4Q69A

Crystal structure of a susd homolog (bt2259) from bacteroides thetaiotaomicron vpi-5482 at 2.50 a resolution
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
456
structure length
456
Chain Sequence
PNTAEKVDPGYLFNYVAVNWAGTRTGGDFYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEADPVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEALQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGGMVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFEPGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGLGVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWIDLMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKIWEKLWFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a SusD homolog (BT2259) from Bacteroides thetaiotaomicron VPI-5482 at 2.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords Putative lipoprotein
total genus 143
structure length 456
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4q69A00
5LX8A 3CK7A 3MYVA 3JQ1A 5J90A 4LERA 3L22A 3CGHA 3JQ0A 4L7TA 3NQPA 3EJNA 3CK8A 5FQ7A 3FDHA 3SGHA 3GZSA 3QNKA 3JYSA 5FQ8A 3MCXA 5T4YA 3I4GA 5FQ6A 3EHMA 3CKCA 3CK9A 3CKBA 5FQ4A 4PUCA 3LEWA 3SNXA 4F53A 4F7AA 4Q69A 3OTNA 5E75A 3EHNA 3MX3A 5E76A 3KEZA 3P1UA 5T3RA 4MRUA 3IV0A 3HDXA
chains in the Genus database with same CATH superfamily
4GZ6A 2VTBB 1UJKA 1IQRA 2AW6A 3QNKA 3HXFA 3LVQE 4Z68A 5H7PA 4U8VD 1OUVA 3U64A 4N3CA 4GMJA 1H6OA 2C0MA 4GYWA 4QFVA 2FO7A 4UWKA 1S64A 1KZOA 5AYWD 3UINC 2CFUA 3FUIA 4FJZA 1NFIE 3UM1A 3DSSA 2GRRB 4CDNA 4J0UA 3LEWA 3FU3A 1DCEA 2RD0A 1LF8A 4ANUA 4DK5A 4FU3A 4ZFHA 2XCBA 4I2WA 3OXLA 1GW6A 1TEZA 1Z3YA 2R59A 4WNDA 3VLDA 3Q73A 1FCHA 3FULA 1MYOA 3BU8A 5FINA 3KSLA 2V4HC 4LNGA 3EJNA 1UJJA 2XGMA 1SQMA 4U7EB 1EDUA 2WXFA 1ELWA 3ZUVB 3DRAA 3D9HA 3ML9A 2P9IG 4RSYA 1NI1A 4H7XA 4ZHBA 3LDZA 4UQYA 4A1SA 2E0IA 3ZU7B 3G2UA 5CRUA 4N3BA 4DJAA 3B7RL 2ETCA 5JHAA 2J07A 2P9UG 2VGXA 3S2AA 2J09A 2HO1A 2XEHA 2I9CA 5D66A 4DRXE 4BETA 2XCCA 3FU0A 2X38A 1ZB1A 3JYSA 1H6KA 3RAUA 4G25A 3PE3A 3B7UX 4I1OB 1E8YA 4NIKA 4JHRA 3FUMA 1Z5SC 3RU0A 2GW1A 1FVHA 3EHQA 4XI0A 4MRUA 2OEVA 3JUEA 4HRMB 4GA1A 1Q2ZA 4EPZA 2H6GA 2OV8A 2V0PA 3ZNGA 2FULA 4JL0A 4JXTA 3FTXA 4CT4A 3LXUX 3CHRA 1E7VA 3ASGA 5AJDA 1UN8A 2L9BA 3HG0D 4F53A 3LY7A 3B95A 2V5FA 3PEVB 4GYYA 3CK7A 2A4ZA 1SZAA 3L16A 2M63A 1K8KG 4DX1A 3HYMB 4B8CB 2QFCA 4LNBA 2AVPA 3IEGA 4CDMA 3FTWA 4GPMA 3DWLG 4B94A 4AXHA 1FT1A 3PH0C 4HRNA 2F8XK 2QC9A 4KMOA 4FA6A 5HRYA 1BLXB 1HX8A 1FT2A 4Q94A 3DXMG 5D2MC 2FEZA 1U3DA 3FUFA 3AS5A 3SNXA 3EUVA 4HOSA 3Q9UC 4DX2A 3AG2E 2CHXA 2L6JA 1H2VC 3PZ3A 4GTOA 4KZ0A 4L2YA 3TWXA 5JA4D 2Y69E 1TNYA 3IHVA 2PNNA 4BERA 4DI4A 3ZVVA 2LSUA 4LNUD 1WG0A 2UY1A 5AN8A 1N4SA 3SBSA 4JC8A 2I2OA 5CCLA 2EIJE 1HG2A 3RKVA 3Q75A 3W9FA 5BPPA 3N71A 4FLHA 3FH5A 2GRMA 3CVVA 4GYOA 2XEVA 4AV7A 3BG1B 2XS8A 4GB9A 1EYHA 5LX8A 3L9TA 2ETAA 3TL5A 3E4BA 3OXFA 5ITZF 4R7LA 5ENPD 3PE4A 1OCZE 2XRZA 3L13A 3UM3A 3C3RA 2H6IA 2KZTA 4PS7A 4P29A 3FUEA 4YDOA 4GTMA 2ETBA 3E37A 1KZPA 3CVUA 2DVWA 3ENEA 4YDYA 1QYMA 2WQ7A 3FWVA 4U0UA 3R7RA 3T8KA 1P5QA 3G2TA 1E8WA 4J8YA 4A1GA 1HZ4A 4ANXA 4KZCA 2WMOA 3LVRE 2LXMA 4K5BA 3GZ1A 4C0MA 1ZBPA 3IBEA 2Y1LE 3K9IA 4TXQA 1SVXA 2I1JA 3B7TA 5FZSA 3ULYA 4GTVA 3QB2A 2ZGDA 4L1BA 4RLYA 3CHMA 1D8EA 2Y4UA 3WG7E 1OY3D 1IHGA 3ZHEB 2EIME 5FQ8A 1IKND 4UQXA 2Q7FA 3BQOA 1TNZA 4NACA 2R5SA 2KCLA 3UKRG 3OTNA 3V79K 5ARGA 5G04C 3AS8A 3PDNA 5G05C 3LY8A 3S7DA 1MZCA 5G05J 3NB2A 4ACLA 2LNIA 4Y6CA 3MCXA 5ENQD 4FHJA 1SW6A 2XS1A 3CSFA 5A23A 1OT8A 2ZISA 4N39A 3KEAA 1TR4A 4C48B 1HO8A 2XENA 2WXMA 2ZGGA 5A7DB 5LOZA 5KNGA 2KCKA 3FUNA 4F6RD 3ZKJA 4N5CA 3MGBA 3QK0A 2WM9A 2WVIA 4F1SA 3MKQA 3CHQA 1TNOA 5ARFA 5FJYA 1JCRA 2KC7A 2FO1E 1AP7A 5BNWA 3FH7A 3FFLA 3PREA 4HRLA 1MX2A 3B7SA 2WXPA 3AU5A 1E8ZA 2KBXA 1JWFA 3CVNA 2OOEA 3C5RA 3EHRA 4HS2A 3NBNB 1O1TA 4MS6A 3JCKC 2YHEA 2GRLA 2OCCE 5LCWJ 5CEAA 2HR2A 3P2BA 3TWUA 1DCQA 3TWTA 2Y4TA 1JCQA 3LYAA 2HE0A 5AARA 4KBQA 2UWJG 1S63A 2C2LA 3NOCD 2CG2A 2X6HA 3TWRA 1BU9A 3E32A 3EIJA 5KJLA 3MEKA 4ANWA 3RRNB 4GTSA 1ZU2A 1TJCA 5FZQA 4HQDA 4HI9A 4WWNA 1HG5A 3FTUA 1N9AA 3AS4A 1Z3XA 1V54E 3DSWA 3FTSA 4HOUA 2CFZA 3UT8A 3L82A 5KNHD 4GPKA 5AQBA 1MX6A 5EDSA 4JD2G 2FBNA 4KT6B 1V55E 2UY1B 4HB5A 4I6EA 3HXCA 4U96D 4KVMA 2YQ8A 5EYLA 3CGHA 3QDNA 4BFRA 4AIFA 2P9NG 4DUIA 2WB2A 3UTMA 4IYPA 3Q7AA 1KT0A 3AG3E 3MZLB 2KXPC 4U8YD 3ABME 3SFYA 3ZW3A 3CR3A 3J5QB 3I3NA 4XIFA 5CCMA 3EHNA 3P1UA 1WDYA 2VQ2A 2R02A 3TJPA 2VSYA 2J4BA 2KCVA 3T8MA 1HFAA 2VJ8A 3QWPA 5JJ7A 3APFA 1TN6A 3E30A 4W9RA 3PZ4A 1E8XA 4EBAA 4N2SA 3UT7A 1N4PA 4J7WA 3JQ1A 4BESA 3ZXPA 1WM5A 2IY0C 5EX3A 1OWOA 2ZIRA 4ME2A 1NZNA 1BI7B 3PEUB 4WWOA 2PL2A 3I4RB 2PM7A 3X2QE 1JPLA 5IY5E 4Q96A 4U8HA 4UI9J 3L54A 2ILRA 1Y6IA 1W3BA 4GTRA 5E76A 3HRAA 3IV0A 2AXVA 1TN8A 3QWVA 3NAWA 1LTXA 3LPZA 1PAQA 1HU3A 3U66A 4DX5D 2R17C 4HLLA 3LJNA 1IQUA 3DSVA 3DPYA 3BG0B 5AIJA 2BKKB 3FHEA 4XKBA 5KJKA 2IO3C 4JA9A 3ZHEA 4N3AA 4J6IA 2L0IA 4XE0A 2QY7A 4FLBA 1L5JA 3QAQA 3CEQA 3TWSA 5KWDA 4GMRA 4G8KA 4BWRA 5ANRA 3ZEFA 3U4TA 1U3CA 3HIZA 1E96B 5CECB 4G8LA 4I17A 3V2OA 1EF1C 4LSZE 5KJMA 3LKUA 3JXJA 4CDRA 3EDTB 3CVXA 3R9MA 3MV3B 4ABNA 2E2EA 1ELKA 4BT9A 1X5BA 5BUZA 3ONLA 2IU1A 4AM9A 3UXGA 1H2TC 4OVUA 3E34A 5CBNA 3LS8A 4Q69A 4H7YA 5T3RA 4B0ZA 4UWHA 4UWGA 4HVBA 4URKA 1OWNA 2CHWA 2XZTG 4RQIA 2WXKA 3ML8A 1QZ2A 1E90A 4HOTA 3SF4A 3Q5MA 3LY9A 1K1AA 5ENNA 4JHJA 2A5UA 3T5XA 4EZJA 3LCAA 1WY6A 2V4LA 1OWMA 4YNDA 2WQ6A 4KXKB 2XPYA 4AOFA 5FTPA 3Q49B 4A55A 2LAIA 1YA0A 1VDYA 2X6IA 4DPRA 4G26A 4WUYA 1MX4A 1SA5A 1TNUA 2FF4A 3LJ3A 4PH4B 3V31A 5AAOA 2QYJA 3HVEB 3IKOB 4C9BB 1RZ4A 4I1AA 3O4ZA 3OAWA 3D9PA 4FP7A 4DX6D 3DSUA 2P9LG 4CT0A 2IEJA 5D0OD 3G2WA 2J4DA 3F6QA 5EN5D 4GCOA 4O6FA 3ZYMA 3ASHA 4TV3A 5ANLA 4GCNA 5KJNA 1H6PA 2VSNA 1DVPA 3DEPA 4ANVA 3TXMA 4OAUC 4ILIA 2NYJA 3Q15A 4BTBA 3HDXA 1EPUA 3ZYLA 2H6FA 5EIBE 4FJYA 4I9CA 4WNEA 3G2SA 1D9SA 2VSXE 3JXIA 3AAAC 2X6FA 3D3MA 5DBKA 1O1RA 1G3NB 2DIWA 5FT9A 5DIZA 2KM4A 3KAEA 4J8DA 5T8IA 3TGOA 2B0OE 3UMVA 2F0YA 1LD8A 3FUDA 4WWPA 4JZYA 2BEDA 3C98A 2DCPA 3ONKA 2EIKE 3OXGA 2YINA 3NOGD 5LCWC 3ZXSA 2KZTB 3FDHA 5LP0A 2J49A 5CEDB 4F3VA 5FQ6A 3EHMA 2J08A 2GRQB 2WQHA 5KBAA 4K5AB 1YMPA 3ULEG 4GA0A 4GTPA 5AQ9A 4UI9C 3NZUA 4XI9A 5ENSD 2MYOA 1H19A 4TRQA 5CMWA 1JWGA 3J5PA 4KVOA 4GMLA 3UM0A 4F1PA 3TWWA 3S7BA 3HXBA 4YDEA 3I4GA 1BPOA 1OCOE 3R9AB 4IULA 3KD7A 3DSXA 2R2LA 3KS2A 2IO2C 1Y8MA 4TXPA 4HOQA 4RG6A 5A6CA 1NA0A 2AWIA 4I6JA 3NZSA 4JW1A 3UQ3A 2GGFA 2VTBA 4J8FA 5B1BE 5CRVA 2J9QA 3EU9A 2VSOE 3CLJA 4JEUA 2L6BA 4FHKA 2MOWA 1JUQA 1SZ9A 3TWVA 2XHEA 1PC2A 4FULA 2MHKA 3SZ7A 3ABKE 4U0SA 3D9JA 3ZRHA 2EILE 4EQFA 2WXOA 3SFZA 3FU5A 3FUJA 1KPSB 4Y6WA 4I43A 1ELRA 2BF0X 2PQRA 3ABLE 3RO3A 2OVBA 4LRZA 4EBAG 3Q79A 3SQVA 3SFXA 2BKGA 1UOHA 4JA7A 4HNAD 2Y0BG 4ACKA 1TJFA 3GW4A 1S70B 4K0RA 5ENTD 2WXHA 1N54A 1FVFA 1N0QA 1DNPA 3UX4A 2R03A 4L9PA 4BY6A 2WXQA 2F8YA 3UT4A 1N11A 4WAFA 3AU4A 5M72A 2DBAA 4E6HA 4HLEA 4X8QA 2DZNA 2LUHA 4BTAA 2PZIA 1MHQA 1OWPA 5HQ8A 3Q9NC 2XRYA 3CQGB 1S0PA 3FEYA 4JHKA 4BX9A 3C3OA 2IOSA 1INZA 5FQ7A 3RRUA 4GTTA 3GZSA 3CHSA 2AJAA 4OYSA 1NL4A 3S7FA 4ATZD 2P9KG 4OAVB 1HE8A 3HHMA 3UM2A 4HI8A 5FIOA 4XEIG 1U2VG 3QKYA 4N5QA 2IQCA 4K5CA 3ZN3A 4GA2A 3GZ2A 2JEKA 2GRPB 2V5QC 3FEXA 2WPVA 2IJGX 3C72A 4M3OA 2RFAA 3RK6A 4HBDA 4L23A 2RG8A 5AJLA 3FTVA 5KCMA 3Q47B 5JJ6A 3MKRA 1HS6A 4APFA 4A3TA 3G2VA 3ESKA 2WXNA 4FC8A 1K3ZD 2H6HA 2I1KA 2VYIA 3FH8A 3UIPC 3DEOA 2WXRA 4UWLA 3ESLA 4RG9A 3PZ1A 1H0AA 4L7TA 5JJTA 4UWFA 3MA5A 3QJZA 4CEMA 4GZ5A 2B6CA 1NA3A 4LEUA 5E75A 4BSXA 4RVBA 3ZFWA 5EYPF 5J90A 2CHZA 3B13A 3PNLB 3Q7FA 2XGOA 3TG5A 4G11A 4NURA 5J08A 2WXLA 2X6KA 3PUJA 3PUKA 5EKQD 4B93B 2OVFA 4LCTA 1MQSA 2I6HA 1MJ0A 3UUXA 3QWWA 4D10C 4G23A 4LERA 4CYMD 2YNQA 4E85A 1B89A 2XQ0A 2DZOA 2X3MA 5C1DA 2ZU6B 2NSZA 3FP3A 1N52A 5CERB 4ILGA 3RJVA 4TXRA 4CGVA 2KATA 4U0ZA 2BTDA 1Z6TA 4NRHB 1AWCB 3TG4A 1RW2A 2HM8A 3QOUA 3B7BA 4IRUA 1KLXA 4G24A 5AQAA 3SI5A 2LXLA 3E33A 4J8SA 3O48A 3CSTA 5BXUA 2QYUA 5FWQA 3HXDA 3ASOE 1BI8B 5B1AE 3SD5A 3MKQB 1A5EA 3TAXA 2OEWA 4CRWA 1TNBA 1FPPA 5BV0A 1JCSA 1QQEA 2ONDA 3UIOC 2V8SE 1O5MA 1N95A 3PZDA 1A17A 2WXIA 3Q4AB 3ZPJA 4APOA 2PQNA 1XNFA 3CKCA 4TUUA 4M7CA 1OCRE 3D9KA 4O1PA 5HI7A 4B89A 1DC2A 4HXIA 2XPIA 4DI3A 2FI7A 5CMYA 3ZYKA 5FZRA 3SGHA 1N0RA 5C2YA 3AG4E 4HORA 2LSVA 1TYQG 2NC9A 3RRMB 4U07A 3V30A 4DLQA 4F7AA 2HYZA 2WMNA 4BX8A 3ZGQA 3CHOA 3NQPA 5AENA 4JB8P 2XPZA 1OXJA 3FUHA 1LD7A 4WNFA 4C0EA 4BEPA 4U95D 5JMND 3Q78A 3HVEA 4O60A 2P9PG 3D9MA 3D9NA 2R05A 4B8AA 4YVOA 1E7UA 4IN3B 4ATGA 4L2LA 3FTZA 1HF8A 3SHFA 4XX5A 3S7JA 3FUKA 3PNTB 3ASFA 5HS0A 1N4RA 3JQ0A 2DYSE 1NP7A 4CCAA 1UW4B 5T4YA 4U63A 1K1BA 3QARA 3IHYA 2WXJA 3KEZA 3NF1A 3UKUG 1UN9A 3SBTB 5EIDA 4AP2A 2WXGA 3DXKG 4I2ZA 2AXUA 4MBGA 2RKKA 4HFGA 5G2NA 3CVWA 3DBSA 3CKBA 1PY1A 2VGEA 4XZ4A 3R7QA 4GU5A 1XGWA 3C3QA 3ASDA 4J8EA 1WAO1 3ZIMA 4DX7D 4LUNU 2AXZA 1TN7A 1N4QA 2P58C 4I9EA 2XEEA 4PUCA 3DSTA 1X81A 4AJWA 3CVPA 3MYVA 4I6GA 3DPDA 3ULQA 3IXEA 5G04J 4UQZA 3UPVA 4KYOB 3L17A 4DLOA 3JUIA 3WXXA 3D9IA 2LAHA 5BW8C 1UG3A 3FTYA 5D0QD 3EIQC 2P2CP 3EU5A 4BT8A 2NXPA 3RO2A 5B3SE 4NQ0A 3SO8A 4QQIA 3ISMC 3VLEA 5JHBA 3PRZA 3CQCB 5BT1A 3L6AA 1QNFA 2QZAA 1OWLA 3FU6A 2X6JA 4A63B 4AY5A 3W9GA 5LFAA 3RSEG 3AG1E 5CHEE 2VGYA 4CGWA 2IONA 4JPSA 3GYZA 4O1OA 4PS3A 4GAAA 3CVYA 3U9WA 4AVXA 2DYRE 4G1TA 3L22A 4XKCA 1YYHA 3FY4A 4GZ3A 3CV0A 3D9LA 1N94A 2EINE 3UI2A 3URZA 3SY2A 1D8DA 2A5EA 3MX3A 3CHPA 3VTYA 3U3WA 2YHCA 4AEZC 2P9SG 1HH8A 3TWQA 2PM6A 3PZ2A 3V2XA 3APDA 1IXVA 4YVQC 2GROB 2VGXB 2IFUA 4U04A 3I5PA 1BD8A 3T9KA 2BUGA 5FQ4A 5CBOA 3CIAA 3D9OA 1H2UA 2RFMA 5BV1A 2J8SD 2Y3AA 3PVLA 3T5VA 1IHBA 2C0LA 3CK8A 4BSZB 2L0TB 3VTXA 1O1SA 4A3VA 4GZCA 5G55A 2DWZA 4UI9K 2CG3A 5ENRD 4WNGA 3AJIA 1IYGA 3QC1A 4JEHA 2ZXWE 4K03A 3L08A 4GTQA 3CVQA 2LO6A 3TXNA 2GRNB 4N2QA 4PS8A 3BUAA 2XGSA 4FADA 2EQXA 3ASNE 2IF4A 5BXOA 4UUCA 3BEEA 4ILHB 4EHMA 3APCA 2IOLA 3CVLA 3HXEA 4MLPA 2MRIA 4OVVA 3RIBA 1HXIA 4EECA 4JVSA 4AY6A 2F37A 4CZ2D 4MKTA 5HKPA 4G2VA 4EZKA 1YCSB 3KSQA 3MJWA 4V3IA 3MV2B 1OCCE 5AQ7A 3PS6A 2JLBA 1SA4A 4TUMA 2XZDG 2JABA 4PDXA 5EX0A 5ENOD 5EILA 4EZLA 3CK9A 1QBQA 3ZYQA 3VLFA 4YDWA 4LG6A 4I1MA 4GZDA 1KT1A
chains in the Genus database with same CATH topology
3O48A 3CSTA 4GZ6A 5FWQA 2VTBB 2WXMA 4GCOA 4O6FA 1UJKA 1IQRA 3ZYMA 5A7DB 3ASHA 2AW6A 3QNKA 4TV3A 5LOZA 5ANLA 3LVQE 2KCKA 4GCNA 3FUNA 5KJNA 4N5CA 3SD5A 3MKQB 2VSNA 3MGBA 1DVPA 1OUVA 3TAXA 3U64A 4CRWA 4ANVA 3TXMA 3QK0A 4N3CA 4ILIA 4GMJA 2C0MA 4GYWA 2WM9A 2WVIA 4QFVA 5BV0A 4F1SA 3Q15A 3MKQA 4BTBA 3CHQA 1QQEA 3HDXA 5ARFA 2ONDA 2FO7A 2V8SE 5FJYA 4UWKA 1EPUA 3PZDA 1A17A 2KC7A 2WXIA 3Q4AB 3ZPJA 3ZYLA 5AYWD 4FJYA 2CFUA 4I9CA 4WNEA 3G2SA 4APOA 3FH7A 2VSXE 2PQNA 5BNWA 3FUIA 4FJZA 3FFLA 3PREA 3B7SA 1XNFA 2WXPA 3AU5A 3CKCA 1E8ZA 4CDNA 4J0UA 1JWFA 2X6FA 3CVNA 3LEWA 4TUUA 3D3MA 5DBKA 3FU3A 2OOEA 3D9KA 2DIWA 4HS2A 2RD0A 5HI7A 1LF8A 4B89A 4ANUA 4DK5A 5FT9A 5DIZA 4MS6A 2KM4A 4HXIA 2XPIA 3KAEA 4DI3A 4J8DA 4FU3A 2FI7A 2YHEA 3JCKC 5CMYA 2XCBA 3ZYKA 5FZRA 2GRLA 3SGHA 4I2WA 5C2YA 5T8IA 3TGOA 3OXLA 3UMVA 1GW6A 5LCWJ 4HORA 2HR2A 2LSVA 3P2BA 1TEZA 3FUDA 2NC9A 3RRMB 4WWPA 4U07A 1Z3YA 4JZYA 2R59A 4DLQA 4F7AA 4WNDA 2Y4TA 3VLDA 3LYAA 2HYZA 2WMNA 4KBQA 2UWJG 1FCHA 3C98A 3FULA 4BX8A 2DCPA 3ONKA 3ZGQA 3CHOA 2C2LA 3OXGA 2YINA 2CG2A 2X6HA 3NQPA 5LCWC 3EJNA 3EIJA 3ZXSA 2KZTB 1UJJA 2XGMA 5KJLA 1SQMA 3FDHA 5LP0A 1EDUA 2WXFA 3MEKA 1ELWA 4ANWA 2J49A 3RRNB 5AENA 1ZU2A 1TJCA 5FZQA 3ML9A 4F3VA 2XPZA 5FQ6A 3EHMA 3FUHA 2J08A 4RSYA 4WNFA 4WWNA 4C0EA 4H7XA 1HG5A 3FTUA 3AS4A 3LDZA 4UQYA 4A1SA 2WQHA 1Z3XA 2E0IA 3G2UA 4DJAA 4N3BA 3HVEA 4GA0A 3FTSA 4HOUA 2CFZA 3B7RL 5JHAA 3UT8A 3D9MA 3D9NA 2J07A 4UI9C 3NZUA 4XI9A 4YVOA 4B8AA 4GPKA 2VGXA 1H19A 4TRQA 5EDSA 5CMWA 1JWGA 1E7UA 4IN3B 4KVOA 4GMLA 4ATGA 3S2AA 4L2LA 3S7BA 3FTZA 2J09A 1BPOA 1HF8A 2FBNA 3I4GA 4KT6B 3R9AB 4IULA 3SHFA 3KD7A 2UY1B 4XX5A 2HO1A 3KS2A 4I6EA 1Y8MA 3FUKA 3PNTB 4HOQA 2I9CA 3S7JA 3ASFA 4KVMA 2YQ8A 2XCCA 3FU0A 4RG6A 3CGHA 3JQ0A 5A6CA 1NA0A 2AWIA 3QDNA 4I6JA 3NZSA 4JW1A 3UQ3A 4BFRA 2X38A 4AIFA 1NP7A 2GGFA 4CCAA 2WB2A 2VTBA 4IYPA 3JYSA 4J8FA 1H6KA 1KT0A 3MZLB 1UW4B 4G25A 2J9QA 4U63A 5T4YA 3PE3A 3ZW3A 2VSOE 3CLJA 4JEUA 3B7UX 3CR3A 1E8YA 4I1OB 4JHRA 3FUMA 4FHKA 3QARA 3IHYA 3RU0A 3I3NA 4XIFA 2WXJA 2GW1A 5CCMA 1FVHA 2MOWA 3EHNA 4XI0A 3KEZA 3P1UA 4MRUA 1JUQA 3NF1A 1SZ9A 1UN9A 2VQ2A 2XHEA 4GA1A 3SBTB 1PC2A 4EPZA 3TJPA 4FULA 4AP2A 2OV8A 2VSYA 2WXGA 2MHKA 3SZ7A 2J4BA 2V0PA 2KCVA 4I2ZA 2AXUA 2FULA 4JL0A 4U0SA 3D9JA 4JXTA 3FTXA 4HFGA 4CT4A 3T8MA 1HFAA 3ZRHA 5G2NA 2VJ8A 3LXUX 3CHRA 1E7VA 3DBSA 3QWPA 3CVWA 4EQFA 2WXOA 5JJ7A 3APFA 3ASGA 5AJDA 1UN8A 2L9BA 3CKBA 3FU5A 3SFZA 3FUJA 1PY1A 4F53A 4W9RA 4Y6WA 3LY7A 4I43A 4XZ4A 1ELRA 2V5FA 3R7QA 3PEVB 1E8XA 4GYYA 2BF0X 4EBAA 4GU5A 2PQRA 4N2SA 3UT7A 3RO3A 3CK7A 1XGWA 3JQ1A 3ASDA 2A4ZA 1WAO1 1SZAA 3L16A 4J8EA 1WM5A 2OVBA 2M63A 3ZIMA 4LRZA 5EX3A 4EBAG 3HYMB 4LUNU 2AXZA 1OWOA 4ME2A 1NZNA 3PEUB 4JA7A 2P58C 4WWOA 4B8CB 2PL2A 3I4RB 4ACKA 2QFCA 4I9EA 1TJFA 2PM7A 3GW4A 2AVPA 3IEGA 4K0RA 1JPLA 2WXHA 1N54A 4Q96A 1FVFA 4U8HA 4CDMA 4PUCA 4UI9J 3L54A 3FTWA 2ILRA 1Y6IA 1DNPA 3UX4A 1W3BA 5E76A 4B94A 4AJWA 3CVPA 4AXHA 3IV0A 3PH0C 4BY6A 2WXQA 2AXVA 3QWVA 3MYVA 4I6GA 3DPDA 4KMOA 3ULQA 4FA6A 3UT4A 3LPZA 5G04J 4UQZA 3UPVA 1PAQA 3AU4A 4KYOB 4WAFA 5M72A 2DBAA 1HX8A 3L17A 4E6HA 4DLOA 1HU3A 3JUIA 3U66A 4HLEA 4Q94A 2R17C 3WXXA 2FEZA 1U3DA 1IQUA 3D9IA 3FUFA 4BTAA 3AS5A 3SNXA 2LAHA 5BW8C 2PZIA 4HOSA 1MHQA 1UG3A 1OWPA 3FTYA 5D0QD 5HQ8A 3BG0B 2XRYA 3EIQC 5AIJA 3CQGB 3FHEA 2CHXA 2L6JA 1H2VC 4XKBA 5KJKA 1S0PA 4BT8A 2NXPA 3FEYA 4JHKA 4JA9A 3RO2A 4BX9A 3ZHEA 4N3AA 4J6IA 4NQ0A 2L0IA 2IOSA 4KZ0A 4XE0A 1INZA 4L2YA 5FQ7A 3RRUA 2QY7A 3VLEA 3GZSA 4FLBA 5JHBA 3CHSA 1L5JA 3QAQA 3CEQA 3IHVA 3PRZA 4OYSA 3CQCB 5BT1A 3L6AA 1QNFA 4DI4A 3ZVVA 2LSUA 3S7FA 1OWLA 3FU6A 2X6JA 4AY5A 4BWRA 2UY1A 5LFAA 5ANRA 3ZEFA 1HE8A 3HHMA 3U4TA 1U3CA 3HIZA 3QKYA 2IQCA 3SBSA 1E96B 3ZN3A 4JC8A 2I2OA 5CHEE 5CCLA 4GA2A 4I17A 2VGYA 4CGWA 2IONA 1HG2A 4JPSA 1EF1C 3GZ2A 2JEKA 3GYZA 3LKUA 3RKVA 5KJMA 3FEXA 2WPVA 5BPPA 3N71A 4FLHA 4CDRA 3FH5A 3EDTB 2GRMA 3CVVA 4PS3A 4GAAA 2IJGX 4M3OA 4GYOA 3RK6A 2XEVA 3CVYA 3CVXA 4AV7A 3U9WA 3BG1B 4AVXA 3MV3B 4G1TA 4GB9A 1EYHA 5LX8A 4L23A 3L22A 2RG8A 2E2EA 4XKCA 4ABNA 5AJLA 3TL5A 1ELKA 3E4BA 3FTVA 3OXFA 4BT9A 1X5BA 5KCMA 5BUZA 3Q47B 5JJ6A 3MKRA 1HS6A 4R7LA 3ONLA 3PE4A 2XRZA 4APFA 2IU1A 4A3TA 3G2VA 3FY4A 3ESKA 4AM9A 2WXNA 3L13A 4GZ3A 1H2TC 4OVUA 3CV0A 4FC8A 2KZTA 4PS7A 3D9LA 4P29A 2I1KA 2VYIA 3URZA 3FUEA 3FH8A 3LS8A 4Q69A 3MX3A 4H7YA 3CHPA 5T3RA 2WXRA 4UWLA 2YHCA 3VTYA 4B0ZA 4AEZC 3U3WA 3ESLA 4RG9A 4UWHA 1HH8A 4UWGA 3CVUA 1H0AA 3ENEA 4L7TA 4HVBA 4URKA 5JJTA 2PM6A 4UWFA 3MA5A 3APDA 4YVQC 1OWNA 2CHWA 3QJZA 2WQ7A 4CEMA 3FWVA 4U0UA 3R7RA 2VGXB 2IFUA 2WXKA 3I5PA 4U04A 3ML8A 4GZ5A 1QZ2A 2BUGA 5FQ4A 1E90A 1NA3A 1P5QA 4LEUA 3G2TA 4HOTA 1E8WA 5E75A 3CIAA 3D9OA 4A1GA 1HZ4A 1H2UA 3SF4A 4BSXA 4ANXA 3Q5MA 4RVBA 3ZFWA 3LY9A 5BV1A 4KZCA 5ENNA 4JHJA 2Y3AA 5J90A 2A5UA 2WMOA 3LVRE 3PVLA 3T5VA 3T5XA 2C0LA 2CHZA 3B13A 3PNLB 2XGOA 4EZJA 3TG5A 4G11A 3LCAA 4NURA 5J08A 3CK8A 1WY6A 2L0TB 2WXLA 2X6KA 3VTXA 4A3VA 3PUJA 3GZ1A 4C0MA 1ZBPA 4GZCA 3IBEA 5G55A 3PUKA 4UI9K 2CG3A 2V4LA 3K9IA 4WNGA 1OWMA 5EKQD 4YNDA 2WQ6A 1IYGA 4KXKB 2XPYA 3QC1A 2OVFA 4AOFA 5FTPA 3Q49B 4GZDA 4JEHA 4LCTA 2I1JA 1MQSA 2I6HA 3B7TA 4K03A 5FZSA 2LAIA 3L08A 4A55A 3UUXA 3QB2A 3QWWA 1YA0A 4L1BA 4D10C 4G23A 3CVQA 2LO6A 4LERA 1VDYA 3TXNA 4N2QA 3CHMA 2YNQA 2X6IA 4PS8A 4DPRA 2Y4UA 4G26A 4E85A 1B89A 4WUYA 2XGSA 4FADA 1IHGA 2EQXA 2XQ0A 2IF4A 2X3MA 3ZHEB 2FF4A 3BEEA 3LJ3A 4ILHB 5FQ8A 3APCA 4PH4B 2IOLA 2ZU6B 3CVLA 5C1DA 2NSZA 4MLPA 2Q7FA 4UQXA 3FP3A 2MRIA 4OVVA 1N52A 3RIBA 4NACA 1HXIA 3HVEB 4ILGA 3RJVA 4EECA 2R5SA 4CGVA 2KCLA 4JVSA 4AY6A 3OTNA 3IKOB 2KATA 4MKTA 5ARGA 4U0ZA 5G04C 4C9BB 3AS8A 3PDNA 2BTDA 5G05C 4G2VA 4EZKA 3LY8A 4I1AA 3S7DA 3MJWA 4V3IA 1Z6TA 4NRHB 3MV2B 3O4ZA 5G05J 3OAWA 3TG4A 3D9PA 4FP7A 3PS6A 2HM8A 2JLBA 4ACLA 2LNIA 4Y6CA 3QOUA 4PDXA 3MCXA 5EX0A 4EZLA 4FHJA 4IRUA 3CSFA 5A23A 3CK9A 1KLXA 3ZYQA 4G24A 4CT0A 3SI5A 4N39A 3VLFA 5D0OD 3G2WA 2J4DA 4I1MA 1HO8A 4J8SA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LX8 A;  3CK7 A;  3MYV A;  3JQ1 A;  5J90 A;  4LER A;  3L22 A;  3CGH A;  3JQ0 A;  4L7T A;  3NQP A;  3EJN A;  3CK8 A;  5FQ7 A;  3FDH A;  3SGH A;  3GZS A;  3QNK A;  3JYS A;  5FQ8 A;  3MCX A;  5T4Y A;  3I4G A;  5FQ6 A;  3EHM A;  3CKC A;  3CK9 A;  3CKB A;  5FQ4 A;  4PUC A;  3LEW A;  3SNX A;  4F53 A;  4F7A A;  4Q69 A;  3OTN A;  5E75 A;  3EHN A;  3MX3 A;  5E76 A;  3KEZ A;  3P1U A;  5T3R A;  4MRU A;  3IV0 A;  3HDX A; 
#chains in the Genus database with same CATH topology
 4GZ6 A;  2VTB B;  1UJK A;  1IQR A;  2AW6 A;  3QNK A;  3HXF A;  3LVQ E;  4Z68 A;  5H7P A;  4U8V D;  1OUV A;  3U64 A;  4N3C A;  4GMJ A;  1H6O A;  2C0M A;  4GYW A;  4QFV A;  2FO7 A;  4UWK A;  1S64 A;  1KZO A;  5AYW D;  3UIN C;  2CFU A;  3FUI A;  4FJZ A;  1NFI E;  3UM1 A;  3DSS A;  2GRR B;  4CDN A;  4J0U A;  3LEW A;  3FU3 A;  1DCE A;  2RD0 A;  1LF8 A;  4ANU A;  4DK5 A;  4FU3 A;  4ZFH A;  2XCB A;  4I2W A;  3OXL A;  1GW6 A;  1TEZ A;  1Z3Y A;  2R59 A;  4WND A;  3VLD A;  3Q73 A;  1FCH A;  3FUL A;  1MYO A;  3BU8 A;  5FIN A;  3KSL A;  2V4H C;  4LNG A;  3EJN A;  1UJJ A;  2XGM A;  1SQM A;  4U7E B;  1EDU A;  2WXF A;  1ELW A;  3ZUV B;  3DRA A;  3D9H A;  3ML9 A;  2P9I G;  4RSY A;  1NI1 A;  4H7X A;  4ZHB A;  3LDZ A;  4UQY A;  4A1S A;  2E0I A;  3ZU7 B;  3G2U A;  5CRU A;  4N3B A;  4DJA A;  3B7R L;  2ETC A;  5JHA A;  2J07 A;  2P9U G;  2VGX A;  3S2A A;  2J09 A;  2HO1 A;  2XEH A;  2I9C A;  5D66 A;  4DRX E;  4BET A;  2XCC A;  3FU0 A;  2X38 A;  1ZB1 A;  3JYS A;  1H6K A;  3RAU A;  4G25 A;  3PE3 A;  3B7U X;  4I1O B;  1E8Y A;  4NIK A;  4JHR A;  3FUM A;  1Z5S C;  3RU0 A;  2GW1 A;  1FVH A;  3EHQ A;  4XI0 A;  4MRU A;  2OEV A;  3JUE A;  4HRM B;  4GA1 A;  1Q2Z A;  4EPZ A;  2H6G A;  2OV8 A;  2V0P A;  3ZNG A;  2FUL A;  4JL0 A;  4JXT A;  3FTX A;  4CT4 A;  3LXU X;  3CHR A;  1E7V A;  3ASG A;  5AJD A;  1UN8 A;  2L9B A;  3HG0 D;  4F53 A;  3LY7 A;  3B95 A;  2V5F A;  3PEV B;  4GYY A;  3CK7 A;  2A4Z A;  1SZA A;  3L16 A;  2M63 A;  1K8K G;  4DX1 A;  3HYM B;  4B8C B;  2QFC A;  4LNB A;  2AVP A;  3IEG A;  4CDM A;  3FTW A;  4GPM A;  3DWL G;  4B94 A;  4AXH A;  1FT1 A;  3PH0 C;  4HRN A;  2F8X K;  2QC9 A;  4KMO A;  4FA6 A;  5HRY A;  1BLX B;  1HX8 A;  1FT2 A;  4Q94 A;  3DXM G;  5D2M C;  2FEZ A;  1U3D A;  3FUF A;  3AS5 A;  3SNX A;  3EUV A;  4HOS A;  3Q9U C;  4DX2 A;  3AG2 E;  2CHX A;  2L6J A;  1H2V C;  3PZ3 A;  4GTO A;  4KZ0 A;  4L2Y A;  3TWX A;  5JA4 D;  2Y69 E;  1TNY A;  3IHV A;  2PNN A;  4BER A;  4DI4 A;  3ZVV A;  2LSU A;  4LNU D;  1WG0 A;  2UY1 A;  5AN8 A;  1N4S A;  3SBS A;  4JC8 A;  2I2O A;  5CCL A;  2EIJ E;  1HG2 A;  3RKV A;  3Q75 A;  3W9F A;  5BPP A;  3N71 A;  4FLH A;  3FH5 A;  2GRM A;  3CVV A;  4GYO A;  2XEV A;  4AV7 A;  3BG1 B;  2XS8 A;  4GB9 A;  1EYH A;  5LX8 A;  3L9T A;  2ETA A;  3TL5 A;  3E4B A;  3OXF A;  5ITZ F;  4R7L A;  5ENP D;  3PE4 A;  1OCZ E;  2XRZ A;  3L13 A;  3UM3 A;  3C3R A;  2H6I A;  2KZT A;  4PS7 A;  4P29 A;  3FUE A;  4YDO A;  4GTM A;  2ETB A;  3E37 A;  1KZP A;  3CVU A;  2DVW A;  3ENE A;  4YDY A;  1QYM A;  2WQ7 A;  3FWV A;  4U0U A;  3R7R A;  3T8K A;  1P5Q A;  3G2T A;  1E8W A;  4J8Y A;  4A1G A;  1HZ4 A;  4ANX A;  4KZC A;  2WMO A;  3LVR E;  2LXM A;  4K5B A;  3GZ1 A;  4C0M A;  1ZBP A;  3IBE A;  2Y1L E;  3K9I A;  4TXQ A;  1SVX A;  2I1J A;  3B7T A;  5FZS A;  3ULY A;  4GTV A;  3QB2 A;  2ZGD A;  4L1B A;  4RLY A;  3CHM A;  1D8E A;  2Y4U A;  3WG7 E;  1OY3 D;  1IHG A;  3ZHE B;  2EIM E;  5FQ8 A;  1IKN D;  4UQX A;  2Q7F A;  3BQO A;  1TNZ A;  4NAC A;  2R5S A;  2KCL A;  3UKR G;  3OTN A;  3V79 K;  5ARG A;  5G04 C;  3AS8 A;  3PDN A;  5G05 C;  3LY8 A;  3S7D A;  1MZC A;  5G05 J;  3NB2 A;  4ACL A;  2LNI A;  4Y6C A;  3MCX A;  5ENQ D;  4FHJ A;  1SW6 A;  2XS1 A;  3CSF A;  5A23 A;  1OT8 A;  2ZIS A;  4N39 A;  3KEA A;  1TR4 A;  4C48 B;  1HO8 A;  2XEN A;  2WXM A;  2ZGG A;  5A7D B;  5LOZ A;  5KNG A;  2KCK A;  3FUN A;  4F6R D;  3ZKJ A;  4N5C A;  3MGB A;  3QK0 A;  2WM9 A;  2WVI A;  4F1S A;  3MKQ A;  3CHQ A;  1TNO A;  5ARF A;  5FJY A;  1JCR A;  2KC7 A;  2FO1 E;  1AP7 A;  5BNW A;  3FH7 A;  3FFL A;  3PRE A;  4HRL A;  1MX2 A;  3B7S A;  2WXP A;  3AU5 A;  1E8Z A;  2KBX A;  1JWF A;  3CVN A;  2OOE A;  3C5R A;  3EHR A;  4HS2 A;  3NBN B;  1O1T A;  4MS6 A;  3JCK C;  2YHE A;  2GRL A;  2OCC E;  5LCW J;  5CEA A;  2HR2 A;  3P2B A;  3TWU A;  1DCQ A;  3TWT A;  2Y4T A;  1JCQ A;  3LYA A;  2HE0 A;  5AAR A;  4KBQ A;  2UWJ G;  1S63 A;  2C2L A;  3NOC D;  2CG2 A;  2X6H A;  3TWR A;  1BU9 A;  3E32 A;  3EIJ A;  5KJL A;  3MEK A;  4ANW A;  3RRN B;  4GTS A;  1ZU2 A;  1TJC A;  5FZQ A;  4HQD A;  4HI9 A;  4WWN A;  1HG5 A;  3FTU A;  1N9A A;  3AS4 A;  1Z3X A;  1V54 E;  3DSW A;  3FTS A;  4HOU A;  2CFZ A;  3UT8 A;  3L82 A;  5KNH D;  4GPK A;  5AQB A;  1MX6 A;  5EDS A;  4JD2 G;  2FBN A;  4KT6 B;  1V55 E;  2UY1 B;  4HB5 A;  4I6E A;  3HXC A;  4U96 D;  4KVM A;  2YQ8 A;  5EYL A;  3CGH A;  3QDN A;  4BFR A;  4AIF A;  2P9N G;  4DUI A;  2WB2 A;  3UTM A;  4IYP A;  3Q7A A;  1KT0 A;  3AG3 E;  3MZL B;  2KXP C;  4U8Y D;  3ABM E;  3SFY A;  3ZW3 A;  3CR3 A;  3J5Q B;  3I3N A;  4XIF A;  5CCM A;  3EHN A;  3P1U A;  1WDY A;  2VQ2 A;  2R02 A;  3TJP A;  2VSY A;  2J4B A;  2KCV A;  3T8M A;  1HFA A;  2VJ8 A;  3QWP A;  5JJ7 A;  3APF A;  1TN6 A;  3E30 A;  4W9R A;  3PZ4 A;  1E8X A;  4EBA A;  4N2S A;  3UT7 A;  1N4P A;  4J7W A;  3JQ1 A;  4BES A;  3ZXP A;  1WM5 A;  2IY0 C;  5EX3 A;  1OWO A;  2ZIR A;  4ME2 A;  1NZN A;  1BI7 B;  3PEU B;  4WWO A;  2PL2 A;  3I4R B;  2PM7 A;  3X2Q E;  1JPL A;  5IY5 E;  4Q96 A;  4U8H A;  4UI9 J;  3L54 A;  2ILR A;  1Y6I A;  1W3B A;  4GTR A;  5E76 A;  3HRA A;  3IV0 A;  2AXV A;  1TN8 A;  3QWV A;  3NAW A;  1LTX A;  3LPZ A;  1PAQ A;  1HU3 A;  3U66 A;  4DX5 D;  2R17 C;  4HLL A;  3LJN A;  1IQU A;  3DSV A;  3DPY A;  3BG0 B;  5AIJ A;  2BKK B;  3FHE A;  4XKB A;  5KJK A;  2IO3 C;  4JA9 A;  3ZHE A;  4N3A A;  4J6I A;  2L0I A;  4XE0 A;  2QY7 A;  4FLB A;  1L5J A;  3QAQ A;  3CEQ A;  3TWS A;  5KWD A;  4GMR A;  4G8K A;  4BWR A;  5ANR A;  3ZEF A;  3U4T A;  1U3C A;  3HIZ A;  1E96 B;  5CEC B;  4G8L A;  4I17 A;  3V2O A;  1EF1 C;  4LSZ E;  5KJM A;  3LKU A;  3JXJ A;  4CDR A;  3EDT B;  3CVX A;  3R9M A;  3MV3 B;  4ABN A;  2E2E A;  1ELK A;  4BT9 A;  1X5B A;  5BUZ A;  3ONL A;  2IU1 A;  4AM9 A;  3UXG A;  1H2T C;  4OVU A;  3E34 A;  5CBN A;  3LS8 A;  4Q69 A;  4H7Y A;  5T3R A;  4B0Z A;  4UWH A;  4UWG A;  4HVB A;  4URK A;  1OWN A;  2CHW A;  2XZT G;  4RQI A;  2WXK A;  3ML8 A;  1QZ2 A;  1E90 A;  4HOT A;  3SF4 A;  3Q5M A;  3LY9 A;  1K1A A;  5ENN A;  4JHJ A;  2A5U A;  3T5X A;  4EZJ A;  3LCA A;  1WY6 A;  2V4L A;  1OWM A;  4YND A;  2WQ6 A;  4KXK B;  2XPY A;  4AOF A;  5FTP A;  3Q49 B;  4A55 A;  2LAI A;  1YA0 A;  1VDY A;  2X6I A;  4DPR A;  4G26 A;  4WUY A;  1MX4 A;  1SA5 A;  1TNU A;  2FF4 A;  3LJ3 A;  4PH4 B;  3V31 A;  5AAO A;  2QYJ A;  3HVE B;  3IKO B;  4C9B B;  1RZ4 A;  4I1A A;  3O4Z A;  3OAW A;  3D9P A;  4FP7 A;  4DX6 D;  3DSU A;  2P9L G;  4CT0 A;  2IEJ A;  5D0O D;  3G2W A;  2J4D A;  3F6Q A;  5EN5 D;  4GCO A;  4O6F A;  3ZYM A;  3ASH A;  4TV3 A;  5ANL A;  4GCN A;  5KJN A;  1H6P A;  2VSN A;  1DVP A;  3DEP A;  4ANV A;  3TXM A;  4OAU C;  4ILI A;  2NYJ A;  3Q15 A;  4BTB A;  3HDX A;  1EPU A;  3ZYL A;  2H6F A;  5EIB E;  4FJY A;  4I9C A;  4WNE A;  3G2S A;  1D9S A;  2VSX E;  3JXI A;  3AAA C;  2X6F A;  3D3M A;  5DBK A;  1O1R A;  1G3N B;  2DIW A;  5FT9 A;  5DIZ A;  2KM4 A;  3KAE A;  4J8D A;  5T8I A;  3TGO A;  2B0O E;  3UMV A;  2F0Y A;  1LD8 A;  3FUD A;  4WWP A;  4JZY A;  2BED A;  3C98 A;  2DCP A;  3ONK A;  2EIK E;  3OXG A;  2YIN A;  3NOG D;  5LCW C;  3ZXS A;  2KZT B;  3FDH A;  5LP0 A;  2J49 A;  5CED B;  4F3V A;  5FQ6 A;  3EHM A;  2J08 A;  2GRQ B;  2WQH A;  5KBA A;  4K5A B;  1YMP A;  3ULE G;  4GA0 A;  4GTP A;  5AQ9 A;  4UI9 C;  3NZU A;  4XI9 A;  5ENS D;  2MYO A;  1H19 A;  4TRQ A;  5CMW A;  1JWG A;  3J5P A;  4KVO A;  4GML A;  3UM0 A;  4F1P A;  3TWW A;  3S7B A;  3HXB A;  4YDE A;  3I4G A;  1BPO A;  1OCO E;  3R9A B;  4IUL A;  3KD7 A;  3DSX A;  2R2L A;  3KS2 A;  2IO2 C;  1Y8M A;  4TXP A;  4HOQ A;  4RG6 A;  5A6C A;  1NA0 A;  2AWI A;  4I6J A;  3NZS A;  4JW1 A;  3UQ3 A;  2GGF A;  2VTB A;  4J8F A;  5B1B E;  5CRV A;  2J9Q A;  3EU9 A;  2VSO E;  3CLJ A;  4JEU A;  2L6B A;  4FHK A;  2MOW A;  1JUQ A;  1SZ9 A;  3TWV A;  2XHE A;  1PC2 A;  4FUL A;  2MHK A;  3SZ7 A;  3ABK E;  4U0S A;  3D9J A;  3ZRH A;  2EIL E;  4EQF A;  2WXO A;  3SFZ A;  3FU5 A;  3FUJ A;  1KPS B;  4Y6W A;  4I43 A;  1ELR A;  2BF0 X;  2PQR A;  3ABL E;  3RO3 A;  2OVB A;  4LRZ A;  4EBA G;  3Q79 A;  3SQV A;  3SFX A;  2BKG A;  1UOH A;  4JA7 A;  4HNA D;  2Y0B G;  4ACK A;  1TJF A;  3GW4 A;  1S70 B;  4K0R A;  5ENT D;  2WXH A;  1N54 A;  1FVF A;  1N0Q A;  1DNP A;  3UX4 A;  2R03 A;  4L9P A;  4BY6 A;  2WXQ A;  2F8Y A;  3UT4 A;  1N11 A;  4WAF A;  3AU4 A;  5M72 A;  2DBA A;  4E6H A;  4HLE A;  4X8Q A;  2DZN A;  2LUH A;  4BTA A;  2PZI A;  1MHQ A;  1OWP A;  5HQ8 A;  3Q9N C;  2XRY A;  3CQG B;  1S0P A;  3FEY A;  4JHK A;  4BX9 A;  3C3O A;  2IOS A;  1INZ A;  5FQ7 A;  3RRU A;  4GTT A;  3GZS A;  3CHS A;  2AJA A;  4OYS A;  1NL4 A;  3S7F A;  4ATZ D;  2P9K G;  4OAV B;  1HE8 A;  3HHM A;  3UM2 A;  4HI8 A;  5FIO A;  4XEI G;  1U2V G;  3QKY A;  4N5Q A;  2IQC A;  4K5C A;  3ZN3 A;  4GA2 A;  3GZ2 A;  2JEK A;  2GRP B;  2V5Q C;  3FEX A;  2WPV A;  2IJG X;  3C72 A;  4M3O A;  2RFA A;  3RK6 A;  4HBD A;  4L23 A;  2RG8 A;  5AJL A;  3FTV A;  5KCM A;  3Q47 B;  5JJ6 A;  3MKR A;  1HS6 A;  4APF A;  4A3T A;  3G2V A;  3ESK A;  2WXN A;  4FC8 A;  1K3Z D;  2H6H A;  2I1K A;  2VYI A;  3FH8 A;  3UIP C;  3DEO A;  2WXR A;  4UWL A;  3ESL A;  4RG9 A;  3PZ1 A;  1H0A A;  4L7T A;  5JJT A;  4UWF A;  3MA5 A;  3QJZ A;  4CEM A;  4GZ5 A;  2B6C A;  1NA3 A;  4LEU A;  5E75 A;  4BSX A;  4RVB A;  3ZFW A;  5EYP F;  5J90 A;  2CHZ A;  3B13 A;  3PNL B;  3Q7F A;  2XGO A;  3TG5 A;  4G11 A;  4NUR A;  5J08 A;  2WXL A;  2X6K A;  3PUJ A;  3PUK A;  5EKQ D;  4B93 B;  2OVF A;  4LCT A;  1MQS A;  2I6H A;  1MJ0 A;  3UUX A;  3QWW A;  4D10 C;  4G23 A;  4LER A;  4CYM D;  2YNQ A;  4E85 A;  1B89 A;  2XQ0 A;  2DZO A;  2X3M A;  5C1D A;  2ZU6 B;  2NSZ A;  3FP3 A;  1N52 A;  5CER B;  4ILG A;  3RJV A;  4TXR A;  4CGV A;  2KAT A;  4U0Z A;  2BTD A;  1Z6T A;  4NRH B;  1AWC B;  3TG4 A;  1RW2 A;  2HM8 A;  3QOU A;  3B7B A;  4IRU A;  1KLX A;  4G24 A;  5AQA A;  3SI5 A;  2LXL A;  3E33 A;  4J8S A;  3O48 A;  3CST A;  5BXU A;  2QYU A;  5FWQ A;  3HXD A;  3ASO E;  1BI8 B;  5B1A E;  3SD5 A;  3MKQ B;  1A5E A;  3TAX A;  2OEW A;  4CRW A;  1TNB A;  1FPP A;  5BV0 A;  1JCS A;  1QQE A;  2OND A;  3UIO C;  2V8S E;  1O5M A;  1N95 A;  3PZD A;  1A17 A;  2WXI A;  3Q4A B;  3ZPJ A;  4APO A;  2PQN A;  1XNF A;  3CKC A;  4TUU A;  4M7C A;  1OCR E;  3D9K A;  4O1P A;  5HI7 A;  4B89 A;  1DC2 A;  4HXI A;  2XPI A;  4DI3 A;  2FI7 A;  5CMY A;  3ZYK A;  5FZR A;  3SGH A;  1N0R A;  5C2Y A;  3AG4 E;  4HOR A;  2LSV A;  1TYQ G;  2NC9 A;  3RRM B;  4U07 A;  3V30 A;  4DLQ A;  4F7A A;  2HYZ A;  2WMN A;  4BX8 A;  3ZGQ A;  3CHO A;  3NQP A;  5AEN A;  4JB8 P;  2XPZ A;  1OXJ A;  3FUH A;  1LD7 A;  4WNF A;  4C0E A;  4BEP A;  4U95 D;  5JMN D;  3Q78 A;  3HVE A;  4O60 A;  2P9P G;  3D9M A;  3D9N A;  2R05 A;  4B8A A;  4YVO A;  1E7U A;  4IN3 B;  4ATG A;  4L2L A;  3FTZ A;  1HF8 A;  3SHF A;  4XX5 A;  3S7J A;  3FUK A;  3PNT B;  3ASF A;  5HS0 A;  1N4R A;  3JQ0 A;  2DYS E;  1NP7 A;  4CCA A;  1UW4 B;  5T4Y A;  4U63 A;  1K1B A;  3QAR A;  3IHY A;  2WXJ A;  3KEZ A;  3NF1 A;  3UKU G;  1UN9 A;  3SBT B;  5EID A;  4AP2 A;  2WXG A;  3DXK G;  4I2Z A;  2AXU A;  4MBG A;  2RKK A;  4HFG A;  5G2N A;  3CVW A;  3DBS A;  3CKB A;  1PY1 A;  2VGE A;  4XZ4 A;  3R7Q A;  4GU5 A;  1XGW A;  3C3Q A;  3ASD A;  4J8E A;  1WAO 1;  3ZIM A;  4DX7 D;  4LUN U;  2AXZ A;  1TN7 A;  1N4Q A;  2P58 C;  4I9E A;  2XEE A;  4PUC A;  3DST A;  1X81 A;  4AJW A;  3CVP A;  3MYV A;  4I6G A;  3DPD A;  3ULQ A;  3IXE A;  5G04 J;  4UQZ A;  3UPV A;  4KYO B;  3L17 A;  4DLO A;  3JUI A;  3WXX A;  3D9I A;  2LAH A;  5BW8 C;  1UG3 A;  3FTY A;  5D0Q D;  3EIQ C;  2P2C P;  3EU5 A;  4BT8 A;  2NXP A;  3RO2 A;  5B3S E;  4NQ0 A;  3SO8 A;  4QQI A;  3ISM C;  3VLE A;  5JHB A;  3PRZ A;  3CQC B;  5BT1 A;  3L6A A;  1QNF A;  2QZA A;  1OWL A;  3FU6 A;  2X6J A;  4A63 B;  4AY5 A;  3W9G A;  5LFA A;  3RSE G;  3AG1 E;  5CHE E;  2VGY A;  4CGW A;  2ION A;  4JPS A;  3GYZ A;  4O1O A;  4PS3 A;  4GAA A;  3CVY A;  3U9W A;  4AVX A;  2DYR E;  4G1T A;  3L22 A;  4XKC A;  1YYH A;  3FY4 A;  4GZ3 A;  3CV0 A;  3D9L A;  1N94 A;  2EIN E;  3UI2 A;  3URZ A;  3SY2 A;  1D8D A;  2A5E A;  3MX3 A;  3CHP A;  3VTY A;  3U3W A;  2YHC A;  4AEZ C;  2P9S G;  1HH8 A;  3TWQ A;  2PM6 A;  3PZ2 A;  3V2X A;  3APD A;  1IXV A;  4YVQ C;  2GRO B;  2VGX B;  2IFU A;  4U04 A;  3I5P A;  1BD8 A;  3T9K A;  2BUG A;  5FQ4 A;  5CBO A;  3CIA A;  3D9O A;  1H2U A;  2RFM A;  5BV1 A;  2J8S D;  2Y3A A;  3PVL A;  3T5V A;  1IHB A;  2C0L A;  3CK8 A;  4BSZ B;  2L0T B;  3VTX A;  1O1S A;  4A3V A;  4GZC A;  5G55 A;  2DWZ A;  4UI9 K;  2CG3 A;  5ENR D;  4WNG A;  3AJI A;  1IYG A;  3QC1 A;  4JEH A;  2ZXW E;  4K03 A;  3L08 A;  4GTQ A;  3CVQ A;  2LO6 A;  3TXN A;  2GRN B;  4N2Q A;  4PS8 A;  3BUA A;  2XGS A;  4FAD A;  2EQX A;  3ASN E;  2IF4 A;  5BXO A;  4UUC A;  3BEE A;  4ILH B;  4EHM A;  3APC A;  2IOL A;  3CVL A;  3HXE A;  4MLP A;  2MRI A;  4OVV A;  3RIB A;  1HXI A;  4EEC A;  4JVS A;  4AY6 A;  2F37 A;  4CZ2 D;  4MKT A;  5HKP A;  4G2V A;  4EZK A;  1YCS B;  3KSQ A;  3MJW A;  4V3I A;  3MV2 B;  1OCC E;  5AQ7 A;  3PS6 A;  2JLB A;  1SA4 A;  4TUM A;  2XZD G;  2JAB A;  4PDX A;  5EX0 A;  5ENO D;  5EIL A;  4EZL A;  3CK9 A;  1QBQ A;  3ZYQ A;  3VLF A;  4YDW A;  4LG6 A;  4I1M A;  4GZD A;  1KT1 A; 
#chains in the Genus database with same CATH homology
 3O48 A;  3CST A;  4GZ6 A;  5FWQ A;  2VTB B;  2WXM A;  4GCO A;  4O6F A;  1UJK A;  1IQR A;  3ZYM A;  5A7D B;  3ASH A;  2AW6 A;  3QNK A;  4TV3 A;  5LOZ A;  5ANL A;  3LVQ E;  2KCK A;  4GCN A;  3FUN A;  5KJN A;  4N5C A;  3SD5 A;  3MKQ B;  2VSN A;  3MGB A;  1DVP A;  1OUV A;  3TAX A;  3U64 A;  4CRW A;  4ANV A;  3TXM A;  3QK0 A;  4N3C A;  4ILI A;  4GMJ A;  2C0M A;  4GYW A;  2WM9 A;  2WVI A;  4QFV A;  5BV0 A;  4F1S A;  3Q15 A;  3MKQ A;  4BTB A;  3CHQ A;  1QQE A;  3HDX A;  5ARF A;  2OND A;  2FO7 A;  2V8S E;  5FJY A;  4UWK A;  1EPU A;  3PZD A;  1A17 A;  2KC7 A;  2WXI A;  3Q4A B;  3ZPJ A;  3ZYL A;  5AYW D;  4FJY A;  2CFU A;  4I9C A;  4WNE A;  3G2S A;  4APO A;  3FH7 A;  2VSX E;  2PQN A;  5BNW A;  3FUI A;  4FJZ A;  3FFL A;  3PRE A;  3B7S A;  1XNF A;  2WXP A;  3AU5 A;  3CKC A;  1E8Z A;  4CDN A;  4J0U A;  1JWF A;  2X6F A;  3CVN A;  3LEW A;  4TUU A;  3D3M A;  5DBK A;  3FU3 A;  2OOE A;  3D9K A;  2DIW A;  4HS2 A;  2RD0 A;  5HI7 A;  1LF8 A;  4B89 A;  4ANU A;  4DK5 A;  5FT9 A;  5DIZ A;  4MS6 A;  2KM4 A;  4HXI A;  2XPI A;  3KAE A;  4DI3 A;  4J8D A;  4FU3 A;  2FI7 A;  2YHE A;  3JCK C;  5CMY A;  2XCB A;  3ZYK A;  5FZR A;  2GRL A;  3SGH A;  4I2W A;  5C2Y A;  5T8I A;  3TGO A;  3OXL A;  3UMV A;  1GW6 A;  5LCW J;  4HOR A;  2HR2 A;  2LSV A;  3P2B A;  1TEZ A;  3FUD A;  2NC9 A;  3RRM B;  4WWP A;  4U07 A;  1Z3Y A;  4JZY A;  2R59 A;  4DLQ A;  4F7A A;  4WND A;  2Y4T A;  3VLD A;  3LYA A;  2HYZ A;  2WMN A;  4KBQ A;  2UWJ G;  1FCH A;  3C98 A;  3FUL A;  4BX8 A;  2DCP A;  3ONK A;  3ZGQ A;  3CHO A;  2C2L A;  3OXG A;  2YIN A;  2CG2 A;  2X6H A;  3NQP A;  5LCW C;  3EJN A;  3EIJ A;  3ZXS A;  2KZT B;  1UJJ A;  2XGM A;  5KJL A;  1SQM A;  3FDH A;  5LP0 A;  1EDU A;  2WXF A;  3MEK A;  1ELW A;  4ANW A;  2J49 A;  3RRN B;  5AEN A;  1ZU2 A;  1TJC A;  5FZQ A;  3ML9 A;  4F3V A;  2XPZ A;  5FQ6 A;  3EHM A;  3FUH A;  2J08 A;  4RSY A;  4WNF A;  4WWN A;  4C0E A;  4H7X A;  1HG5 A;  3FTU A;  3AS4 A;  3LDZ A;  4UQY A;  4A1S A;  2WQH A;  1Z3X A;  2E0I A;  3G2U A;  4DJA A;  4N3B A;  3HVE A;  4GA0 A;  3FTS A;  4HOU A;  2CFZ A;  3B7R L;  5JHA A;  3UT8 A;  3D9M A;  3D9N A;  2J07 A;  4UI9 C;  3NZU A;  4XI9 A;  4YVO A;  4B8A A;  4GPK A;  2VGX A;  1H19 A;  4TRQ A;  5EDS A;  5CMW A;  1JWG A;  1E7U A;  4IN3 B;  4KVO A;  4GML A;  4ATG A;  3S2A A;  4L2L A;  3S7B A;  3FTZ A;  2J09 A;  1BPO A;  1HF8 A;  2FBN A;  3I4G A;  4KT6 B;  3R9A B;  4IUL A;  3SHF A;  3KD7 A;  2UY1 B;  4XX5 A;  2HO1 A;  3KS2 A;  4I6E A;  1Y8M A;  3FUK A;  3PNT B;  4HOQ A;  2I9C A;  3S7J A;  3ASF A;  4KVM A;  2YQ8 A;  2XCC A;  3FU0 A;  4RG6 A;  3CGH A;  3JQ0 A;  5A6C A;  1NA0 A;  2AWI A;  3QDN A;  4I6J A;  3NZS A;  4JW1 A;  3UQ3 A;  4BFR A;  2X38 A;  4AIF A;  1NP7 A;  2GGF A;  4CCA A;  2WB2 A;  2VTB A;  4IYP A;  3JYS A;  4J8F A;  1H6K A;  1KT0 A;  3MZL B;  1UW4 B;  4G25 A;  2J9Q A;  4U63 A;  5T4Y A;  3PE3 A;  3ZW3 A;  2VSO E;  3CLJ A;  4JEU A;  3B7U X;  3CR3 A;  1E8Y A;  4I1O B;  4JHR A;  3FUM A;  4FHK A;  3QAR A;  3IHY A;  3RU0 A;  3I3N A;  4XIF A;  2WXJ A;  2GW1 A;  5CCM A;  1FVH A;  2MOW A;  3EHN A;  4XI0 A;  3KEZ A;  3P1U A;  4MRU A;  1JUQ A;  3NF1 A;  1SZ9 A;  1UN9 A;  2VQ2 A;  2XHE A;  4GA1 A;  3SBT B;  1PC2 A;  4EPZ A;  3TJP A;  4FUL A;  4AP2 A;  2OV8 A;  2VSY A;  2WXG A;  2MHK A;  3SZ7 A;  2J4B A;  2V0P A;  2KCV A;  4I2Z A;  2AXU A;  2FUL A;  4JL0 A;  4U0S A;  3D9J A;  4JXT A;  3FTX A;  4HFG A;  4CT4 A;  3T8M A;  1HFA A;  3ZRH A;  5G2N A;  2VJ8 A;  3LXU X;  3CHR A;  1E7V A;  3DBS A;  3QWP A;  3CVW A;  4EQF A;  2WXO A;  5JJ7 A;  3APF A;  3ASG A;  5AJD A;  1UN8 A;  2L9B A;  3CKB A;  3FU5 A;  3SFZ A;  3FUJ A;  1PY1 A;  4F53 A;  4W9R A;  4Y6W A;  3LY7 A;  4I43 A;  4XZ4 A;  1ELR A;  2V5F A;  3R7Q A;  3PEV B;  1E8X A;  4GYY A;  2BF0 X;  4EBA A;  4GU5 A;  2PQR A;  4N2S A;  3UT7 A;  3RO3 A;  3CK7 A;  1XGW A;  3JQ1 A;  3ASD A;  2A4Z A;  1WAO 1;  1SZA A;  3L16 A;  4J8E A;  1WM5 A;  2OVB A;  2M63 A;  3ZIM A;  4LRZ A;  5EX3 A;  4EBA G;  3HYM B;  4LUN U;  2AXZ A;  1OWO A;  4ME2 A;  1NZN A;  3PEU B;  4JA7 A;  2P58 C;  4WWO A;  4B8C B;  2PL2 A;  3I4R B;  4ACK A;  2QFC A;  4I9E A;  1TJF A;  2PM7 A;  3GW4 A;  2AVP A;  3IEG A;  4K0R A;  1JPL A;  2WXH A;  1N54 A;  4Q96 A;  1FVF A;  4U8H A;  4CDM A;  4PUC A;  4UI9 J;  3L54 A;  3FTW A;  2ILR A;  1Y6I A;  1DNP A;  3UX4 A;  1W3B A;  5E76 A;  4B94 A;  4AJW A;  3CVP A;  4AXH A;  3IV0 A;  3PH0 C;  4BY6 A;  2WXQ A;  2AXV A;  3QWV A;  3MYV A;  4I6G A;  3DPD A;  4KMO A;  3ULQ A;  4FA6 A;  3UT4 A;  3LPZ A;  5G04 J;  4UQZ A;  3UPV A;  1PAQ A;  3AU4 A;  4KYO B;  4WAF A;  5M72 A;  2DBA A;  1HX8 A;  3L17 A;  4E6H A;  4DLO A;  1HU3 A;  3JUI A;  3U66 A;  4HLE A;  4Q94 A;  2R17 C;  3WXX A;  2FEZ A;  1U3D A;  1IQU A;  3D9I A;  3FUF A;  4BTA A;  3AS5 A;  3SNX A;  2LAH A;  5BW8 C;  2PZI A;  4HOS A;  1MHQ A;  1UG3 A;  1OWP A;  3FTY A;  5D0Q D;  5HQ8 A;  3BG0 B;  2XRY A;  3EIQ C;  5AIJ A;  3CQG B;  3FHE A;  2CHX A;  2L6J A;  1H2V C;  4XKB A;  5KJK A;  1S0P A;  4BT8 A;  2NXP A;  3FEY A;  4JHK A;  4JA9 A;  3RO2 A;  4BX9 A;  3ZHE A;  4N3A A;  4J6I A;  4NQ0 A;  2L0I A;  2IOS A;  4KZ0 A;  4XE0 A;  1INZ A;  4L2Y A;  5FQ7 A;  3RRU A;  2QY7 A;  3VLE A;  3GZS A;  4FLB A;  5JHB A;  3CHS A;  1L5J A;  3QAQ A;  3CEQ A;  3IHV A;  3PRZ A;  4OYS A;  3CQC B;  5BT1 A;  3L6A A;  1QNF A;  4DI4 A;  3ZVV A;  2LSU A;  3S7F A;  1OWL A;  3FU6 A;  2X6J A;  4AY5 A;  4BWR A;  2UY1 A;  5LFA A;  5ANR A;  3ZEF A;  1HE8 A;  3HHM A;  3U4T A;  1U3C A;  3HIZ A;  3QKY A;  2IQC A;  3SBS A;  1E96 B;  3ZN3 A;  4JC8 A;  2I2O A;  5CHE E;  5CCL A;  4GA2 A;  4I17 A;  2VGY A;  4CGW A;  2ION A;  1HG2 A;  4JPS A;  1EF1 C;  3GZ2 A;  2JEK A;  3GYZ A;  3LKU A;  3RKV A;  5KJM A;  3FEX A;  2WPV A;  5BPP A;  3N71 A;  4FLH A;  4CDR A;  3FH5 A;  3EDT B;  2GRM A;  3CVV A;  4PS3 A;  4GAA A;  2IJG X;  4M3O A;  4GYO A;  3RK6 A;  2XEV A;  3CVY A;  3CVX A;  4AV7 A;  3U9W A;  3BG1 B;  4AVX A;  3MV3 B;  4G1T A;  4GB9 A;  1EYH A;  5LX8 A;  4L23 A;  3L22 A;  2RG8 A;  2E2E A;  4XKC A;  4ABN A;  5AJL A;  3TL5 A;  1ELK A;  3E4B A;  3FTV A;  3OXF A;  4BT9 A;  1X5B A;  5KCM A;  5BUZ A;  3Q47 B;  5JJ6 A;  3MKR A;  1HS6 A;  4R7L A;  3ONL A;  3PE4 A;  2XRZ A;  4APF A;  2IU1 A;  4A3T A;  3G2V A;  3FY4 A;  3ESK A;  4AM9 A;  2WXN A;  3L13 A;  4GZ3 A;  1H2T C;  4OVU A;  3CV0 A;  4FC8 A;  2KZT A;  4PS7 A;  3D9L A;  4P29 A;  2I1K A;  2VYI A;  3URZ A;  3FUE A;  3FH8 A;  3LS8 A;  4Q69 A;  3MX3 A;  4H7Y A;  3CHP A;  5T3R A;  2WXR A;  4UWL A;  2YHC A;  3VTY A;  4B0Z A;  4AEZ C;  3U3W A;  3ESL A;  4RG9 A;  4UWH A;  1HH8 A;  4UWG A;  3CVU A;  1H0A A;  3ENE A;  4L7T A;  4HVB A;  4URK A;  5JJT A;  2PM6 A;  4UWF A;  3MA5 A;  3APD A;  4YVQ C;  1OWN A;  2CHW A;  3QJZ A;  2WQ7 A;  4CEM A;  3FWV A;  4U0U A;  3R7R A;  2VGX B;  2IFU A;  2WXK A;  3I5P A;  4U04 A;  3ML8 A;  4GZ5 A;  1QZ2 A;  2BUG A;  5FQ4 A;  1E90 A;  1NA3 A;  1P5Q A;  4LEU A;  3G2T A;  4HOT A;  1E8W A;  5E75 A;  3CIA A;  3D9O A;  4A1G A;  1HZ4 A;  1H2U A;  3SF4 A;  4BSX A;  4ANX A;  3Q5M A;  4RVB A;  3ZFW A;  3LY9 A;  5BV1 A;  4KZC A;  5ENN A;  4JHJ A;  2Y3A A;  5J90 A;  2A5U A;  2WMO A;  3LVR E;  3PVL A;  3T5V A;  3T5X A;  2C0L A;  2CHZ A;  3B13 A;  3PNL B;  2XGO A;  4EZJ A;  3TG5 A;  4G11 A;  3LCA A;  4NUR A;  5J08 A;  3CK8 A;  1WY6 A;  2L0T B;  2WXL A;  2X6K A;  3VTX A;  4A3V A;  3PUJ A;  3GZ1 A;  4C0M A;  1ZBP A;  4GZC A;  3IBE A;  5G55 A;  3PUK A;  4UI9 K;  2CG3 A;  2V4L A;  3K9I A;  4WNG A;  1OWM A;  5EKQ D;  4YND A;  2WQ6 A;  1IYG A;  4KXK B;  2XPY A;  3QC1 A;  2OVF A;  4AOF A;  5FTP A;  3Q49 B;  4GZD A;  4JEH A;  4LCT A;  2I1J A;  1MQS A;  2I6H A;  3B7T A;  4K03 A;  5FZS A;  2LAI A;  3L08 A;  4A55 A;  3UUX A;  3QB2 A;  3QWW A;  1YA0 A;  4L1B A;  4D10 C;  4G23 A;  3CVQ A;  2LO6 A;  4LER A;  1VDY A;  3TXN A;  4N2Q A;  3CHM A;  2YNQ A;  2X6I A;  4PS8 A;  4DPR A;  2Y4U A;  4G26 A;  4E85 A;  1B89 A;  4WUY A;  2XGS A;  4FAD A;  1IHG A;  2EQX A;  2XQ0 A;  2IF4 A;  2X3M A;  3ZHE B;  2FF4 A;  3BEE A;  3LJ3 A;  4ILH B;  5FQ8 A;  3APC A;  4PH4 B;  2IOL A;  2ZU6 B;  3CVL A;  5C1D A;  2NSZ A;  4MLP A;  2Q7F A;  4UQX A;  3FP3 A;  2MRI A;  4OVV A;  1N52 A;  3RIB A;  4NAC A;  1HXI A;  3HVE B;  4ILG A;  3RJV A;  4EEC A;  2R5S A;  4CGV A;  2KCL A;  4JVS A;  4AY6 A;  3OTN A;  3IKO B;  2KAT A;  4MKT A;  5ARG A;  4U0Z A;  5G04 C;  4C9B B;  3AS8 A;  3PDN A;  2BTD A;  5G05 C;  4G2V A;  4EZK A;  3LY8 A;  4I1A A;  3S7D A;  3MJW A;  4V3I A;  1Z6T A;  4NRH B;  3MV2 B;  3O4Z A;  5G05 J;  3OAW A;  3TG4 A;  3D9P A;  4FP7 A;  3PS6 A;  2HM8 A;  2JLB A;  4ACL A;  2LNI A;  4Y6C A;  3QOU A;  4PDX A;  3MCX A;  5EX0 A;  4EZL A;  4FHJ A;  4IRU A;  3CSF A;  5A23 A;  3CK9 A;  1KLX A;  3ZYQ A;  4G24 A;  4CT0 A;  3SI5 A;  4N39 A;  3VLF A;  5D0O D;  3G2W A;  2J4D A;  4I1M A;  1HO8 A;  4J8S A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...