4Q69A

Crystal structure of a susd homolog (bt2259) from bacteroides thetaiotaomicron vpi-5482 at 2.50 a resolution
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
456
structure length
456
Chain Sequence
PNTAEKVDPGYLFNYVAVNWAGTRTGGDFYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEADPVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEALQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGGMVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFEPGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGLGVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWIDLMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKIWEKLWFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a SusD homolog (BT2259) from Bacteroides thetaiotaomicron VPI-5482 at 2.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords Putative lipoprotein
total genus 143
structure length 456
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4q69A00
3IV0A 5FQ4A 5J90A 3KEZA 3L22A 5FQ7A 5LX8A 3MX3A 3NQPA 4LERA 3EHMA 3GZSA 4MRUA 5FQ8A 3OTNA 3CGHA 3P1UA 3LEWA 3CKBA 3JQ1A 5T3RA 4L7TA 4Q69A 3CK9A 3MCXA 3QNKA 3EHNA 3CK7A 5E75A 3CK8A 3JYSA 3I4GA 3JQ0A 4PUCA 4F53A 5T4YA 3MYVA 3CKCA 3SGHA 3HDXA 5E76A 3SNXA 4F7AA 3EJNA 3FDHA 5FQ6A
chains in the Genus database with same CATH superfamily
5ENRD 2RD0A 5D2MC 4FP7A 4CDRA 2WQHA 2BKGA 4FC8A 1TNBA 1UOHA 4MRUA 2XGOA 5ARFA 1OWLA 1X5BA 3SFXA 2WXKA 5BUZA 3NAWA 5ARGA 1IHBA 2I1JA 4TXRA 5J90A 3DSVA 4GA2A 2JABA 1OCCE 2P9SG 4QQIA 2QC9A 3MKQA 4PS3A 2WXRA 3CVUA 1O1RA 1Z5SC 3DSSA 4N3AA 4F7AA 4IULA 3PDNA 1FT2A 4XI0A 2KZTA 1Y8MA 2CG2A 4B8AA 3FUDA 4DX6D 3D3MA 4ANXA 4G24A 3FH7A 1Z3XA 5KNHD 2GRQB 3UI2A 4HFGA 1GW6A 2P9LG 4G8LA 1N4RA 1VDYA 3MV3B 5ANLA 3CHPA 1S63A 4BEPA 4XZ4A 3AJIA 5JJ6A 1YA0A 4UWLA 4AXHA 2L6JA 3HG0D 2LSVA 4ILGA 3B7SA 1K1AA 2GW1A 3U9WA 1UJJA 3CHSA 1O5MA 4UI9C 1TNUA 3JXIA 2IQCA 1H6KA 1A5EA 2OOEA 4U95D 2IU1A 4G1TA 4YDWA 2DYRE 3KEAA 3FP3A 3SNXA 3SFYA 5FTPA 4OVVA 4TUUA 1SA5A 3DSTA 4CGVA 4XIFA 3ABKE 3QNKA 4FJZA 3L13A 3UUXA 3ZW3A 2IFUA 2XS1A 2XQ0A 3HXDA 1LD8A 3EHQA 4XI9A 2P9IG 1OXJA 4HNAD 1U3CA 4GPKA 1W3BA 4GMRA 3AS5A 1JWGA 4GZDA 5T8IA 4U96D 3I4GA 1IYGA 5CMWA 2C0LA 3RKVA 4URKA 4BSZB 4UUCA 2NC9A 4W9RA 3C3QA 2VJ8A 3C3OA 4U8VD 2KCVA 4YNDA 2Q7FA 3Q5MA 4G25A 3AS4A 4AOFA 3FTZA 3CHRA 3RIBA 4LNBA 2XRYA 4XKCA 5JHAA 2EINE 3R7QA 3MX3A 3LXUX 3PUJA 2ONDA 3FTXA 4ACLA 1O1TA 3OXFA 3L17A 4J8EA 3AG2E 5EIDA 3PREA 3U4TA 3HXCA 3ZXPA 4AIFA 1MX2A 2EQXA 3LJ3A 2YINA 1MHQA 2J9QA 1BPOA 3JUEA 1DNPA 2V0PA 4PUCA 3IBEA 4O1PA 2WXGA 3L16A 5AN8A 3R9AB 2Y3AA 4K03A 2HM8A 2VGYA 3E37A 5CMYA 5CRUA 2DIWA 5FINA 3NOGD 5H7PA 4JL0A 4HI9A 5JMND 4APFA 2NXPA 3QWPA 5J08A 3RJVA 3LJNA 1L5JA 3MEKA 2Y4UA 2XEEA 1TR4A 3GW4A 2BKKB 3LYAA 3FU3A 4GYWA 4KT6B 3NZUA 3LVRE 2KC7A 1IQRA 1JWFA 3DRAA 3QC1A 3SF4A 3UX4A 3DSWA 3SI5A 2F0YA 1Z6TA 3NBNB 2WM9A 3UT8A 4BTBA 4GB9A 3JCKC 3V31A 1UN9A 3CVQA 4HXIA 2DYSE 3FY4A 4WWNA 1KZPA 3SFZA 3VLEA 1BD8A 3AG4E 2AXVA 3T8MA 2DCPA 4J8YA 3T5VA 2LAIA 3SD5A 5LCWC 2VGEA 3SBSA 3Q15A 2J07A 4Q94A 3J5PA 3LS8A 5G55A 3S7FA 4L23A 1SW6A 4DRXE 2X38A 4E6HA 3BU8A 2BEDA 2MHKA 1HG2A 4UQXA 4DUIA 4CCAA 3CHQA 4ACKA 1QZ2A 3FTSA 2H6HA 3CSFA 2IEJA 4UWFA 2ILRA 1KT0A 3DXMG 5DIZA 2WXMA 3ZVVA 2WXHA 2XPIA 5HRYA 5LFAA 3W9GA 3QOUA 1N0RA 1OT8A 3L22A 1JCQA 3OTNA 1HZ4A 3SHFA 4UWKA 2AXZA 4PS7A 3DEPA 4XEIG 2R03A 5BW8C 2ETAA 3CQGB 5C2YA 4U0SA 4OVUA 4EZLA 4OYSA 3I5PA 4F6RD 4N5QA 4L2YA 1MZCA 5D66A 3ULQA 4J7WA 3CHOA 2YHCA 5CCLA 3MCXA 4G8KA 3C72A 1OY3D 2BTDA 1HE8A 2GRLA 3I3NA 3MYVA 4LEUA 1OWPA 2A4ZA 3HDXA 4CDMA 3V79K 1MYOA 4JVSA 4NRHB 1TN7A 2RFAA 3CVWA 5FJYA 3Q4AB 3UM2A 3S2AA 3PH0C 3BG1B 4K5BA 4JW1A 1NA3A 1PY1A 4B89A 4U63A 2P2CP 4UQZA 4NIKA 5AARA 3QKYA 2F37A 4BY6A 4GMJA 1N0QA 3ZFWA 3DSXA 3RAUA 3LVQE 3SGHA 1DC2A 3TAXA 2R02A 3Q73A 4DLQA 1E90A 3ESKA 4C0EA 3OXLA 5AJLA 4L2LA 5KNGA 2XZTG 3HIZA 3Q79A 2Y1LE 4IRUA 4Y6CA 3ENEA 3AG1E 4GTTA 2XPZA 1UJKA 2XCCA 5HQ8A 4GAAA 3UM3A 4IYPA 2A5EA 4UQYA 1NI1A 1FCHA 4IN3B 4O6FA 2GRMA 3APFA 4CEMA 2GGFA 2B0OE 4FJYA 5KCMA 2CG3A 3KEZA 4HBDA 2WMOA 4J6IA 3BEEA 3ONKA 3IKOB 3PVLA 5B1BE 3FTWA 5BV0A 2VSXE 2VYIA 1V55E 2V5QC 3TL5A 1HX8A 3FEYA 5JHBA 3RU0A 3GZSA 4LNUD 3LY7A 4H7XA 5CRVA 4ABNA 4GZ6A 3O4ZA 3HVEA 1WY6A 3ZHEB 4JD2G 4AP2A 2WXFA 4KZCA 2NYJA 3DPYA 4BT8A 4HRNA 2ETCA 4GA0A 3L6AA 4LNGA 1MX4A 3E33A 3D9LA 1WG0A 3QK0A 2PQRA 5LCWJ 4XKBA 2AXUA 4AV7A 1MQSA 3V30A 3CKCA 3ZGQA 1BI8B 3VLDA 3AU5A 3TWQA 4AM9A 3APDA 1S64A 5CBOA 2LO6A 5ENSD 4GZ5A 2IOLA 3D9JA 3ZUVB 1FT1A 4WWPA 1NZNA 4N5CA 4P29A 3ULYA 2WB2A 5AQ9A 3PEUB 4XX5A 4I1MA 2DWZA 3VTXA 3URZA 1N4QA 3E34A 4I17A 1OCZE 4LSZE 4G26A 4U07A 4FLBA 3FH5A 1P5QA 3TWUA 3PZ4A 3EU5A 2BUGA 3ASOE 3FU6A 5DBKA 4DX7D 4O60A 3FULA 1H19A 2GROB 1SQMA 1H2TC 2WXIA 2FF4A 3ZHEA 2VSNA 4DK5A 2J09A 5D0QD 2LAHA 1HXIA 4F53A 4KVOA 5AENA 5EILA 4GCOA 3FUEA 3UMVA 4CRWA 2V5FA 5ANRA 4N2SA 2GRNB 3CVNA 5KBAA 3APCA 4AY5A 2CHXA 2UY1B 2J08A 3ZKJA 3Q7AA 5EX0A 2XS8A 1IXVA 3NF1A 3PE4A 4BTAA 4WNEA 3SO8A 4BFRA 2ZXWE 1ZU2A 4HOSA 5LP0A 4YDYA 4WNFA 2OVBA 2R05A 5KJKA 1E7UA 1A17A 3ZRHA 4OAUC 4I2ZA 2WQ6A 5CECB 3SQVA 1E7VA 1TJFA 2NSZA 2AVPA 1OUVA 3SBTB 4O1OA 1RZ4A 5LOZA 1WAO1 3CVYA 5BV1A 4ZHBA 4K5AB 3LPZA 4NQ0A 4CYMD 2KBXA 1N4PA 3ESLA 1TNZA 4AVXA 2C2LA 3CK9A 4EPZA 4B94A 2LNIA 4HRLA 3PNLB 3EIQC 4A1GA 2PZIA 3ZXSA 4GTQA 4AY6A 3CVLA 3EDTB 3UTMA 2P58C 4LUNU 2OV8A 4U0UA 4RLYA 4BT9A 3UXGA 2CFUA 2LXMA 2EIKE 1N95A 4PH4B 3HYMB 1E8ZA 3C98A 2PL2A 4YDOA 3AS8A 1FVFA 3PEVB 2ETBA 3CGHA 3GYZA 4GZ3A 1OWOA 2XPYA 4UI9J 2FO7A 3ML9A 3E4BA 3RK6A 1ELWA 1IKND 1QNFA 2J49A 5CERB 2LXLA 4CT4A 2VTBB 1LF8A 3FTVA 3IEGA 1V54E 1NL4A 2QZAA 2IO2C 2P9UG 2PNNA 3GZ2A 5EX3A 3PRZA 2JLBA 3PZ3A 4A63B 4G11A 5ENNA 2J8SD 2R59A 4F3VA 4C9BB 2KZTB 4GYOA 2EIME 3G2TA 3ISMC 1HO8A 5BNWA 4CT0A 4CDNA 3PE3A 3CVVA 2Y0BG 2JEKA 2I1KA 3KAEA 1ZBPA 5FQ6A 2LSUA 4EZJA 5FZQA 2PM7A 3NQPA 3LKUA 3Q49B 2R2LA 5D0OD 4GCNA 1N54A 1E96B 4KYOB 1TEZA 3QWVA 3RRNB 2M63A 3FUMA 1IQUA 3FEXA 3DWLG 2QYUA 2UY1A 4N3CA 4R7LA 2VSYA 3D9OA 5BPPA 2B6CA 3JYSA 3JQ0A 3UIOC 4J8SA 4UWHA 5ENPD 5EYLA 4BWRA 3E32A 4HLLA 2HR2A 2XZDG 2V4LA 4GPMA 2MOWA 4JEUA 1KLXA 3CSTA 1DCEA 3T8KA 3EUVA 4ANVA 5FZSA 3S7BA 1HFAA 3PZ2A 3EIJA 3CK7A 4I9EA 4WAFA 4I6JA 3TGOA 5E76A 1SZ9A 1UW4B 4LERA 3KSLA 1E8WA 2AJAA 2IONA 3O48A 4DI3A 3FTUA 3TWVA 2R17C 4MBGA 2PQNA 2VGXB 2E0IA 1N9AA 4JHJA 5G05C 4ME2A 1E8XA 3U64A 1WM5A 1HS6A 5KJMA 1OWMA 1OCOE 2WVIA 2A5UA 1ELKA 1XNFA 3TWXA 4N2QA 5CEDB 3Q9NC 4HVBA 5A6CA 3ABLE 2XEVA 2OVFA 2IJGX 4HOQA 4Y6WA 3UKRG 1MJ0A 2ZIRA 4DPRA 4B8CB 2XRZA 4N39A 2X6KA 1BI7B 4GA1A 3V2OA 4BERA 2P9PG 3ZYQA 3OXGA 1HF8A 2MYOA 2XHEA 3UINC 3ASGA 5AAOA 2E2EA 5EN5D 4DI4A 1FVHA 3MA5A 3ZN3A 5AJDA 4RQIA 4L7TA 1HG5A 2ZGGA 1U3DA 2IF4A 3ASFA 4MKTA 3MKRA 1PAQA 2PM6A 3ZU7B 3CHMA 4L1BA 2IOSA 2WXNA 1OWNA 3EHMA 1AWCB 3UT4A 2YQ8A 1EPUA 4RG6A 4B93B 3SY2A 4G23A 4M3OA 2KCLA 4GTSA 2H6GA 2WXPA 3PNTB 4BETA 5LX8A 5ENTD 5IY5E 4C48B 3WXXA 5EIBE 3TG5A 4KZ0A 4TRQA 5AQBA 3QARA 3D9NA 3HXBA 4U04A 5AQAA 1OCRE 4WNDA 1O1SA 2GRRB 2L9BA 2WXJA 3T5XA 2XGSA 4JA9A 3MJWA 2KATA 4Q96A 2Y69E 3D9PA 2RFMA 3F6QA 3NOCD 4YVQC 2X6JA 3ZYKA 3QJZA 2WXQA 1HH8A 5G2NA 1JCRA 2V4HC 2CFZA 5AYWD 3SZ7A 1G3NB 2XENA 3QAQA 3FUNA 3CR3A 1EDUA 3S7DA 4HB5A 2HO1A 2QYJA 3EU9A 5FT9A 5FQ8A 2WQ7A 1S70B 3AAAC 3R9MA 4QFVA 2XCBA 3D9KA 2HE0A 3V2XA 4K5CA 1WDYA 2H6FA 5AQ7A 4ILIA 4JA7A 3MKQB 4U8YD 4HQDA 3ZEFA 3LY8A 4D10C 1D9SA 1KPSB 1N94A 4ANWA 3C5RA 3G2UA 3IHYA 2J4BA 1JPLA 4PDXA 5T4YA 3EJNA 4GTOA 3B7BA 3ABME 4I43A 4PS8A 4B0ZA 4GTMA 2RKKA 3ZPJA 3HRAA 4U7EB 3TWWA 3VLFA 2VSOE 1BLXB 1NFIE 4I1OB 2FO1E 4RG9A 5FQ7A 5G04J 3LY9A 3ZIMA 2FI7A 2CHZA 3JXJA 4MS6A 3L9TA 3FUJA 3VTYA 3TXMA 1U2VG 3B95A 1YYHA 1E8YA 2FEZA 4A55A 2QFCA 4GYYA 3FU5A 3KS2A 2AWIA 3MZLB 5ENQD 4AEZC 4DX2A 4HOUA 1PC2A 3CLJA 3ZYLA 4LCTA 3LCAA 3JUIA 4I1AA 3QDNA 1IHGA 2ZU6B 2LUHA 4EECA 2VGXA 1S0PA 3J5QB 2L0IA 1N11A 3DBSA 3ZYMA 1KZOA 3FU0A 4MLPA 5FZRA 3B7TA 3X2QE 3B7UX 5FIOA 4ILHB 3ASNE 1TNYA 5B3SE 3P1UA 4TUMA 4FA6A 2KXPC 2I2OA 4HORA 3CK8A 3CVPA 4J8DA 1SA4A 2AW6A 4EQFA 4C0MA 2X6HA 3D9MA 3FH8A 4RSYA 4YDEA 2P9NG 3FFLA 1SZAA 3I4RB 2WXOA 3B7RL 3PUKA 4BX8A 5HKPA 3Q9UC 2FULA 4G2VA 5HS0A 4FLHA 4E85A 3FHEA 2VQ2A 1D8DA 3FUKA 1EF1C 1LTXA 1UG3A 2BF0X 1NP7A 3UPVA 4GU5A 3UT7A 4GZCA 1YMPA 4K0RA 3BQOA 3CVXA 2OCCE 3Q7FA 3W9FA 1H2VC 3PZ1A 4JEHA 4ATGA 1Y6IA 2CHWA 4FU3A 4JB8P 1K3ZD 2OEVA 5HI7A 4BSXA 3LEWA 1Q2ZA 1JUQA 4Q69A 3RRMB 4L9PA 3HHMA 4APOA 4JHKA 3C3RA 2WMNA 5C1DA 3DXKG 1MX6A 3ONLA 3HVEB 1QYMA 3NZSA 3CKBA 5BXUA 4UWGA 2X6FA 4DX1A 1ELRA 2MRIA 3Q75A 1KT1A 3ASHA 2QY7A 3E30A 3PS6A 3ZNGA 1XGWA 4FADA 2DVWA 4GTRA 3D9HA 4DX5D 3B13A 4J8FA 4WNGA 2ZISA 2FBNA 4NURA 4LRZA 4ZFHA 4A3TA 1HU3A 5JJ7A 3DEOA 4YVOA 3GZ1A 4GTVA 4TXQA 3PZDA 3TXNA 2VTBA 1TJCA 3N71A 4HOTA 1AP7A 4A1SA 3UM1A 1DCQA 4EHMA 5AIJA 3K9IA 1Z3YA 1X81A 3EHRA 4BESA 4FHJA 4HS2A 5CHEE 3DPDA 5EYPF 4ANUA 5BT1A 4U8HA 1NA0A 2X3MA 3CQCB 4CGWA 1TN8A 3FWVA 3EHNA 4FHKA 4JC8A 5G05J 4ATZD 5FWQA 1QBQA 2RG8A 3FDHA 2YNQA 2F8YA 1UN8A 3TWSA 3ML8A 4JXTA 4JZYA 3TG4A 2X6IA 3FUIA 5G04C 3RRUA 3FUFA 2OEWA 4V3IA 1YCSB 3D9IA 3UQ3A 3UIPC 3TWRA 4X8QA 2WPVA 4U0ZA 4DLOA 3NB2A 4I6EA 2I6HA 3G2SA 4TXPA 1TN6A 4H7YA 3AU4A 3T9KA 3CEQA 3G2VA 1K1BA 4JHRA 3S7JA 5T3RA 5CEAA 1QQEA 5E75A 4CZ2D 3KSQA 3WG7E 1N4SA 5JJTA 5CCMA 5A23A 4LG6A 5CBNA 3ASDA 4A3VA 1SVXA 4GTPA 3TJPA 4EBAG 3IXEA 3JQ1A 2XGMA 3L82A 2EILE 3MV2B 3RSEG 3TWTA 2XEHA 3DSUA 2DBAA 4BX9A 2V8SE 3Q47B 3OAWA 4XE0A 3UM0A 4HLEA 1H6OA 3MGBA 3HXFA 4TV3A 1BU9A 2YHEA 2IY0C 3BUAA 1RW2A 1INZA 2HYZA 1B89A 3AG3E 3BG0B 5FQ4A 5KJNA 2EIJE 1H2UA 5ENOD 3QWWA 1N52A 4FULA 4GMLA 5EKQD 4KBQA 2KM4A 4EZKA 2L0TB 5M72A 2ZGDA 2KCKA 3RO3A 3QB2A 3FUHA 4I6GA 1H0AA 2I9CA 1D8EA 3LDZA 3G2WA 3IV0A 2J4DA 4NACA 4N3BA 4HRMB 5EDSA 1H6PA 4EBAA 4WWOA 5JA4D 4I9CA 2R5SA 5A7DB 4DJAA 2C0MA 3U66A 1DVPA 1K8KG 3HXEA 4KVMA 5B1AE 4Z68A 3CV0A 2IO3C 4HI8A 4KMOA 4F1SA 3P2BA 4UI9K 4JPSA 5KWDA 4WUYA 4AJWA 2L6BA 4KXKB 5KJLA 5BXOA 1JCSA 2DZOA 4J0UA 2DZNA 2WXLA 3U3WA 3R7RA 3KD7A 1TNOA 4RVBA 3RO2A 3FTYA 2UWJG 1ZB1A 1TYQG 2F8XK 2H6IA 3IHVA 4I2WA 4F1PA 3L54A 1FPPA 2Y4TA 3ULEG 2GRPB 3CIAA 3L08A 1LD7A 3UKUG 1EYHA 2P9KG 4M7CA 5ITZF 4OAVB 3Q78A
chains in the Genus database with same CATH topology
5FZRA 2RD0A 4G11A 4FP7A 5ENNA 4CDRA 2WQHA 3B7TA 4FC8A 2R59A 4JVSA 3B7UX 4MRUA 5ARFA 2XGOA 4F3VA 4ILHB 1OWLA 4NRHB 4C9BB 2KZTB 4GYOA 3P1UA 3CVWA 1X5BA 5FJYA 4FA6A 3G2TA 1HO8A 5BNWA 2WXKA 3Q4AB 5BUZA 2I2OA 4CT0A 4HORA 3CK8A 3CVPA 4CDNA 4J8DA 3PE3A 3S2AA 3PH0C 3BG1B 5ARGA 3CVVA 2JEKA 2I1KA 3KAEA 4JW1A 1NA3A 2AW6A 2I1JA 4EQFA 1PY1A 4B89A 1ZBPA 4C0MA 5FQ6A 2LSUA 2X6HA 3D9MA 3FH8A 5FZQA 4RSYA 4U63A 4EZJA 4UQZA 5J90A 2PM7A 4GA2A 3NQPA 3LKUA 3Q49B 3FFLA 3MKQA 1SZAA 3I4RB 2WXOA 5D0OD 3QKYA 4GCNA 1N54A 4PS3A 1E96B 4BY6A 2WXRA 3B7RL 3PUKA 4KYOB 4BX8A 4GMJA 3CVUA 1TEZA 2FULA 3QWVA 4G2VA 4FLHA 3ZFWA 4E85A 3RRNB 3FHEA 2VQ2A 2M63A 3FUKA 1EF1C 3LVQE 3FUMA 3SGHA 4N3AA 3TAXA 4F7AA 4IULA 1IQUA 1UG3A 3FEXA 2BF0X 3PDNA 1NP7A 2UY1A 4XI0A 4DLQA 3UPVA 1E90A 4GU5A 2KZTA 3UT7A 4GZCA 1Y8MA 2CG2A 3ESKA 4B8AA 4N3CA 4R7LA 4K0RA 3FUDA 4C0EA 2VSYA 3D9OA 3D3MA 4ANXA 3OXLA 5BPPA 5AJLA 3CVXA 4G24A 3JYSA 3FH7A 4L2LA 3JQ0A 1Z3XA 1H2VC 4JEHA 4J8SA 4UWHA 4ATGA 4HFGA 1GW6A 3HIZA 4BWRA 2HR2A 1Y6IA 1VDYA 2V4LA 3MV3B 5ANLA 2MOWA 3CHPA 4IRUA 4Y6CA 2CHWA 4JEUA 1KLXA 3CSTA 4XZ4A 3ENEA 4FU3A 5JJ6A 2XPZA 5HI7A 1YA0A 1UJKA 4UWLA 3LEWA 2XCCA 4AXHA 2L6JA 4ANVA 4BSXA 5FZSA 5HQ8A 3S7BA 4GAAA 1HFAA 1JUQA 3EIJA 4IYPA 2LSVA 4Q69A 4UQYA 3RRMB 3CK7A 1FCHA 4IN3B 4I9EA 4O6FA 2GRMA 3APFA 4WAFA 4ILGA 4I6JA 2GGFA 3B7SA 4CEMA 2GW1A 3TGOA 5E76A 3U9WA 4FJYA 1UJJA 3CHSA 5KCMA 1SZ9A 3HHMA 1UW4B 2CG3A 4APOA 3KEZA 4JHKA 4UI9C 4LERA 2WMOA 2WMNA 1E8WA 5C1DA 2IONA 3O48A 4J6IA 4DI3A 5BV1A 3ONLA 2IQCA 3HVEB 3FTUA 3NZSA 1H6KA 2R17C 3BEEA 3CKBA 4UWGA 3ONKA 3IKOB 2OOEA 2PQNA 3PVLA 2X6FA 2VGXB 2IU1A 1ELRA 3FTWA 2E0IA 2MRIA 4G1TA 1KT1A 5BV0A 2VSXE 3ASHA 2QY7A 2VYIA 3FP3A 3SNXA 3PS6A 4JHJA 5G05C 1XGWA 3TL5A 4ME2A 4FADA 1E8XA 1HX8A 3FEYA 5FTPA 5JHBA 4OVVA 3U64A 3RU0A 1WM5A 4TUUA 3GZSA 1HS6A 5KJMA 1OWMA 2WVIA 3B13A 3LY7A 4H7XA 4J8FA 4WNGA 4ABNA 4CGVA 4GZ6A 4XIFA 2A5UA 1ELKA 3HVEA 3O4ZA 1WY6A 2FBNA 4NURA 3ZHEB 3QNKA 4FJZA 1XNFA 2WXFA 4LRZA 4KZCA 4A3TA 1HU3A 3L13A 4AP2A 3UUXA 3ZW3A 2IFUA 5JJ7A 4N2QA 4BT8A 2XQ0A 4YVOA 3GZ1A 4HVBA 4GA0A 3PZDA 3TXNA 5A6CA 4XI9A 2VTBA 1TJCA 2XEVA 3L6AA 3N71A 2OVFA 2IJGX 4HOQA 1U3CA 3D9LA 4GPKA 4HOTA 1W3BA 4Y6WA 3QK0A 4A1SA 3AS5A 2PQRA 1JWGA 5AIJA 3K9IA 4GZDA 5T8IA 4XKBA 5LCWJ 4DPRA 2AXUA 4AV7A 3I4GA 4B8CB 2XRZA 1Z3YA 1MQSA 1IYGA 3CKCA 4N39A 5CMWA 3ZGQA 2C0LA 2X6KA 4FHJA 3AU5A 3VLDA 3RKVA 4GA1A 4URKA 4HS2A 5CHEE 3DPDA 3ZYQA 3OXGA 4AM9A 3APDA 1HF8A 2NC9A 4ANUA 5BT1A 4W9RA 2LO6A 2XHEA 3ASGA 4U8HA 4GZ5A 2IOLA 2E2EA 4DI4A 1FVHA 3MA5A 3ZN3A 1NA0A 2VJ8A 5AJDA 3D9JA 2X3MA 3CQCB 4CGWA 4L7TA 3FWVA 1HG5A 3EHNA 4FHKA 4JC8A 2KCVA 1U3DA 2IF4A 3ASFA 4MKTA 4YNDA 4WWPA 2Q7FA 3Q5MA 3MKRA 4G25A 3AS4A 1NZNA 4AOFA 3FTZA 4N5CA 4P29A 1PAQA 3CHRA 3RIBA 5FWQA 2PM6A 2XRYA 2RG8A 4XKCA 3FDHA 2WB2A 2YNQA 3PEUB 5JHAA 3CHMA 4L1BA 4XX5A 3R7QA 1UN8A 4I1MA 3ML8A 2IOSA 3MX3A 2WXNA 4JXTA 3LXUX 4JZYA 3VTXA 1OWNA 3EHMA 3URZA 3TG4A 2X6IA 3UT4A 3PUJA 3FUIA 4I17A 2ONDA 3FTXA 2YQ8A 1EPUA 4RG6A 5G04C 4G26A 4U07A 4FLBA 3RRUA 3FUFA 4ACLA 3FH5A 1P5QA 3OXFA 4G23A 4M3OA 4V3IA 3D9IA 3UQ3A 3L17A 4J8EA 2KCLA 2BUGA 2WXPA 3PREA 2WPVA 4U0ZA 3U4TA 4DLOA 3FU6A 4I6EA 2I6HA 3G2SA 5DBKA 3PNTB 4AIFA 5LX8A 2EQXA 4H7YA 3AU4A 3LJ3A 2YINA 3FULA 3CEQA 1H19A 3WXXA 1SQMA 1H2TC 3G2VA 2WXIA 4JHRA 3TG5A 2FF4A 3ZHEA 2VSNA 3S7JA 4KZ0A 4TRQA 3QARA 5T3RA 3D9NA 4DK5A 1MHQA 4U04A 2J09A 2J9QA 1QQEA 5D0QD 5E75A 1BPOA 2LAHA 1HXIA 1DNPA 5JJTA 4WNDA 2V0PA 4PUCA 4F53A 4KVOA 3IBEA 2L9BA 5A23A 5AENA 5CCMA 2WXGA 4GCOA 3FUEA 2WXJA 3L16A 3UMVA 3ASDA 4A3VA 3T5XA 4CRWA 2XGSA 3R9AB 2Y3AA 2V5FA 4K03A 5ANRA 2HM8A 4JA9A 4N2SA 3MJWA 2KATA 2VGYA 4Q96A 3TJPA 3D9PA 5CMYA 3CVNA 2DIWA 3APCA 4AY5A 2CHXA 2UY1B 2J08A 2X6JA 4YVQC 3ZYKA 4EBAG 3QJZA 3JQ1A 2XGMA 2WXQA 1HH8A 4JL0A 5G2NA 3MV2B 4APFA 2NXPA 5EX0A 3QWPA 2CFZA 3PE4A 3NF1A 5AYWD 4BTAA 3SZ7A 4WNEA 5J08A 3RJVA 3QAQA 1L5JA 3MEKA 2Y4UA 3FUNA 4BFRA 3CR3A 1EDUA 3S7DA 2DBAA 3GW4A 4BX9A 3LYAA 1ZU2A 2V8SE 3FU3A 4GYWA 4KT6B 2HO1A 3NZUA 3LVRE 3Q47B 5FT9A 2KC7A 5FQ8A 4HOSA 5LP0A 1IQRA 1JWFA 3QC1A 3OAWA 2WQ7A 4WNFA 4XE0A 2OVBA 3SF4A 4HLEA 3MGBA 5KJKA 3UX4A 1E7UA 4TV3A 4QFVA 3SI5A 1A17A 1Z6TA 2XCBA 3ZRHA 2WM9A 3D9KA 3UT8A 4BTBA 2YHEA 4I2ZA 4GB9A 3JCKC 1UN9A 2WQ6A 1INZA 2HYZA 3CVQA 1B89A 4HXIA 3BG0B 3FY4A 5FQ4A 1E7VA 1TJFA 4WWNA 3SFZA 2NSZA 2AVPA 1OUVA 3SBTB 3VLEA 5KJNA 1H2UA 2AXVA 5LOZA 2DCPA 4ILIA 3QWWA 1N52A 1WAO1 3MKQB 4FULA 4JA7A 5G05J 4GMLA 3CVYA 5EKQD 4KBQA 2KM4A 4NQ0A 3LPZA 3ZEFA 3LY8A 4EZKA 4D10C 2LAIA 3SD5A 2L0TB 5LCWC 3T5VA 5M72A 3ESLA 4ANWA 3G2UA 4AVXA 2KCKA 3RO3A 3QB2A 2C2LA 3FUHA 3IHYA 3CK9A 2J4BA 3Q15A 3SBSA 4EPZA 4I6GA 1JPLA 4B94A 1H0AA 4PDXA 2I9CA 2J07A 5T4YA 2LNIA 3LDZA 3PNLB 3EIQC 4Q94A 3G2WA 3EJNA 4A1GA 3IV0A 3LS8A 5G55A 3S7FA 2PZIA 3ZXSA 2J4DA 4L23A 4AY6A 3CVLA 2X38A 4I43A 3EDTB 4NACA 2MHKA 2P58C 1HG2A 4LUNU 4N3BA 4PS8A 4UQXA 4E6HA 4B0ZA 4CCAA 3CHQA 2OV8A 3ZPJA 4ACKA 4U0UA 5EDSA 1QZ2A 4EBAA 4WWOA 4I9CA 3FTSA 2R5SA 5A7DB 4BT9A 3VLFA 2CFUA 2VSOE 4DJAA 3CSFA 4UWFA 2ILRA 1KT0A 4PH4B 5DIZA 3HYMB 2C0MA 2WXMA 1DVPA 1E8ZA 3C98A 3U66A 2PL2A 3ZVVA 2WXHA 4KVMA 4I1OB 3AS8A 4RG9A 2XPIA 5LFAA 3QOUA 3L22A 3CV0A 5FQ7A 5G04J 3LY9A 3ZIMA 1FVFA 4KMOA 3PEVB 2FI7A 1HZ4A 3OTNA 4F1SA 3SHFA 3P2BA 2CHZA 4UWKA 3CGHA 2AXZA 3GYZA 4GZ3A 4MS6A 4UI9K 1OWOA 2XPYA 3FUJA 4JPSA 4PS7A 3VTYA 4WUYA 3TXMA 4UI9J 2FO7A 4AJWA 3ML9A 5BW8C 1E8YA 2FEZA 4KXKB 5KJLA 3CQGB 4A55A 2QFCA 3E4BA 4GYYA 3FU5A 5C2YA 3RK6A 1ELWA 3KS2A 4U0SA 4J0UA 4OVUA 4EZLA 2AWIA 4OYSA 2WXLA 3U3WA 3R7RA 3MZLB 3I5PA 3KD7A 4AEZC 4RVBA 3RO2A 4L2YA 4HOUA 3FTYA 1PC2A 1QNFA 2J49A 3CLJA 2UWJG 3T8MA 3ZYLA 4LCTA 4CT4A 2VTBB 1LF8A 3FTVA 3IHVA 4I2WA 3IEGA 3LCAA 3JUIA 3ULQA 3L54A 3CHOA 4I1AA 2YHCA 1IHGA 2ZU6B 3QDNA 2Y4TA 4EECA 2VGXA 5CCLA 1S0PA 3MCXA 2L0IA 3CIAA 3L08A 1EYHA 3DBSA 3GZ2A 5EX3A 3ZYMA 2BTDA 1HE8A 3FU0A 2GRLA 3I3NA 3MYVA 4LEUA 1OWPA 2A4ZA 3HDXA 3PRZA 2JLBA 4CDMA 4MLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV0 A;  5FQ4 A;  5J90 A;  3KEZ A;  3L22 A;  5FQ7 A;  5LX8 A;  3MX3 A;  3NQP A;  4LER A;  3EHM A;  3GZS A;  4MRU A;  5FQ8 A;  3OTN A;  3CGH A;  3P1U A;  3LEW A;  3CKB A;  3JQ1 A;  5T3R A;  4L7T A;  4Q69 A;  3CK9 A;  3MCX A;  3QNK A;  3EHN A;  3CK7 A;  5E75 A;  3CK8 A;  3JYS A;  3I4G A;  3JQ0 A;  4PUC A;  4F53 A;  5T4Y A;  3MYV A;  3CKC A;  3SGH A;  3HDX A;  5E76 A;  3SNX A;  4F7A A;  3EJN A;  3FDH A;  5FQ6 A; 
#chains in the Genus database with same CATH topology
 5ENR D;  2RD0 A;  5D2M C;  4FP7 A;  4CDR A;  2WQH A;  2BKG A;  4FC8 A;  1TNB A;  1UOH A;  4MRU A;  2XGO A;  5ARF A;  1OWL A;  1X5B A;  3SFX A;  2WXK A;  5BUZ A;  3NAW A;  5ARG A;  1IHB A;  2I1J A;  4TXR A;  5J90 A;  3DSV A;  4GA2 A;  2JAB A;  1OCC E;  2P9S G;  4QQI A;  2QC9 A;  3MKQ A;  4PS3 A;  2WXR A;  3CVU A;  1O1R A;  1Z5S C;  3DSS A;  4N3A A;  4F7A A;  4IUL A;  3PDN A;  1FT2 A;  4XI0 A;  2KZT A;  1Y8M A;  2CG2 A;  4B8A A;  3FUD A;  4DX6 D;  3D3M A;  4ANX A;  4G24 A;  3FH7 A;  1Z3X A;  5KNH D;  2GRQ B;  3UI2 A;  4HFG A;  1GW6 A;  2P9L G;  4G8L A;  1N4R A;  1VDY A;  3MV3 B;  5ANL A;  3CHP A;  1S63 A;  4BEP A;  4XZ4 A;  3AJI A;  5JJ6 A;  1YA0 A;  4UWL A;  4AXH A;  2L6J A;  3HG0 D;  2LSV A;  4ILG A;  3B7S A;  1K1A A;  2GW1 A;  3U9W A;  1UJJ A;  3CHS A;  1O5M A;  4UI9 C;  1TNU A;  3JXI A;  2IQC A;  1H6K A;  1A5E A;  2OOE A;  4U95 D;  2IU1 A;  4G1T A;  4YDW A;  2DYR E;  3KEA A;  3FP3 A;  3SNX A;  3SFY A;  5FTP A;  4OVV A;  4TUU A;  1SA5 A;  3DST A;  4CGV A;  4XIF A;  3ABK E;  3QNK A;  4FJZ A;  3L13 A;  3UUX A;  3ZW3 A;  2IFU A;  2XS1 A;  2XQ0 A;  3HXD A;  1LD8 A;  3EHQ A;  4XI9 A;  2P9I G;  1OXJ A;  4HNA D;  1U3C A;  4GPK A;  1W3B A;  4GMR A;  3AS5 A;  1JWG A;  4GZD A;  5T8I A;  4U96 D;  3I4G A;  1IYG A;  5CMW A;  2C0L A;  3RKV A;  4URK A;  4BSZ B;  4UUC A;  2NC9 A;  4W9R A;  3C3Q A;  2VJ8 A;  3C3O A;  4U8V D;  2KCV A;  4YND A;  2Q7F A;  3Q5M A;  4G25 A;  3AS4 A;  4AOF A;  3FTZ A;  3CHR A;  3RIB A;  4LNB A;  2XRY A;  4XKC A;  5JHA A;  2EIN E;  3R7Q A;  3MX3 A;  3LXU X;  3PUJ A;  2OND A;  3FTX A;  4ACL A;  1O1T A;  3OXF A;  3L17 A;  4J8E A;  3AG2 E;  5EID A;  3PRE A;  3U4T A;  3HXC A;  3ZXP A;  4AIF A;  1MX2 A;  2EQX A;  3LJ3 A;  2YIN A;  1MHQ A;  2J9Q A;  1BPO A;  3JUE A;  1DNP A;  2V0P A;  4PUC A;  3IBE A;  4O1P A;  2WXG A;  3L16 A;  5AN8 A;  3R9A B;  2Y3A A;  4K03 A;  2HM8 A;  2VGY A;  3E37 A;  5CMY A;  5CRU A;  2DIW A;  5FIN A;  3NOG D;  5H7P A;  4JL0 A;  4HI9 A;  5JMN D;  4APF A;  2NXP A;  3QWP A;  5J08 A;  3RJV A;  3LJN A;  1L5J A;  3MEK A;  2Y4U A;  2XEE A;  1TR4 A;  3GW4 A;  2BKK B;  3LYA A;  3FU3 A;  4GYW A;  4KT6 B;  3NZU A;  3LVR E;  2KC7 A;  1IQR A;  1JWF A;  3DRA A;  3QC1 A;  3SF4 A;  3UX4 A;  3DSW A;  3SI5 A;  2F0Y A;  1Z6T A;  3NBN B;  2WM9 A;  3UT8 A;  4BTB A;  4GB9 A;  3JCK C;  3V31 A;  1UN9 A;  3CVQ A;  4HXI A;  2DYS E;  3FY4 A;  4WWN A;  1KZP A;  3SFZ A;  3VLE A;  1BD8 A;  3AG4 E;  2AXV A;  3T8M A;  2DCP A;  4J8Y A;  3T5V A;  2LAI A;  3SD5 A;  5LCW C;  2VGE A;  3SBS A;  3Q15 A;  2J07 A;  4Q94 A;  3J5P A;  3LS8 A;  5G55 A;  3S7F A;  4L23 A;  1SW6 A;  4DRX E;  2X38 A;  4E6H A;  3BU8 A;  2BED A;  2MHK A;  1HG2 A;  4UQX A;  4DUI A;  4CCA A;  3CHQ A;  4ACK A;  1QZ2 A;  3FTS A;  2H6H A;  3CSF A;  2IEJ A;  4UWF A;  2ILR A;  1KT0 A;  3DXM G;  5DIZ A;  2WXM A;  3ZVV A;  2WXH A;  2XPI A;  5HRY A;  5LFA A;  3W9G A;  3QOU A;  1N0R A;  1OT8 A;  3L22 A;  1JCQ A;  3OTN A;  1HZ4 A;  3SHF A;  4UWK A;  2AXZ A;  4PS7 A;  3DEP A;  4XEI G;  2R03 A;  5BW8 C;  2ETA A;  3CQG B;  5C2Y A;  4U0S A;  4OVU A;  4EZL A;  4OYS A;  3I5P A;  4F6R D;  4N5Q A;  4L2Y A;  1MZC A;  5D66 A;  3ULQ A;  4J7W A;  3CHO A;  2YHC A;  5CCL A;  3MCX A;  4G8K A;  3C72 A;  1OY3 D;  2BTD A;  1HE8 A;  2GRL A;  3I3N A;  3MYV A;  4LEU A;  1OWP A;  2A4Z A;  3HDX A;  4CDM A;  3V79 K;  1MYO A;  4JVS A;  4NRH B;  1TN7 A;  2RFA A;  3CVW A;  5FJY A;  3Q4A B;  3UM2 A;  3S2A A;  3PH0 C;  3BG1 B;  4K5B A;  4JW1 A;  1NA3 A;  1PY1 A;  4B89 A;  4U63 A;  2P2C P;  4UQZ A;  4NIK A;  5AAR A;  3QKY A;  2F37 A;  4BY6 A;  4GMJ A;  1N0Q A;  3ZFW A;  3DSX A;  3RAU A;  3LVQ E;  3SGH A;  1DC2 A;  3TAX A;  2R02 A;  3Q73 A;  4DLQ A;  1E90 A;  3ESK A;  4C0E A;  3OXL A;  5AJL A;  4L2L A;  5KNG A;  2XZT G;  3HIZ A;  3Q79 A;  2Y1L E;  4IRU A;  4Y6C A;  3ENE A;  3AG1 E;  4GTT A;  2XPZ A;  1UJK A;  2XCC A;  5HQ8 A;  4GAA A;  3UM3 A;  4IYP A;  2A5E A;  4UQY A;  1NI1 A;  1FCH A;  4IN3 B;  4O6F A;  2GRM A;  3APF A;  4CEM A;  2GGF A;  2B0O E;  4FJY A;  5KCM A;  2CG3 A;  3KEZ A;  4HBD A;  2WMO A;  4J6I A;  3BEE A;  3ONK A;  3IKO B;  3PVL A;  5B1B E;  3FTW A;  5BV0 A;  2VSX E;  2VYI A;  1V55 E;  2V5Q C;  3TL5 A;  1HX8 A;  3FEY A;  5JHB A;  3RU0 A;  3GZS A;  4LNU D;  3LY7 A;  4H7X A;  5CRV A;  4ABN A;  4GZ6 A;  3O4Z A;  3HVE A;  1WY6 A;  3ZHE B;  4JD2 G;  4AP2 A;  2WXF A;  4KZC A;  2NYJ A;  3DPY A;  4BT8 A;  4HRN A;  2ETC A;  4GA0 A;  3L6A A;  4LNG A;  1MX4 A;  3E33 A;  3D9L A;  1WG0 A;  3QK0 A;  2PQR A;  5LCW J;  4XKB A;  2AXU A;  4AV7 A;  1MQS A;  3V30 A;  3CKC A;  3ZGQ A;  1BI8 B;  3VLD A;  3AU5 A;  3TWQ A;  4AM9 A;  3APD A;  1S64 A;  5CBO A;  2LO6 A;  5ENS D;  4GZ5 A;  2IOL A;  3D9J A;  3ZUV B;  1FT1 A;  4WWP A;  1NZN A;  4N5C A;  4P29 A;  3ULY A;  2WB2 A;  5AQ9 A;  3PEU B;  4XX5 A;  4I1M A;  2DWZ A;  3VTX A;  3URZ A;  1N4Q A;  3E34 A;  4I17 A;  1OCZ E;  4LSZ E;  4G26 A;  4U07 A;  4FLB A;  3FH5 A;  1P5Q A;  3TWU A;  3PZ4 A;  3EU5 A;  2BUG A;  3ASO E;  3FU6 A;  5DBK A;  4DX7 D;  4O60 A;  3FUL A;  1H19 A;  2GRO B;  1SQM A;  1H2T C;  2WXI A;  2FF4 A;  3ZHE A;  2VSN A;  4DK5 A;  2J09 A;  5D0Q D;  2LAH A;  1HXI A;  4F53 A;  4KVO A;  5AEN A;  5EIL A;  4GCO A;  3FUE A;  3UMV A;  4CRW A;  2V5F A;  5ANR A;  4N2S A;  2GRN B;  3CVN A;  5KBA A;  3APC A;  4AY5 A;  2CHX A;  2UY1 B;  2J08 A;  3ZKJ A;  3Q7A A;  5EX0 A;  2XS8 A;  1IXV A;  3NF1 A;  3PE4 A;  4BTA A;  4WNE A;  3SO8 A;  4BFR A;  2ZXW E;  1ZU2 A;  4HOS A;  5LP0 A;  4YDY A;  4WNF A;  2OVB A;  2R05 A;  5KJK A;  1E7U A;  1A17 A;  3ZRH A;  4OAU C;  4I2Z A;  2WQ6 A;  5CEC B;  3SQV A;  1E7V A;  1TJF A;  2NSZ A;  2AVP A;  1OUV A;  3SBT B;  4O1O A;  1RZ4 A;  5LOZ A;  1WAO 1;  3CVY A;  5BV1 A;  4ZHB A;  4K5A B;  3LPZ A;  4NQ0 A;  4CYM D;  2KBX A;  1N4P A;  3ESL A;  1TNZ A;  4AVX A;  2C2L A;  3CK9 A;  4EPZ A;  4B94 A;  2LNI A;  4HRL A;  3PNL B;  3EIQ C;  4A1G A;  2PZI A;  3ZXS A;  4GTQ A;  4AY6 A;  3CVL A;  3EDT B;  3UTM A;  2P58 C;  4LUN U;  2OV8 A;  4U0U A;  4RLY A;  4BT9 A;  3UXG A;  2CFU A;  2LXM A;  2EIK E;  1N95 A;  4PH4 B;  3HYM B;  1E8Z A;  3C98 A;  2PL2 A;  4YDO A;  3AS8 A;  1FVF A;  3PEV B;  2ETB A;  3CGH A;  3GYZ A;  4GZ3 A;  1OWO A;  2XPY A;  4UI9 J;  2FO7 A;  3ML9 A;  3E4B A;  3RK6 A;  1ELW A;  1IKN D;  1QNF A;  2J49 A;  5CER B;  2LXL A;  4CT4 A;  2VTB B;  1LF8 A;  3FTV A;  3IEG A;  1V54 E;  1NL4 A;  2QZA A;  2IO2 C;  2P9U G;  2PNN A;  3GZ2 A;  5EX3 A;  3PRZ A;  2JLB A;  3PZ3 A;  4A63 B;  4G11 A;  5ENN A;  2J8S D;  2R59 A;  4F3V A;  4C9B B;  2KZT B;  4GYO A;  2EIM E;  3G2T A;  3ISM C;  1HO8 A;  5BNW A;  4CT0 A;  4CDN A;  3PE3 A;  3CVV A;  2Y0B G;  2JEK A;  2I1K A;  3KAE A;  1ZBP A;  5FQ6 A;  2LSU A;  4EZJ A;  5FZQ A;  2PM7 A;  3NQP A;  3LKU A;  3Q49 B;  2R2L A;  5D0O D;  4GCN A;  1N54 A;  1E96 B;  4KYO B;  1TEZ A;  3QWV A;  3RRN B;  2M63 A;  3FUM A;  1IQU A;  3FEX A;  3DWL G;  2QYU A;  2UY1 A;  4N3C A;  4R7L A;  2VSY A;  3D9O A;  5BPP A;  2B6C A;  3JYS A;  3JQ0 A;  3UIO C;  4J8S A;  4UWH A;  5ENP D;  5EYL A;  4BWR A;  3E32 A;  4HLL A;  2HR2 A;  2XZD G;  2V4L A;  4GPM A;  2MOW A;  4JEU A;  1KLX A;  3CST A;  1DCE A;  3T8K A;  3EUV A;  4ANV A;  5FZS A;  3S7B A;  1HFA A;  3PZ2 A;  3EIJ A;  3CK7 A;  4I9E A;  4WAF A;  4I6J A;  3TGO A;  5E76 A;  1SZ9 A;  1UW4 B;  4LER A;  3KSL A;  1E8W A;  2AJA A;  2ION A;  3O48 A;  4DI3 A;  3FTU A;  3TWV A;  2R17 C;  4MBG A;  2PQN A;  2VGX B;  2E0I A;  1N9A A;  4JHJ A;  5G05 C;  4ME2 A;  1E8X A;  3U64 A;  1WM5 A;  1HS6 A;  5KJM A;  1OWM A;  1OCO E;  2WVI A;  2A5U A;  1ELK A;  1XNF A;  3TWX A;  4N2Q A;  5CED B;  3Q9N C;  4HVB A;  5A6C A;  3ABL E;  2XEV A;  2OVF A;  2IJG X;  4HOQ A;  4Y6W A;  3UKR G;  1MJ0 A;  2ZIR A;  4DPR A;  4B8C B;  2XRZ A;  4N39 A;  2X6K A;  1BI7 B;  4GA1 A;  3V2O A;  4BER A;  2P9P G;  3ZYQ A;  3OXG A;  1HF8 A;  2MYO A;  2XHE A;  3UIN C;  3ASG A;  5AAO A;  2E2E A;  5EN5 D;  4DI4 A;  1FVH A;  3MA5 A;  3ZN3 A;  5AJD A;  4RQI A;  4L7T A;  1HG5 A;  2ZGG A;  1U3D A;  2IF4 A;  3ASF A;  4MKT A;  3MKR A;  1PAQ A;  2PM6 A;  3ZU7 B;  3CHM A;  4L1B A;  2IOS A;  2WXN A;  1OWN A;  3EHM A;  1AWC B;  3UT4 A;  2YQ8 A;  1EPU A;  4RG6 A;  4B93 B;  3SY2 A;  4G23 A;  4M3O A;  2KCL A;  4GTS A;  2H6G A;  2WXP A;  3PNT B;  4BET A;  5LX8 A;  5ENT D;  5IY5 E;  4C48 B;  3WXX A;  5EIB E;  3TG5 A;  4KZ0 A;  4TRQ A;  5AQB A;  3QAR A;  3D9N A;  3HXB A;  4U04 A;  5AQA A;  1OCR E;  4WND A;  1O1S A;  2GRR B;  2L9B A;  2WXJ A;  3T5X A;  2XGS A;  4JA9 A;  3MJW A;  2KAT A;  4Q96 A;  2Y69 E;  3D9P A;  2RFM A;  3F6Q A;  3NOC D;  4YVQ C;  2X6J A;  3ZYK A;  3QJZ A;  2WXQ A;  1HH8 A;  5G2N A;  1JCR A;  2V4H C;  2CFZ A;  5AYW D;  3SZ7 A;  1G3N B;  2XEN A;  3QAQ A;  3FUN A;  3CR3 A;  1EDU A;  3S7D A;  4HB5 A;  2HO1 A;  2QYJ A;  3EU9 A;  5FT9 A;  5FQ8 A;  2WQ7 A;  1S70 B;  3AAA C;  3R9M A;  4QFV A;  2XCB A;  3D9K A;  2HE0 A;  3V2X A;  4K5C A;  1WDY A;  2H6F A;  5AQ7 A;  4ILI A;  4JA7 A;  3MKQ B;  4U8Y D;  4HQD A;  3ZEF A;  3LY8 A;  4D10 C;  1D9S A;  1KPS B;  1N94 A;  4ANW A;  3C5R A;  3G2U A;  3IHY A;  2J4B A;  1JPL A;  4PDX A;  5T4Y A;  3EJN A;  4GTO A;  3B7B A;  3ABM E;  4I43 A;  4PS8 A;  4B0Z A;  4GTM A;  2RKK A;  3ZPJ A;  3HRA A;  4U7E B;  3TWW A;  3VLF A;  2VSO E;  1BLX B;  1NFI E;  4I1O B;  2FO1 E;  4RG9 A;  5FQ7 A;  5G04 J;  3LY9 A;  3ZIM A;  2FI7 A;  2CHZ A;  3JXJ A;  4MS6 A;  3L9T A;  3FUJ A;  3VTY A;  3TXM A;  1U2V G;  3B95 A;  1YYH A;  1E8Y A;  2FEZ A;  4A55 A;  2QFC A;  4GYY A;  3FU5 A;  3KS2 A;  2AWI A;  3MZL B;  5ENQ D;  4AEZ C;  4DX2 A;  4HOU A;  1PC2 A;  3CLJ A;  3ZYL A;  4LCT A;  3LCA A;  3JUI A;  4I1A A;  3QDN A;  1IHG A;  2ZU6 B;  2LUH A;  4EEC A;  2VGX A;  1S0P A;  3J5Q B;  2L0I A;  1N11 A;  3DBS A;  3ZYM A;  1KZO A;  3FU0 A;  4MLP A;  5FZR A;  3B7T A;  3X2Q E;  3B7U X;  5FIO A;  4ILH B;  3ASN E;  1TNY A;  5B3S E;  3P1U A;  4TUM A;  4FA6 A;  2KXP C;  2I2O A;  4HOR A;  3CK8 A;  3CVP A;  4J8D A;  1SA4 A;  2AW6 A;  4EQF A;  4C0M A;  2X6H A;  3D9M A;  3FH8 A;  4RSY A;  4YDE A;  2P9N G;  3FFL A;  1SZA A;  3I4R B;  2WXO A;  3B7R L;  3PUK A;  4BX8 A;  5HKP A;  3Q9U C;  2FUL A;  4G2V A;  5HS0 A;  4FLH A;  4E85 A;  3FHE A;  2VQ2 A;  1D8D A;  3FUK A;  1EF1 C;  1LTX A;  1UG3 A;  2BF0 X;  1NP7 A;  3UPV A;  4GU5 A;  3UT7 A;  4GZC A;  1YMP A;  4K0R A;  3BQO A;  3CVX A;  2OCC E;  3Q7F A;  3W9F A;  1H2V C;  3PZ1 A;  4JEH A;  4ATG A;  1Y6I A;  2CHW A;  4FU3 A;  4JB8 P;  1K3Z D;  2OEV A;  5HI7 A;  4BSX A;  3LEW A;  1Q2Z A;  1JUQ A;  4Q69 A;  3RRM B;  4L9P A;  3HHM A;  4APO A;  4JHK A;  3C3R A;  2WMN A;  5C1D A;  3DXK G;  1MX6 A;  3ONL A;  3HVE B;  1QYM A;  3NZS A;  3CKB A;  5BXU A;  4UWG A;  2X6F A;  4DX1 A;  1ELR A;  2MRI A;  3Q75 A;  1KT1 A;  3ASH A;  2QY7 A;  3E30 A;  3PS6 A;  3ZNG A;  1XGW A;  4FAD A;  2DVW A;  4GTR A;  3D9H A;  4DX5 D;  3B13 A;  4J8F A;  4WNG A;  2ZIS A;  2FBN A;  4NUR A;  4LRZ A;  4ZFH A;  4A3T A;  1HU3 A;  5JJ7 A;  3DEO A;  4YVO A;  3GZ1 A;  4GTV A;  4TXQ A;  3PZD A;  3TXN A;  2VTB A;  1TJC A;  3N71 A;  4HOT A;  1AP7 A;  4A1S A;  3UM1 A;  1DCQ A;  4EHM A;  5AIJ A;  3K9I A;  1Z3Y A;  1X81 A;  3EHR A;  4BES A;  4FHJ A;  4HS2 A;  5CHE E;  3DPD A;  5EYP F;  4ANU A;  5BT1 A;  4U8H A;  1NA0 A;  2X3M A;  3CQC B;  4CGW A;  1TN8 A;  3FWV A;  3EHN A;  4FHK A;  4JC8 A;  5G05 J;  4ATZ D;  5FWQ A;  1QBQ A;  2RG8 A;  3FDH A;  2YNQ A;  2F8Y A;  1UN8 A;  3TWS A;  3ML8 A;  4JXT A;  4JZY A;  3TG4 A;  2X6I A;  3FUI A;  5G04 C;  3RRU A;  3FUF A;  2OEW A;  4V3I A;  1YCS B;  3D9I A;  3UQ3 A;  3UIP C;  3TWR A;  4X8Q A;  2WPV A;  4U0Z A;  4DLO A;  3NB2 A;  4I6E A;  2I6H A;  3G2S A;  4TXP A;  1TN6 A;  4H7Y A;  3AU4 A;  3T9K A;  3CEQ A;  3G2V A;  1K1B A;  4JHR A;  3S7J A;  5T3R A;  5CEA A;  1QQE A;  5E75 A;  4CZ2 D;  3KSQ A;  3WG7 E;  1N4S A;  5JJT A;  5CCM A;  5A23 A;  4LG6 A;  5CBN A;  3ASD A;  4A3V A;  1SVX A;  4GTP A;  3TJP A;  4EBA G;  3IXE A;  3JQ1 A;  2XGM A;  3L82 A;  2EIL E;  3MV2 B;  3RSE G;  3TWT A;  2XEH A;  3DSU A;  2DBA A;  4BX9 A;  2V8S E;  3Q47 B;  3OAW A;  4XE0 A;  3UM0 A;  4HLE A;  1H6O A;  3MGB A;  3HXF A;  4TV3 A;  1BU9 A;  2YHE A;  2IY0 C;  3BUA A;  1RW2 A;  1INZ A;  2HYZ A;  1B89 A;  3AG3 E;  3BG0 B;  5FQ4 A;  5KJN A;  2EIJ E;  1H2U A;  5ENO D;  3QWW A;  1N52 A;  4FUL A;  4GML A;  5EKQ D;  4KBQ A;  2KM4 A;  4EZK A;  2L0T B;  5M72 A;  2ZGD A;  2KCK A;  3RO3 A;  3QB2 A;  3FUH A;  4I6G A;  1H0A A;  2I9C A;  1D8E A;  3LDZ A;  3G2W A;  3IV0 A;  2J4D A;  4NAC A;  4N3B A;  4HRM B;  5EDS A;  1H6P A;  4EBA A;  4WWO A;  5JA4 D;  4I9C A;  2R5S A;  5A7D B;  4DJA A;  2C0M A;  3U66 A;  1DVP A;  1K8K G;  3HXE A;  4KVM A;  5B1A E;  4Z68 A;  3CV0 A;  2IO3 C;  4HI8 A;  4KMO A;  4F1S A;  3P2B A;  4UI9 K;  4JPS A;  5KWD A;  4WUY A;  4AJW A;  2L6B A;  4KXK B;  5KJL A;  5BXO A;  1JCS A;  2DZO A;  4J0U A;  2DZN A;  2WXL A;  3U3W A;  3R7R A;  3KD7 A;  1TNO A;  4RVB A;  3RO2 A;  3FTY A;  2UWJ G;  1ZB1 A;  1TYQ G;  2F8X K;  2H6I A;  3IHV A;  4I2W A;  4F1P A;  3L54 A;  1FPP A;  2Y4T A;  3ULE G;  2GRP B;  3CIA A;  3L08 A;  1LD7 A;  3UKU G;  1EYH A;  2P9K G;  4M7C A;  5ITZ F;  4OAV B;  3Q78 A; 
#chains in the Genus database with same CATH homology
 5FZR A;  2RD0 A;  4G11 A;  4FP7 A;  5ENN A;  4CDR A;  2WQH A;  3B7T A;  4FC8 A;  2R59 A;  4JVS A;  3B7U X;  4MRU A;  5ARF A;  2XGO A;  4F3V A;  4ILH B;  1OWL A;  4NRH B;  4C9B B;  2KZT B;  4GYO A;  3P1U A;  3CVW A;  1X5B A;  5FJY A;  4FA6 A;  3G2T A;  1HO8 A;  5BNW A;  2WXK A;  3Q4A B;  5BUZ A;  2I2O A;  4CT0 A;  4HOR A;  3CK8 A;  3CVP A;  4CDN A;  4J8D A;  3PE3 A;  3S2A A;  3PH0 C;  3BG1 B;  5ARG A;  3CVV A;  2JEK A;  2I1K A;  3KAE A;  4JW1 A;  1NA3 A;  2AW6 A;  2I1J A;  4EQF A;  1PY1 A;  4B89 A;  1ZBP A;  4C0M A;  5FQ6 A;  2LSU A;  2X6H A;  3D9M A;  3FH8 A;  5FZQ A;  4RSY A;  4U63 A;  4EZJ A;  4UQZ A;  5J90 A;  2PM7 A;  4GA2 A;  3NQP A;  3LKU A;  3Q49 B;  3FFL A;  3MKQ A;  1SZA A;  3I4R B;  2WXO A;  5D0O D;  3QKY A;  4GCN A;  1N54 A;  4PS3 A;  1E96 B;  4BY6 A;  2WXR A;  3B7R L;  3PUK A;  4KYO B;  4BX8 A;  4GMJ A;  3CVU A;  1TEZ A;  2FUL A;  3QWV A;  4G2V A;  4FLH A;  3ZFW A;  4E85 A;  3RRN B;  3FHE A;  2VQ2 A;  2M63 A;  3FUK A;  1EF1 C;  3LVQ E;  3FUM A;  3SGH A;  4N3A A;  3TAX A;  4F7A A;  4IUL A;  1IQU A;  1UG3 A;  3FEX A;  2BF0 X;  3PDN A;  1NP7 A;  2UY1 A;  4XI0 A;  4DLQ A;  3UPV A;  1E90 A;  4GU5 A;  2KZT A;  3UT7 A;  4GZC A;  1Y8M A;  2CG2 A;  3ESK A;  4B8A A;  4N3C A;  4R7L A;  4K0R A;  3FUD A;  4C0E A;  2VSY A;  3D9O A;  3D3M A;  4ANX A;  3OXL A;  5BPP A;  5AJL A;  3CVX A;  4G24 A;  3JYS A;  3FH7 A;  4L2L A;  3JQ0 A;  1Z3X A;  1H2V C;  4JEH A;  4J8S A;  4UWH A;  4ATG A;  4HFG A;  1GW6 A;  3HIZ A;  4BWR A;  2HR2 A;  1Y6I A;  1VDY A;  2V4L A;  3MV3 B;  5ANL A;  2MOW A;  3CHP A;  4IRU A;  4Y6C A;  2CHW A;  4JEU A;  1KLX A;  3CST A;  4XZ4 A;  3ENE A;  4FU3 A;  5JJ6 A;  2XPZ A;  5HI7 A;  1YA0 A;  1UJK A;  4UWL A;  3LEW A;  2XCC A;  4AXH A;  2L6J A;  4ANV A;  4BSX A;  5FZS A;  5HQ8 A;  3S7B A;  4GAA A;  1HFA A;  1JUQ A;  3EIJ A;  4IYP A;  2LSV A;  4Q69 A;  4UQY A;  3RRM B;  3CK7 A;  1FCH A;  4IN3 B;  4I9E A;  4O6F A;  2GRM A;  3APF A;  4WAF A;  4ILG A;  4I6J A;  2GGF A;  3B7S A;  4CEM A;  2GW1 A;  3TGO A;  5E76 A;  3U9W A;  4FJY A;  1UJJ A;  3CHS A;  5KCM A;  1SZ9 A;  3HHM A;  1UW4 B;  2CG3 A;  4APO A;  3KEZ A;  4JHK A;  4UI9 C;  4LER A;  2WMO A;  2WMN A;  1E8W A;  5C1D A;  2ION A;  3O48 A;  4J6I A;  4DI3 A;  5BV1 A;  3ONL A;  2IQC A;  3HVE B;  3FTU A;  3NZS A;  1H6K A;  2R17 C;  3BEE A;  3CKB A;  4UWG A;  3ONK A;  3IKO B;  2OOE A;  2PQN A;  3PVL A;  2X6F A;  2VGX B;  2IU1 A;  1ELR A;  3FTW A;  2E0I A;  2MRI A;  4G1T A;  1KT1 A;  5BV0 A;  2VSX E;  3ASH A;  2QY7 A;  2VYI A;  3FP3 A;  3SNX A;  3PS6 A;  4JHJ A;  5G05 C;  1XGW A;  3TL5 A;  4ME2 A;  4FAD A;  1E8X A;  1HX8 A;  3FEY A;  5FTP A;  5JHB A;  4OVV A;  3U64 A;  3RU0 A;  1WM5 A;  4TUU A;  3GZS A;  1HS6 A;  5KJM A;  1OWM A;  2WVI A;  3B13 A;  3LY7 A;  4H7X A;  4J8F A;  4WNG A;  4ABN A;  4CGV A;  4GZ6 A;  4XIF A;  2A5U A;  1ELK A;  3HVE A;  3O4Z A;  1WY6 A;  2FBN A;  4NUR A;  3ZHE B;  3QNK A;  4FJZ A;  1XNF A;  2WXF A;  4LRZ A;  4KZC A;  4A3T A;  1HU3 A;  3L13 A;  4AP2 A;  3UUX A;  3ZW3 A;  2IFU A;  5JJ7 A;  4N2Q A;  4BT8 A;  2XQ0 A;  4YVO A;  3GZ1 A;  4HVB A;  4GA0 A;  3PZD A;  3TXN A;  5A6C A;  4XI9 A;  2VTB A;  1TJC A;  2XEV A;  3L6A A;  3N71 A;  2OVF A;  2IJG X;  4HOQ A;  1U3C A;  3D9L A;  4GPK A;  4HOT A;  1W3B A;  4Y6W A;  3QK0 A;  4A1S A;  3AS5 A;  2PQR A;  1JWG A;  5AIJ A;  3K9I A;  4GZD A;  5T8I A;  4XKB A;  5LCW J;  4DPR A;  2AXU A;  4AV7 A;  3I4G A;  4B8C B;  2XRZ A;  1Z3Y A;  1MQS A;  1IYG A;  3CKC A;  4N39 A;  5CMW A;  3ZGQ A;  2C0L A;  2X6K A;  4FHJ A;  3AU5 A;  3VLD A;  3RKV A;  4GA1 A;  4URK A;  4HS2 A;  5CHE E;  3DPD A;  3ZYQ A;  3OXG A;  4AM9 A;  3APD A;  1HF8 A;  2NC9 A;  4ANU A;  5BT1 A;  4W9R A;  2LO6 A;  2XHE A;  3ASG A;  4U8H A;  4GZ5 A;  2IOL A;  2E2E A;  4DI4 A;  1FVH A;  3MA5 A;  3ZN3 A;  1NA0 A;  2VJ8 A;  5AJD A;  3D9J A;  2X3M A;  3CQC B;  4CGW A;  4L7T A;  3FWV A;  1HG5 A;  3EHN A;  4FHK A;  4JC8 A;  2KCV A;  1U3D A;  2IF4 A;  3ASF A;  4MKT A;  4YND A;  4WWP A;  2Q7F A;  3Q5M A;  3MKR A;  4G25 A;  3AS4 A;  1NZN A;  4AOF A;  3FTZ A;  4N5C A;  4P29 A;  1PAQ A;  3CHR A;  3RIB A;  5FWQ A;  2PM6 A;  2XRY A;  2RG8 A;  4XKC A;  3FDH A;  2WB2 A;  2YNQ A;  3PEU B;  5JHA A;  3CHM A;  4L1B A;  4XX5 A;  3R7Q A;  1UN8 A;  4I1M A;  3ML8 A;  2IOS A;  3MX3 A;  2WXN A;  4JXT A;  3LXU X;  4JZY A;  3VTX A;  1OWN A;  3EHM A;  3URZ A;  3TG4 A;  2X6I A;  3UT4 A;  3PUJ A;  3FUI A;  4I17 A;  2OND A;  3FTX A;  2YQ8 A;  1EPU A;  4RG6 A;  5G04 C;  4G26 A;  4U07 A;  4FLB A;  3RRU A;  3FUF A;  4ACL A;  3FH5 A;  1P5Q A;  3OXF A;  4G23 A;  4M3O A;  4V3I A;  3D9I A;  3UQ3 A;  3L17 A;  4J8E A;  2KCL A;  2BUG A;  2WXP A;  3PRE A;  2WPV A;  4U0Z A;  3U4T A;  4DLO A;  3FU6 A;  4I6E A;  2I6H A;  3G2S A;  5DBK A;  3PNT B;  4AIF A;  5LX8 A;  2EQX A;  4H7Y A;  3AU4 A;  3LJ3 A;  2YIN A;  3FUL A;  3CEQ A;  1H19 A;  3WXX A;  1SQM A;  1H2T C;  3G2V A;  2WXI A;  4JHR A;  3TG5 A;  2FF4 A;  3ZHE A;  2VSN A;  3S7J A;  4KZ0 A;  4TRQ A;  3QAR A;  5T3R A;  3D9N A;  4DK5 A;  1MHQ A;  4U04 A;  2J09 A;  2J9Q A;  1QQE A;  5D0Q D;  5E75 A;  1BPO A;  2LAH A;  1HXI A;  1DNP A;  5JJT A;  4WND A;  2V0P A;  4PUC A;  4F53 A;  4KVO A;  3IBE A;  2L9B A;  5A23 A;  5AEN A;  5CCM A;  2WXG A;  4GCO A;  3FUE A;  2WXJ A;  3L16 A;  3UMV A;  3ASD A;  4A3V A;  3T5X A;  4CRW A;  2XGS A;  3R9A B;  2Y3A A;  2V5F A;  4K03 A;  5ANR A;  2HM8 A;  4JA9 A;  4N2S A;  3MJW A;  2KAT A;  2VGY A;  4Q96 A;  3TJP A;  3D9P A;  5CMY A;  3CVN A;  2DIW A;  3APC A;  4AY5 A;  2CHX A;  2UY1 B;  2J08 A;  2X6J A;  4YVQ C;  3ZYK A;  4EBA G;  3QJZ A;  3JQ1 A;  2XGM A;  2WXQ A;  1HH8 A;  4JL0 A;  5G2N A;  3MV2 B;  4APF A;  2NXP A;  5EX0 A;  3QWP A;  2CFZ A;  3PE4 A;  3NF1 A;  5AYW D;  4BTA A;  3SZ7 A;  4WNE A;  5J08 A;  3RJV A;  3QAQ A;  1L5J A;  3MEK A;  2Y4U A;  3FUN A;  4BFR A;  3CR3 A;  1EDU A;  3S7D A;  2DBA A;  3GW4 A;  4BX9 A;  3LYA A;  1ZU2 A;  2V8S E;  3FU3 A;  4GYW A;  4KT6 B;  2HO1 A;  3NZU A;  3LVR E;  3Q47 B;  5FT9 A;  2KC7 A;  5FQ8 A;  4HOS A;  5LP0 A;  1IQR A;  1JWF A;  3QC1 A;  3OAW A;  2WQ7 A;  4WNF A;  4XE0 A;  2OVB A;  3SF4 A;  4HLE A;  3MGB A;  5KJK A;  3UX4 A;  1E7U A;  4TV3 A;  4QFV A;  3SI5 A;  1A17 A;  1Z6T A;  2XCB A;  3ZRH A;  2WM9 A;  3D9K A;  3UT8 A;  4BTB A;  2YHE A;  4I2Z A;  4GB9 A;  3JCK C;  1UN9 A;  2WQ6 A;  1INZ A;  2HYZ A;  3CVQ A;  1B89 A;  4HXI A;  3BG0 B;  3FY4 A;  5FQ4 A;  1E7V A;  1TJF A;  4WWN A;  3SFZ A;  2NSZ A;  2AVP A;  1OUV A;  3SBT B;  3VLE A;  5KJN A;  1H2U A;  2AXV A;  5LOZ A;  2DCP A;  4ILI A;  3QWW A;  1N52 A;  1WAO 1;  3MKQ B;  4FUL A;  4JA7 A;  5G05 J;  4GML A;  3CVY A;  5EKQ D;  4KBQ A;  2KM4 A;  4NQ0 A;  3LPZ A;  3ZEF A;  3LY8 A;  4EZK A;  4D10 C;  2LAI A;  3SD5 A;  2L0T B;  5LCW C;  3T5V A;  5M72 A;  3ESL A;  4ANW A;  3G2U A;  4AVX A;  2KCK A;  3RO3 A;  3QB2 A;  2C2L A;  3FUH A;  3IHY A;  3CK9 A;  2J4B A;  3Q15 A;  3SBS A;  4EPZ A;  4I6G A;  1JPL A;  4B94 A;  1H0A A;  4PDX A;  2I9C A;  2J07 A;  5T4Y A;  2LNI A;  3LDZ A;  3PNL B;  3EIQ C;  4Q94 A;  3G2W A;  3EJN A;  4A1G A;  3IV0 A;  3LS8 A;  5G55 A;  3S7F A;  2PZI A;  3ZXS A;  2J4D A;  4L23 A;  4AY6 A;  3CVL A;  2X38 A;  4I43 A;  3EDT B;  4NAC A;  2MHK A;  2P58 C;  1HG2 A;  4LUN U;  4N3B A;  4PS8 A;  4UQX A;  4E6H A;  4B0Z A;  4CCA A;  3CHQ A;  2OV8 A;  3ZPJ A;  4ACK A;  4U0U A;  5EDS A;  1QZ2 A;  4EBA A;  4WWO A;  4I9C A;  3FTS A;  2R5S A;  5A7D B;  4BT9 A;  3VLF A;  2CFU A;  2VSO E;  4DJA A;  3CSF A;  4UWF A;  2ILR A;  1KT0 A;  4PH4 B;  5DIZ A;  3HYM B;  2C0M A;  2WXM A;  1DVP A;  1E8Z A;  3C98 A;  3U66 A;  2PL2 A;  3ZVV A;  2WXH A;  4KVM A;  4I1O B;  3AS8 A;  4RG9 A;  2XPI A;  5LFA A;  3QOU A;  3L22 A;  3CV0 A;  5FQ7 A;  5G04 J;  3LY9 A;  3ZIM A;  1FVF A;  4KMO A;  3PEV B;  2FI7 A;  1HZ4 A;  3OTN A;  4F1S A;  3SHF A;  3P2B A;  2CHZ A;  4UWK A;  3CGH A;  2AXZ A;  3GYZ A;  4GZ3 A;  4MS6 A;  4UI9 K;  1OWO A;  2XPY A;  3FUJ A;  4JPS A;  4PS7 A;  3VTY A;  4WUY A;  3TXM A;  4UI9 J;  2FO7 A;  4AJW A;  3ML9 A;  5BW8 C;  1E8Y A;  2FEZ A;  4KXK B;  5KJL A;  3CQG B;  4A55 A;  2QFC A;  3E4B A;  4GYY A;  3FU5 A;  5C2Y A;  3RK6 A;  1ELW A;  3KS2 A;  4U0S A;  4J0U A;  4OVU A;  4EZL A;  2AWI A;  4OYS A;  2WXL A;  3U3W A;  3R7R A;  3MZL B;  3I5P A;  3KD7 A;  4AEZ C;  4RVB A;  3RO2 A;  4L2Y A;  4HOU A;  3FTY A;  1PC2 A;  1QNF A;  2J49 A;  3CLJ A;  2UWJ G;  3T8M A;  3ZYL A;  4LCT A;  4CT4 A;  2VTB B;  1LF8 A;  3FTV A;  3IHV A;  4I2W A;  3IEG A;  3LCA A;  3JUI A;  3ULQ A;  3L54 A;  3CHO A;  4I1A A;  2YHC A;  1IHG A;  2ZU6 B;  3QDN A;  2Y4T A;  4EEC A;  2VGX A;  5CCL A;  1S0P A;  3MCX A;  2L0I A;  3CIA A;  3L08 A;  1EYH A;  3DBS A;  3GZ2 A;  5EX3 A;  3ZYM A;  2BTD A;  1HE8 A;  3FU0 A;  2GRL A;  3I3N A;  3MYV A;  4LEU A;  1OWP A;  2A4Z A;  3HDX A;  3PRZ A;  2JLB A;  4CDM A;  4MLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...