4Q66C

Structure of exomer bound to arf1.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
134
Chain Sequence
ILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVSFTVWDVGGLDRIRSLWRHYYRNTGVIFVVDSNDRSRIGEAREVMQLNEDELRVFANKQDLPEAMSAAEITEKLGWFIQATCATSGEGLYEGLEWLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for membrane binding and remodeling by the exomer secretory vesicle cargo adaptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae r008
molecule tags Protein transport
molecule keywords Chs5p
total genus 29
structure length 134
sequence length 155
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q66C00
4TMZA 2HDNB 3ICEA 1A5TA 1CULC 1VYVA 3LQQA 3S1AA 3JVUA 4E22A 5GADl 1OF1A 3SR0A 2GJAA 2FSIA 3GLHB 2IEYA 2FPKA 2IK8A 2H8KA 5DN6D 4XSHA 4AKIA 3JZAA 3VX4A 3HYRA 4MRPA 4AYWA 4DEYA 4KO8A 5FUVA 1WBDA 4LBWA 1OIWA 4RD2A 1NY5A 2C95A 2V7QA 5HPYB 1NKTA 2QMUA 2QUZA 3UKDA 4LHVA 4B43A 1U9IA 3NBFA 3A4MA 1Q1QA 4F38A 2BIFA 3CRVA 1DE0A 2XITA 2BCJQ 4GT1A 4URYR 3ZQJA 1N6HA 3I61A 3DOFA 4UJ5A 3AVUA 2JJ1A 2H7VA 2WWFA 1S0UA 1DAGA 2FG5A 5B58C 3KQNA 4M0LA 3CBQA 2FFHA 2AFIE 1R10A 5JSZB 5G3ZA 4HAZA 1G7CA 3K0SA 4BZXA 2XZOA 4QBFA 2VIIA 4RVCA 5E7IA 2QORA 2ZRNA 2C8VA 1O87A 2MMGA 4PR0A 5FBRB 4EPWA 4ZKDA 3MWJA 3VHLB 2IF0A 4JBYA 1X1RA 4M1KA 3CKLA 1VECA 2ATVA 2FZ4A 4JLVA 4M8NE 4WOPA 1YVDA 2KI5A 3U6BA 1XU4A 3TUIC 3R20A 2A5YB 1R0XA 2BEKA 1Q57A 2WSSA 1W36D 4LBVA 2WMNB 2XSZA 4JKYA 4MYUA 3SC3A 3RNLA 3GEHA 4MYCA 2FU5C 3IDQA 4R2IA 5JCZA 3BIFA 2GXUA 2SHKA 1KKMA 4MKFA 2MSEB 4M53A 3WYAA 1P5ZB 4B73A 3GJ6A 4DB2A 4FCTA 3GEIA 3DKVA 5FPHA 3TAUA 4WA7A 2OUKA 1NN1A 1Q12A 2QU8A 2PT5A 3C16C 1P2VA 3L2OB 3VKHA 2GHIA 1LFDB 2DWPA 5LBIA 2BCGY 421PA 1RJ9B 5A4JA 1KDRA 2XGJA 4FD2A 4YQFA 5FPSA 3RDPA 5SZJA 2NO0A 1YRAA 5G41A 1KMHB 2HLDA 4Q7LA 2IHYA 3AKEA 2FOLA 2EFEB 2V1UA 2CLCX 3BGWA 3RC3A 1H8ED 4JBWA 3UWOA 1SGWA 1NSFA 4B3FX 221PA 4LJ7A 3OEEA 4DCTA 3RLFA 1MO5A 4OQMA 5D3MA 3CH4B 4BLPA 1KI2A 1M7HA 2D2FA 1E9SA 2F1HA 4WBSA 1OSNA 1BS1A 5LD2C 1A4RA 2GZDA 2H18A 4BASA 3CF6R 2AD5A 1YZTA 1E79A 2JDIA 1OH5A 1GRNA 3A58B 3F5FA 3QOFA 3MWKA 4P4SB 2C77A 4MYTA 5KDLA 3K0AA 1EGAA 3CRMA 5EE5B 5TV2A 3FMPB 4B48A 1A2BA 4B2PA 4IOJA 4KYUA 1TEXA 1YKSA 3RS5A 2J1LA 1IAQA 2ERYA 4O2LA 2D62A 1N6KA 3C4JA 1U8YA 2OLKA 4I1UA 5DSZA 1OH8A 1PLJA 3LDAA 5KUTA 3T34A 3QXCA 3TUJC 4PZLA 4KLZA 1RE0A 2J0UA 3B7GA 4OJKA 2VSXA 4EIWA 3AM1A 3X2SA 2QNRA 3B13B 2QP3A 3WYGA 1UFQA 1Z6YA 3K70B 1QRAA 3T06B 4OHXA 2A3RA 4AYXA 2GDJA 3AVQA 1JR6A 4QRHA 2BJVA 5TDHA 2WWXA 2JLQA 1OH7A 1T6NA 1E4YA 2GEUA 3QENA 4HUTA 2P5SA 3DHWC 1E0SA 3ZVNA 5CB6A 4ILEA 2ONKA 4B76A 1AS2A 3MCAA 3A1SA 5GJCA 1JBKA 2D06A 2JLRA 4Q9JA 5TMPA 1UDXA 5B64A 4TLEA 1M2OB 3U3JA 1Q3HA 2WJGA 1AZSC 4KJZA 1NIPA 2HT1A 2C78A 1KK0A 2QTVB 4PANA 5C2JB 5F9FA 2O0JA 2ZXUA 1E2IA 2R6DA 1G7TA 4DDUA 1NKSA 1YR8A 2GAAA 2HLDD 2WKPA 3RAPR 1QHXA 1W36C 1XZQA 3LH5A 5CK4A 3K9GA 2HJGA 2BOVA 1AM4D 2GXSA 3C5HA 3DPUA 3LV8A 4NE2A 4TMTA 3K8YA 3WHLA 2ANCA 2Z43A 5D3MB 1KY2A 2GJ9A 1P9WA 3IHWA 4RD3A 2WWWA 4XH9B 2YZ2A 3NG1A 4KVAA 1SQ5A 3OZXA 4R2HA 3O47A 1NLYA 1G16A 2ZUBA 1WMSA 3LO5A 2F9MA 3T5DA 2BBSA 2ZSDA 4RD6A 3SJCA 1G19A 1G4AE 1DAKA 2XNSA 2GCOB 4RFSB 1ZU4A 1X8LA 1XJ0A 3THYA 2AFHE 4CEHB 3T1OA 1GAJA 1KI6A 1TEVA 2GCNA 2N46A 4KVGA 2FJUA 4PC6A 3GLFE 1UBCA 2WMOB 3KX2A 3GFTA 5SZKB 2FFBA 1NLZA 2P0EA 4TSFD 1E4VA 3ZZ0A 5KNDA 2VP6A 2ODEA 1Z6GA 1JXOA 1JALA 1ZMXA 4CGZA 2GBLA 3C5CA 3RSOA 2IF2A 5G3YA 3R9IA 1IQPA 3SFZA 1VG0B 2RGXA 4A2QA 1MO4A 5FBQB 5J4LA 2PBRA 1KIMA 4FMCB 1ZC3A 2V1XA 3BB1A 3DZDA 2HYIC 2YKGA 1CJVC 4X8MA 5B30A 2FH5B 3W34A 4HZIA 3F0TA 4BWYA 2GJ8A 2QY9A 4ZIRA 1I4LD 1U0LA 1QHYA 2J0SA 1E2HA 1YZUA 2H5EA 2BC9A 4S35A 3W5JA 5KYKA 2PZEA 2XOKD 1NN0A 4IVRA 2ZS7A 3VTKA 1CEEA 2ZRCA 4KFSA 4P31A 3BERA 1W5TA 1TUIA 2V7QD 4DIDA 1P9RA 3I5YA 5KSOA 1KAOA 4DXAA 3FMIA 4JT2A 3LXRA 2IYTA 3UMFA 5FI1B 4KFTA 4CEIB 3LAWA 4QOSA 3FOZA 1MO3A 3PITA 4JVMA 3LX8A 1XMIA 1DADA 2VBCA 1ZUNB 2BV3A 2PLRA 2WJVA 2IHBA 4YMSA 1T4GA 4M22A 2AK3A 3U61B 3KL4A 1W49A 3SHWA 3C15C 2IYWA 1PLLA 1I4TD 1ESNA 2Y8EA 2ZRBA 3EIQA 3L0IB 4TYPA 1KKLA 2PX3A 3BH0A 4XOIA 2HEIA 3I4LA 3WMEA 4Q66C 4XWOA 4PHHA 2BEJA 2XTZA 2JIZA 4L9SA 3PEWA 1G7RA 2PLFA 4G01B 1Z22A 2DWOA 4PAQA 1EFRA 1P3JA 2WPDA 3ND9A 1ZUHA 4V0MA 1COWD 5EXSA 3ZDQA 1XD9A 3U4QA 1ZM2A 2ZU0C 1FX0A 1ZRHA 4X8OA 3O8RA 5FBWB 4EJSA 3EC2A 3PR1A 3VFDA 1F2TA 3ASYA 3P27A 3N2EA 4JYCA 3TSOA 2W2XA 4A0FA 1E2FA 2QRNA 4Q03A 3ZVLA 4QJ4A 3BH6A 3OFND 3A4LA 4LYHA 2OCAA 3W9YA 4EPTA 1XEFA 1AKYA 1N5JA 3W8NA 3HJNA 1BYIA 2RGBA 3KQUA 1T3SA 1X8KA 3AP3A 2GAOA 2Q21A 1DAEA 1G8YA 3AF2A 4Q9HA 3BE4A 3SBDA 2HXSA 4FXPA 3IBYA 2QQ0A 4IDHA 5IK2A 3SNHA 3CX8A 3PEYA 2ANBA 2ZI5A 4UNNA 1U8AA 2Q3HA 2WVJA 3I5XA 3I1FA 1XCPA 2GVDC 1NF3A 2CCGA 4FIDA 4MUBA 3U3MA 1HE8B 1RRFA 2FMXA 4DLXA 4A15A 4OQFA 4OHYA 1MABB 4XTCS 2VQSA 2DBYA 2CVFA 1EFUA 1ETUA 3E5HA 3IQXA 4EAQA 3PJRA 2FZLA 1VG9B 3CRQA 1U99A 3O8BA 4HUQA 4IDNA 2NZ8A 4LHWA 1QHNA 1NSTA 3ZIAD 4BZPA 2YWFA 4H9GA 3SDZA 1AQUA 3D6TB 3WMFA 1N6IA 3LW8A 5D3QA 2YJTD 5E95A 1Z28A 1X1SA 4HATA 2QSYA 4M2LA 1F60A 5EP3A 1GZSA 4TTPA 4C0KA 3KJHA 1E9BA 5JWOA 4PTLA 3KUDA 4KSBA 1P9NA 1TL7C 3THWA 2WKQA 5KSYA 1ZM7A 3O8CA 4PHGA 1GM5A 1LVGA 4RKFA 3KQKA 3VNUA 2J45A 3TSZA 4DUGD 3EW9A 4Q4AB 4P0TA 3OIUA 4MITA 3FMFA 4URZR 2GKSA 2OSBA 3IIMA 3ASZA 5DHAA 621PA 2VSFA 2CE7A 2V3CC 1Q44A 1TU4A 2DFKB 3ZH9B 1HT2E 4ESVA 1TTTA 2OAP1 3JVVA 3VU9B 2GRJA 4BFSA 4CEIA 4CEHA 3A1UA 3GQBA 2PZGA 3CPJB 5CLQA 5JCPA 4LHXA 3ZVMA 1AS0A 1NBME 4MGIR 2DB3A 2DPXA 1VHTA 121PA 4L15A 2OBLA 2QSZA 3N2IA 3L0OA 4YXWD 1SVLA 3Q9LA 4Q18A 1GKUB 2JEOA 3EXAA 1Q0UA 3V4FA 3L8YA 3WHKA 2G83A 4LDJA 3SOPA 2ZPTX 3L0SA 1TUEA 4P33A 1XTQA 4O2RA 2IYSA 2PT7A 3P4XA 2OCYC 4Q1BA 4TTRA 1Z6TA 2FV8A 4MRVA 3ECCA 5JHHB 1FUUA 1CR4A 3PCRB 4DCVA 3QBVA 2BKEA 4W7SA 4DSNA 3FKQA 3LBNA 4LJ5A 1E32A 1G8FA 4HB2A 4O25A 2ZRKA 5FTNA 5AR1A 1GKIA 2AKYA 3KUCA 4PHTA 5H1YA 4IOKA 4JL8A 4UNSA 1J8MF 2ZS9A 4Q4JA 1YZGA 3RABA 2CHGA 2G3YA 4K8OA 1P2TA 1EWRA 5KOYA 4IVPA 2J59A 2J9RA 3KZ1E 3UANA 4A2WA 1II9A 1HA3A 1SKYE 2C5LA 4Q1FA 1G4UR 1Z0JA 2I3BA 3I73A 5DHFA 4EQ6A 3PENA 1Z06A 2RHDA 4YXWA 2JCSA 1G291 1QHHB 1US8A 4GZMA 2ERXA 3QXSA 3FKSD 4FMDB 3QVVA 5J4HA 1E1QA 2F1JA 1RJ9A 1XCGB 1Z0KA 3W6OA 1VDZA 3KKQA 1U0HC 3WBKA 2QAGA 4RCZA 4DLYA 2F3RA 1OFHA 2IX3A 3VU9A 1TMKA 2GCOA 1TAGA 1CBUA 4IJMA 5AUNB 4PC2A 2ZI3A 4QC2A 2G1KA 3H4MA 4ZV4A 3QI2A 1ZAKA 5EJEA 3QJYA 1ZNXA 4B74A 3R8FA 1E2NA 2YNMA 2DYKA 1WBBA 2HT6A 3AVWA 4G5OA 3MWLA 1M1YE 5CM9C 3BBPA 3E70C 5FL3A 1PV4A 3P4YA 2EYUA 3CRRA 1RVDA 3AEZA 3ZJYA 1MKYA 1NLFA 2PCLA 2ZE6A 1FW6A 1JQLB 1GIAA 1S4QA 2I1VB 1QF9A 4LV8B 3TE6A 3BOSA 1UKYA 3AF3A 5IK2D 1ZM9A 3AKDA 3OIYA 4K81B 2CL7X 2XJ9A 4KU4A 3OF5A 1FNMA 4JYBA 1E3MA 2FEOA 1XZPA 5FUYA 1QG2A 3A36A 2IYLD 2KJQA 2ZE8A 1ZVQA 4J0QA 4LBYA 2OAQ1 821PA 3EPLA 4DUGA 4CYMA 4JIMA 2ZJZA 1XMSA 2ZJ2A 2FDCA 4C7OA 4JVLA 4DCNA 4NYJQ 5CYPA 4HLDA 1T9HA 4M9ZA 4ZDIA 5IRCD 1NVUQ 4ACBA 1ZNWA 2WWGA 1ZU5A 4AIIA 4NONA 2ZRIA 5FTMA 4DLSA 2B92A 2IYQA 4BFYA 4GNKA 2F1RA 3KFVA 2NO6A 1BYUA 4WW0A 1Z2CA 1JNYA 2BWJA 3KB1A 3NTUA 2R65A 3SU8A 2IYXA 2RHMA 2IL1A 5FI0B 1EFTA 4ASUD 2BBTA 1T8TA 1GDDA 2IS2A 1FMLA 1BO6A 1SXJA 3HP1A 2GBLC 4LWZA 3W3ZB 2RH5A 4ZKEA 2NOAA 4AKHA 4BFVA 1G17A 1N0VC 4MKIA 4V0KA 4Z51A 3VX3A 4JSYA 1HQCA 2OFXA 1SHZA 1Q1EA 1Q21A 1CP2A 4MGYR 4OK3A 4Q21A 3TUZC 1T0HB 2P6NA 2CE2X 3QNUA 3THOA 4KITB 2CLDX 3BB4A 2QGZA 3CNNA 3U6KA 2HXYA 2GZHA 3QXXA 2OHFA 3B1YA 1XTSA 2ZTSA 1T5IA 4L9WA 1H65A 2EW1A 1K6MA 2ZIAA 3AF4A 3AVYA 1OJLA 3NKVA 1KNQA 2RMKA 1GILA 1LY1A 5FBLB 3BH7A 4M1SA 2D74A 5CJ2A 4QNMA 4FW9A 4D0NA 2DWQA 3TNFA 3AF0A 1LF5A 3MWYW 3QF4B 3SFVA 1VCIA 3W5IA 1F2UA 5F3WB 1KSFX 2HJVA 3QE0A 1OLOA 3RS0A 2FSGA 3EZ9A 5L3QB 1XPUA 4QG7A 2GA8A 2MSDB 3PV0A 1GL9B 3IPYA 2B21A 5EQTA 2EFGA 2BM1A 1KO4A 5FPTA 3U44A 3A6PC 2WJIA 3H0KA 5KSZA 1XMJA 4V0LA 1W4BA 4DVGA 2ZEJA 4FMCF 4I1VA 5K8LA 2CNWA 1YR7A 5J4YA 4II7A 3A4NA 4JLPA 5JFGA 2GWHA 5FR1A 3M0EA 1U94A 3B82A 4LK2A 4DSOA 2VF7A 4PHFA 4OHWA 3K70C 2AR7A 1M34E 3TKLA 4KV9A 2J0QA 2ZSEA 4NP6A 1IONA 1GUAA 2WBLC 4F4CA 1P73A 3NHBA 4RZUA 5EP1A 4B3GA 2ZRDA 4WZ6A 1RYHA 5JJKA 5KPDA 3LNCA 2REBA 3K0CC 3GLFA 3B85A 5EZ5A 4FCWA 1WA5A 1QVRA 2NTYC 2W2TA 3QPVA 1NG9A 1GRRA 2JIZD 3EPKA 1GL7A 3KTAB 4RZ3A 1PLKA 3SYKA 4BEBA 2IT1A 3QG5A 2W6ID 5F9HA 2Q3FA 2BMFA 1DBSA 2IS1A 1CRPA 1G5PA 1LW7A 2R62A 4RZ2A 1FPMA 4DLTA 2E87A 1VG1A 4NYMQ 5CDFA 3RRYA 3UK6A 2PCJA 2GK7A 1JEEA 1FP6A 2FSHA 2CCJA 2O5VA 3ZZUA 1VTKA 1KDPA 3ZQ6A 3C7KA 1W48A 2RGGA 4HYYA 4MGZR 2R2AA 1C9KA 1Y63A 1ANKA 3PQCA 1VMAA 1QG4A 3A37A 2PMDA 2OXCA 3CONA 1W2GA 2QMOA 1BOFA 2MMCA 3EZ2A 4C0JA 1E9EA 2P2LA 4LBZA 4LOAA 2JJ2A 2OG2A 3FE2A 1P72A 3RWOA 1XFAA 4RD4A 3TQCA 4FN5A 4Q7MB 1EXMA 4RD0A 3T61A 2WPDD 1CU1A 4OQLA 2L0XA 5CK5A 2XTNA 4MDFA 4QFMA 3I3SR 2LKDA 3RRZA 3J81k 1NMZA 1OXTA 3MG9A 2G77B 5KDDA 1JJ7A 1XXHE 2IYRA 2OV2A 2PH1A 4KYIB 4YDHB 4A8JB 2AWNA 2IUTA 4LSGA 4KAXA 4NHOA 1W46A 2UVQA 1BMFD 1ZD8A 2WKRA 3H1TA 2J41A 721PA 5AJVB 2BBWA 1XD2A 5UKDA 4D82A 3PFIA 1R0WA 1KNXA 5HE9A 4BLTA 3U44B 1I4DD 3W6PA 1OT3A 2PX0A 4GRAA 4V0OA 2GXQA 3OEHD 4C30A 1JJVA 3GJ4A 4JL5A 1EFCA 2IUSA 1IXSB 3T35A 5A0FA 3U7EB 3TQFA 4A4DA 4U5XA 1D5CA 3KKOA 1KK1A 1RC8A 1AS3A 2QE7D 4B3XA 1Z5ZA 1SKYB 5AUOB 2ZITA 4V0ME 4BQSA 3THXB 1D9XA 2BMEA 4B3DA 4QM6A 2V6IA 4ZDWA 3DDCA 5FL7A 4ERNA 1R8SA 2KBFA 2OZEA 2YV5A 5H8WA 1F2TB 4NPHA 1KI3A 1MV5A 3UG7A 1ODFA 1Q1BA 3CX7A 4FI3C 4FINA 1CF4A 4JLAA 2FEMA 3ND8A 2YWEA 1Y3AA 1D8TA 2QL6A 2HCBA 4I81A 2AHOA 3EWSA 5FOWA 1L8QA 4M9XA 1RZ3A 2VF8A 2ZANA 3CNLA 2ZQ5A 3K9HA 4YONB 4EFNA 1G3QA 1KI6B 1Z0FA 1S3SA 4NTZA 4LC0A 2IA5A 1II0A 2Q9CA 2QPAA 5DYIA 4NCKA 4TMXA 4DHEA 4RZXA 1N0WA 2CJWA 2QPTA 1JB1A 4MDEA 1R5BA 2FGJA 2O8BB 4ZO4A 2ZS8A 4JS0A 4IFBA 2ZI7A 4A6XA 1FOEB 3OE7D 3NBYC 2JJ8A 1VIYA 2H57A 3IQWA 5CDFE 2XB2A 2KBEA 4A0GA 4Z54A 1N3BA 4GP7A 2ZR0A 1TX4B 1UBFA 2OE2A 2RGNC 2OBMA 1XEXA 3EASA 5B2ZA 2D4HA 1G18A 1JECA 3OAAD 1FUKA 3V9PA 1YRBA 2YYZA 2G0NA 1TADA 3RRMA 1YZNA 1L7VC 4R98A 3LRPA 1W0JD 3IUYA 1QHSA 1P61B 1SKQA 2B7CA 2KWIA 4TT3D 1XJCA 2NO7A 2CNWD 1GP2A 4RKEA 4S2EA 4MRSA 4LJ6A 3GFPA 3BB3A 1E2MA 4B33A 4GOKA 5L3QA 4ZI2A 2E9SA 3SZRA 3BC1A 1I2MA 1IN8A 2IYZA 1OH6A 5IF9A 3H2YA 2V55B 4OK6A 3WP0A 4LPSA 1W4AA 4EKDA 1EG7A 4MGKR 3AVXA 4B32A 4Q9IA 4JL6A 1KZGB 3U7GA 3MGCA 3I8XA 5B57C 3Q5DA 5DGXA 4WVFA 3RYTC 3QQ5A 4NCIA 3VMFA 2GILA 4MRRA 4X8HA 1JR3E 2JASA 1G8PA 1OKKA 1M8PA 4LHZA 1KZ7B 1SXJD 2LKCA 2ZI6A 3NC1C 2QROA 4L4UA 4ZCLA 4DT1B 1JR3A 2REOA 1KJYA 4BZQA 4PSVA 2WIBA 4ZCIA 4IHQA 5HCNA 4C0SA 1VPLA 3U4QB 3Q8XB 1IM2A 1XF9A 3FTQA 4OI4A 2QBYA 2HCJB 1G3UA 4M1WA 4PXAA 2XEXA 4TN1A 2KE5A 4URXR 4QGFA 3OEHA 4YC7A 4TYWA 1IOZA 1ONBA 1E9DA 5EUMA 4JLBA 3X1DA 4QM7A 1X3SA 3FB4A 1E2DA 1D9ZA 2AD1A 4Q47A 5KU1A 3MUFA 3OAAA 4LGMA 3LBHA 4IOLA 4Q19A 1FX0B 1R5NA 4IKEA 1GNQA 2DY1A 2XJ4A 2Q6TA 3SI7A 4A2PA 4US1R 3AKYA 3RANA 3TMKA 4URVR 4LV6A 2H16A 2UZIR 4NDZA 3WNBA 1X6VA 3CZPA 4US0R 4BE7B 3B9PA 2ZYWX 3ZZTA 5DIFA 5DISB 4MKHA 3GLHA 3K0FB 2DCUA 4Q4JB 1R8QA 2GCPA 2K5UA 3ONWA 4IFEA 2OLJA 1XTKA 3NEJA 1JXMA 1GRQA 1DEKA 1SVWA 3VR4A 4AWXA 4GBMA 2NQ2C 5LD2B 4DLZA 4IDOA 1H8EA 1M74A 1IBRA 1E9FA 1ZUIA 5C46F 3FFAA 2X19A 2X8AA 4OI2A 2ZRGA 5L3RA 4KSCA 2ZJAA 5L3VA 3BAFA 5JRJA 2ZRHA 3MAAC 2C03A 4LC1A 1QVAA 5C1BA 1NNEA 2BMJA 3EARA 4CF7A 1EFHA 1T3LA 3O8DA 2QPOA 3D8BA 4C4PA 3LX5A 3GJ0A 4Q1AA 2W0SA 3LVQE 3ZYCA 4QGGA 2N1BA 5JI3E 1Q20A 2VRWA 3OEED 2ZI9A 2XZPA 1Z08A 3QXJA 4Z1MA 3QVUA 1ZINA 3W8RA 4US2R 4TYYA 2FE4A 2ZVPX 1TQ4A 4CW7A 1GOTA 4G3XA 4HB0A 2QP4A 1DG3A 4LJYA 2XTMA 4UNQA 1XNJA 3NDPA 3X1ZA 5JSZA 3N70A 3OIWA 2AN9A 1G6HA 1Z8FA 2V54A 1S8FA 3FYHA 4JLKA 2R6GA 5BXQC 3CR8A 1KK2A 5EXTA 2IWHA 4PX9A 3C14C 4FCVA 2OT3B 1UEIA 2C04A 1W1WA 2FN4A 3SBEA 1OPXA 2JLZA 3QKSA 1ZM3A 2F1IA 5FOSA 3AV0B 2E1RA 1DAMA 1JI0A 4HAUA 3DM9B 2DFLA 2QZ4A 2P67A 1XTIA 2RCNA 2WJYA 1RFLA 4DCUA 1KGDA 4H1UA 1NVVQ 2AX4A 3MJHA 4TMKA 1WQ1R 3MLEA 3PUVA 1ZNZA 4I99A 1IJFA 4WIAA 4NZYA 5J4VA 3IBGA 2R6AA 5E3HA 2OILA 3ZD7A 3EC1A 1FL9A 1NG1A 2YINC 1CLUA 1E0JA 3BFKA 3LA6A 5CYOA 2J3EA 2ZUCA 3MRSA 2V4ZA 4N3NA 4OQXA 1AZTA 2OFWA 4AG5A 2BVNA 3CIOA 2Z5FA 4WAUA 4P32A 1N2CE 4JMPA 4UKDA 1QZXA 3TAHA 2FSFA 3VR2A 4D4JA 3QXHA 4D6PA 2WHXA 2V6JA 4V02A 4E07A 1RRPA 1ZW6A 5JEEA 1I2DA 5CIQA 5J47A 4IXMA 5EP2A 4LRWA 4XIGS 2OESA 4B71A 1SVIA 3ZIAA 4BGDA 3NBZC 4Z1MD 1SXJC 3HU2A 1C1YA 4EPXA 3EIEA 4BUJA 2BDTA 3NEYA 3NHAA 3TVDA 3PUYA 1LNZA 5DI3A 3KXLA 1MRSA 3TRFA 4CVNA 3GLIE 4A8JC 1YU9A 3WBJA 4YMWA 5AUQA 3VHXA 4AG6A 3CWQA 5CIWA 2VP4A 1N0UA 4GP6A 5FTJA 4LZZA 2VA8A 1KI1A 1R7RA 1CR2A 2X1VA 2B7BA 4OKSA 4Z8XA 3HDTA 4BFZA 3THYB 4BLSA 4W5WA 4QL3A 5JMTA 3WNCA 4TQUS 3EA5A 1LV7A 3L0PA 4G5QA 2QM7A 4PPQA 2P6RA 2QAGB 5HE8A 3G5UA 3U2QA 1J70A 1KK3A 3K9NA 2ZYUX 1CR1A 4NU0A 4NYIR 1PUJA 4BFWA 5GJWC 1O3YA 3VR5A 1DAIA 1ESMA 2VP9A 5KPJA 1LS1A 1QHHA 4C0LA 2F7SA 3Q85A 4C0BA 4Q1DA 1KHTA 2O8BA 3K9LA 1D2MA 1LF0A 3RS2A 5EE9A 3SHFA 2A9KA 3MJRA 3B8HA 3CRW1 3HPQA 3NWJA 1XEWY 2EFDB 3SYLA 1DO2A 3LQRA 1XJQA 2DR3A 3FVQA 4B3CA 1G3IA 2ORVA 3IIJA 2C9OA 2QMHA 3K1JA 1U98A 4EQ6B 4F93B 1XB2A 2IXEA 1U8ZA 4QBHA 1G9XA 1EESA 1G5TA 4PO9A 3IKJA 2GK6A 3AVPA 5FFMA 4PPFA 4W5HA 1KOFA 5SZHB 3GP8A 2WSSD 3NIBA 4G1UC 3WP1B 1W0KD 3CF0A 4HB3A 1E99A 2WICA 1NI3A 2JGNA 1WE2A 2QEQA 3TR0A 3U3KA 3GJ3A 4A6PA 4ZIRB 1R0YA 2O0KA 4HLCA 3SQXA 3IO3A 4I1SA 1SZPA 1XD2B 3LBIA 4TL9A 5FOXA 5P21A 1EFRD 1IHUA 2GEVA 3FMOB 1OB2A 1UAAA 3R9WA 1OHHD 3FPAA 3RWMB 2ZJ8A 4C7OB 2B8WA 4Q1EA 4NYMR 1HH4A 3MD0A 4HAYA 2PEYA 4LHYA 4UQOA 4A92A 1J2JA 1SXJB 1W7AA 3AP1A 1FQJA 2OXRA 4JLJA 5EP4A 1OKKD 1N6NA 1SXJE 1KAGA 4BLQA 1JR3D 5IHPA 1XXHA 1OE0A 2ZM5A 2AL7A 3G0HA 1G64A 1Z3IX 4LYJA 5IT5A 3ADBA 4ITRC 1DELA 3Q3JB 3IEVA 4BFUA 4NBSA 3ZVRA 4DSTA 4JSTA 4DRZA 1RRGA 3B1VA 1S2MA 1QDEA 3LVRE 4UXIA 1UF9A 4GFDA 4TMWA 4Z8YA 4P3YA 4TL7A 4IVQA 1G8HA 2WWIA 2YHSA 2CLSA 1DVRA 4C2UA 1XEWX 1JQJC 3HPRA 5EE1A 3THXA 4OYHA 1DAHA 3QKTA 4JJZA 5DN6A 3DO6A 4ARZB 4C0QC 4IDQA 1XCMA 2VO1A 4AURA 2XB4A 3HU1A 2B6HA 5H68A 2ODWA 1RPZA 2ECKA 2KB0A 5FOUA 2F43A 2DHRA 4GI7A 1NRJB 3A8TA 1MOZA 2J5XA 2WJJA 2ODNA 2J87A 3Q72A 4OHZA 5KO2A 1UPTA 4I1OA 2IXFA 3C8UA 4ACAA 5DYGA 1T0JB 1S3GA 1MH1A 2IWRA 1KJWA 2W58A 1CR0A 4DIEA 3QEJA 4QJ3A 1E2PA 1OIXA 3B2EA 1J8YF 4BFTA 4L5BA 4BRUA 1E69A 1E2EA 4C0HA 1COWA 3L82B 3CPEA 3AVTA 1HUQA 2WIAA 5LB2A 4AYTA 1OW3B 1W4CA 4CZ2A 2CK3D 5E7MA 4W9MC 5C4MA 1DOAA 2CJWB 2GJSA 1Q22A 3BORA 4NL4H 3AP2A 4Q4HA 4B3BA 1OYWA 4CIDA 1OV4A 1Z6XA 1Z0IA 3W90A 1WCV1 3EWAA 1W0JA 4TT3A 3TSWA 2FA9A 3THWB 4TL6A 4U00A 2VYFA 1M6NA 3IIKA 3GLIB 3Q7PA 2GZAA 3GEEA 2PMKA 4Q7KA 4DDWA 2QP9X 5ANRB 1T3HA 1G7SA 3NH9A 4M4SA 1G6OA 3HR8A 4DJTA 1Z07A 2VPPA 2RGEA 5FPKA 2CXXA 2V8OA 2GESA 1L2TA 1PVOA 2VLIA 1WF3A 5DNYB 4DLVA 1KDOA 4B6EA 1W4RA 4GZLA 4EPRA 4GDFA 4PAMA 1Z29A 4D4LA 1NN5A 1H8HA 3CH5A 4HLUC 4Q9LA 5AJYA 5FTKA 1TPZA 4WZBE 1SHKA 1DARA 2GF9A 4LCBA 4QHTA 3EZ7A 2N42A 3FDIA 4I4LA 2Q3MA 4EDHA 3I8SA 1E9CA 1TQ2A 1ZBDA 2EU8A 3PEUA 1KTVA 2P65A 2C9YA 2W83A 3KTAA 4QNRA 1AN0A 1U9IC 2ZRLA 5F2EA 1GNRA 1N6RA 1XTJA 3M1IA 3TK1A 2RB4A 5DLQC 3SJBA 3ADKA 4B6FA 1AQYA 1W47A 4IEIA 5KTYA 3FHCB 3H86A 4YMUA 4B2IA 1SVKA 1PUIA 2VH5R 4LJ4A 2C2HA 1E2KA 4URUR 3QF7A 3CPHA 4TZ0A 3QKUA 4M21A 3U60B 4A0RA 5LDDC 5BYJA 1G41A 2ZVQX 2ONJA 5JS8A 1EWQA 5JI2E 4NCNA 1J90A 2VHUA 2ZRJA 3W6NA 4D4MA 4F7WA 5M04A 1S1MA 3GMTA 5EZ6B 4PAOA 5L3SB 4IXNA 1IY2A 1W2HA 4LJ8A 4RD1A 1VYTA 1ZP6A 4E5UA 3A1WA 4DCSA 1NJFA 4JLNA 1S9DA 3EIHA 2WTUA 1F48A 1UKEA 2IEZA 1LB1B 3SQWA 4PO1A 1E9AA 2IC5A 3KKNA 4JLMA 2ORWA 4HLUA 4FWIB 2CMKA 1ZCAA 3LW7A 1T5LA 5DE3A 1Z83A 2XNDD 2QT0A 4M1MA 1RIFA 3I92A 2RAPA 5GVSA 1P6XA 1QHIA 2AWOA 3T5GA 3WRYC 2QGNA 2A78A 3EPJA 1XD8A 1NVWQ 4PQRA 5JEDA 1YQTA 1EK0A 3BRWD 5AJZA 1OB5A 5EXXA 3QIAA 3C41J 3QKRB 5HZKA 4M9QA 4P4UA 4M1TA 5JECA 3OHMA 2X2FA 4QBGB 3UG6A 1OFIA 4TLDA 2FGKA 5EE0A 2QENA 1AIPA 4NH0A 2WOJA 3M6AA 2JATA 3OFNA 4KI0A 4LJAA 3T1TA 1GNPA 3K0CA 4NCJA 4QXAA 2NPIA 3BWDD 3GLGA 3RS7A 4KLNA 1GG2A 1R6BX 4RFSA 4G5SA 4POAA 4HAVA 2XXAB 1VHLA 3NXSA 3B1WA 1JEDA 1VYUA 2ZJ5A 1AA9A 1ZYUA 4C2TA 2R44A 5J4KA 4Q4HB 3TGPA 1IJEA 3CR7A 1H8HD 1WP9A 4CT4B 3SEAA 4RJLA 1D2NA 2W6JD 1XBTA 1ZCBA 3IPXA 1B23P 1FZQA 2YVUA 1N5IA 4IDPA 3SE0A 3DZ8A 3QEOA 1HQYE 1ZD9A 2A2ZA 4G0NA 1CJUC 4XJXA 1G21E 5BW8A 3EPHA 5JJLA 6Q21A 2ZYTX 1FTNA 1X86B 2JAQA 1Q3TA 1LS6A 4UXHA 2IS4A 3BFVA 3R9XA 2VHQA 1N6OA 3K53A 1NBMD 2JLYA 1KO8A 3FHTA 3FWYA 3AUYA 4Y0AA 2FWRA 2WM9B 1UDWA 3RRNA 4LYFA 3GJ5A 1J7KA 2C98A 4R71A 2BBOA 4QKQA 2P6UA 2HYDA 1ELOA 3NDBB 3FFBA 4PPGA 3LFUA 2A5GA 2ZR9A 3TW4A 5LB4A 2RGCA 3TJZA 2X77A 2GETA 2Q0HA 1CKEA 2CBZA 4O0MA 3X1XA 5DH9A 1R4AA 1S1CA 4PO8A 3L8ZA 2EFCB 1VIAA 1EX7A 4L8GA 1E1QD 2WZQA 3VR3A 4PPNA 1HV8A 2XSZD 3PEVA 4WXPA 2QRZA 3REFA 2O8EA 1XDBA 1IXZA 2UKDA 3KFXA 3IGFA 3LLMA 2FPMA 1G20E 2GJKA 1ZIOA 4JVSB 4PC1A 2Q9AA 3P26A 1FP7A 5BN4A 4C0AC 2XZLA 2O8DA 3P1JA 4G5RA 1CJKC 3U5ZB 4LYAA 3KKMA 2H92A 3PVSA 1N6LA 5ELXA 4OQNA 2REXB 2CHVA 2VHJA 3KJIA 5FBVB 4E09A 1YZQA 3GD7A 1R0ZA 4MYHA 3K70D 1KI8A 1NVVR 4Q5IA 3ADCA 1F5NA 4DT1A 4HSEA 2V9PA 1KY3A 4TLCA 2BJWA 3MSXA 1C4OA 2NPFA 3LWNA 2HUPA 2AK2A 3DVLA 4BLOA 3B78A 3CWZA 3KXKA 4CT5A 2NO9A 4KFRA 1P2UA 1CIPA 4Q48A 1NBMA 1G3RA 4UNRA 1DPFA 1BMFA 4Q7JB 4TQ9A 3ZD6A 2B8TA 3AB3A 4KCGA 1G1MA 2G6BA 2ZRAA 5G40A 2A5DA 4Q00A 1TF5A 3KJEA 5FL7D 3I62A 4IW3B 4X8LA 1UJ2A 1R2QA 2PJZA 3GFOA 1F3OA 1KMHA 1KSJA 2JLXA 2I4IA 4BRWA 2VSOA 2F55A 2G1JA 1XPRA 3SJZA 4G5GA 4EUNA 3AF1A 1XMVA 4AC9A 2XNDA 4LJ9A 1SVMA 4LUCA 3U7HB 3G82C 4DDTA 2BM0A 3E2IA 1N5LA 4TLAA 2D3WA 2ZYVX 1OXSC 2ZR7A 2EFHB 4M1YA 5TXGA 4DWJA 2ZREA 3KKPA 2AXPA 4TYNA 2A30A 2JLUA 3QSYA 3EZ6A 3BD9A 4FMBB 1IY1A 2W6JA 1K8RA 2CL0X 2CVHA 2R6CA 5E4FA 3X1YA 4U7DA 3QUSA 1OXUA 2DFTA 4ASUA 4D26A 4TTQA 2AKAB 1RRCA 4HLQB 4HAXA 2QI9C 3LD9A 4A8JA 5FTLA 5AWFC 4JLOA 3IHLA 4MH0R 5CM8B 1NMYA 1TU3A 3T15A 3UMRA 1ZNYA 3GLGB 3D7MA 4B2LA 2IS6A 1T91A 1JAIA 1NN3A 2C96A 1P2SA 4HZUA 2R8RA 1OHHA 4MKGA 3SYNA 1KI7A 2YOGA 3RHFA 3V4RA 1SVOA 2VL7A 2QG6A 4P4TA 2FFQA 4WXRA 5TARA 5TB5A 4F4JA 3QPUA 2D2EA 3WY9A 3FKSA 2XX3A 4HDOB 4RSGA 2O8EB 5JWRA 1RW4A 1KSHA 2G9NA 2J0VA 5AUPB 3AGQA 3TLXA 3WMGA 521PA 2YC2C 2CL6X 3B9QA 1E0KA 1SULA 2OCPA 4PC3A 1CJTC 5E7JA 4BEJA 1P60A 1AGPA 5TVKA 1VG8A 3F8TA 4DKXA 3ADDA 2ZI4A 1SVSA 2QAGC 1HYQA 2FFAA 3AH8A 1BIFA 1HY3A 4M9SA 1YJ5A 2I1QA 3NVAA 3K0FA 8OHMA 4Q01A 4PSKA 5KHOC 2VP5A 2LWIA 1JAHA 5JBQA 3B60A 3T1QA 4HDQB 5BN5A 2WJHA 4NKRA 1MT0A 3LXXA 3CF2A 4JZKA 4OHVA 3CO5A 3PXGA 4DEXA 2CHQA 4DLWA 2XOKA 3P20A 2ZU6A 5AK0A 3T1VA 1FNNA 3PUXA 2OO7A 1KMQA 3WRXC 2WSMA 3H84A 2WAXA 5DO9A 3B1ZA 5HCIA 2UZ3A 4MUAA 5C18A 1XRJA 1G3MA 2W0MA 4QJ5A 2ZROA 2J7PD 2ZJOA 3S1AB 4UNPA 3ZS8A 1U0JA 3AKCA 4R7ZA 1IN5A 3U3RA 2VTKA 1UKVY 2G0TA 1NP6A 3CB4A 3QBTA 2JDID 4QGAA 3BK7A 2ZRPA 1E9RA 4Q4AA 2J46A 1Z47A 5FOTA 2ZAMA 5DI9A 2HV8A 4TMVA 3B6EA 2Z6VA 3PUWA 5BN3A 2WOOA 4KFUA 2W00A 4A36A 1CS4C 2O8FA 1E6CA 1P62B 3TR5A 5HKKA 3D3QA 1II8B 5CITA 2ZUDA 1CXZA 1UKZA 4GOJA 4PQYA 2JLVA 3Q7QA 5JS7A 5JLJA 2HF9A 3KDSE 4GSYA 3X1WA 4ZDKA 5GVRA 1BKDR 2VHCA 3GLFB 5GJBA 2JA1A 3IILA 2FF7A 4XWAA 1W0KA 4IOMA 2NGRA 2NO1A 1NIJA 3L43A 5EXPA 1U2RA 2Z4RA 4GOXA 5K8UA 1OFUX 4EPYA 2OCBA 5AJWA 2G88A 1IN4A 4TQAA 4XWKA 2JLWA 2GF0A 3KB2A 1OXVA 2WAYA 4KBGA 2CCKA 1TF2A 2O8DB 1DAFA 1G5RA 3EA0A 2VP0A 5C4GB 3VR6A 2JLSA 4UXJA 3LLUA 4D2IA 3AUXA 1UADA 4HUQB 3EZFA 3K0AB 2FX3A 5KDOA 4OL0A 4ESHA 2XAUA 4Y0VA 3QKRA 2JJ1D 5G53C 2ZE5A 3R7WA 4A1FA 4CRWB 2NMVA 1F2UB 2R9VA 1K5GA 4HEJA 1FTSA 4HZUB 3IO5A 4DDVA 2QTHA 2IYUA 2VEDA 1IXRC 4DBLC 4EFLA 2CDNA 3AQ4A 2YWGA 2O8CB 2ZSFA 3LY5A 2VP2A 5BYKA 4F92B 1KO1A 2ZAOA 3B5JA 1U81A 1GITA 1XP8A 4PZYA 1YR9A 1Z0DA 3RS4A 5HTKA 3K09C 3Q5EA 3QKSB 4XVQA 5FUWA 3DMDA 3R8CA 3DMNA 1TF7A 5KNCA 2A5JA 3BS4A 3QG1A 1KI4A 1E2LA 4OI1A 2PEZA 4RY2A 1WXQA 3DEFA 1HT1E 1D2EA 1AGRA 1ZM4A 1HE1C 1AKEA 1TNDA 1W44A 3BJIC 1E98A 4LY6A 4TZ6A 4TLBA 1DG1G 5J40A 1GL6A 3VQTA 2QQEA 2GXAA 3DM5A 3ICQB 2D7DA 2FPLA 4XSGA 4AKEA 2OM2A 1QBKC 3GLGE 2QN6A 2Z4SA 1FQKA 2NIPA 1B0UA 1S96A 3OE7A 3V00A 3CW2A 3E1SA 4AK9A 3ZLJA 5EE3A 2WWYA 2ZRFA 1A2KC 3GJ8A 1AJEA 4Q02A 4DZZA 4A0HA 1GKYA 4ARZA 4ZPXA 4RCYA 3D31A 3PUZA 4LPKA 4TYQA 2BKUA 3VR1A 5TY0A 5HZHA 3SS8A 4TSFA 1GSIA 2DFNA 4YDSA 3VNVA 4GMDA 1KO7A 1RYFA 4QBIA 2LCFA 5BWMA 3PIRA 1N5KA 3HWSA 3MMPA 4QHYA 2PL3A 4B34A 1IN6A 1S9HA 1GVNB 4D4KA 4D0LB 2J7PA 3W3AA 5F98A 2J7KA 2J0UB 4PFSA 3PG5A 1IY0A 1YE8A 4IRUB 4JT4A 3P32A 1GTVA 5CJPA 4KODA 2IBMA 4DC9A 5K8IA 3M4YA 4PSAA 2X2EA 4GPTA 2NZJA 3HYTA 2Q9BA 2IYYA 4PC7A 4BPBA 1GFIA 3ZS9A 4K46A 1E1RD 3OESA 4HDCA 1U90A 3NC0C 4ON9A 5CB8A 2HF8A 1FMJA 1W36B 1KSGA 3A1VA 5JWHA 5JRZA 2QM8A 5SZIA 4BLRA 3K09A 4N0DA 4FWTA 2O8FB 3QPWA 4N1AA 4XTRA 2PZFA 1F6BA 4OJQA 4MA4A 4YMTA 1XPOA 4EJSB 4HAWA 4LV5B 4KHZA 3F3YA 4JKIA 4D0GA 4D25A 2F6RA 2VHTA 2KSQA 1HTWA 4TWZA 4MQBA 3EG5A 5AJXA 5BQ5A 4B35A 5JZVA 4QHSA 1IN7A 1P75A 1NL3A 5JHGB 3MFYA 1V5WA 1LTQA 1E96A 3I32A 4KBFA 3HU3A 3UIEA 5KNBA 3VKGA 2ZRMA 2YC4C 1M7BA 2EWWA 1XWIA 4FMDF 3WYFA 5HR5A 4NMMA 1UEJA 3DKPA 3EX7C 3R7WB 1II8A 3JZMA 1G8GA 2YOFA 3TVTA 4ZDJA 2H1LA 2NG1A 3RC8A 5IDVA 2AXNA 4MRNA 4NYIQ 3REGA 1DS6A 3GCGA 4Q9KA 5FR2A 3RVBA 2QA5A 4XVRA 2RGAA 3TBKA 3UWKA 4EJSC 3TIFA 3GLHE 2O8CA 4NYJR 1D6JA 3DL0A 1XXHB 2GEDA 3CLVA 4ZCMA 2IYVA 1TQDA 2ZETA 4XD7D 3WXMA 1WRBA 1DO0A 2ZSAA 2O0HA 1CTQA 3BXZA 2F9LA 1CRQA 4NCHA 2EWVA 4HB4A 2EYQA 5H70A 4YMVA 4KXFB 1XX6A 4ZI3A 1KJZA 2QE7A 1W5SA 2W6IA 3ZGXA 4CDGA 4CEJB 4B75A 2D7CA 2CEAA 1OFTA 1NJGA 4W5JA 4ABYA 2P5TB 2ZSBA 3KQLA 3KQHA 1A1VA 1E2QA 3GJXC 2C9CA 3GJ7A 4TL8A 4OBEA 3U3OA 3UATA 3VKWA 5L3SA 1PJRA 4N0EA 1N6PA 3WNDA 3DOEA 1ZIPA 4XD7A 4R9UC 5FUXA 1L4YA 3U7FB 3UPUA 1YHNA 2BMDA 3QY0A 4PZZA 3GLIA 1OXXK 4JBXA 4H1VA 1VCMA 3BFXA 3K0EA 4V0NA 4PQFA 2ASEA 2A5FA 3RSLA 4C3ZA 1Q1ZA 2GNOA 4Q4LA 1Z0AA 4QGHA 2YOHA 3UMSA 4B44A 2A7QA 1RKBA 1ZJ6A 4OI0A 1N25A 4AKGA 2EQBA 2C99A 3AVOA 4DLRA 4D81A 4A9AA 1TQ6A 2IUUA 1XEXB 1Z6AA 2JJ2D 4B47A 1P7CA 3CX6A 1KI9A 2ZJYA 3B1XA 3NBXX 1PZNA 5KSPA 1XTRA 1MO6A 4GL2A 1KDTA 4XVUA 2CK3A 4F4IA 2Z0MA 1US8B 2ATXA 2EVWX 1Z63A 1OYYA 3CZQA 4DB4A 2P3SA 5A5GA 1YZLA 1E94E 4YLGA 2F43B 4L16A 5FOVA 4EFMA 5HKKD 1DTSA 5K8TA 3KJGA 4E03A 1OIVA 3NH6A 1VCNA 3GPLA 3A1TA 4P4SA 1FFHA 1MR3F 1WB9A 1P4SA 1YR6A 1V43A 4D80A 1WDTA 4M1OA 4GMXA 2YWHA 4JLDA 4EPVA 2F3TA 1X8JA 2MSCB 1BH2A 3IEUA 3T12A 3TH5A 1E2GA 2QT1A 2Z83A 2WV9A 1M7GA 5DI3B 1MRNA 4WZAE 1UBGA 2FNAA 1E0AA 5JJIA 3OIVA 4AY2A 2ODBA 1VCOA 3CNOA 1QHGA 1VKJA 1J99A 4O3MA 2GVZC 1JPJA 3RS3A 2R6FA 4Q1CA 1A82A 1E2JA 1KYIA 1T8UA 1HURA 2ZJBA 4LX0A 1CJMA 2OFOA 3HR7A 4C9BA 4CEJA 3FGNA 5J5CA 1A7JA 3EAQA 2XXAA 4BECA 1YZKA 3VAAA 2H17A 1UM8A 5LPNA 3AGPA 4JVNA 2GTPA 1R5OA 1JPNA 2RGNA 3I72A 1E79D 2QBYB 4V03A 2OEPA 1L4UA 1UBEA 2QMEA 1NMXA 4LI0A 3CM0A 2PJRA 2BHRA 2IW3A 2OBNA 3TW8B 3FHOA 4U02A 1KO5A 4HI0E 4IEEA 4F91B 1E1RA 5FH9A 2O52A 4DLUA 1ZD1A 3SJAA 4AD8A 5CLLA 3UXMA 1EX6A 1Z2AA 3N5CA 3KXIA 2W2VA 4RFVA 3QF4A 2RKOA 1NVXQ 4BFXA 2QAJA 2QTFA 2ZE7A 3ETLA 4URWR 1ZC4A 1K5DA 2IXGA 2ORIA 4UJ3A 3SN6A 4AI6A 5L8VA 1GWNA 4DSUA 1MABA 1AK2A 1NY6A 3CUEF 5GJVC 2RGDA 2TMKA 2WWHA 4JJKA 5FPYA 4A82A 3AVVA 1HEIA 4OK5A 5EUQB
chains in the Genus database with same CATH superfamily
2VH1A 4L7VA 2XKBA 3M1YA 4FYYA 1YVRA 4FKZA 5CVVA 5GADl 3UKOA 4MP3A 3ESXA 3LVFO 3FSGA 3GLHB 4LZOA 4UTPA 3IB3A 4IO0A 2IK8A 1TM7E 1HE3A 3O74A 5E6SA 4P2GA 5A0VA 3FI0A 1Y7TA 2YXBA 2H00A 3JZAA 1Q74A 4IZOA 5KNDH 5JNTA 4LIPD 1OIWA 1NY5A 1ZH2A 4ZODA 3KQWA 4GMGA 5HPYB 5DYWA 3I1JA 3JPWA 3QXGA 3UKDA 1ZI9A 4AUNA 4ECEA 2C94A 1U9IA 2OCGA 4G84A 3RB8A 8MHTA 4HH3C 4Q37A 2JGKA 1DQNA 2BIFA 1E1DA 1KVSA 4DLLA 4NMHA 4DQ0A 1AK1A 4OVKA 4DRYA 1SUWA 5KJEA 3LECA 3ZWMA 1HZZC 4EJMA 1N6HA 5KHAA 3COSA 1RLMA 2JPDA 1REQA 2FPUA 1DIAA 1J1IA 2GNAA 2CNDA 2GVNA 3JARB 4G1VA 3DL2A 3I61A 3UVEA 4Q9NA 3NHZA 1PS9A 4XYEA 1K8XB 1S0UA 1DAGA 2FG5A 5B58C 4RX1A 4M0LA 5BNFA 1XQ1A 1HORA 2FFHA 2AFIE 3NPAA 1XRSB 4GWKA 3DOCA 1TK2A 4QU5A 5G3ZA 4Y2TA 1G7CA 5LBUA 3ZKWA 5C51B 2OL4A 1H2BA 4R7GA 3AJDA 3RCBA 1Q11A 3AX6A 3CLTD 4KQWA 5CT4A 5E7IA 1IWOA 4R0VA 2B82A 3VI4B 2QK4A 2M6RA 5FBRB 3D3EA 2ZZNA 1AUQA 2O59A 1E6KA 3VHLB 4EO7A 1PK7A 5A2GA 4M8NE 1JF8A 3U6BA 2IEAA 4EYSA 1R0XA 4L8FA 1LVUA 4RJTA 3MUEA 2G71A 1KZ4A 4W9NA 2WMNB 4JKYA 3E03A 4D56A 3RNLA 4IQ0A 1RCUA 3FOBA 4X1KB 4E1BA 2G1PA 4JI2B 3VR5D 3GJQA 2ZP1A 4R40A 4FDUA 5LJLA 1KKMA 2H2AA 2OORC 2MSEB 1F8UA 3CUVA 2GGSA 4YWHA 4BKPA 2FRXA 3D54D 2XDYA 3M70A 1MJGM 3ZV7A 3MF4A 3MT7A 1DJQA 4IMRA 3BRSA 4X7PA 1T10A 5A4AA 2VF5X 3PK0A 1QVVA 3EXG2 4XLTA 3TAUA 1QG0A 1D7AA 3MJCA 3S8YA 2PT5A 3A2MA 1YS9A 3PQ2A 4UHEA 2CD7A 3RYCB 3DFMA 5LBIA 1O5IA 1XYYA 3H3JA 2ZATA 3Q3HA 3P9CA 3OUTA 2XGJA 4DQKA 3W7BA 3Q3EA 3SMVA 1DQPA 1SZJG 3OM9A 3BIWA 4CNQA 1EZ1A 1VKHA 4W82A 5JU6A 4Q82A 1JX6A 5F1YA 4JC5A 4ZJUA 2NU6B 4YJ3B 1DCKA 5TVGA 1AO3A 2X86A 1OAKA 3L5OA 2LP4Y 3IODA 2H52A 1BKYA 3AHCA 4WD3A 3CJTA 2V7PA 5AKHA 5H3CA 3JSXA 4JBWA 3W6UA 1H1DA 1SGWA 3EQ2A 1QQ7A 3G7SA 1ORHA 2H1VA 1JQBA 3QFTA 1BHJA 3GUZA 4ZVKA 4BDTA 1AQJA 3OEEA 5G1PA 4M38A 3I09A 4X54A 3LK6A 3RLFA 3STHA 2ZT8A 4REQB 3E48A 3G9UA 2XW6A 3TN7A 2CVQA 2V74B 3FVRA 3UT0A 1TQ8A 4ZGBA 3ROTA 5HIMA 1N9GA 3O4IA 5EL0A 4DV7B 4WBSA 3AHIA 1A4RA 4BASA 3NM6B 4BNUA 4CMEC 4QPZA 3S1SA 1CUXA 1SVNA 2AD5A 1Z34A 1OTXA 2WE7A 1GRNA 2P7IA 4FGZA 1OH5A 1KWKA 2DUMA 3MWKA 8ABPA 1XPJA 2JHGA 5KX5A 4MYTA 4EO9A 5KDLA 5TV2A 2VJMB 3CRMA 5TR9A 3U9SA 4E3ZA 5DBIA 3ER9A 1NVEA 3DMRA 3OT5A 1NXOA 1NUUA 3HADA 4KQXA 1Z73A 1FU4A 1TM1E 5EI5A 3WL3A 4ZJZA 1EDOA 4DZRA 1IMJA 2J4FA 3U56A 1R88A 1N6KA 3MS7A 3F6RA 4LJRA 5HUHA 2XMRA 1KXJA 3HC7A 2XT9A 5E1OA 1OH8A 1PLJA 4G1CA 2HJWA 3GROA 1MIHA 3LDAA 1DDOA 2R68A 1X0XA 5T3YA 3TTVA 1VBFA 4UEQA 3TUJC 1EH5A 4KLZA 4YT8A 4YQEA 3DBOB 3HVIA 3B7GA 2XYRA 1LBHA 4TMYA 3C1AA 3RK4A 1KAEA 5KS2A 1YE5A 3B13B 3CLTC 2AZMA 3WYGA 4EZIA 3B9RA 3T06B 3X43A 3IUPA 4AJHA 1GEGA 3ADOA 4LNAA 2VNIA 3GC6A 1JR6A 2ZBUA 4FJ1A 4BEVA 3ELDA 3ICWA 4QRHA 5K20A 3P0FA 2UUAB 2BJVA 3H18A 3WBFA 2F62A 1SU4A 2P9BA 3MYRA 3AONB 2MYUA 1T6NA 4HK4A 4RZIA 1OH7A 1E4YA 3G02A 3D7LA 2J3JA 4F2HA 2RHHA 4YJGA 1IEWA 5DB4A 3DHWC 4M83A 4BNXA 4DA9A 5BQOA 5JPDA 5C9ZA 5CB6A 4Z53A 1RKVA 4IDBA 1Z7EA 1EI9A 1QFMA 1UZUA 5DGIA 3DKKA 3PQ5A 1JBKA 3ABSB 1UDXA 3BMQA 3O92A 5JDCC 4EENA 1CETA 3BYZA 4G56A 2WJAA 1ESEA 3G9XA 1BJTA 2AEEA 3KUKA 1I51A 1PBNA 1ZWLA 3MPUA 4KJZA 4RL6A 1KQFA 4BDSA 2HT1A 3MS4A 2NADA 2NU9A 3I83A 5CPFA 4FEGA 4LK3A 5F9FA 1S2DA 2O0JA 5ALGA 4DYDA 1JKJB 5KYYA 1D2AA 1E2IA 3BXPA 1KWGA 1UMKA 2WKPA 2GAAA 4U1RA 4IJVA 4QUGA 3RT1A 4BNWA 3K9GA 4XFDA 2QW1A 3BDAA 3NTVA 3T94A 4C87A 1AM4D 3C5HA 1JEYB 3LV8A 4HNQA 2Z43A 5AW6A 5IT4A 5K3OA 2QD3A 4O2BB 3PNBA 1CCWA 4ECAA 3NG1A 5AM4A 1Y7IA 4KVAA 1SQ5A 4IFIA 3NBKA 1H93A 3INRA 2H06A 1G16A 2ZUBA 4RK4A 3T5DA 2GN0A 2PBLA 2BBSA 2ZSDA 2PLAA 1JILA 2P9QA 4XQCA 4I3HA 3W5VA 1QIKA 1V3QE 3SJCA 4RK7A 1H1LA 1S8OA 5BVHB 4RFSB 5EKUA 4QDTA 2P9FA 3R0IA 4KNVA 4RV5A 4JI0B 2A57A 5DGCA 1GAJA 1RBQA 1TEVA 4JB2A 1SOMA 2Y1GA 4KVGA 3T1OA 3W8DA 4PC6A 3ROEA 2PRJA 3D59A 1UBCA 3EFHA 3KX2A 1NNSA 1XAGA 2BHTA 5SZKB 3RYIB 2P2YA 5E6UB 3ZW7A 1E4VA 1XMOB 1M1YB 1M2EA 2ID9A 1JEAA 2AS0A 2CYAA 5T6MA 1AKWA 5EZQA 2IF2A 3QX9A 4JUCA 1RBZA 2HHAA 3UUEA 1U7UA 3G9ZA 3R9IA 3TFWA 4A6XA 2XRZA 1MO4A 5LIPA 2FSPA 2PL1A 2HYIC 2V1XA 3BB1A 3QLUA 4HRAA 1IG0A 2QRMA 5E2BA 2LCQA 2IU0A 2YKGA 1SCAA 5B30A 1FFSA 4Q0MA 4NAHA 3MQ4A 3F0TA 4OXXA 4BWYA 2FPRA 4HHEA 3FGZA 4JV5B 4FYHA 3MFQA 4NPAA 5AQEA 1U2QA 4EFDA 4YXFA 5F5LA 2IYOA 1HF3A 4HDSB 1FLAA 2CXPA 1YZUA 1UQUA 2H5EA 5FPPA 2BC9A 4S35A 1AF7A 3A9WA 4Y1FA 4BLUA 2YNMD 5A7FA 4HYTA 4KPUA 5HS6A 1GDTA 4Q3LA 1NN0A 1PD1A 3FLEA 1CEEA 2YVKA 1T25A 2O5EA 1MNAA 1ULZA 3ACCA 2G04A 2QRGA 2BEWA 3P9SA 1W5TA 3PDWA 2I9KA 1Y3DE 3E3AA 1W88B 4LX8A 3WK5A 1TM2A 3V1TC 3W78A 3TZLA 3F4LA 2GYWA 1UWVA 3HUTA 3EEOA 2QTCA 1R6UA 3TOZA 3HSKA 1T0PA 3UMFA 4JBNA 5FI1B 4KFTA 1ZO8A 2CB9A 4R69A 4ILKA 2ZBFA 3LVBA 4JLSA 3GARA 4QOSA 1DXHA 2V4UA 3UY4A 3VOSA 3FOZA 1SXQA 2NZ2A 5JAUA 3UTDA 3LT1A 1FXWF 3LX8A 1Y4AE 4AY3A 4BATA 2CUKA 3I6QA 3F5MA 5IJWA 5CBPB 2WWRA 2CJYA 4BX0A 1O5TA 2BV3A 1RU3A 2IHBA 3TTXA 3VPGA 1W35A 2P27A 1IQ0A 3OZRA 4MJLA 2I8AA 3GR6A 5SYMA 1Z2PX 3C15C 2IYWA 2JFVA 3GVPA 3IJ5A 4MQLA 1Q50A 1I4TD 2Y8EA 2ZRBA 3ROKA 3QE9Y 3H1BA 4YJDA 2QRVB 2PX3A 4XOIA 2Y0CA 2HBRA 1EGMB 4BZZA 2XE4A 2RBEA 5IVIA 4XWOA 4CNBA 2G63A 1Q7CA 3N9IA 1UXJA 1F0YA 1FXWA 1JAZA 1SQ0A 2IY7A 3PHCA 1G7RA 4R4JA 4FQ5A 5CAEA 5AW1A 3FDZA 5AK5A 4KDEA 3VSBA 2YZGA 2WJ6A 5GOTA 4PE5B 4NC9A 1Y1TA 2GS9A 4BC0A 1F6WA 1T34A 3FPGA 4V0MA 1COWD 5EXSA 3V7NA 3NYRA 4HWPA 4UCWA 4BX9A 1GGEA 1GQQA 1ZRHA 4DEVA 4CIWA 5FBWB 4QYTA 2FPGA 3MJEA 4HRVA 3EC2A 4EJSA 3MCZA 3N2EA 4JYCA 4LY3A 4PRYA 1XTPA 1L7BA 2QRNA 4G26A 4UZFA 4KR2A 2A0FA 3NB0A 4EY3A 4XVHA 2HF2A 1C4KA 3A4LA 2IZOA 1U7HA 1IY8A 3AUTA 1TEZA 3PC6A 1XEFA 2W4IA 3BK1A 2QUBA 2HREA 2HCFA 2WILA 1EJ2A 3F74A 3DZCA 1RYYA 2GHQA 2Q8NA 3TM4A 1OX6A 2CD9A 1RADA 3AF2A 4DA6A 1AY0A 2V45A 3AFGA 4RIEA 1RQGA 3WAKA 3QEBZ 2EV9A 4OHKA 3ZIDA 3ANLA 4JEMA 1Z2OX 4LEIA 5J2TA 2ZI5A 3BD6A 1U8AA 2Q3HA 3Q0IA 1A4UA 5D5QA 1CJBA 1T2UA 3F49S 4I4TB 3CW9A 5DRTA 4CBVA 3I2HA 4FIDA 4KX3A 4WECA 2I6SA 5AK6A 5K6RA 1HE8B 2XT6A 4FB4A 5DNEA 1QQAA 1BMDA 2YYYA 1P2GA 1P0IA 2J32A 2XAAA 4H3HB 4IYJA 4WK0B 2PPVA 4XTCS 3ZU5A 2C7PA 2DBYA 4H6XA 5AKYA 2CVFA 1EFUA 3UB3A 4RBNA 4TLMB 4EAQA 4OSPA 1F0PA 3KEQA 5C1IA 1C9DB 1QHNA 1VRCA 4K9LA 4Q39A 2I6QA 4F5ZA 4TUYF 3ZIAD 4BZPA 1WIWA 3L4BA 4UAJA 1AQUA 5KYWB 4IJKA 4R0MA 2Y27A 2YJTD 2OHXA 2GYUA 4GICA 4R1LA 3O95A 5E95A 3PE3A 3IOEA 1F60A 4Z9BA 3HCEA 4F0JA 4L4RA 1A9PA 3T3IA 5A6SB 2G36A 2ZCVA 3TO5A 5CBKA 4OHYA 1QANA 4MR9A 6CHYA 3UBTA 1KAQA 5CVJA 3IKVA 2PAAA 1PX2A 5G0WA 4E5YA 4ER0A 5KCZA 2C5GA 4I7EA 4J0FA 4DCCA 5D7BA 3L7YA 2WHPB 4ED9A 4RKFA 5AW9A 1C9JA 1A97A 2XNCA 2GEFA 4DUGD 1OX4A 1L5SA 3Q41A 1HNNA 2AOUA 2OSBA 3RRXA 2ZAYA 3DE6X 3FR8A 4L9AA 4QDUA 4F3KA 2K7ZA 3VDQA 4BBAA 1JHMA 2UYHA 3N2GA 1XQXA 4QOEA 1Q44A 2V6FA 4ZJPA 3PEWA 1TC1A 1PJZA 3D4NA 5CFZA 4BFSA 3VV2A 5AVJA 1E2BA 5CB4B 2VCYA 3CPJB 3CVOA 5EZYF 4JR0A 4LHXA 3ZVMA 4I5EA 5FKJA 1CY1A 4H1TA 2DPXA 2Q2WA 1SHJA 3O0TA 1YQQA 3L0OA 3NW9A 3R5JA 4QDKA 1SVLA 1FJXA 1S6YA 8ATCA 1WPGA 3NBAA 4Q18A 4WY8A 3E9NA 5AHXA 5K01A 2HC9A 4YRFA 3B6ZA 1GKUB 2JEOA 2PH7A 3EXAA 4FYWA 4KQHA 5I9TA 4BEWA 3DE4X 5CDGA 5SY4A 4PPYA 1BX0A 3R3YA 2VUIB 3SOPA 4XDGA 3L0SA 5HKOA 1QU3A 3CUWA 2C5AA 3UK2A 1E0DA 1XTQA 1B41A 4O2RA 4ZGGA 1XMQB 2LCIA 3P4XA 4Q1BA 5B7QA 4U8HA 4PG8A 1BCRB 2FV8A 2GPNA 3ECCA 1CLEA 5I7EA 3ORSA 1EBBA 4MQFB 3WADA 3PXBA 4W7SA 5EJ9A 4DSNA 3LBNA 2Q5EA 2J67A 3IP8A 3KJZA 4LJ5A 3ZH2A 3ZHBA 4BJ6A 1NVGA 3G3EA 4FN4A 4O25A 2HIMA 4ZI5A 1JIKA 2WG1A 4HPWA 2PVSA 5FTNA 5H81A 1VGVA 2VJCA 1GKIA 3JASB 1JKMA 1O9BA 3KUCA 4N7BA 1QGYA 1HQDA 3OT4A 1N7GA 4I5GA 1J8MF 4F8YA 2CV1A 3KKKA 3VC7A 1EUQA 3CMMA 1P2TA 1XROA 5KOYA 4IVPA 5MHTA 3EVEA 2VAPA 1PZEA 4Q1FA 1SBCA 3ZEAA 3D43A 3I73A 4Y6OA 3H1AA 3O3NB 3LC7O 1A4IA 1Z06A 4MV1A 5LLSA 3EZXA 1MU0A 4B1FA 1QHHB 3ET5A 2A1UA 3LNTA 4CMIB 1RLJA 3W2TA 3H4IA 2XKKA 1YVUA 3KAPA 2DULA 3D3WB 1RJ9A 3AUAA 1RABA 4S1WA 4L74A 2V9ZA 4V39A 2O2YA 1NWCA 3L79A 4ZT4A 3AHJA 3ZBUA 1FIUA 2O3SA 2ZFUA 1QCCA 2ZVJA 4RCZA 1ZA2A 3HUDA 3A28A 4HGOA 4R81A 5I4IA 1LBQA 4HBZA 3L8CA 3WGOA 4CF5A 8LDHA 1YOVA 1TAGA 4IJMA 4D41A 3QFRA 1A98A 2XLBA 2ZIUB 3EVFA 1ISPA 3OZBA 1JDZA 1CUAA 1V6CA 1VE5A 1DUVG 2CNOA 4JIGA 3VVCA 1GFWA 1M1NA 2EW2A 5CLJA 1KQOA 1HR0B 4NXNB 1BJRE 1IULA 2Q2NA 4CMAA 4B74A 4JXXA 1E2NA 2YNMA 3KNZA 3K3PA 3T1NA 3OWHA 2I7TA 3DVAB 3AVWA 4G5OA 3TNJA 4O4IB 2TRSB 4EF4A 3C8ZA 2OFFA 3T95A 4J7UA 3K2EA 5FL3A 1XYVA 5JC8A 4CF3A 1CIJA 2EYUA 2JGFA 1RVDA 3CRRA 4S24A 3VZPA 2CXOA 3DTNA 5CVDA 1TGYA 4R05A 5H0IA 3TXAA 1ZJ4A 5A2QA 4YAUA 4WGFA 2I1VB 4B7UA 1QF9A 4LV8B 2IXTA 2W90A 3WB9A 3IX7A 1FPQA 3HN2A 4UCXA 3B52X 3WL8A 4AZWA 1E1LA 3LT4A 2AYXA 2OOSA 4K81B 2XJ9A 3LT5A 1K86A 1ZOOA 2COEA 3OF5A 4M8KA 1FNMA 4JYBA 1GPMA 2Q07A 3SCZA 4I3FA 4DV5B 1D2CA 4QZVA 3E27A 5IJXA 3UAOA 4IV0A 1Y98A 3A36A 3C1UA 4NBKA 3SM3A 2PY6A 1XZIA 1JDBB 1NW8A 1ZVQA 4G25A 2OAQ1 2Q46A 2VNJA 4CYMA 4JIMA 4DUGA 2UU9B 1NUTA 1XN4A 4GZ3A 1XMSA 4AL4A 3DMTC 3UN1A 2BTOA 2XCUA 4PLGA 3FDJA 4DCNA 4NYJQ 3EPPA 4B3TB 1MC1A 4GQBA 5IXYA 4Y9RA 5KYXB 1H2XA 1T9HA 4XLZA 8AT1A 3JS5A 4DR5B 4X65B 2CWWA 4K9QA 4JYPA 4H18A 4QVKA 1ZU5A 2A67A 4FILA 4YCBA 1M0EA 1VFPA 4HTFB 1N8TA 2NO6A 1BYUA 3C3JA 4WW0A 3ENVA 5K05A 3KB1A 3RVPA 3NTUA 3SU8A 2QIOA 3DNPA 2GTHA 2IYXA 4WH0A 2IL1A 5FI0B 5DTEA 1C7RA 4LZLA 4NNPA 5I8PA 5JY1A 4FQ7A 5BN4B 2O50A 2VXOA 2ZWOA 1FMLA 1M34B 3OEYA 2IUEA 2PUBA 1U5BB 1ZL0A 2JZNA 2VYND 1Y5LA 1EQUA 1T5OA 2GHRA 1FQWA 4M6WB 2JAUA 4ZKEA 2DKFA 3RO7A 1JVNA 2R7MA 4CIBA 1NDQA 2YH2A 1QZUA 4S1PA 4Z51A 4ER3A 4N40A 4R2JA 5CURA 3CH6A 4ZHSA 2CYCA 1T0HB 2P6NA 3HO6A 1JVBA 2BUBA 2DHQA 3PD7A 1WDKA 4FYMA 4JHXA 4PVDA 4UUQA 4K9DA 5EA2A 1HM5A 2MWMA 2O2DA 3GVHA 3VDXA 1K6MA 4DMUB 1E3TA 4F9GA 1AHNA 2BFFA 1EGHA 3EDRA 3EXG1 4Y9DA 5CUQA 5ICSA 2BEUA 3ASVA 5IM4F 2EZTA 3TE7A 3AR3A 4RVUA 3WLKX 1C9MA 3W7VA 1NXWA 3PIDA 4R6XA 2D74A 2C5HA 4KE7A 5CJ2A 5KAPA 4CCSA 3G88A 2IBSA 2PGAA 3KLOA 2DWQA 4WLFA 2D3TA 1LF5A 3MWYW 3PD0A 2ZBQA 3QEKA 4MUIA 2M1XA 2YXEA 4B09A 2HWWA 1KSFX 3ESZA 1NLMA 5F3WB 4JXZA 3E9MA 4QBTA 3A9TA 5IARA 4D42A 4GX2A 4D96A 1Q7BA 4YUXA 4QG7A 1XPUA 2MSDB 5JQGA 3SE7A 1GL9B 1MCZA 3EZGA 5JS7A 4QRIA 4W1QA 5FWXB 2BTEA 1P9OA 2WJIA 1EG2A 4UDXX 3DF9A 2PG3A 4Y7CA 5KSZA 1W4BA 5U4XA 2FZGA 3RE1A 4P53A 5CA0F 5K0ZA 3NANA 4IHAA 2FX5A 1CRZA 1THGA 3OECA 4NZMA 4RACA 1OFUA 2CY0A 4NCXA 1ODCA 2GWHA 4YCDA 4DG9A 5JFGA 3DEKA 4YAWA 3OOEA 4Z5XA 3C4VA 5CFLA 5JDIA 2QRPA 2HX1A 2H65A 2VF7A 5L6MB 4OHWA 5B3KA 3QIVA 4MGEA 3PGKA 1M34E 4IJUA 2X9NA 4RKWA 2ZSEA 1V1RA 1DBQA 1ZGJA 1V5GA 1NXSA 2TMYA 5JSYA 2WBLC 1JAXA 4WJZA 4RQAA 1YFZA 2PUCA 4OO3A 4RZUA 4B3GA 2ZRDA 5CDUA 4L07A 4FLFA 3IEKA 4UVIA 3TBHA 4B6OA 5AKEA 3LNCA 4H35A 4JLWA 4C4RA 5ES4B 4EG7A 2REBA 4DUZB 2AJ8A 3PDHA 5C3MA 3N74A 3B85A 3HJBA 4IGKA 4ENQA 1BX1A 1Y4ZA 1QVRA 1A9YA 1U3DA 2NTYC 3EIXA 3QPVA 2POQX 1GRRA 2JIZD 4TM8A 3OU2A 3EPKA 1GL7A 3KTAB 2DHEA 4UPDA 3WYDA 3JX9A 2R2GA 4OXRA 1N1GA 2PUWA 5EHXA 3SYKA 5ADHA 2QRLA 3HFSA 3OKPA 1WNTA 1VPDA 1PEYA 3QG5A 2D1TA 4TKLA 2Q3FA 1G8JA 2BMFA 2FOXA 3FI9A 2XF8A 2IS1A 4CTJA 2PHZA 2HHLA 2XQIA 1G5PA 4LZNA 4B46A 1CRPA 2FMHA 4HADA 1FPMA 4D9EA 1VG1A 1IAVA 2PKYX 2PL5A 3FIUA 1CDOA 3JVDA 5LZ5A 5CDFA 5G0VA 1QC5A 2P35A 2YICA 6GPBA 4ZAZA 2XDAA 3C7KA 4YUWA 1W48A 3GQBB 4HYYA 1VBMA 2OWDA 1C9KA 2R2AA 4PLWA 3PGMA 1ANKA 1R0RE 1GLVA 1KZ1A 1VMAA 2QQFA 2RH9B 2VJQA 3GT3A 4U9HS 5GINE 1G60A 5JPIA 3WA6A 5LQRA 2C4NA 2N3ZA 3STXA 2FN9A 4L50A 4IRXA 1V9SA 3NDJA 4LBZA 4BNDB 4QE3A 3MHPA 1U0NA 4DABA 4GGOA 4FN5A 3INGA 1EXMA 2AMFA 3HSYA 3ZHTA 1P8JA 1WKVA 3T61A 4J75A 5BOVA 4YJ3A 1ZONA 3AUKA 3SLKA 1RJEA 1CU1A 5IF3A 1T9GS 2G5GX 3KVVA 3I3SR 2LKDA 3PYMA 4QFMA 4AJ2A 4GOMD 2NSLA 4PTZA 3QVWA 5KDDA 4A8JB 3HB4X 2PH1A 1LTHR 3EXEA 1L5LA 3AK4A 3WLFA 1T9BA 2ZW9A 2IUTA 3BILA 4PX2A 3JALA 4HEA1 5KTOA 5JY6A 1YAHA 2Q5QA 3PPVA 3H9JA 4BQIA 1BMFD 3H1TA 1PHRA 2J41A 4UUOA 4DJEC 2PKRA 3O4VA 1K75A 2JEZA 3PFIA 5A04A 1R0WA 4IV5A 5HE9A 4BLTA 1IM5A 1I4DD 3U44B 4BO4A 2GJ4A 1OT3A 3AHFA 1T1EA 3DUFA 2PX0A 3F78A 1FSPA 4GRAA 1QE3A 1RWXA 4HN9A 4U0KA 4V0OA 2JFWA 3L4KA 1QV7A 2W22A 1YKFA 4JL5A 1U9ZA 2IUSA 1GGNA 2LIVA 4YAIA 1ULHA 1A7AA 2RHLA 3C98A 1D5CA 3ABOB 1ITZA 1KK1A 1QSGA 1WUHS 2QE7D 1N9GB 1RC8A 1OXBB 1Z5ZA 4YAFA 4ETIA 3S2YA 4V0ME 4YRCA 3THXB 1D9XA 2BMEA 1IZ7A 2O6HA 4PGGA 3ONNA 1P0QA 4ONEA 3EQ7A 4B3DA 3VH4A 1EAMA 1RI2A 2OAGA 2OZLB 3C6MA 3DDSA 4MW2A 1FNDA 3WGQA 3ZCRA 1F2TB 2M1ZA 3IAXA 4EHKA 1MV5A 2K4MA 3UG7A 1C7FA 3RT9A 5A3RA 2DEUA 2PYDA 4PYOA 4FBLA 1CF4A 4R8SA 4NS4A 1M2VB 1S3FA 3UM9A 2YWEA 3VNQA 4B6PA 1O7JA 7AT1A 4X7BA 2J3QA 3T4EA 4AMBA 4JR2A 3R7BA 4YRSA 5IC4A 3T9AA 1DUIA 3K9HA 2QX8A 2CYBA 3I23A 1JA0A 3VRHA 3ESAA 1OGJA 1PT5A 3ILVA 3SICE 3FZQA 1NNI1 5DW3A 3QMPA 5JVDB 1UFKA 2QPAA 3VYTB 4TMXA 4IJWA 4RZXA 3INNA 2XUOA 4AP9A 2ADMA 1H1TA 1PNTA 5D86A 3TQSA 3P5SA 1BTOA 2VSQA 1LUAA 5LKAA 3K6RA 1OGYA 3BZWA 2ZI7A 4CQJA 1FOEB 4YV0A 5ELLA 4GLBA 2W8BB 3RVKA 2KBEA 3O73A 3TLBA 3TZKA 2PUAA 3MRXA 2OE2A 3BWXA 2RGNC 1V4NA 3EASA 1N2CB 3GT0A 4WZAB 5B2ZA 1KJ8A 2OB1A 3QVKA 2JD2A 1NHGA 1YVEI 4XDYA 1YRBA 2YYZA 3WNQA 3DFZA 2V65A 3EC7A 1YZNA 7MDHA 4R98A 3LRPA 4MULA 2DQYA 4WUTA 1T6YA 1T13A 1QO7A 2NO7A 4RKEA 4BB5A 2C7BA 1L7RA 2RAVA 3URKA 4B33A 4M1QA 4GOKA 1A7KA 1J97A 2YZNA 4TWBA 3K16A 5FWNA 2Z2YA 3SZRA 3BC1A 1I2MA 1XDZA 1IN8A 1PU2A 1OH6A 5IF9A 4NZNA 3AYXB 3P0RA 1GQRA 4R1PA 3WP0A 1X1BA 5DTIA 4EKDA 3WIEA 1E3JA 2NU7A 4E3WA 5BSWA 4MGKR 4AKSA 2YWCA 3PC8C 4K7JA 4Q9IA 4B32A 3VOTA 3HE3A 4DHWA 3HH8A 1L5WA 1PDWA 4D4IA 3VR4D 3I8XA 3Q5DA 5JG7A 1LD3A 1NI4B 1SCBA 1F14A 3FRHA 3G2NA 4NCIA 3VMFA 3B1FA 3KLNA 1YD7A 2XTJA 3RC8A 4LHZA 4UMVA 2ZI6A 4ZVTA 3HXOA 3NC1C 2QROA 1QUEA 1GSOA 4F9EA 2PSDA 4I55B 4CEHB 4IAOA 2NLOA 3MTIA 1FUIA 4IHQA 4JN6B 5HCNA 4DYVA 1VPLA 2BFEB 5IAGA 4HVCA 2A9QA 3F1KA 3OHPA 1EFLA 1IM2A 4AJ4A 1U3CA 2WA1A 2H0RA 3FTQA 3NFYA 3JVEA 3P9XA 4OI4A 2HCJB 1G3UA 2BT4A 4YP9A 1IBCA 4QU0A 5TT0A 5A1JA 4MWOA 4X97A 2XEXA 3IVAA 2YIJA 3T4UA 3G5LA 1MAHA 1R3UA 3E82A 4XYLA 3F6CA 2AXEA 2PWAA 5BYBA 4ZGWA 4TYWA 2VPZA 3FSGD 1QB7A 4JX8A 1U0EA 4JNKA 5JVDA 4JLBA 4ESOA 1M73E 1ETHA 2OUIA 1X3SA 4JP8A 3X1DA 1M1NB 4Q47A 2X15A 4Y1RA 2I2AA 2K6GA 3GIDA 3MUFA 3OX2A 3HYCA 4YUVA 5L7WA 4TN5A 2Z3VA 3O1LA 4IOLA 1FX0B 1SEVA 4O2BA 1PVDA 2VRCA 1P6QA 1KMIY 1VSTA 2WJ4A 3GUCA 5CDSA 2VQ6A 3RI3A 3RANA 2PN1A 3RIYA 4URVR 1F17A 2UZIR 3DHVA 5JW6A 2P0YA 4LA4A 4P1ZA 2VK1A 3KEMA 2C4KA 4PVCA 1B15A 1V35A 4V0QA 4UQLA 3CZPA 4BE7B 1AQLA 2ZYWX 4FYPA 1CERA 2CMDA 3CZMA 1UWLA 2DCUA 2HL6A 4Q4JB 3RC1A 4QFCA 3DNMA 2GCPA 4R9RA 1ZKMA 4KIUA 3A32A 4RY8A 1LDBA 3NEJA 5H7XA 4ARCA 1J5PA 1Z26A 4RJKA 4AWXA 1PTJC 3I42A 3RHZA 1BGVA 1AXRA 2A0UA 2GEBA 4GBMA 3RSGA 5LD2B 2DCMA 4G5HA 1W5EA 1E4EB 1Y4SA 2X9QA 3C5EA 3M82A 5FBZA 4WXYB 5CR9A 3OLXA 3VC3A 1LI7A 4EG8A 4JI1B 5ALDA 4EF6A 4LJSA 4C20A 1T4DA 2X8AA 5AMXA 2OP1A 2P91A 1NPDA 4HWTA 5L3RA 4AJIA 4BYGA 3AIMA 1DWOA 1JH8A 2JB9A 1J2EA 3IE1A 2VNAA 3AEQB 2XADA 1T1IA 2BMJA 3EARA 4MQUA 3OM1A 3OPYB 4Q9DA 4WL0A 1W9MA 4BTEA 2HRRA 2Z2JA 5DT2A 2XHZA 1F5SA 1Q14A 3GJ0A 4EUSA 2GTIA 4NBRA 3VA7A 1M76A 3WYNA 1P0PA 3CT4A 2NSYA 3T5PA 4Y2UA 3RV3A 1U7XA 2IOQA 3ZYCA 3ZXSA 1ID8A 3BZBA 3HB0A 3V8PA 1THTA 1Z08A 2AE1A 3QXJA 2O07A 2FN7A 1ZINA 4JJIA 3WKBA 1UK7A 1R6VA 1N0IA 2BI7A 2FE4A 5DCWA 1GQSA 1UL1X 1TQ4A 1NSYA 1L3BA 4MARA 1WCXA 3VKFA 4CW7A 1Z7BA 4DMHA 3A7EA 4HB0A 2QP4A 3HDHA 2X1LA 3BSWA 5LYJA 2XTMA 3GFQA 2HWKA 3K0HA 4V0SA 3N70A 1IFXA 3JWPA 1JEOA 4IMJB 3VJRA 4DDHA 1Z8FA 5JH7A 1PWYE 1S8FA 4JLKA 2R6GA 4NATA 3GJZA 2IWHA 1M6EX 3L6UA 5HOEA 3D5TA 4PX9A 2B1JA 3LY8A 5CHYA 5CRIA 2OT3B 5FP0A 1G59A 2FN4A 1W1WA 2JLZA 1ZM3A 5JCJA 3HJAA 1AHPA 1ZN7A 4MV4A 3M34A 4A23A 2DFLA 2YCBA 3DZGA 3G68A 2GKGA 1XTIA 2QZSA 1TIBA 2WJYA 3IYLW 1BMQA 1T8YA 1RC1A 4LZJA 1H0RA 4TMKA 4QXQA 3MLEA 2C2OA 4O8CA 1EU1A 4K6GA 4JQCA 5J4VA 3AR9A 2YJ6A 5E3HA 2OILA 2ZIXA 4YEDA 3ZD7A 1FL9A 3OCYA 1ORDA 5DWQA 4CG1A 4MEBA 3RJMA 5HVNA 2L69A 4F3YA 5CYOA 2J3EA 4N3NA 3P5BA 1YS6A 3JSAA 1AZTA 4QUHA 3NZEA 1WG8A 2OFWA 1Z0ZA 3CIOA 3EVZA 1I0IA 4NZ9A 3PL5A 3H75A 5FORA 2JI7A 4GX0A 3WAGA 1P6UA 4P32A 4YCAA 4JMPA 1J9ZA 1RQRA 2X58A 4JBIA 5KNDD 4P08A 1ZEMA 2FSFA 3TAHA 1P1HA 2E6UX 4D4JA 5BWCA 2PBFA 1XP5A 2QRJA 2Q8QA 4D45A 2NXCA 3K5IA 4C29A 1AMUA 3CQ9A 3AJAA 4MWBA 4V02A 1CQXA 3ER8A 1ZW6A 4DIKA 3MGAA 3FPBA 2VK2A 4LW8A 4MIEA 1I2DA 1XJWA 5ADUS 5KKCA 4I2VA 5EP2A 1FTQA 1QX3A 3NBQA 2ZULA 4JGBA 4RPGA 4DTIA 4B71A 4F12A 4MQ6A 5KQSA 5E0KB 3E6AA 3QLEA 4OU4A 4EK9A 1YI8A 3HU2A 4YFVA 4WESA 3RSHA 5K6TA 4EPXA 3TF5A 3GFBA 2IV7A 1B16A 2BDTA 3NEYA 2QUJA 3RIMA 1YJBA 2FY8A 3N8DA 3G2HA 5B3JC 4FIZA 5KYNA 5IYZA 3GLIE 3BSFA 3PWSA 4JBHA 4RM3A 1Z4PX 2WY2D 4YMWA 5AUQA 3VHXA 3BGVA 3EMVA 3IBFA 5JZMA 2FW9A 4LZZA 1T24A 2AI1A 2PD6A 3EYWA 4GPIB 4B4OA 1WQ4A 1K97A 3MW8A 5ALPA 3ZC3A 1CR2A 3C3DA 5BN3B 4Z8XA 3THYB 4U3JB 2DUNA 2E1PA 1TXGA 3DE3X 1ZSNA 1E8NA 3E0XA 4OGLA 1UIMA 3LL4A 1FRZA 4QL3A 5BN1A 2PE5A 3EA5A 1EEHA 2I4LA 2X8LA 4XFJA 4KOEC 3PPIA 3VTAA 1EB8A 3OFJA 4NFHA 3WISA 1KEVA 1RQNA 3WK4A 2COUA 1E5QA 2C2XA 4PGHA 3WLLA 2ZYUX 1CR1A 4YLYA 5ITVA 4K2AA 5GJWC 4R9NA 2IKSA 1DAIA 4OGGA 5TT1A 3WS7A 1ESMA 1L5GB 5KPJA 1LS1A 2F7SA 3Q85A 2VHYA 1VPVA 3F96A 5JBNA 5JCJD 4Q1DA 4KMSA 3VC1A 1TB4A 2DSNA 1ISMA 4UC0A 4ZVOA 4BNMA 1D2MA 1LF0A 2O8BA 4MWZA 3SHFA 3CF4G 3MJRA 3CRW1 4MMXB 3BXEA 5I8WA 1TU0A 3HPQA 2I80A 3FTPA 1DJMA 2XMCA 2AE2A 5BSUA 3OZFA 1DO2A 3LQRA 2R66A 3BHIA 3LYLA 3P9NA 1JPVA 4K28A 3TL2A 4DV4B 4GR4A 1C1XA 3FFTA 1U8ZA 4QBHA 1EESA 4L2IB 1G5TA 2GK6A 4FP9A 1PNQA 2GKOA 4YJFB 1YDWA 1UT8A 3LJKA 5SZHB 3NIBA 4G1UC 1MQAA 3D3WA 4B7CA 1ACJA 3R3HA 4P9NA 4I36A 2ES4A 3TR0A 2QEQA 3U3KA 2CXQA 3GJ3A 1T8SA 1A5AB 1JHVA 3C7CB 3S27A 4ZIRB 2NU9B 4HLCA 4FFLA 3SQXA 2OBFA 4FPXA 2PANA 1JN0A 1IHUA 2JGRA 1OB2A 1NOJA 1ODSA 1U28C 4J8PA 2X4DA 2P8JA 1UAAA 1W75A 2QNIA 3N07A 2JH9A 5BSMA 3WDSA 4H1HA 4RVDA 1H0HA 2PGNA 2D1QA 4Q1EA 3K9WA 1OLXA 1P1CA 2J08A 3AG6A 3BRCA 3JQGA 3K2IA 4HAYA 4BNJA 5K8CA 1SXJB 3MD9A 3AP1A 4MKZA 4YP5A 5HWSA 4EI9A 4RTJA 3M89A 5JC1A 3E9RA 1P5HA 4L6CA 5NULA 1N6NA 2FPSA 4KSYA 3VNSA 2ZK7A 3D4OA 2FXVA 4I50F 4MWTA 4U2CA