 3CH5A 2GJKA 3HYRA 4LJ9A 3R9WA 4GP7A 1OFUX 4V03A 4IW3B 4M22A 4BGDA 2VL7A 2EYQA 1N6IA 1RW4A 5ANRB 3TAUA 1IJEA 3K0FA 4JLAA 4LPSA 3I61A 3NG1A 4ILEA 3THWB 2GZHA 3KXLA 3VR3A 4A6PA 1W44A 1TAGA 4B47A 1NLYA 1VPLA 1GKYA 1M8PA 2QM8A 4M21A 2QENA 2JLXA 3BOSA 4N0DA 4Z8YA 1CJKC 4LV8B 3DL0A 4JYCA 5CJ2A 2CLCX 3WYFA 4MGKR 2GZAA 2XTMA 4DDWA 3KQKA 4KBGA 1D9ZA 3NC0C 2XZLA 2PEYA 2IUSA 3U4QB 3X1ZA 4ASUA 2YOHA 4C30A 2H5EA 2WWYA 2DBYA 3DKVA 3MUFA 5AK0A 5HE8A 1OLOA 3VKWA 1W4AA 5CB6A 1G5TA 3T1OA 3AVYA 1UBCA 3AKYA 1OHHD 4TQUS 5GADl 3B9PA 1N5KA 1B0UA 1GL6A 4YONB 2FPLA 3BAFA 2GCOA 4N1AA 1F2UA 2GXAA 1Y63A 2ZIAA 2CNWD 3QXHA 4EPTA 4A82A 1OIWA 3MJRA 1D2MA 1FFHA 4V0OA 2ZRKA 1N5JA 1XTQA 1UKYA 3FKSD 3OF5A 1K5DA 4DRZA 2OT3B 3TW8B 3AB3A 5EXPA 3VR5A 4FMBB 2A9KA 1P6XA 2YOGA 5TDHA 3EPKA 4GZLA 1NMYA 1E1QA 1HT1E 3GMTA 4YXWD 4NYMR 2XXAA 1WQ1R 2AL7A 3KJEA 2HCJB 3FDIA 1QVRA 3E70C 3JZMA 5ELXA 1NI3A 3ASZA 2P6NA 1TTTA 3TSOA 2IYYA 5DIFA 1E94E 5TXGA 1EFTA 4QHSA 2IEZA 1XBTA 2BKUA 4JL6A 3OIVA 4QC2A 1ZMXA 3U2QA 2QAJA 2GCPA 3U7GA 4L15A 1Z5ZA 3KUDA 1VHLA 2FFHA 1OB5A 5BN5A 2GJ9A 2J59A 3B7GA 1IN8A 4W7SA 5IK2D 4ACAA 3IUYA 5FL7D 4C0KA 2KJQA 2XJ4A 4PR0A 1SVKA 2IEYA 3GFOA 4BEJA 2ZR0A 2A5YB 1KI8A 2ZJYA 2ZSEA 2ZRHA 5FBLB 4B6FA 4LHWA 1US8B 4LJ6A 3GLIA 1II8B 2BJWA 2ZUCA 1W4BA 3GJ7A 3R9IA 1ZNWA 3SHFA 2A5JA 2IBMA 4Q1CA 5E7MA 2V6JA 3AVXA 4KFSA 3BXZA 5JEDA 2FFBA 3NC1C 1SKYB 2PH1A 1W36C 3NBXX 3SNHA 2J87A 2BM1A 3U6KA 1G6HA 1G8FA 1KKMA 4YQFA 2B7BA 1TMKA 1Z2CA 4LV6A 3VFDA 1OB2A 3K53A 2VPPA 2OUKA 4DKXA 2BMFA 3BGWA 4DJTA 2BMDA 2IXEA 2ZSAA 5EXXA 5FUVA 4FMCF 2B92A 1LB1B 1KMQA 1KDPA 1XZPA 1S0UA 3EC1A 1SXJA 1SVMA 4RZ2A 4G5QA 1AN0A 1VG8A 4S35A 4ZI3A 5DI3A 4IVRA 1Z0KA 2FGJA 4XWOA 4Q4AA 5BYJA 1OYYA 3PCRB 4TLAA 1AM4D 1FNMA 4A0RA 2NG1A 3LXXA 3JVUA 2AN9A 1DO0A 1NJGA 1HT2E 2VP2A 3IBYA 4PAQA 4A6XA 5KNDA 3NEJA 3RWMB 221PA 2GETA 1U94A 2EW1A 4QL3A 1P75A 2J0UB 4BLSA 3C7KA 4PPGA 2P6UA 1HYQA 4GSYA 1MKYA 1U2RA 2GRJA 3QKSB 1CR4A 4MKHA 1HQYE 1G16A 1KZ7B 4MA4A 3GJ4A 4TL7A 2EFEB 3BS4A 4TMZA 3EZ6A 3U3MA 2O8BB 4RD2A 4D82A 1FW6A 4JLDA 4JLMA 3RHFA 2OE2A 1N6NA 3QKRB 4PQFA 1Z08A 5D3MA 3UKDA 3U7HB 2ZE6A 3PQCA 2HV8A 4URWR 4M1OA 4E09A 1RJ9B 1IM2A 1RRGA 5CB8A 4OQXA 4A2PA 5B64A 1QRAA 4R98A 2QN6A 3K70D 2QL6A 4GP6A 5A0FA 3I5YA 1XMJA 2I3BA 3C16C 4ZIRA 2R6AA 2PJZA 2QUZA 1N5LA 1UDWA 2RGCA 4OQFA 3WP0A 4QFMA 4LV5B 3IPXA 4TMVA 4KITB 1ZM7A 4Z51A 1G3IA 2VF8A 3CZQA 3GJ0A 4LWZA 4LDJA 5CM8B 1VYUA 2J0SA 3GLGA 3WMFA 1JI0A 3AKCA 1E3MA 3F3YA 4Q9LA 3KTAB 4XVRA 3PITA 4WZ6A 1KDOA 5KOYA 4US0R 1ZM3A 3ZIAA 2KBEA 2YVUA 3H4MA 3A4NA 1CULC 2TMKA 4JBWA 3UMSA 3T12A 1Z0JA 1YJ5A 2P2LA 4F4JA 5KSOA 4Q1EA 5EP3A 4IDNA 1FUUA 1TL7C 2WSSD 1KAGA 4Q1AA 4IOMA 3REFA 4K81B 5KDLA 2WSMA 3HYTA 2DWQA 2J9RA 1QBKC 4PANA 3DVLA 5IHPA 1LF0A 4I1VA 4IFEA 1W7AA 3VQTA 5GJCA 1E0KA 2WWIA 4M1TA 4ZPXA 3HU1A 2WV9A 3OEED 2VF7A 4EIWA 4S2EA 5L3VA 4UNSA 1Z2AA 2BMJA 3KKPA 1E9RA 1GWNA 1VYTA 2KSQA 2V9PA 2H1LA 1XB2A 3LBIA 2W6JA 4DDVA 4KVGA 2Z5FA 2OILA 2OV2A 3QG5A 1VKJA 1XTSA 1BYUA 3AP2A 3A1SA 1PUJA 4JJZA 4X8OA 3U44B 5H68A 4HATA 1W0JA 2JLUA 5DN6D 3H1TA 1P60A 5K8LA 1UBEA 3GFPA 2IS1A 3S1AA 1AS3A 5LDDC 5CYPA 2PT5A 4PC6A 4KXFB 1T91A 2QT0A 4TT3A 3B1YA 4XWAA 3THXB 4JYBA 1VTKA 4NL4H 2ZI7A 2JLZA 3EPLA 4AYTA 1FX0B 1ZD8A 4JLPA 3EA5A 4CEJB 2OCPA 4PQRA 3IILA 3W6PA 1FQJA 3WBKA 3UIEA 4LBVA 3AVUA 3NBZC 2O0KA 2AKYA 2ZJBA 5JWRA 1S2MA 4HAXA 1G3UA 3WBJA 5E95A 2YOFA 1XFAA 1OFHA 1E1RD 2AHOA 2DCUA 2ZE7A 5DISB 4ZV4A 5FUYA 4C2TA 3K0AB 3CO5A 4DEYA 2HYIC 4DLRA 1R0XA 5JSZB 1ZUIA 2FF7A 4QHYA 1QG4A 4U5XA 3CRRA 5EZ5A 4BRWA 2NZJA 3OIYA 1E9FA 4WIAA 1V43A 2ZRLA 2CHQA 2OG2A 3CWQA 3KB2A 3AF3A 2D74A 2ZAOA 1UBGA 1HURA 4QRHA 4C4PA 2BOVA 3WY9A 1MH1A 1S4QA 1TU4A 2B7CA 4DIDA 3LBHA 1KAOA 1NIJA 4HZIA 4FW9A 1AQUA 5HCNA 4XH9B 1C9KA 3VR4A 4LHXA 3GJ8A 1G64A 1CJUC 2PL3A 4UXJA 1YZKA 4OQLA 2FMXA 3IKJA 4GL2A 1ZVQA 1W5TA 1FP7A 2BC9A 1ESNA 5JWHA 2P67A 2XB4A 1XEWX 4NMMA 1CEEA 1E0AA 3QF4B 4UJ5A 2EWWA 1QHSA 3SHWA 2ZITA 3ONWA 3QE0A 3M4YA 4XD7A 1BS1A 1Z0AA 2DYKA 2G1JA 2ZRGA 2G1KA 5KTYA 4E03A 3VKHA 3SFZA 1JR3D 4NP6A 2WTUA 4BECA 3BD9A 4PPQA 1XNJA 2X8AA 4Q02A 4MKIA 1VECA 1KO4A 3TSWA 1G19A 1XJ0A 1R5OA 1DAFA 1XPUA 2H57A 3UMRA 2P6RA 1Q1QA 1GFIA 1R8SA 2IXFA 2XTZA 4HUQA 3REGA 5C18A 1T8TA 4QBGB 3VAAA 1Z07A 1ZIPA 3K8YA 5J5CA 3X1WA 2B8TA 2GVZC 2Y8EA 3SJBA 3CZPA 3PEWA 4MITA 1MRNA 3GLHB 2IWRA 5CJPA 2WIAA 4BLRA 1YQTA 4D4LA 4YDHB 1Z29A 2CVHA 3KQNA 3SJAA 5C1BA 1JPJA 1YZNA 4DLYA 1KSHA 2BKEA 3UATA 3CM0A 4UKDA 2Q3FA 1E2FA 1O87A 5TVKA 4C9BA 4IHQA 2F1JA 5TV2A 4BFUA 1GAJA 2GJSA 4Q19A 1BO6A 3TH5A 3IBGA 1ANKA 1II0A 3I32A 5DHFA 4HB0A 3TQFA 2N46A 3FFBA 3KX2A 3U3RA 4ZCMA 2C5LA 4KI0A 2VSFA 4Z8XA 2PZFA 1ETUA 1ZNYA 1H65A 4Q5IA 2QI9C 4PC2A 1NY6A 2IS2A 5G40A 2ZVQX 1Z0IA 2ZYUX 5HKKA 1KI6B 5AJZA 1KI2A 4QKQA 1T4GA 4IJMA 5CDFA 1QZXA 1U90A 2A5GA 4MDEA 1UKZA 2X1VA 1Q1BA 4DC9A 2D06A 4D25A 2ZRJA 4QNMA 3TAHA 1EG7A 2WIBA 4M4SA 4AC9A 3UWKA 3QKRA 1COWA 1XXHE 4B6EA 2D2EA 3VTKA 4G5RA 3F8TA 4DXAA 1RJ9A 3BFVA 5DO9A 1ZM2A 2Q3MA 4PFSA 1E69A 2X19A 1VCNA 2ZREA 1NL3A 2FZLA 3LO5A 3EPJA 2J46A 5EP2A 3GPLA 4DCSA 1NP6A 1OXUA 3ADCA 4YMVA 2ODBA 2QE7D 4C7OB 1JQLB 1XF9A 2HDNB 4HZUB 3T1QA 1NG1A 4LJAA 1BOFA 3B85A 3B82A 2GTPA 1IN4A 1ZJ6A 3M6AA 4E5UA 3QPUA 2XNDD 2IW3A 4Q48A 2DWPA 2ZJ5A 3B1XA 3B1ZA 1IXZA 1PJRA 2D4HA 4RKFA 3X1XA 4EFLA 4HLUC 2ORIA 2OSBA 4Z1MD 4BZXA 3OIWA 3PEUA 2F9MA 2OLJA 2WKQA 3T5DA 3HR8A 3QUSA 4V02A 2R2AA 2ZJ8A 1NN3A 4RD1A 2YYZA 4R9UC 4BQSA 1JXOA 2SHKA 4JBXA 1XXHB 3SBDA 4C0SA 2QEQA 2CCJA 1Z6YA 1F60A 4JL5A 4PC3A 4Q66C 4HYYA 1RIFA 3DM9B 1N6KA 2BDTA 2H8KA 1LVGA 2QQ0A 1OXXK 4B34A 5FUXA 1TEXA 1VG0B 1DE0A 3LQRA 4ON9A 2J7KA 3L0SA 3T61A 4URVR 1H8ED 1G8HA 1E2QA 5L8VA 1T5IA 2WWHA 2CNWA 2J0QA 2RGAA 1TNDA 2G88A 1YRAA 2HXYA 5JBQA 1G7TA 4LJ8A 1KGDA 5EXSA 4G5SA 1BIFA 3ZVLA 3VR2A 5L3SB 1ZNXA 2P3SA 3AF0A 4Q1DA 1L2TA 4YMTA 4YXWA 3ZVNA 3I73A 1SZPA 3V4RA 2IL1A 1OXVA 4N0EA 3MWLA 1DAIA 3SOPA 1MABA 1V5WA 2EYUA 4MRNA 3KJHA 2ZUDA 3WHKA 5FL3A 3WNCA 2QG6A 1XPOA 3B78A 4PSVA 1NN0A 4RFSA 4I1SA 1SXJE 3H86A 4B2LA 1EGAA 2YWEA 3O8CA 2O8EB 2IYQA 3TVDA 1S9DA 1E9BA 4EJSC 4AY2A 4D6PA 1GNRA 1MO4A 2WJVA 4DVGA 4CEJA 4A1FA 3PUVA 4IOKA 4EPXA 5LD2C 3VNUA 2FEMA 4L9SA 3WHLA 1UBFA 3BFKA 4D0LB 5AUNB 1NBME 2FG5A 3W3AA 4M9QA 5IK2A 2CLSA 5DYGA 3FHTA 4M9XA 5FL7A 3RRMA 1Q57A 1X8KA 5FI1B 1E2LA 1KJZA 2ATXA 4GBMA 4QM7A 5KO2A 2Z0MA 3H2YA 2A30A 3DKPA 1S1CA 5JSZA 1XJQA 2YNMA 1D2EA 1HA3A 3B1WA 4KYUA 1R8QA 5IF9A 1T0HB 4DB4A 1AQYA 2DFLA 2QP9X 4UJ3A 5JJLA 1TQ2A 3OFND 5AJYA 1S3GA 4DLVA 4B2IA 5F98A 1AK2A 2ZANA 2ZEJA 1NMZA 2CLDX 1EFHA 5AUQA 2D3WA 4TLDA 4O25A 4NYMQ 1JNYA 3WNBA 3DMNA 4CW7A 4G5GA 4NDZA 1UKVY
chains in the Genus database with same CATH superfamily
1E1KA 3COVA 4D8TA 4LN1A 5FADA 1E5VA 1RQ2A 3UWDA 1YCFA 5I5EA 3ZY2A 1Z5PA 5EZYA 3P4XA 3Q12A 2XYQA 4WK6A 1ZEJA 2OCLA 5C8ZA 2J8ZA 3AJDA 1POWA 4PCLA 4YCBA 3QE9Y 4IF6A 1C9DB 3A4MA 2YV5A 4HLQB 1U3TA 3MCTA 1TYBE 1R5NA 1ZRSA 2FOLA 4AM8A 2ZZMA 5L4NA 1K7EB 3MTDA 4JNKA 2AD5A 1UUFA 4QQKA 3RVQA 4EQ6B 1OJ7A 4Z6KA 2O52A 2R1VB 3JR3A 1PL7A 1DKLA 1FDWA 4B4WA 3X1KA 2RKBA 3NHJA 4RUKA 3JQ7B 5AVZA 4J0HA 1QDEA 4R8SA 1CUBA 3TZBA 4NZYA 4KEAA 1YU6A 2GJAA 2HHLA 1NI4A 2G36A 3HU5A 4PSAA 5L3QA 4EVRA 1YR2A 3U1TA 1ORRA 2P9CA 5ADWA 5K45A 1CRLA 3IDQA 4FNMA 1M66A 1OW3B 5FLXA 5DFAA 1E61A 5H8WA 1X1BA 1C9YA 3K6KA 5CA1F 3T6KA 3HADA 1FPMA 1I3MA 3TTYA 1F6DA 4BB0A 2IS6A 2Z4RA 4DDKA 3OOWA 3RODA 2YVQA 4J94A 2XCLA 1AOXA 3IT3A 4YT4A 4B7ZA 4GKVA 5C4MA 1V8BA 3LLUA 4R1NA 5LR6A 2YVKA 3U6BA 1KR2A 1ZPDA 2ODTX 3PQ4A 1JWLA 3RTEA 3HEMA 3VR1A 2J33A 2ZB2A 4B79A 5JHGB 3VU1A 3H4IA 4F1KA 2OBLA 3IR7A 3EEIA 1QTNA 3D3QA 1UBUS 3U4AA 4QFBA 1PVOA 1T0UA 1NVEA 4UNQA 4JN6B 3MB8A 2DUWA 4FDVA 1XAIA 5LNK1 1AGPA 1PVDA 2QSZA 4ARZA 3BCSA 3IUEA 1K7SN 5IAJA 1PCXA 4ALNA 3WYDA 4GQIA 1AUPA 5LDHA 1BWSA 1SUIA 3HKDA 4EJ0A 3L7JA 3L8HA 2P4HX 2H29A 2V8BA 1CVRA 4BYMA 3WRVA 5JLJA 2V5VA 3AR3A 4IF4A 4J0CA 3TIGA 3GLFB 1PNTA 3MERA 3O1IC 4ZD6A 3W2FA 2B1IA 2HSGA 4MH0R 2G7ZA 3WS7A 1X8XA 2YUIA 1C50A 2FN7A 3PEFA 4JENA 5DGXA 3BXEA 4J0JA 2KM1A 2ZR9A 3K2QA 4G1UC 3ZV5A 2ST1A 1NDQA 1N2OA 1XTRA 4JR1A 4U63A 2Q4DA 1JU9A 3DTVB 1EI9A 5KDOA 1KK3A 4X63A 3QWIA 1AHHA 2OGSA 8ABPA 2P11A 3A9SA 3SHOA 4DSUA 2CJPA 5JROA 3CZCA 3KU1A 5IRCD 1K7YA 3TDMA 3I0NA 1BROA 1CPYA 1ZIOA 3K5WA 5UKDA 1CY8A 3PC8C 1LXCA 4IDHA 4X6LA 4M1WA 1S4MA 2NSYA 4OBBA 3QU9A 3TTWA 4LY6A 3T9AA 4PO3X 2CMGA 5DBHX 3QYAA 3ZNQA 2IDJA 1SXJC 3L4BC 5G02A 4D6YA 2C54A 1BA2A 4QDOA 5HKAA 1JHZA 2SKDA 2M32A 5D01A 5BSUA 4JMLA 4KR9A 5AK5A 1Y9ZA 1MAAA 3U9SA 3QW4B 5B2FA 4WSOA 4YMWA 1JFSA 4FGSA 4LJ7A 1KHHA 4R5HA 4YH1A 2ZKLA 4QG7A 4PC1A 2XMBA 3PHJA 4YPFA 1W93A 2IYZA 4KACA 2V7XA 4QT0A 1B6SA 1RI5A 5EIAA 1IQPA 2WK1A 4B83A 2JH8A 1NONA 3RU9A 3NALA 3NP9A 2OHFA 4OMDA 5CLLA 2HU7A 4WQMA 9LDTA 1LBIA 3P4UA 2V4ZA 1WOMA 1HFJA 3DTTA 2WLTA 1I2ZA 3NKVA 1FYEA 3IOEA 3EAGA 1XU4A 4Y2HA 2RCYA 3F3SA 1E9EA 1Y42X 1O96B 4K6FA 1V3UA 4BFXA 2XCUA 3WIOA 5A5GA 1GJRA 3TUZC 1T2NA 2B69A 2DVMA 2FQXA 1I4OA 2W2NA 4NIMA 1B6GA 3BGOS 3E8MA 1JFFA 3AVVA 5FTJA 1K8QA 3D4NA 5JRZA 1U04A 3H2JA 5E9WA 1FQKA 4LOAA 4ESHA 1EK1A 2H5IA 2IS4A 5BOSA 2HUNA 2XQKA 1H4QA 3WLNA 2D7CA 5K09A 4AB1A 1OWLA 2HQSA 3JAKB 4KN9S 5BWOA 5GIPE 2EHDA 1OXSC 1DP4A 1E4YA 2VXCA 2HCBA 3ZCVA 1YZLA 2HSDA 2GSWA 4BBAA 4HX5A 5DYIA 2NV6A 5JBNA 3MWDB 4NV1A 2BZSA 1ZGJA 2JFBA 3MOIA 2BHNA 4RZXA 3TSAA 1MC8A 4YPOA 5I47A 3FZYA 3C24A 3OD1A 4R2LA 1FJHA 1NE7A 2D59A 3H8WA 4ND3A 2UYOA 5KCMA 3SYKA 5DGCA 3EXAA 1LPPA 4Z3KA 2QTFA 4KBFA 1FPQA 1ZY2A 4XGNA 1HR0B 4OHWA 3L46A 2QMHA 4MVCA 5TB5A 4LXHA 4EENA 5J4HA 3DNPA 3BGSA 1F5NA 1X74A 2OGZA 4INPA 3VYVA 3HTXA 5FD8A 2OLKA 3ZGLA 3S7ZA 1J70A 1QH9A 2ZBVA 4Q3AA 3NBQA 4WXEA 5AW3A 4ZT5A 2AG5A 4X66B 4YX9A 4HRYA 1O58A 3RQSA 4CKCA 4FZ3A 4J16A 4FNOA 3KWJA 1Q0RA 2O5VA 2XT6A 4IDGA 3A3NA 3ZJYA 3UCXA 1XTJA 5JYDA 1SELA 2AA3A 1JHXA 1HZJA 2KWIA 3HL4A 1X7DA 5T57A 4M1ZA 2WHYA 1G7RA 3JYQA 4JLJA 1JT9A 4E4RA 4LNUB 1T9KA 1Z56C 5HJ2A 3B12A 1N7GA 2GFHA 2J6CA 1ZC3A 2WWVD 2H4ZA 3CVJA 3Q7TA 4NE7A 4RSGA 5DM4A 3G9QA 4IVPA 5JECA 3O03A 3G2IA 2P9HA 4ND1A 2ZUWA 3PWKA 1H0RA 4N3BA 2J3EA 2F9FA 5AVSA 3F90A 4ZYZA 2CD9A 4TLEA 3RE1A 3GRYA 1LW6E 3O91A 4JX9A 3RC1A 1QMPA 1YZTA 4HADA 4KHZA 4U4AA 1I7QB 1EP9A 1F7UA 4YJ2F 2B99A 2JIMA 1FIUA 1VZ2A 4B0OA 3T7DA 5K3EA 4NE9A 4UUQA 4Y3UA 1B4DA 2BBWA 4TTPA 5MGBA 1G8KA 1ZNZA 4JQYA 3GP8A 4OHKA 4WEOA 2NXWA 3SGLA 1M1YE 5AT1A 4IZ6A 3VZSA 1Y5LA 1Z3IX 2QSYA 2QR5A 2O2CA 3E4DA 1H2RS 3L7IA 4UM8B 3W7AA 2HL6A 1E7RA 1V7QA 2QAGB 2RC6A 3WJAA 1QHFA 3ZWKA 4DY4A 4CMBA 1XDUA 2WHEA 1NTOA 1N9GA 4N7JA 1W75A 1YI8A 2QUKA 2R751 4PO9A 3B9RA 5GJVC 5K0CA 3IGFA 1YE5A 4GLJA 5KWJA 2GKOA 3MTGA 4IIJF 4BGEA 4BCBA 2JI9A 3CPSA 3WO0A 1ZK2A 1XZJA 2IOYA 3LL7A 5EJMA 5J4KA 1U7HA 3K5HA 4NFHA 3TCNA 1LJ8A 4CLXA 2HWWA 1V11A 1U99A 3HV2A 3GGPA 3EE6A 2XX3A 2GESA 5CXUA 3PFKA 1GAQA 4U8HA 1EXVA 1J7KA 2IY9A 4ZVKA 3DYVA 4ARBA 4TRNA 5FBZA 3UJ3X 3UUFA 1W30A 4N8SA 4ND5A 2NU7A 3KYCA 4H1TA 4ZK6A 4FGJA 1GG9A 5AXCA 4HDCA 4CT0A 1TUIA 5KSPA 3CZMA 4U7DA 4MVJF 1ZZGA 3AW8A 4F3CA 2BMEA 2PUVA 1VG1A 2J5KA 2JGNA 1NM5C 5EIEA 1OOEA 3QNUA 3O2QB 3OX3A 1WW2A 3MILA 3O8BA 4LZPA 5FOUA 5EYPA 3FFXA 1S89A 3KXDA 2OXTA 3GZNA 4EUNA 3VHQA 3OQ6A 2IOQA 4BS9A 1U7UA 2B2NA 3KP1A 2DH5A 2VYNA 1Z74A 5IVHA 5DB4A 2XNDA 4P53A 1QR2A 4KXNA 4UVDA 3GJYA 4XX0A 2QRNA 1MN6A 1I3KA 3JTMA 1ZIYA 1XRSB 2GK6A 3KKOA 3FTDA 2WJIA 5ED0A 1XQ6A 5DOVA 3HLTA 2X41A 3OZIA 3PX3A 4KJZA 2ZYVX 1W4CA 2HY7A 3FPBA 3GJRA 4MV8A 4ND6A 3SIWA 4B9AA 5C8VA 4F3KA 1XN1A 2FFJA 2N42A 4R54A 2Y93A 4MRVA 3V8PA 2BCGY 3RYFB 4JJAA 1A0OA 1SD1A 1Y6RA 2DPMA 4QJ3A 4CF7A 1XRNA 4XM1A 3L6BA 4H18A 4WV3A 4MUFA 2HAEA 3H04A 2QXUA 3BQNB 1K0UA 1V45E 4JVMA 4LWPA 4Q39A 4K9LA 3WK5A 3BSWA 5ERXA 1XF1A 2QRGA 4TYQA 2EGGA 2JI6A 3MRTA 4L9RA 4YJHB 4ZI5A 5TF4A 1U8YA 3Q0TA 4ZAVA 4DIUA 1H8EA 1UFOA 2I2FA 4HEA1 1V8PA 2P8JA 3I8XA 4R2HA 2JASA 1CR2A 3NPAA 2EHJA 3H8VA 1Y3CE 1N3LA 4DLTA 1Q11A 1XA3A 2MU1A 1XWFA 2WTEA 1KTVA 3BSFA 5BVHB 3E81A 1QIFA 1JN0A 1QJCA 4QGAA 4XWTA 3OT4A 4L4YA 2C4KA 3NVAA 4DV5B 2E82A 3KKNA 1P5ZB 2A88A 3LT1A 4PYLA 4DR2B 2PM8A 5IXYA 2GKGA 3EB9A 4M1EA 1G6OA 4QYMA 5H70A 3OOYA 3A3PA 2OGWA 4JROA 4JXKA 1N25A 4NNOA 1PJBA 4INZA 5AIBA 5HKOA 3AI3A 4L95C 2RG1A 1PNRA 5D6NA 3ZY6A 2H4WA 1BHQ1 1BA3A 1AKEA 4BO2A 2W5UA 4F96A 1TZKA 1J2JA 3VHRA 4DCOA 5KVVA 3S2FA 2X0KA 2ADFA 1L5OA 3DAFA 3QV1A 4BNHA 1T5LA 1WHTB 3OCVA 5KYXB 2SKCA 4RD4A 1JTVA 121PA 1JFTA 1DMRA 1V96A 4HGYA 4FZRA 4WNCA 3HC7A 5E1DA 4R1QA 2BWJA 1A1VA 1YHNA 5FPKA 1E1MA 4PGFA 4CWAA 3G89A 1JI3A 4CLRA 3C2QA 1SQ0A 4WKOA 4F9EA 3C3KA 1MORA 1B26A 2QG9A 1F3LA 4C2AA 4HDKA 2DB3A 2IK8A 4UDYX 1QWOA 3Q7PA 2IF2A 4YAKA 2PCJA 4TKVB 3OT1B 3KZCA 1L1QA 2OR3A 2VJLA 1F12A 3DMPA 3RC7A 2HMYB 4LQDA 4PZDA 3IXQA 3NHFA 2PQ0A 2BMAA 3QXSA 2VZ8A 3EIWA 5U4XA 2RSLA 5K0SA 1BXRB 1NURA 2B20A 3BH7A 2Y4OA 1TPYA 3OFNA 3P9RA 3WSWA 4A92A 3PUIA 3KK0A 3E4CA 1DKOA 3W5HA 1Z6QA 2DQKA 3EK2A 1LPNA 1M9NA 2A78A 3E7PA 4L9WA 4RU1A 4K1XA 4CMHA 4BYGA 1WDTA 2CHFA 2PZGA 4BE7B 5LPNA 1W5AA 2IXGA 3GUCA 2BKAA 3N76A 1E98A 1NR7A 1ARZA 2GZMA 4WE3A 5KVQA 1YZGA 4BASA 1E20A 1W1WA 3COZA 4W1PA 1S2IA 4I1OA 4DB2A 1A9YA 5KSZA 1Y3AA 2XYHA 5E3HA 3T1YB 4YMUA 5JS2A 1T34A 2EP5A 3OIUA 4I3GA 4OLJA 1Z6TA 2OBNA 4QUEA 2ONKA 2CUKA 5AJWA 1O4VA 3EVAA 4L7VA 4KLZA 5LYJA 1MOQA 2EBUA 1OXKB 4GLBA 4WLNA 1V1MB 5AK3A 1NBMD 4MR7A 3I62A 2PGDA 3EGCA 3UK7A 2PHZA 4F8YA 3QPVA 1OLUA 1E9CA 3HCRA 2FTKE 2QX8A 3PUJA 4JJ6A 1GITA 3MF4A 4ARUA 5IKEA 2AFIE 4EB6A 3QYJA 1P2VA 1HZZA 3AF2A 4RTMA 1JAIA 4BX3A 3GFSA 4V24A 4Q7LA 1QO0D 3PPYA 5JSYA 1GR1A 1TYAE 3G2NA 1P8JA 3AUTA 4JT8A 1Y6FA 4QGGA 1Q0TA 2OMEA 2PUCA 3TB4A 4ESVA 2ZUUA 4OHRA 4CEIB 4H3HB 2QPAA 2AQKA 4WN3A 4MI1A 4FI3F 2PX4A 2REBA 4JS0A 3ROQA 1A8QA 1HDRA 3RIYA 5A1TA 3Q41A 2X3YA 3SS7X 3QKSA 4KXWA 1SU7A 3MQFA 3I5XA 5IM5A 5JS6A 2P78A 2UYCA 3I1YA 2O5EA 1EK6A 1IOZA 1KZGB 2O8BA 2OBXA 5G0SA 3ZZTA 3T1VA 1GT91 3MGCA 1DBIA 3D8SA 4YJFB 3WIVA 7ADHA 3IB3A 1IAQA 3EXIB 1ZCZA 2WJJA 2Q0QA 4P3YA 4XJXA 5FBWB 3TLZA 2P5YA 4KFRA 2POQX 2ENWA 3K0FB 5K05A 2VT2A 3B6IA 2CV2A 3TPZA 4IEEA 4M89A 3EWNA 4F4CA 5CT4A 1DV1A 4V0SA 5ADUS 3ZLBA 3M9LA 4XPIB 4ZRNA 2YASA 2C95A 5HILA 2I5PO 1C9MA 4FR2A 5LXTF 2WKPA 4IV8A 4QPPA 1QYIA 1KY5A 4JSRA 3RAEC 1NPDA 1RTTA 2J9YB 2RK3A 4XGIA 4B3FX 3KR0A 3KZKA 4JHXA 1OPRA 3DBRB 5BOSB 3OM0A 2AOUA 2W11A 1E6LA 2QRQA 3OF3A 3I01M 2DFDA 4MR9A 3EVFA 2YN4A 5BSTA 4HH1A 1N2CA 4BKMA 2GUGA 3E5MA 3OIGA 4AKTA 1SVNA 4QAQA 4R8LA 3RK1A 4BO7A 1KI3A 2SKEA 2GPNA 4N9WA 1U8ZA 3G6KA 1ZQ1A 4ENSA 4CTOA 1JPUA 5FV4A 1VFPA 2DTDA 2DU8A 3CX7A 2V58A 3BBPA 4I66A 4KLRA 3ZBQA 1KQFA 3B38A 2I8CA 2I4RA 1QNFA 5JPCA 4C06A 4Q1BA 4W6QA 1B93A 4FGLA 3PQ3A 4G5HA 2O3UA 1ZHFA 1J20A 4QWWA 3ETLA 3W5IA 2DP4E 2C2ZA 2MYUA 3A6KA 5K3FB 1SHKA 2E6UX 2Z5VA 4XARA 2GM3A 4RIIA 3BGDA 2FX3A 1TEVA 1WUTA 4MHSA 1G4UR 3GLIE 4CG0A 2XXAB 1UEJA 1MF7A 3ASUA 4X20A 5I9SA 1CZNA 3IA2A 2A94A 4F8JA 3R3JA 1CQIB 4ZO6A 1L6RA 2BV3A 3L93A 2MT9A 3GY0A 4MS3B 4XB2A 4I50A 1EEXB 5EJ2A 4TXJA 4LMRA 4TWRA 5AKHA 4AJ1A 4YT5A 3PUKA 4HC4A 5CX1A 4YAEA 1VLLA 1DBWA 1F8YA 3QELA 4QBHA 2YZ2A 3F73A 2JIPA 8MHTA 4U7GA 3DC2A 4FMCB 5K4HA 2GEBA 4J29A 1HORA 1CZHA 1EWRA 3IQZA 3DOEA 3MMPA 1XHEA 5TS3A 1R0ZA 5IMSA 4EG5A 2WYVA 3BTVA 2WTNA 1ES9A 4W8GA 2KX7A 4O08A 1C1XA 1X0VA 3ESXA 4LEIA 5HK8A 3X0DA 2ADMA 3UMMA 3P32A 3W7VA 5JVDA 5JZBA 1R88A 2PG3A 3DMRA 4X1IB 1CE8A 3DMDA 4JQCA 3S70A 1B00A 2GBLA 3ILHA 4DC1A 4IDPA 1NYQA 1DTSA 1DUIA 2FWMX 4HN4B 4EHAA 2H1WA 1O7JA 4J1SA 1BS2A 2TYSB 4OHPA 5FA5A 5A4FS 4NXNB 5CLHA 4MGYR 3U4HA 1E6KA 3NAGA 3PFFA 3FIUA 3FGNA 4I4LA 2IX9A 3O8DA 2MINA 4P3KA 3ZR4B 4MQEA 3LKZA 5HIAA 1Z2NX 4NFYA 4QULA 4OBWA 1N75A 3K0AA 1Y8QA 3L07A 3W9SA 1PWEA 4UQLA 1NBOA 1XTPA 3FGZA 1QH1A 5D51S 4UVIA 4B8YA 3ZVKA 1PR2A 4TMFA 2XB8A 3EZ9A 3M7IA 1NW3A 1JQJC 4O4LA 1LD3A 3GRCA 4QOSA 3WL5A 3ZGNA 1W8DA 3NB0A 4ARVA 3PGA1 5IUJC 3CXUA 1LPMA 2QYSA 1JZQA 1NUUA 3STUA 4BWFB 4LYYA 3BRCA 3H3FA 2DULA 4HD8A 4IFIA 1XYYA 4LJ4A 2C42A 1MO3A 4ZYUA 4DV1B 4RTKA 1U2SA 4A9AA 2J7PD 4Q9DA 3WI7A 1RYBA 2ZI6A 4QXRA 1NP7A 3FHOA 1WBBA 2HGSA 5AW7A 4QDJA 5EE1A 5B2ZA 2VRCA 1U80A 1WG8A 2H17A 3F1KA 7AT1A 3LG2A 3KVYA 1G291 1ODKA 1NBEA 3DBVO 2ZXFA 4QT4A 2W6QA 4YR9A 1R6AA 2GRAA 4JP8A 1JQBA 4WGGA 4KPFC 3DD5A 1NMSA 3V1UA 3ZU4A 5H4HA 1FBNA 1K4YA 2JANA 1MT0A 3UWPA 4V0NA 5G3ZA 4XQ9A 1RRFA 2E37A 2OO3A 1QM5A 4GL4A 4LWOA 1TF7A 1UDCA 5EZ6B 4MV6A 4PGGA 2NO7A 3LXUX 1OTHA 2A1TR 1KO7A 2REXB 4WFKA 5EN4A 1DIAA 1PNQA 2CMKA 2XNHA 3B5EA 3N3BC 2A7QA 4FFRA 1KF0A 2R6R1 4GX0A 1YVUA 3CU5A 2HMWA 4MVJP 3A0RB 1K2WA 1JIKA 2R4TA 2WLSA 2QTBA 4MVJG 4EGSA 5ILOA 2NTEA 3GRFA 3OZCA 3D1VA 2HA0A 3FPJA 4HRAA 3ID6C 1DJNA 2JIZA 3HBNA 3MW8A 3HV0A 2OORC 3CNNA 4UZEA 4QYIA 2RI1A 4B3GA 1AKVA 2XUDA 4D0GA 1UEXC 1PFYA 1VPEA 2PKQO 2VHYA 1EIZA 3JZAA 4CT4B 5AVTA 2IHYA 5LU8A 2C1XA 1UBSB 3U49A 2C98A 2DR2A 2D5CA 3R3WA 1OUMA 2GR9A 3W9UA 2GD6A 3M6WA 4FC6A 1OU4A 3EVGA 4KO8A 4GLLA 1LW7A 2AT1A 4RGBA 5IBCA 1MAHA 1H2YA 5KZMB 3CRZA 2XT0A 1IN7A 1C3EA 2XDQA 1BMFD 3HB9A 1WB6A 1MC4A 2XF8A 4I55B 2PRKA 1BJKA 5AXDA 2Q8PA 3AKDA 1XMQB 1R3DA 3HYNA 1SQ5A 2FAXA 2OKGA 3CRMA 2BJVA 3GJSA 1WE2A 4EW2A 3B5IA 3G8YA 3WK7A 2NIPA 4UBJA 5BNWA 1W581 2P2YA 1T8YA 5BPFA 4N40A 2O8FA 3PVSA 3LD9A 1XLTA 1PS9A 3FUCA 1G41A 4G0NA 3OLYA 3BMOB 4OIFA 2PH5A 4H31A 5LZ2A 5FBHA 1QHNA 2ZYGA 3E22A 2DZDA 3D2AA 3HXTA 1N5RA 4LOJA 3T5AA 4V1CI 4GOND 4EM6A 4Y8VA 4OYHA 3GUUA 4RX1A 4RHCA 3MWEA 3SF8A 1ZG3A 1E4VA 5SZJA 4CKEA 1SEVA 1U9YA 2AFHE 1J0XO 2XWQA 2AWOA 4UE2A 2ZYWX 1NY5A 3IO5A 4EK9A 1NNI1 1PFQA 1ADBA 4KL8S 3CG0A 4TTRA 3N53A 3SBOA 1OZFA 1TJ5A 2WJ6A 3PDWA 4IJWA 4D3SA 5IASA 3I64A 3PHIA 5FB3A 1WCWA 2GK3A 3DEIA 1U1IA 1YE3A 2VZEA 4YMHA 2GYWA 1YQDA 3D7KA 3EXG2 1YULA 3TGPA 1Z36A 1U9IC 4KMOA 2P68A 4MA0A 2GNOA 2VCHA 1MW9X 2QPOA 4DJAA 5KKCA 2A59A 2HZBA 2IHNA 1VMKA 1OI4A 1SUAA 1SXGA 1NVUQ 3DDNA 1B8VA 5JQGF 2PUEA 1RLTA 1BH6A 2Y0PA 2VHVA 3DCIA 1T0PA 3AIIA 1C0PA 3KAQA 3TLBA 3S1AB 3HSSA 4WLFA 1ADJA 1P1HA 4TYPA 1OA1A 3D7RA 3SVZA 2G1UA 3LWNA 3RGWS 1YR7A 2OQRA 4TWAA 4JSYA 4XDHA 1E1CB 3QK7A 5BQOA 1G38A 2IFTA 3ETDA 3I2JA 1UBJS 1VLVA 3UPDA 4I9GA 2H59A 3AUAA 4CKWB 2FETA 3IVGA 3ICPA 3N1UA 1NQ5A 4G65A 5CFOA 5IXJA 4RH1A 3HH8A 2O4UX 4N65A 2AEEA 2AHRA 4X1KB 4AO6A 1RPNA 2PKEA 1WXGA 4WOPA 4D4HA 2LTAA 1T29A 1LU9A 1A04A 4FDAA 3URMA 5CYOA 4DMFA 5JMTA 3CVXA 2HLDA 3LNCA 4H7KA 4TKVA 5JBIA 4RLHA 4F4FA 1XXHA 5H1YA 2FUKA 1UKEA 3GP5A 4MMXB 1GA4A 3JALA 4JA2A 4PLWA 5F2NA 1RYDA 2BY4A 5AHRA 2FWJA 2C7BA 4BNUA 4E6PA 4AS1A 1X15A 4P7FA 1XEXB 4X94A 4ARAA 2V8OA 3TIFA 2G25A 4ZAXA 4JT2A 5ITZA 2ZDGA 1J39A 4DNXA 1Z75A 1YKSA 4NHEA 3RHTA 3RC8A 3ONDA 1OH5A 4C88A 3IO3A 1XHLA 5DHUA 5FOXA 1IY2A 3R5TA 4RPHA 3BULA 2I66A 4OB8A 4EI9A 3TL6A 1LJLA 4N5NA 1TX4B 1NW5A 3B6EA 1FS6A 1V3QE 1SKYE 1R0YA 2GHIA 3JVEA 1PFKA 4J0DA 4ZOEA 2DOKA 4FWBA 3LTEA 5EE9A 3WTBA 4M38A 4RVCA 2C99A 4U7WA 4IRUB 1OH8A 1K6XA 1ZQ9A 3GVCA 2Z30A 4TUYA 3U62A 3KRTA 2FKNA 1RP7A 2OWEA 1I10A 1HE2A 4LYJA 3TSZA 4ED9A 5MHTA 2PFSA 2Y68A 1R0LA 5EUQB 3G49A 3EWAA 3EXEA 1EVZA 1TM7E 2IPAB 1H1LB 2J85A 4CM9D 1JE1A 1TM5E 5EKXA 2FLWA 2YWJA 3MIZA 1E92A 4JKYA 3ZY4A 4O59O 4DRYA 1ESCA 3WKEA 4FS8A 4I6JA 1QIMA 1SXPA 1M8JA 3A4TA 5KJFA 3TFOA 4OI1A 2R66A 2JS7A 4UEJA 3DWEX 4QHTA 2E3JA 5C0OE 4N5IX 1KO1A 2VOEA 4TKZA 5A06A 1UJNA 3G2KA 5ITSA 3RYIB 3EIXA 1N6PA 4K05A 1FNCA 4PONA 1D3AA 1QDUA 2L42A 2ZYTX 3IDSA 3F67A 4RD6A 2WWTA 3D0KA 3QMPA 1ZCFA 3LSTA 3PNKA 3UMGA 3LC1O 4QXMA 1HRKA 1K8ZB 1M76A 3GJ5A 3LQYA 2GBFA 5D5PA 3ZZ0A 1ZAYA 3R23A 3TZHA 3V7UA 3DVSX 3R3UA 4JBLA 2DBZA 3HA2A 4Y6QA 2FXIA 2C2XA 4Z0HO 1YVPA 3NHZA 1XV5A 1YS7A 4B4DA 4HUTA 4F6RB 4NONA 1YHYA 4QVIA 5LKRA 2PGAA 2C7VA 2RFLA 2ZRIA 1UKAA 5TQVA 1ABBA 4RNDB 3FWKA 4LQLA 2P2ZA 4P4LA 2XMGA 3AEUA 4HMQA 2HMSA 5EP1A 3K31A 5ULLA 1BMQA 2R6DA 4PHTA 2PBRA 5JE8A 4LF9B 3SYRA 2OZPA 1DHTA 3QP9A 4Q9KA 2FGKA 5TPWA 2UYYA 5FT9A 3TK1A 4FOPA 1FFXA 1HSZA 1JR4A 2PPLA 3WL8A 4LZWA 4P58A 2PDAA 3JZFA 1DEAA 1G5PA 4ZO7A 3DHVA 3MFYA 1VMEA 1FUKA 3R76A 3UHJA 2Q2NA 2ZJ2A 4G5OA 4CRWB 1NMEA 4IH4A 1QK5A 2UUCB 2NO5A 1PWXA 2B1GA 3BXFA 3JV7A 4L4XA 1HQKA 1KK1A 1ST2A 1HLDA 1DAKA 2JAWA 1MG0A 4P8RA 3EA0A 2DFNA 4FT2A 3V7NA 3ZU2A 4IOJA 4HNVA 1QRDA 1ZKMA 2QS9A 3MJFA 4TYMA 4JLNA 4MUJA 5DLPA 4B87A 1CIPA 2WE8A 3W0LB 4UE6A 3I04M 1IB0A 1PTKA 4KVFA 1D4OA 1EFDN 2HH9A 4COOA 4EQ6A 1GNPA 1ZYUA 4CU5A 1O94A 2R1VA 4RA6B 3GNTA 3JQ7A 3FUWA 3AUSA 4HAWA 3CQ9A 3E9DA 3FRHA 4QOFA 1FX1A 3D6MA 1KETA 2WMYA 4O4JA 4ETNA 1GGFA 2MDTA 4P98A 4II7A 2VJAA 1RXYA 2C2OA 3SPXA 2XIQA 4IM7A 2HF9A 3TLAA 4AMYA 1Y1TA 3IAHA 2AK3A 2Q1TA 1U7PA 2IZ0A 4Y9TA 2WOJA 3LRPA 1B16A 4RZUA 5AOVA 2W71A 3T7KA 4OXKA 3T7RA 3GXBA 1U3WA 1RBZA 3CNOA 2AVNA 3OF2A 4HH3C 1OFUA 3L7AA 2PX8A 5L7WA 2FDRA 4DG8A 3D3JA 3STYA 4AJOA 4UHCA 5DNVA 3C1OA 2XRFA 5T41A 1JH9A 1BRTA 1UBNA 4YCCA 1QKJA 4Q4HB 4CT5A 1W46A 2GZRA 4V0MA 3B6KA 1O0SA 1UBLS 5FPQA 3PQDA 4OAQA 1E2DA 2C7QA 4KU4A 2EJUA 4V0LA 4HGOA 5H59A 2F1RA 1MDFA 2EZTA 3ZGOA 3ZTTA 3K3PA 1KIAA 2CYCA 2AUMA 4BMCA 3N2EA 1DQNA 1IXYA 5JDIC 2IE8A 1JS1X 4YJ3B 1P2UA 2D2VA 2YHBA 1RFLA 4F2GA 4ZZ3A 3GBPA 3MS4A 3ZCPA 4O2RA 4L5JA 3FSEA 2EX4A 4L5BA 2GF0A 1H3NA 4FHFA 2WVGA 3BKXA 3DDSA 2O3QA 1PTJA 1UODA 2IYOA 1IMOA 3BFJA 3CUWA 4OUDB 3WLLA 1O95A 4A27A 4DSNA 4L0DA 4PPNA 3RRYA 4KV7A 5IDQA 2QROA 3H1GA 1MPXA 3I2GA 3QKUA 2KLHA 3VJKA 4ENVA 1E2MA 1NWCA 3ORHA 3GLFA 1OGJA 3EZLA 3GVXA 2AE1A 2CZQA 4UU7A 1LLCA 3UJPA 621PA 5LMUB 1G60A 1GARA 1NLFA 4JEHA 5T8KA 1Z4PX 3F7MA 3MELA 3N2YA 2Q3HA 4ASUD 3ZD7A 3C48A 2C03A 2WSLA 1MQ9A 3AVPA 3I5AA 2XUIA 3DTVA 4N3AA 2NZWA 3G8DA 1MC1A 2NLOA 3VA7A 3INNA 5DTMA 3TNJA 1RZVA 3BDIA 1I36A 1YMQA 2R62A 5EA2A 1ID8A 1C3LA 1QP0A 5IPFA 5EGNA 5BN3A 2OD7A 4TZTA 3BDAA 3MD9A 4YC7A 3Q2IA 1YQWA 3SC4A 2CFRA 4KQXA 4M1KA 4MR8B 1GTVA 1V0JA 4X7PA 3VSAA 3GZTB 3BA1A 1W5SA 3NC4A 2R9VA 4ZVOA 3NKLA 2XZPA 5TQJA 5GVSA 2F55A 1T15A 4MUAA 1JDJA 3T99A 1UXGA 2GB4A 3OZWA 2P3QA 2H52A 1NVXQ 3K9BA 3BEOA 3IEXA 4Y18A 4JBGA 3NO4A 2WFMA 2OZKA 3C3MA 4BCCA 1F6BA 1Q6YA 1N2JA 1V4BA 3QMVA 1E1QD 2PRIA 3JRWA 1UC9A 1KI9A 2HF2A 1RRVA 3A58B 3K32A 4Q4JB 2G5TA 4QVGA 5IT0A 1AKUA 1GTL1 1U1DA 3A6DA 4F9GA 5F2EA 1ORHA 4AJNA 3O8OB 3SQLA 4F2DA 1IY9A 1NJFA 2FWBA 2PV0A 2IUUA 4N5HX 3RUHA 4H7PA 3FPSA 4KMSA 1DC3A 2ECPA 5LQRA 2CYAA 2F3QA 2D0DA 2DWUA 3OJ0A 5GV7A 2RE8A 3KYIB 2PMEA 1DELA 1DLJA 3EQ7A 4JNCA 4OEHA 3DUFB 4P5EA 5H02A 2W2TA 4DA7A 1RLUA 4RDXA 3A9WA 2YJ5A 2BM0A 1ECBA 1PW5A 4ZJZA 1F3OA 3PI7A 3EVEA 4XDZA 2G4LA 1W8IA 2VYCA 4G5XA 4CGZA 1J0DA 1SCBA 2AX4A 3SK0A 4JGGA 1ZVMA 2M2IA 1YIAA 5AUPB 3SZOA 1W47A 4MLPA 4E5MA 1O96A 4XW2A 3C8UA 4QEDA 3TQHA 1N4AA 4TM7A 4EITA 1YQEA 3GOQA 4DTCA 3KAPA 4QTTB 3WLKX 3BH0A 3CTPA 1JEQB 3QUBA 5LB4A 4NFLA 1LBSA 4BKPA 2ZRCA 3RKRA 5HHTA 1W0KD 3IV9A 1M6NA 1O1YA 3AR4A 3B5JA 3JQ8B 4U2KA 4XSGA 1Y4DE 4H35A 2L69A 4PCVA 2XUOA 3ZWVA 4CFZA 5LSAA 2GEDA 1UPUA 4R68A 1Z8FA 3IEVA 4U9UA 1CZRA 2DPXA 3JAKA 3RASA 4WASA 4FGZA 3T1TA 3EPRA 4BMOB 3QOXA 3L43A 1BEEA 2P9BA 2QAGC 5F21A 1E6UA 3ZI7A 4DEXA 4UTVA 5AVWA 3ZD6A 3ESYA 5KWEA 3A1WA 4CM8B 1H05A 3MCAA 3N28A 1MB0A 4LW8A 5HFNA 3G9UA 1IQ0A 2CUZA 3C5CA 3GLHE 3MWDA 4KWEA 4M0FA 4TWBA 5AKJA 5JDCC 2BBTA 1GUZA 3DHEA 4BO9A 4E70A 4XFKA 2V7BA 3FGOA 1DWUA 1V3TA 5JCJD 1YS1X 1MFPA 3I9NA 3IELA 4ZQGA 1NW9B 4OLAA 4B1FA 3PFGA 2VUSA 1E6CA 1LI4A 1XVVA 3QI7A 2B4QA 5BNIA 5DBEX 5LZ5A 1E5DA 4TLMB 2H2FA 3W8NA 2JFZA 1V9LA 3QVKA 5GP1A 1VBNA 3RFVA 1OX6A 1GP2A 1XQ1A 1GDDA 4HTAA 4P5DA 1KNXA 4KRXA 4B80A 1L5HB 1XAJA 3S8EA 4N48A 1E2PA 2G06A 2PKXA 3VTZA 3ZU6A 4A36A 5C7IO 4IJ6A 2CCKA 4K6CA 1IATA 1QX4A 5KKAA 4A91A 1WPXA 3DXYA 5HBGA 2QUHA 4IO1A 2FW1A 3QNWA 3O8RA 4EJSB 4BV8A 2AC7A 4ZCLA 3HJNA 1ODCA 3VYWA 2VHUA 1A8UA 5TPWB 2YXLA 3NM4A 1AKNA 2BGMA 3DEFA 1MQ8B 2ODAA 3LP6A 5IBRA 2OYRA 4G0YA 4ZOQI 2YIMA 4KAFA 3K70B 3GZ4A 3RS3A 1W6UA 4RKRA 4LNUA 3V2UA 4RSMA 1DKPA 3VM6A 3W5JA 3IIEA 2GH1A 2DC1A 4PQEA 5KPJA 5IJ0B 2LBPA 4DMMA 4H9GA 5D00A 2HQRA 5AR1A 3ED5A 3HP1A 4EEXA 3DO5A 6YASA 3AEXA 1YBMA 1G2IA 1CB7A 2HLPA 2KBFA 5DNDA 4C2UA 2QVBA 3NHWA 2PGOA 2QORA 1GLGA 3PNPA 2XVYA 3SJCA 4MICA 3DE7X 1E9VA 2VN8A 4NOKA 4PAGA 1JYEA 4LBZA 3CR8A 1YZYA 2XPCA 3W90A 3A6EA 3T06B 5TQ2B 2ZU6A 1LSJA 3IAS6 1DJOA 2QMEA 3DPSA 4ATNA 3P0IA 1JJ7A 3FSGA 2ODNA 2FPMA 2XAAA 3A4YA 1DX9A 2QT9A 4M3NA 5A3RA 1SHZA 5HW0A 5LWQA 3DW3X 3U7HB 3H9EO 1JWBB 1YB5A 3ZJ5A 4ECEA 2Z2JA 3CEAA 3PR1A 1WP9A 1BWRA 4AN4A 2H51A 3C7CB 3R6DA 3EJ6A 1LVUA 4FXPA 4XFDA 1YS2X 1TE2A 1RRPA 2N0SA 2X8BA 1W5FA 3E2MA 3ZQJA 2TMDA 1GV1A 1LS6A 3GBVA 1AH2A 3GI1A 3LUDA 4R1UA 2NPFA 3R3VA 5HDQA 2HNBA 3DZ8A 4FXOA 5H16A 3EHEA 2OQIA 3FXAA 1MU0A 3OUTA 1J9EA 1FXWA 5KU7A 5KUTA 1APBA 1S02A 2AYZA 2F48A 1L8LA 4XEHA 1AIPA 3HCDA 4ZA2A 3EIEA 5DEOA 1W19A 4HP8A 4P35A 3AEZA 1EZ4A 4RDCA 5E2AA 4RE6A 1XJ5A 2W4QA <