4Q69A

Crystal structure of a susd homolog (bt2259) from bacteroides thetaiotaomicron vpi-5482 at 2.50 a resolution
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
456
structure length
456
Chain Sequence
PNTAEKVDPGYLFNYVAVNWAGTRTGGDFYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEADPVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEALQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGGMVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFEPGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGLGVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWIDLMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKIWEKLWFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of a SusD homolog (BT2259) from Bacteroides thetaiotaomicron VPI-5482 at 2.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 143
structure length 456
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4q69A00
3JQ1A 3P1UA 3CK7A 3JYSA 3NQPA 4F53A 4LERA 3EHMA 3FDHA 3IV0A 5FQ7A 5J90A 3MCXA 3QNKA 3LEWA 3SGHA 3SNXA 5FQ4A 3CKBA 3CK9A 3CK8A 3MX3A 5FQ8A 3GZSA 3EJNA 5T3RA 3JQ0A 3EHNA 3I4GA 5LX8A 3CGHA 5E75A 4L7TA 5FQ6A 3HDXA 4MRUA 4PUCA 5E76A 3OTNA 4Q69A 5T4YA 3MYVA 4F7AA 3CKCA 3L22A 3KEZA
chains in the Genus database with same CATH superfamily
4HS2A 3CK7A 1N9AA 2ZIRA 4EZJA 5AQ7A 5CRUA 4WAFA 3DPYA 3LDZA 2H6FA 4EPZA 4J8DA 3ZPJA 4GZ3A 2IO3C 2PQNA 2VGEA 1O1RA 5AENA 3ASNE 3UI2A 3LVRE 3R9MA 3HXCA 5EX3A 3PNTB 4G8KA 4I6EA 3LS8A 2FULA 4PDXA 1IKND 3S7FA 5BXUA 4BFRA 4L23A 1HU3A 2L0IA 1TN7A 1N0RA 3LKUA 3J5PA 3KD7A 2ILRA 2V0PA 2L6BA 4N3AA 4UWGA 5ARGA 4AV7A 4JHKA 3G2SA 1TJCA 2IF4A 5HQ8A 4UQYA 5AQAA 3FTYA 3FHEA 1N0QA 2VGXB 4HOSA 3SGHA 1IYGA 4B0ZA 2XCCA 4NURA 1WY6A 1TNYA 3BEEA 2I6HA 3I4RB 4CRWA 3RK6A 4DX1A 4JA9A 2WQ7A 2WXJA 1TN6A 2VTBA 5KNGA 5BPPA 1OCRE 5BV1A 2NC9A 4ANXA 4U8YD 3Q9UC 4HI8A 1A5EA 4XZ4A 2I1JA 3FUNA 3LJ3A 1JCQA 2FBNA 3SI5A 2J09A 1Z5SC 4BX9A 4GA1A 3FEYA 2J07A 3FUHA 3QDNA 4FJYA 4DI4A 2P9KG 3SBSA 5ITZF 2AXUA 1HFAA 1U3CA 5KJLA 1E8WA 2WXOA 2R03A 3D9IA 2UY1A 5EYPF 5LFAA 1XGWA 2JEKA 3L16A 1K1AA 3MCXA 4HRLA 3PEVB 3UQ3A 3FTWA 1OY3D 1MX2A 4HI9A 2WPVA 1D9SA 3E34A 3SF4A 4WWNA 4APOA 5B3SE 1MX6A 3FH5A 4BWRA 4X8QA 4IRUA 1NA0A 4LEUA 2DIWA 3DSUA 4GTQA 4N2SA 3ABLE 1SZAA 3TWSA 1H2UA 1HF8A 3D9HA 3UM2A 3TAXA 5G05C 3TG5A 4HOQA 4A63B 2WVIA 1TNOA 3B7UX 3JUIA 3PE4A 1AP7A 2WXRA 2IOLA 3FH8A 4U95D 4MLPA 4XEIG 3UUXA 3E33A 1FT1A 3RJVA 3R9AB 1L5JA 3WXXA 3Q7AA 3D3MA 2QZAA 4BTBA 2DBAA 2PZIA 5H7PA 4ANWA 4UWKA 3S7BA 4LNUD 4UI9C 4TV3A 3V31A 1KPSB 3QWPA 3DSSA 4BSXA 1HE8A 5FQ6A 5FJYA 2RFAA 3APCA 3LJNA 3HYMB 4JB8P 4KXKB 4UI9K 2Y69E 4EHMA 1OWMA 4DLQA 1FVFA 2VSXE 1H19A 1UN9A 3EHNA 2RFMA 3ZYQA 4ANVA 1OWLA 2KM4A 3TXMA 5HS0A 1UOHA 4IYPA 2OVBA 3CHPA 4TUUA 5G04C 4K03A 2WXHA 4BEPA 3RU0A 3QKYA 2IO2C 5EX0A 3KEAA 3OAWA 2L9BA 2HE0A 4W9RA 2QYUA 2BF0X 2C0LA 2B0OE 2LAHA 4N2QA 2IU1A 3FTUA 2PM7A 5CEAA 2YINA 3RRMB 2Y4TA 4HNAD 1D8EA 1E8YA 4XKCA 2R17C 5JHBA 3ZNGA 4O60A 3TL5A 2CFZA 3MV3B 3D9NA 3SO8A 3I5PA 5LCWJ 1V54E 3Q4AB 3Q75A 4LUNU 2JLBA 3CSFA 5ENNA 2A5UA 3ONKA 5ANLA 4HRNA 4EBAG 4OVUA 2Y0BG 4LNBA 2YHCA 3T9KA 2WXQA 4F53A 4IN3B 4HLLA 1WAO1 4JPSA 3FUDA 4GMJA 3JQ0A 5B1AE 1WDYA 1IHBA 3L13A 4EQFA 4DX5D 3P1UA 4Y6CA 1Y6IA 4I9CA 4G2VA 5D2MC 2WM9A 3SD5A 5CECB 3UX4A 5EIDA 3B95A 1WG0A 1LTXA 2V8SE 4BT8A 3AS5A 3Q79A 4CGVA 3ZFWA 4BESA 3FFLA 2DVWA 3ASFA 5KJNA 4U07A 3ESLA 4MS6A 4CZ2D 1HG5A 5CERB 3AS8A 4GZCA 4A1SA 2ZGGA 3ASGA 3RKVA 3ZRHA 3GZ2A 3TWRA 1EYHA 2LAIA 2J4BA 2VGXA 3JCKC 3UT7A 2F0YA 3CVQA 2VGYA 3CHSA 1BPOA 4JZYA 1PY1A 4RSYA 4B8CB 3PZ4A 2NSZA 1MHQA 3FU3A 5CMWA 1NFIE 3FUEA 3SHFA 2NYJA 1DCEA 4GTOA 3CVPA 4M7CA 3ONLA 3PREA 3ZXPA 4FULA 4A3TA 3CQCB 3D9LA 3P2BA 2VQ2A 1SQMA 4AY5A 3BU8A 1SZ9A 3MV2B 5T3RA 4TUMA 3PUKA 2IJGX 4CDRA 2E2EA 3BUAA 1N4RA 3RIBA 1JUQA 3PRZA 3ZKJA 4C0MA 4JEHA 3ZYKA 1LD7A 4L9PA 3G2UA 1E90A 3FTVA 3APDA 3E32A 3S2AA 5CEDB 4LSZE 3TWVA 2DYSE 4ILIA 2CG2A 2XEEA 5G2NA 2AXZA 2LSVA 4H7XA 3HVEA 2HM8A 3FTZA 4FJZA 3PZ2A 3V30A 1JWFA 3V79K 3OXLA 2IEJA 1QBQA 4GCNA 1Y8MA 1O5MA 4DX2A 3CR3A 4XKBA 3EUVA 5FZQA 5LP0A 4IULA 2PQRA 3ZUVB 4NQ0A 5HKPA 5JA4D 3KEZA 2KXPC 4U96D 3PE3A 4J8YA 3L54A 5FQ7A 4ABNA 4F6RD 3DBSA 4WNDA 1TNBA 3PVLA 1N54A 2MOWA 3RAUA 3BG1B 4XI9A 4MBGA 4UWFA 4J8FA 5JMND 3EHMA 3SFYA 3AG4E 3LEWA 3CKBA 1EF1C 4AP2A 1H6KA 2VSNA 4J0UA 2IOSA 1N11A 4AVXA 4ZFHA 2BTDA 4HQDA 4G11A 3FUJA 3S7JA 3SFXA 5DBKA 5JJTA 1EDUA 4PS8A 1DVPA 3VTYA 2L6JA 4XI0A 2XGSA 3MGBA 2I1KA 4XX5A 3V2OA 3Q78A 5E75A 5JJ7A 5AIJA 2A4ZA 3AG3E 4N3CA 1PC2A 3T8MA 2GRLA 3QNKA 1NL4A 2H6IA 3NB2A 1S64A 3IHVA 5AARA 4G8LA 1YCSB 3TWXA 2XGOA 5LX8A 1K1BA 2VSOE 3B7BA 2QFCA 3DSWA 1OCCE 1X5BA 2J9QA 2MHKA 3E30A 1N4PA 1KLXA 4O6FA 4I1MA 4UI9J 2UWJG 3KS2A 3CIAA 3CHRA 3KAEA 4WWOA 2WQHA 4ATZD 4D10C 3FWVA 3ML8A 4GMRA 3PDNA 4HOUA 4CYMD 5ENRD 4HXIA 4GTMA 4DX7D 3JXIA 2OEWA 3NOCD 2AXVA 4AJWA 5FIOA 4K5CA 4HFGA 3ULEG 4YDWA 3OTNA 3UM3A 4ANUA 3RSEG 4GU5A 4GA0A 3DXMG 2XS1A 3QWVA 3HVEB 5KNHD 4WNEA 1BI7B 3PZ1A 4WNGA 3G2WA 4APFA 4CGWA 1BD8A 1H2TC 3QARA 4U8HA 3OXFA 2WXLA 2LXMA 2X3MA 4DRXE 1QQEA 2QY7A 3UKUG 3CVLA 5ANRA 1RZ4A 3B7SA 2CHXA 2V5QC 2PL2A 3NOGD 2XZDG 4GA2A 3X2QE 4I17A 5ENSD 1V55E 3DSXA 4GTPA 3ABKE 5T4YA 4KVMA 4GPKA 3MKQB 4U8VD 2XEVA 2J08A 2R2LA 2V5FA 1E96B 3I4GA 4L7TA 3ULQA 2ZGDA 1Q2ZA 2ONDA 3UINC 3T8KA 3Q5MA 3TG4A 5FWQA 3ISMC 3CVYA 2E0IA 4V3IA 2GROB 2CHZA 5CBNA 2P2CP 3VLFA 1OCZE 3MJWA 3R7QA 3AG1E 3L22A 1YYHA 2AVPA 3ZN3A 3DRAA 4GTVA 4FADA 2DYRE 1OT8A 5EKQD 1UJKA 1AWCB 3GZSA 2X6KA 4RLYA 4FA6A 3FUFA 3CVNA 1N4SA 3QC1A 1E7VA 4UQZA 5D0QD 5KBAA 2I2OA 2WXFA 2WXIA 1KZPA 3L17A 4LERA 3EHQA 3ZXSA 2KZTB 1W3BA 4J8EA 3SNXA 2P58C 3CK9A 4CEMA 3FU6A 4KZ0A 4KVOA 3CQGB 3UIPC 1BI8B 1OWPA 5B1BE 4GZ6A 2XQ0A 4HVBA 1OXJA 3D9PA 4U0UA 3NF1A 1KZOA 3ZIMA 2H6GA 2P9NG 1OCOE 2PM6A 1BLXB 5HRYA 5CCLA 4N3BA 3CHMA 4I1AA 1K3ZD 3NZSA 3HRAA 5CCMA 3ZGQA 3AU5A 1SW6A 3QK0A 5CRVA 4BX8A 3E4BA 5KCMA 3NAWA 4A3VA 2P9IG 5AAOA 3S7DA 4HORA 2ZISA 3U4TA 3BG0B 3QOUA 1N95A 4AOFA 2QYJA 2HR2A 4GZDA 2F8YA 2DZOA 4DJAA 3O48A 1BU9A 4UUCA 5J08A 1QNFA 1PAQA 4ILHB 5AJDA 4JHJA 3EHRA 2EIKE 1TEZA 2WXMA 1D8DA 4AM9A 2Y3AA 3MYVA 4E85A 4N39A 4DLOA 3LYAA 4WWPA 3SFZA 5AYWD 2GW1A 4OAVB 3Q73A 5JHAA 3IXEA 3APFA 5HI7A 2XGMA 2XPZA 3CV0A 4B94A 4QQIA 4J7WA 3ZYMA 3UPVA 3JYSA 1U3DA 1MJ0A 4EZKA 2ZXWE 1H6PA 3B7TA 3Q49B 2XS8A 3FH7A 2H6HA 2RG8A 3JUEA 2L0TB 2OV8A 5EN5D 1JPLA 3N71A 1B89A 5DIZA 5BW8C 1FT2A 4RG6A 3FULA 4HB5A 3UT4A 2EQXA 4AY6A 2AJAA 3FY4A 2GGFA 1X81A 3DSTA 4QFVA 2AW6A 4R7LA 3TXNA 4KMOA 4Z68A 3VTXA 4NACA 1IHGA 2VYIA 4FLHA 5FZRA 3CK8A 5BXOA 1TYQG 4CT0A 3OXGA 4FC8A 3UXGA 3G2VA 5EILA 3RRUA 3FEXA 4DUIA 1JCSA 5G55A 2IY0C 3ZVVA 1OUVA 2RD0A 4GTTA 3DSVA 4GYYA 1TNZA 4FHJA 2Q7FA 3EU5A 2I9CA 3LY8A 3JXJA 3WG7E 4UWHA 2BUGA 1Z3YA 4OVVA 4G26A 4PS3A 3SBTB 5LCWC 4I9EA 3LPZA 2QC9A 3IV0A 3IEGA 2YNQA 1IQRA 1HH8A 2XEHA 5FZSA 3EJNA 4YNDA 4EBAA 3R7RA 4DK5A 5C1DA 1HG2A 2X6JA 4F7AA 1FPPA 2KCVA 4YDEA 3ASHA 3D9JA 3URZA 2WQ6A 2KCKA 3QWWA 1UW4B 4WNFA 3KSQA 5KJKA 4JA7A 3IBEA 4KYOB 3CVXA 1UG3A 2FO1E 3EDTB 2GRRB 4E6HA 4GB9A 4AIFA 3MZLB 4TXRA 5FTPA 3EIJA 2P9UG 1N4QA 3TWWA 4K5BA 1E8ZA 1EPUA 3UMVA 4ATGA 3ZEFA 4I43A 4GPMA 3Q47B 5BUZA 3L9TA 4ZHBA 3MKQA 5EIBE 2ZU6B 2F37A 3SY2A 3ZHEB 2C2LA 3W9GA 2LO6A 1LD8A 4L2YA 3FUMA 2M63A 3UT8A 3PZ3A 1N94A 4C9BB 3FTXA 4AXHA 3AJIA 1MZCA 3CVVA 4XE0A 5G05J 2OCCE 4GCOA 4JC8A 4Y6WA 3HIZA 4OAUC 3C3QA 5J90A 1QYMA 4RVBA 4A55A 3MX3A 3IKOB 2XZTG 3V2XA 3CVUA 3K9IA 2BKGA 1TN8A 4U0ZA 1MX4A 1U2VG 5T8IA 2BKKB 3DEPA 4JW1A 3CHOA 3DXKG 4DI3A 2GRQB 2KZTA 3PNLB 2X6HA 4UQXA 3DWLG 5BT1A 4K5AB 3B7RL 4HRMB 4RG9A 4GAAA 2NXPA 3EU9A 4B8AA 4OYSA 3UM0A 1QZ2A 1MQSA 1NI1A 3TWUA 3LVQE 1E8XA 4KBQA 3AAAC 3PZDA 2OVFA 2IFUA 5E76A 3VLDA 3U9WA 2DZNA 4FU3A 4ME2A 5AQ9A 5G04J 1FCHA 2CHWA 4L1BA 2VJ8A 2FO7A 3C3OA 5JJ6A 4I6JA 3L6AA 2XPYA 2KC7A 5LOZA 1KT1A 4GYOA 1SVXA 1GW6A 1S0PA 3GW4A 1K8KG 2ETBA 4TRQA 5FQ4A 4MKTA 1IXVA 2XENA 1ELWA 3RO3A 2BEDA 4C0EA 4A1GA 1DCQA 1SA4A 3LXUX 5A6CA 2X38A 3ABME 2EIME 3Q7FA 4KT6B 5M72A 4GTRA 3SZ7A 1ZB1A 3UIOC 1HX8A 4TXQA 2WXPA 5FQ8A 3UKRG 4LCTA 3ULYA 1UJJA 4I2WA 4I6GA 4ILGA 1NP7A 3C5RA 2DCPA 3ZU7B 2XPIA 4RQIA 4HOTA 3PS6A 3BQOA 4BSZB 3F6QA 3TWQA 4CCAA 4URKA 2WXGA 3AU4A 2LXLA 1NZNA 2PNNA 4GYWA 4G1TA 1ELKA 4XIFA 2WXKA 2MYOA 2WXNA 4CT4A 3NZUA 4M3OA 5AJLA 2YQ8A 2WMNA 2RKKA 3PEUB 3AG2E 3B13A 4GMLA 4Q96A 3LY7A 2HYZA 5CBOA 2F8XK 4WUYA 4U0SA 4EZLA 4B89A 1Z6TA 2AWIA 4FHKA 1A17A 5BV0A 5KJMA 1HO8A 4C48B 2LSUA 3TJPA 4JD2G 4HBDA 5FINA 3FTSA 3DEOA 1XNFA 1ZU2A 5FT9A 4U04A 2GRMA 5ENPD 5KWDA 4LNGA 1ELRA 4YDYA 2HO1A 4YVQC 3CHQA 4JL0A 3TWTA 3CEQA 2VTBB 3HHMA 3HG0D 4TXPA 3L82A 3J5QB 2JABA 4DX6D 2WB2A 3HXDA 2X6IA 3GZ1A 3T5XA 4GTSA 1H0AA 2X6FA 3HDXA 2V4LA 2OEVA 2FI7A 3JQ1A 3T5VA 2VSYA 5AQBA 4UWLA 4G24A 4DPRA 2MRIA 5BNWA 2XHEA 3U64A 3IHYA 1G3NB 4LRZA 2J8SD 4O1PA 2P9LG 2B6CA 3I3NA 1HS6A 4KZCA 3RRNB 5ENTD 3U3WA 4B93B 4J8SA 1SA5A 3DPDA 3QJZA 4BETA 4H7YA 5EDSA 2UY1B 1YMPA 3MEKA 1YA0A 2XRYA 2R05A 2CG3A 1FVHA 3QAQA 4ACLA 3U66A 1Z3XA 3CGHA 4GZ5A 3Q9NC 1DNPA 4MRUA 4BT9A 5ENOD 3FU5A 5ARFA 2R59A 2EILE 1P5QA 3MKRA 4G23A 3EIQC 2J49A 5AN8A 3ZHEA 4AEZC 4P29A 3AS4A 3HXFA 4O1OA 4BY6A 4FLBA 3KSLA 4LG6A 3O4ZA 5A23A 1LF8A 3GYZA 1E7UA 1JWGA 3D9MA 4HLEA 3PUJA 3VLEA 2XCBA 3NQPA 2KCLA 3FDHA 4YDOA 1RW2A 3D9OA 3CLJA 4F1SA 3CVWA 1O1TA 4CDMA 2J4DA 3UM1A 3FUKA 1IQUA 2Y4UA 4PUCA 2IQCA 2LNIA 4JEUA 4JXTA 3C98A 5IY5E 4F1PA 4K0RA 2KBXA 3NBNB 5ENQD 3Q15A 5EYLA 3FP3A 4JHRA 3ESKA 3W9FA 2GRPB 2C0MA 3G2TA 2FF4A 3FU0A 4FP7A 3CKCA 1UN8A 3TGOA 1WM5A 1OWNA 3HXEA 2R02A 3ASDA 3LCAA 3RO2A 2P9SG 2KATA 4EECA 3MA5A 3L08A 4ACKA 5D0OD 3ZYLA 2LUHA 1INZA 4J6IA 4U63A 3FUIA 4F3VA 1H6OA 2OOEA 5D66A 3SQVA 1ZBPA 3E37A 2IONA 4NRHB 2FEZA 4NIKA 2EIJE 5A7DB 4JVSA 3CSTA 1TJFA 4BERA 4YVOA 3ENEA 3ASOE 1O1SA 5C2YA 2CFUA 3HXBA 2EINE 3C72A 2ETAA 5CHEE 1NA3A 1S63A 4N5QA 1OWOA 2R5SA 4PH4B 4I2ZA 4Q94A 2P9PG 4Q69A 4U7EB 3C3RA 1HZ4A 5CMYA 1HXIA 3PH0C 3LY9A 1MYOA 3ML9A 1TR4A 3UTMA 1TNUA 2DWZA 3ZW3A 2GRNB 1VDYA 3QB2A 4I1OB 2V4HC 2XRZA 4N5CA 1DC2A 3D9KA 4L2LA 2WMOA 4BTAA 4CDNA 2A5EA 1JCRA 1KT0A 1N52A 1H2VC 1S70B 4PS7A 4G25A 2YHEA 2ETCA 2Y1LE
chains in the Genus database with same CATH topology
4HS2A 4ME2A 5KJNA 3CK7A 3L17A 4U07A 4LERA 3ZXSA 5G04J 3ESLA 4EZJA 1FCHA 2CHWA 1W3BA 1HG5A 2KZTB 4J8EA 4L1BA 4MS6A 3AS8A 4WAFA 4GZCA 2P58C 3CK9A 3LDZA 3SNXA 4CEMA 3FU6A 4KZ0A 4KVOA 2VJ8A 2FO7A 3CQGB 4EPZA 4J8DA 3ZPJA 4A1SA 3ASGA 1OWPA 4GZ6A 5JJ6A 4I6JA 3L6AA 3RKVA 2XQ0A 4GZ3A 4HVBA 3ZRHA 3D9PA 3GZ2A 2PQNA 1EYHA 2KC7A 2XPYA 2LAIA 4U0UA 1KT1A 3NF1A 5LOZA 4GYOA 2J4BA 1GW6A 2VGXA 1S0PA 3ZIMA 3GW4A 3JCKC 3UT7A 3CVQA 5AENA 2VGYA 3CHSA 1BPOA 4JZYA 1PY1A 2PM6A 4RSYA 4B8CB 3LVRE 4TRQA 5FQ4A 4MKTA 5CCLA 2NSZA 3CHMA 4N3BA 4I1AA 5EX3A 3NZSA 3PNTB 1MHQA 3FU3A 5CCMA 5CMWA 1ELWA 4I6EA 3RO3A 3LS8A 3AU5A 2FULA 3QK0A 3ZGQA 4C0EA 4PDXA 4A1GA 3S7FA 4BX8A 3FUEA 4BFRA 3E4BA 5KCMA 3SHFA 3LXUX 4A3VA 5A6CA 2X38A 4L23A 3S7DA 4HORA 3U4TA 3BG0B 4KT6B 5M72A 1HU3A 3QOUA 3CVPA 2L0IA 4AOFA 3SZ7A 3LKUA 2HR2A 3KD7A 3ONLA 3PREA 2ILRA 2V0PA 4FULA 4GZDA 4A3TA 3CQCB 3D9LA 3P2BA 2VQ2A 4DJAA 3O48A 1HX8A 1SQMA 4N3AA 4UWGA 2WXPA 5ARGA 4AY5A 1SZ9A 3MV2B 5FQ8A 4AV7A 5J08A 4LCTA 5T3RA 3PUKA 4JHKA 1QNFA 3G2SA 1PAQA 1UJJA 1TJCA 4ILHB 4I2WA 2IJGX 4I6GA 4JHJA 2IF4A 5AJDA 4ILGA 4CDRA 5HQ8A 2E2EA 1NP7A 4UQYA 1TEZA 2DCPA 2WXMA 3RIBA 1JUQA 3PRZA 2XPIA 4AM9A 2Y3AA 3MYVA 3FTYA 4C0MA 4E85A 4JEHA 3ZYKA 4N39A 3FHEA 3LYAA 4DLOA 4HOTA 2VGXB 3PS6A 4WWPA 4HOSA 4CCAA 3SGHA 3SFZA 5AYWD 1IYGA 3G2UA 4B0ZA 1E90A 2XCCA 4NURA 4URKA 3FTVA 3APDA 1WY6A 2WXGA 3AU4A 3S2AA 2GW1A 3BEEA 1NZNA 2I6HA 4GYWA 3I4RB 4G1TA 4CRWA 4ILIA 1ELKA 4XIFA 3RK6A 2WXKA 5JHAA 2CG2A 2WXNA 4JA9A 2WQ7A 3APFA 4CT4A 5HI7A 5G2NA 2XGMA 3NZUA 2XPZA 2AXZA 2WXJA 3CV0A 4M3OA 5AJLA 2LSVA 4H7XA 4B94A 3HVEA 2HM8A 2YQ8A 2VTBA 3ZYMA 3UPVA 3FTZA 5BPPA 4FJZA 3JYSA 2WMNA 5BV1A 1U3DA 3PEUB 1JWFA 4EZKA 3B13A 3B7TA 4GMLA 2NC9A 4Q96A 3OXLA 4ANXA 3Q49B 3LY7A 2HYZA 3FH7A 4GCNA 2RG8A 4WUYA 1Y8MA 4U0SA 4EZLA 2L0TB 4XZ4A 2OV8A 4B89A 2I1JA 3CR3A 3FUNA 3LJ3A 1Z6TA 2AWIA 4FHKA 1A17A 4XKBA 5FZQA 5BV0A 5LP0A 5KJMA 4IULA 2PQRA 2FBNA 1JPLA 4NQ0A 3N71A 1HO8A 1B89A 2LSUA 3KEZA 5DIZA 3TJPA 3SI5A 5BW8C 2J09A 3PE3A 4RG6A 4BX9A 3L54A 4GA1A 5FQ7A 3FEYA 2J07A 4ABNA 3FTSA 3FULA 3DBSA 3FUHA 4WNDA 3UT4A 3QDNA 3PVLA 1XNFA 1ZU2A 5FT9A 1N54A 4U04A 2EQXA 4AY6A 2GRMA 3FY4A 2GGFA 1ELRA 4FJYA 4DI4A 2HO1A 3SBSA 4YVQC 2AXUA 2MOWA 3CHQA 4JL0A 1HFAA 1U3CA 5KJLA 4QFVA 1E8WA 2AW6A 2WXOA 3BG1B 4R7LA 4XI9A 3TXNA 4KMOA 3CEQA 2UY1A 3D9IA 4J8FA 4UWFA 5LFAA 1XGWA 2JEKA 3L16A 2VTBB 3EHMA 3HHMA 3VTXA 4NACA 3MCXA 1IHGA 2VYIA 3LEWA 3PEVB 4FLHA 3UQ3A 3FTWA 5FZRA 3CKBA 3CK8A 1EF1C 2WB2A 2WPVA 4CT0A 4AP2A 1H6KA 3OXGA 4FC8A 2X6IA 2VSNA 3GZ1A 4J0UA 3SF4A 4WWNA 3G2VA 1H0AA 2IOSA 2X6FA 3T5XA 4APOA 4AVXA 2BTDA 3HDXA 3RRUA 3FEXA 3FH5A 4BWRA 4G11A 3FUJA 3S7JA 2V4LA 4IRUA 5G55A 3ZVVA 1OUVA 2RD0A 5DBKA 2FI7A 5JJTA 1NA0A 3JQ1A 1EDUA 3T5VA 2VSYA 4UWLA 4G24A 4DPRA 4PS8A 1DVPA 4GYYA 4LEUA 2MRIA 5BNWA 2DIWA 3VTYA 2XHEA 4FHJA 2Q7FA 2L6JA 3U64A 3IHYA 4LRZA 2I9CA 2XGSA 3LY8A 4XI0A 4N2SA 3MGBA 2I1KA 4XX5A 1SZAA 4UWHA 2BUGA 5E75A 3I3NA 5JJ7A 1HS6A 4KZCA 3RRNB 1H2UA 1Z3YA 1HF8A 4OVVA 5AIJA 2A4ZA 3U3WA 4N3CA 3TAXA 4G26A 4PS3A 3SBTB 1PC2A 4J8SA 5G05C 3TG5A 5LCWC 3DPDA 4I9EA 4HOQA 3QJZA 3T8MA 3LPZA 4H7YA 5EDSA 2UY1B 2GRLA 3IV0A 2WVIA 3QNKA 3MEKA 3B7UX 1YA0A 3IEGA 3JUIA 2XRYA 3PE4A 2CG3A 2YNQA 1IQRA 1FVHA 1HH8A 2WXRA 3IHVA 5FZSA 3EJNA 2IOLA 4YNDA 3FH8A 3QAQA 4ACLA 3U66A 4MLPA 1Z3XA 2XGOA 4EBAA 3CGHA 5LX8A 3R7RA 4DK5A 3UUXA 4GZ5A 1DNPA 2VSOE 4MRUA 5C1DA 1HG2A 2X6JA 4BT9A 3FU5A 2QFCA 4F7AA 3RJVA 3R9AB 1L5JA 2KCVA 3WXXA 5ARFA 1X5BA 2R59A 3ASHA 1P5QA 3D9JA 3MKRA 3URZA 4G23A 3EIQC 2J49A 3D3MA 2WQ6A 2KCKA 4BTBA 2DBAA 3QWWA 1UW4B 2J9QA 2MHKA 2PZIA 3ZHEA 4AEZC 4ANWA 4P29A 3AS4A 4UWKA 3S7BA 4WNFA 5KJKA 1KLXA 4O6FA 4BY6A 4JA7A 4TV3A 4I1MA 3IBEA 4FLBA 4KYOB 4UI9C 4UI9J 3CVXA 3O4ZA 1UG3A 2UWJG 3EDTB 3KS2A 3QWPA 3CIAA 3CHRA 3KAEA 4WWOA 4BSXA 1HE8A 5FQ6A 4E6HA 5A23A 2WQHA 5FJYA 4D10C 1LF8A 3FWVA 3ML8A 3GYZA 3PDNA 1E7UA 4GB9A 4AIFA 1JWGA 4HOUA 3MZLB 3D9MA 4HLEA 4HXIA 5FTPA 3APCA 3EIJA 3PUJA 3VLEA 2XCBA 3NQPA 3HYMB 2KCLA 4KXKB 3FDHA 4UI9K 1OWMA 4DLQA 1FVFA 2AXVA 3D9OA 1E8ZA 1EPUA 3CLJA 4AJWA 4F1SA 3CVWA 3UMVA 2VSXE 1H19A 4ATGA 4CDMA 2J4DA 1UN9A 4HFGA 3EHNA 3ZEFA 3ZYQA 4I43A 4ANVA 3Q47B 3FUKA 1IQUA 1OWLA 2Y4UA 2KM4A 3TXMA 4PUCA 5BUZA 2IQCA 2LNIA 3OTNA 4JEUA 4JXTA 2WXIA 3C98A 4IYPA 2OVBA 4ANUA 3CHPA 4GU5A 4GA0A 4K0RA 3MKQA 4TUUA 5G04C 4K03A 2WXHA 3QWVA 3HVEB 3RU0A 4WNEA 3Q15A 3FP3A 2ZU6B 3QKYA 5EX0A 3OAWA 3ZHEB 2C2LA 2L9BA 4WNGA 4W9RA 3G2WA 2LO6A 2BF0X 4APFA 4CGWA 4JHRA 3ESKA 4L2YA 1H2TC 2C0LA 3QARA 4U8HA 3FUMA 3OXFA 2WXLA 2C0MA 2M63A 3G2TA 2LAHA 3UT8A 4N2QA 2IU1A 2FF4A 3FU0A 4FP7A 2X3MA 3FTUA 3CKCA 1QQEA 2QY7A 2PM7A 1UN8A 4C9BB 3TGOA 2YINA 1WM5A 3CVLA 3FTXA 5ANRA 1OWNA 3B7SA 2CHXA 4AXHA 3ASDA 3RRMB 2Y4TA 3LCAA 3RO2A 2PL2A 1E8YA 4GA2A 4XKCA 2R17C 5JHBA 2KATA 4I17A 4EECA 3MA5A 3L08A 3TL5A 4ACKA 2CFZA 3MV3B 3CVVA 5D0OD 3ZYLA 1INZA 4J6IA 3D9NA 5T4YA 3I5PA 4U63A 4XE0A 3FUIA 4F3VA 2OOEA 5G05J 5LCWJ 4GCOA 4JC8A 4KVMA 4Y6WA 4GPKA 3MKQB 3HIZA 3Q4AB 2XEVA 5J90A 4LUNU 1ZBPA 4RVBA 2JLBA 2J08A 4A55A 3CSFA 5ENNA 3MX3A 2IONA 3IKOB 2A5UA 3ONKA 3CVUA 3K9IA 2V5FA 4NRHB 1E96B 5ANLA 3I4GA 4U0ZA 2FEZA 4L7TA 3ULQA 5A7DB 4JVSA 5T8IA 2ONDA 4EBAG 3CSTA 4JW1A 1TJFA 3CHOA 3Q5MA 3TG4A 4YVOA 4OVUA 5FWQA 3CVYA 2YHCA 3ENEA 4F53A 2E0IA 2WXQA 4DI3A 2KZTA 3PNLB 2X6HA 4V3IA 5C2YA 2CFUA 4IN3B 4UQXA 2CHZA 1WAO1 4JPSA 3FUDA 4GMJA 5CHEE 3JQ0A 1NA3A 1OWOA 5BT1A 2R5SA 4PH4B 4I2ZA 4Q94A 3VLFA 3L13A 3B7RL 3MJWA 4EQFA 4Q69A 4RG9A 1HZ4A 3R7QA 4GAAA 5CMYA 1HXIA 2NXPA 3PH0C 3L22A 3LY9A 2AVPA 3ML9A 3P1UA 4Y6CA 4B8AA 3ZN3A 4OYSA 1Y6IA 4I9CA 1QZ2A 4FADA 4G2VA 3ZW3A 1VDYA 3QB2A 1MQSA 2WM9A 4I1OB 3SD5A 2XRZA 5EKQD 4N5CA 1UJKA 3LVQE 3UX4A 1E8XA 3D9KA 4L2LA 3GZSA 2X6KA 4KBQA 2WMOA 4BTAA 4FA6A 4CDNA 2V8SE 4BT8A 3FUFA 3CVNA 3AS5A 3PZDA 4CGVA 2OVFA 2IFUA 1KT0A 5E76A 3VLDA 3ZFWA 1N52A 1H2VC 3QC1A 3U9WA 1E7VA 4UQZA 5D0QD 4FU3A 4PS7A 2I2OA 3FFLA 4G25A 2WXFA 2YHEA 3ASFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQ1 A;  3P1U A;  3CK7 A;  3JYS A;  3NQP A;  4F53 A;  4LER A;  3EHM A;  3FDH A;  3IV0 A;  5FQ7 A;  5J90 A;  3MCX A;  3QNK A;  3LEW A;  3SGH A;  3SNX A;  5FQ4 A;  3CKB A;  3CK9 A;  3CK8 A;  3MX3 A;  5FQ8 A;  3GZS A;  3EJN A;  5T3R A;  3JQ0 A;  3EHN A;  3I4G A;  5LX8 A;  3CGH A;  5E75 A;  4L7T A;  5FQ6 A;  3HDX A;  4MRU A;  4PUC A;  5E76 A;  3OTN A;  4Q69 A;  5T4Y A;  3MYV A;  4F7A A;  3CKC A;  3L22 A;  3KEZ A; 
#chains in the Genus database with same CATH topology
 4HS2 A;  3CK7 A;  1N9A A;  2ZIR A;  4EZJ A;  5AQ7 A;  5CRU A;  4WAF A;  3DPY A;  3LDZ A;  2H6F A;  4EPZ A;  4J8D A;  3ZPJ A;  4GZ3 A;  2IO3 C;  2PQN A;  2VGE A;  1O1R A;  5AEN A;  3ASN E;  3UI2 A;  3LVR E;  3R9M A;  3HXC A;  5EX3 A;  3PNT B;  4G8K A;  4I6E A;  3LS8 A;  2FUL A;  4PDX A;  1IKN D;  3S7F A;  5BXU A;  4BFR A;  4L23 A;  1HU3 A;  2L0I A;  1TN7 A;  1N0R A;  3LKU A;  3J5P A;  3KD7 A;  2ILR A;  2V0P A;  2L6B A;  4N3A A;  4UWG A;  5ARG A;  4AV7 A;  4JHK A;  3G2S A;  1TJC A;  2IF4 A;  5HQ8 A;  4UQY A;  5AQA A;  3FTY A;  3FHE A;  1N0Q A;  2VGX B;  4HOS A;  3SGH A;  1IYG A;  4B0Z A;  2XCC A;  4NUR A;  1WY6 A;  1TNY A;  3BEE A;  2I6H A;  3I4R B;  4CRW A;  3RK6 A;  4DX1 A;  4JA9 A;  2WQ7 A;  2WXJ A;  1TN6 A;  2VTB A;  5KNG A;  5BPP A;  1OCR E;  5BV1 A;  2NC9 A;  4ANX A;  4U8Y D;  3Q9U C;  4HI8 A;  1A5E A;  4XZ4 A;  2I1J A;  3FUN A;  3LJ3 A;  1JCQ A;  2FBN A;  3SI5 A;  2J09 A;  1Z5S C;  4BX9 A;  4GA1 A;  3FEY A;  2J07 A;  3FUH A;  3QDN A;  4FJY A;  4DI4 A;  2P9K G;  3SBS A;  5ITZ F;  2AXU A;  1HFA A;  1U3C A;  5KJL A;  1E8W A;  2WXO A;  2R03 A;  3D9I A;  2UY1 A;  5EYP F;  5LFA A;  1XGW A;  2JEK A;  3L16 A;  1K1A A;  3MCX A;  4HRL A;  3PEV B;  3UQ3 A;  3FTW A;  1OY3 D;  1MX2 A;  4HI9 A;  2WPV A;  1D9S A;  3E34 A;  3SF4 A;  4WWN A;  4APO A;  5B3S E;  1MX6 A;  3FH5 A;  4BWR A;  4X8Q A;  4IRU A;  1NA0 A;  4LEU A;  2DIW A;  3DSU A;  4GTQ A;  4N2S A;  3ABL E;  1SZA A;  3TWS A;  1H2U A;  1HF8 A;  3D9H A;  3UM2 A;  3TAX A;  5G05 C;  3TG5 A;  4HOQ A;  4A63 B;  2WVI A;  1TNO A;  3B7U X;  3JUI A;  3PE4 A;  1AP7 A;  2WXR A;  2IOL A;  3FH8 A;  4U95 D;  4MLP A;  4XEI G;  3UUX A;  3E33 A;  1FT1 A;  3RJV A;  3R9A B;  1L5J A;  3WXX A;  3Q7A A;  3D3M A;  2QZA A;  4BTB A;  2DBA A;  2PZI A;  5H7P A;  4ANW A;  4UWK A;  3S7B A;  4LNU D;  4UI9 C;  4TV3 A;  3V31 A;  1KPS B;  3QWP A;  3DSS A;  4BSX A;  1HE8 A;  5FQ6 A;  5FJY A;  2RFA A;  3APC A;  3LJN A;  3HYM B;  4JB8 P;  4KXK B;  4UI9 K;  2Y69 E;  4EHM A;  1OWM A;  4DLQ A;  1FVF A;  2VSX E;  1H19 A;  1UN9 A;  3EHN A;  2RFM A;  3ZYQ A;  4ANV A;  1OWL A;  2KM4 A;  3TXM A;  5HS0 A;  1UOH A;  4IYP A;  2OVB A;  3CHP A;  4TUU A;  5G04 C;  4K03 A;  2WXH A;  4BEP A;  3RU0 A;  3QKY A;  2IO2 C;  5EX0 A;  3KEA A;  3OAW A;  2L9B A;  2HE0 A;  4W9R A;  2QYU A;  2BF0 X;  2C0L A;  2B0O E;  2LAH A;  4N2Q A;  2IU1 A;  3FTU A;  2PM7 A;  5CEA A;  2YIN A;  3RRM B;  2Y4T A;  4HNA D;  1D8E A;  1E8Y A;  4XKC A;  2R17 C;  5JHB A;  3ZNG A;  4O60 A;  3TL5 A;  2CFZ A;  3MV3 B;  3D9N A;  3SO8 A;  3I5P A;  5LCW J;  1V54 E;  3Q4A B;  3Q75 A;  4LUN U;  2JLB A;  3CSF A;  5ENN A;  2A5U A;  3ONK A;  5ANL A;  4HRN A;  4EBA G;  4OVU A;  2Y0B G;  4LNB A;  2YHC A;  3T9K A;  2WXQ A;  4F53 A;  4IN3 B;  4HLL A;  1WAO 1;  4JPS A;  3FUD A;  4GMJ A;  3JQ0 A;  5B1A E;  1WDY A;  1IHB A;  3L13 A;  4EQF A;  4DX5 D;  3P1U A;  4Y6C A;  1Y6I A;  4I9C A;  4G2V A;  5D2M C;  2WM9 A;  3SD5 A;  5CEC B;  3UX4 A;  5EID A;  3B95 A;  1WG0 A;  1LTX A;  2V8S E;  4BT8 A;  3AS5 A;  3Q79 A;  4CGV A;  3ZFW A;  4BES A;  3FFL A;  2DVW A;  3ASF A;  5KJN A;  4U07 A;  3ESL A;  4MS6 A;  4CZ2 D;  1HG5 A;  5CER B;  3AS8 A;  4GZC A;  4A1S A;  2ZGG A;  3ASG A;  3RKV A;  3ZRH A;  3GZ2 A;  3TWR A;  1EYH A;  2LAI A;  2J4B A;  2VGX A;  3JCK C;  3UT7 A;  2F0Y A;  3CVQ A;  2VGY A;  3CHS A;  1BPO A;  4JZY A;  1PY1 A;  4RSY A;  4B8C B;  3PZ4 A;  2NSZ A;  1MHQ A;  3FU3 A;  5CMW A;  1NFI E;  3FUE A;  3SHF A;  2NYJ A;  1DCE A;  4GTO A;  3CVP A;  4M7C A;  3ONL A;  3PRE A;  3ZXP A;  4FUL A;  4A3T A;  3CQC B;  3D9L A;  3P2B A;  2VQ2 A;  1SQM A;  4AY5 A;  3BU8 A;  1SZ9 A;  3MV2 B;  5T3R A;  4TUM A;  3PUK A;  2IJG X;  4CDR A;  2E2E A;  3BUA A;  1N4R A;  3RIB A;  1JUQ A;  3PRZ A;  3ZKJ A;  4C0M A;  4JEH A;  3ZYK A;  1LD7 A;  4L9P A;  3G2U A;  1E90 A;  3FTV A;  3APD A;  3E32 A;  3S2A A;  5CED B;  4LSZ E;  3TWV A;  2DYS E;  4ILI A;  2CG2 A;  2XEE A;  5G2N A;  2AXZ A;  2LSV A;  4H7X A;  3HVE A;  2HM8 A;  3FTZ A;  4FJZ A;  3PZ2 A;  3V30 A;  1JWF A;  3V79 K;  3OXL A;  2IEJ A;  1QBQ A;  4GCN A;  1Y8M A;  1O5M A;  4DX2 A;  3CR3 A;  4XKB A;  3EUV A;  5FZQ A;  5LP0 A;  4IUL A;  2PQR A;  3ZUV B;  4NQ0 A;  5HKP A;  5JA4 D;  3KEZ A;  2KXP C;  4U96 D;  3PE3 A;  4J8Y A;  3L54 A;  5FQ7 A;  4ABN A;  4F6R D;  3DBS A;  4WND A;  1TNB A;  3PVL A;  1N54 A;  2MOW A;  3RAU A;  3BG1 B;  4XI9 A;  4MBG A;  4UWF A;  4J8F A;  5JMN D;  3EHM A;  3SFY A;  3AG4 E;  3LEW A;  3CKB A;  1EF1 C;  4AP2 A;  1H6K A;  2VSN A;  4J0U A;  2IOS A;  1N11 A;  4AVX A;  4ZFH A;  2BTD A;  4HQD A;  4G11 A;  3FUJ A;  3S7J A;  3SFX A;  5DBK A;  5JJT A;  1EDU A;  4PS8 A;  1DVP A;  3VTY A;  2L6J A;  4XI0 A;  2XGS A;  3MGB A;  2I1K A;  4XX5 A;  3V2O A;  3Q78 A;  5E75 A;  5JJ7 A;  5AIJ A;  2A4Z A;  3AG3 E;  4N3C A;  1PC2 A;  3T8M A;  2GRL A;  3QNK A;  1NL4 A;  2H6I A;  3NB2 A;  1S64 A;  3IHV A;  5AAR A;  4G8L A;  1YCS B;  3TWX A;  2XGO A;  5LX8 A;  1K1B A;  2VSO E;  3B7B A;  2QFC A;  3DSW A;  1OCC E;  1X5B A;  2J9Q A;  2MHK A;  3E30 A;  1N4P A;  1KLX A;  4O6F A;  4I1M A;  4UI9 J;  2UWJ G;  3KS2 A;  3CIA A;  3CHR A;  3KAE A;  4WWO A;  2WQH A;  4ATZ D;  4D10 C;  3FWV A;  3ML8 A;  4GMR A;  3PDN A;  4HOU A;  4CYM D;  5ENR D;  4HXI A;  4GTM A;  4DX7 D;  3JXI A;  2OEW A;  3NOC D;  2AXV A;  4AJW A;  5FIO A;  4K5C A;  4HFG A;  3ULE G;  4YDW A;  3OTN A;  3UM3 A;  4ANU A;  3RSE G;  4GU5 A;  4GA0 A;  3DXM G;  2XS1 A;  3QWV A;  3HVE B;  5KNH D;  4WNE A;  1BI7 B;  3PZ1 A;  4WNG A;  3G2W A;  4APF A;  4CGW A;  1BD8 A;  1H2T C;  3QAR A;  4U8H A;  3OXF A;  2WXL A;  2LXM A;  2X3M A;  4DRX E;  1QQE A;  2QY7 A;  3UKU G;  3CVL A;  5ANR A;  1RZ4 A;  3B7S A;  2CHX A;  2V5Q C;  2PL2 A;  3NOG D;  2XZD G;  4GA2 A;  3X2Q E;  4I17 A;  5ENS D;  1V55 E;  3DSX A;  4GTP A;  3ABK E;  5T4Y A;  4KVM A;  4GPK A;  3MKQ B;  4U8V D;  2XEV A;  2J08 A;  2R2L A;  2V5F A;  1E96 B;  3I4G A;  4L7T A;  3ULQ A;  2ZGD A;  1Q2Z A;  2OND A;  3UIN C;  3T8K A;  3Q5M A;  3TG4 A;  5FWQ A;  3ISM C;  3CVY A;  2E0I A;  4V3I A;  2GRO B;  2CHZ A;  5CBN A;  2P2C P;  3VLF A;  1OCZ E;  3MJW A;  3R7Q A;  3AG1 E;  3L22 A;  1YYH A;  2AVP A;  3ZN3 A;  3DRA A;  4GTV A;  4FAD A;  2DYR E;  1OT8 A;  5EKQ D;  1UJK A;  1AWC B;  3GZS A;  2X6K A;  4RLY A;  4FA6 A;  3FUF A;  3CVN A;  1N4S A;  3QC1 A;  1E7V A;  4UQZ A;  5D0Q D;  5KBA A;  2I2O A;  2WXF A;  2WXI A;  1KZP A;  3L17 A;  4LER A;  3EHQ A;  3ZXS A;  2KZT B;  1W3B A;  4J8E A;  3SNX A;  2P58 C;  3CK9 A;  4CEM A;  3FU6 A;  4KZ0 A;  4KVO A;  3CQG B;  3UIP C;  1BI8 B;  1OWP A;  5B1B E;  4GZ6 A;  2XQ0 A;  4HVB A;  1OXJ A;  3D9P A;  4U0U A;  3NF1 A;  1KZO A;  3ZIM A;  2H6G A;  2P9N G;  1OCO E;  2PM6 A;  1BLX B;  5HRY A;  5CCL A;  4N3B A;  3CHM A;  4I1A A;  1K3Z D;  3NZS A;  3HRA A;  5CCM A;  3ZGQ A;  3AU5 A;  1SW6 A;  3QK0 A;  5CRV A;  4BX8 A;  3E4B A;  5KCM A;  3NAW A;  4A3V A;  2P9I G;  5AAO A;  3S7D A;  4HOR A;  2ZIS A;  3U4T A;  3BG0 B;  3QOU A;  1N95 A;  4AOF A;  2QYJ A;  2HR2 A;  4GZD A;  2F8Y A;  2DZO A;  4DJA A;  3O48 A;  1BU9 A;  4UUC A;  5J08 A;  1QNF A;  1PAQ A;  4ILH B;  5AJD A;  4JHJ A;  3EHR A;  2EIK E;  1TEZ A;  2WXM A;  1D8D A;  4AM9 A;  2Y3A A;  3MYV A;  4E85 A;  4N39 A;  4DLO A;  3LYA A;  4WWP A;  3SFZ A;  5AYW D;  2GW1 A;  4OAV B;  3Q73 A;  5JHA A;  3IXE A;  3APF A;  5HI7 A;  2XGM A;  2XPZ A;  3CV0 A;  4B94 A;  4QQI A;  4J7W A;  3ZYM A;  3UPV A;  3JYS A;  1U3D A;  1MJ0 A;  4EZK A;  2ZXW E;  1H6P A;  3B7T A;  3Q49 B;  2XS8 A;  3FH7 A;  2H6H A;  2RG8 A;  3JUE A;  2L0T B;  2OV8 A;  5EN5 D;  1JPL A;  3N71 A;  1B89 A;  5DIZ A;  5BW8 C;  1FT2 A;  4RG6 A;  3FUL A;  4HB5 A;  3UT4 A;  2EQX A;  4AY6 A;  2AJA A;  3FY4 A;  2GGF A;  1X81 A;  3DST A;  4QFV A;  2AW6 A;  4R7L A;  3TXN A;  4KMO A;  4Z68 A;  3VTX A;  4NAC A;  1IHG A;  2VYI A;  4FLH A;  5FZR A;  3CK8 A;  5BXO A;  1TYQ G;  4CT0 A;  3OXG A;  4FC8 A;  3UXG A;  3G2V A;  5EIL A;  3RRU A;  3FEX A;  4DUI A;  1JCS A;  5G55 A;  2IY0 C;  3ZVV A;  1OUV A;  2RD0 A;  4GTT A;  3DSV A;  4GYY A;  1TNZ A;  4FHJ A;  2Q7F A;  3EU5 A;  2I9C A;  3LY8 A;  3JXJ A;  3WG7 E;  4UWH A;  2BUG A;  1Z3Y A;  4OVV A;  4G26 A;  4PS3 A;  3SBT B;  5LCW C;  4I9E A;  3LPZ A;  2QC9 A;  3IV0 A;  3IEG A;  2YNQ A;  1IQR A;  1HH8 A;  2XEH A;  5FZS A;  3EJN A;  4YND A;  4EBA A;  3R7R A;  4DK5 A;  5C1D A;  1HG2 A;  2X6J A;  4F7A A;  1FPP A;  2KCV A;  4YDE A;  3ASH A;  3D9J A;  3URZ A;  2WQ6 A;  2KCK A;  3QWW A;  1UW4 B;  4WNF A;  3KSQ A;  5KJK A;  4JA7 A;  3IBE A;  4KYO B;  3CVX A;  1UG3 A;  2FO1 E;  3EDT B;  2GRR B;  4E6H A;  4GB9 A;  4AIF A;  3MZL B;  4TXR A;  5FTP A;  3EIJ A;  2P9U G;  1N4Q A;  3TWW A;  4K5B A;  1E8Z A;  1EPU A;  3UMV A;  4ATG A;  3ZEF A;  4I43 A;  4GPM A;  3Q47 B;  5BUZ A;  3L9T A;  4ZHB A;  3MKQ A;  5EIB E;  2ZU6 B;  2F37 A;  3SY2 A;  3ZHE B;  2C2L A;  3W9G A;  2LO6 A;  1LD8 A;  4L2Y A;  3FUM A;  2M63 A;  3UT8 A;  3PZ3 A;  1N94 A;  4C9B B;  3FTX A;  4AXH A;  3AJI A;  1MZC A;  3CVV A;  4XE0 A;  5G05 J;  2OCC E;  4GCO A;  4JC8 A;  4Y6W A;  3HIZ A;  4OAU C;  3C3Q A;  5J90 A;  1QYM A;  4RVB A;  4A55 A;  3MX3 A;  3IKO B;  2XZT G;  3V2X A;  3CVU A;  3K9I A;  2BKG A;  1TN8 A;  4U0Z A;  1MX4 A;  1U2V G;  5T8I A;  2BKK B;  3DEP A;  4JW1 A;  3CHO A;  3DXK G;  4DI3 A;  2GRQ B;  2KZT A;  3PNL B;  2X6H A;  4UQX A;  3DWL G;  5BT1 A;  4K5A B;  3B7R L;  4HRM B;  4RG9 A;  4GAA A;  2NXP A;  3EU9 A;  4B8A A;  4OYS A;  3UM0 A;  1QZ2 A;  1MQS A;  1NI1 A;  3TWU A;  3LVQ E;  1E8X A;  4KBQ A;  3AAA C;  3PZD A;  2OVF A;  2IFU A;  5E76 A;  3VLD A;  3U9W A;  2DZN A;  4FU3 A;  4ME2 A;  5AQ9 A;  5G04 J;  1FCH A;  2CHW A;  4L1B A;  2VJ8 A;  2FO7 A;  3C3O A;  5JJ6 A;  4I6J A;  3L6A A;  2XPY A;  2KC7 A;  5LOZ A;  1KT1 A;  4GYO A;  1SVX A;  1GW6 A;  1S0P A;  3GW4 A;  1K8K G;  2ETB A;  4TRQ A;  5FQ4 A;  4MKT A;  1IXV A;  2XEN A;  1ELW A;  3RO3 A;  2BED A;  4C0E A;  4A1G A;  1DCQ A;  1SA4 A;  3LXU X;  5A6C A;  2X38 A;  3ABM E;  2EIM E;  3Q7F A;  4KT6 B;  5M72 A;  4GTR A;  3SZ7 A;  1ZB1 A;  3UIO C;  1HX8 A;  4TXQ A;  2WXP A;  5FQ8 A;  3UKR G;  4LCT A;  3ULY A;  1UJJ A;  4I2W A;  4I6G A;  4ILG A;  1NP7 A;  3C5R A;  2DCP A;  3ZU7 B;  2XPI A;  4RQI A;  4HOT A;  3PS6 A;  3BQO A;  4BSZ B;  3F6Q A;  3TWQ A;  4CCA A;  4URK A;  2WXG A;  3AU4 A;  2LXL A;  1NZN A;  2PNN A;  4GYW A;  4G1T A;  1ELK A;  4XIF A;  2WXK A;  2MYO A;  2WXN A;  4CT4 A;  3NZU A;  4M3O A;  5AJL A;  2YQ8 A;  2WMN A;  2RKK A;  3PEU B;  3AG2 E;  3B13 A;  4GML A;  4Q96 A;  3LY7 A;  2HYZ A;  5CBO A;  2F8X K;  4WUY A;  4U0S A;  4EZL A;  4B89 A;  1Z6T A;  2AWI A;  4FHK A;  1A17 A;  5BV0 A;  5KJM A;  1HO8 A;  4C48 B;  2LSU A;  3TJP A;  4JD2 G;  4HBD A;  5FIN A;  3FTS A;  3DEO A;  1XNF A;  1ZU2 A;  5FT9 A;  4U04 A;  2GRM A;  5ENP D;  5KWD A;  4LNG A;  1ELR A;  4YDY A;  2HO1 A;  4YVQ C;  3CHQ A;  4JL0 A;  3TWT A;  3CEQ A;  2VTB B;  3HHM A;  3HG0 D;  4TXP A;  3L82 A;  3J5Q B;  2JAB A;  4DX6 D;  2WB2 A;  3HXD A;  2X6I A;  3GZ1 A;  3T5X A;  4GTS A;  1H0A A;  2X6F A;  3HDX A;  2V4L A;  2OEV A;  2FI7 A;  3JQ1 A;  3T5V A;  2VSY A;  5AQB A;  4UWL A;  4G24 A;  4DPR A;  2MRI A;  5BNW A;  2XHE A;  3U64 A;  3IHY A;  1G3N B;  4LRZ A;  2J8S D;  4O1P A;  2P9L G;  2B6C A;  3I3N A;  1HS6 A;  4KZC A;  3RRN B;  5ENT D;  3U3W A;  4B93 B;  4J8S A;  1SA5 A;  3DPD A;  3QJZ A;  4BET A;  4H7Y A;  5EDS A;  2UY1 B;  1YMP A;  3MEK A;  1YA0 A;  2XRY A;  2R05 A;  2CG3 A;  1FVH A;  3QAQ A;  4ACL A;  3U66 A;  1Z3X A;  3CGH A;  4GZ5 A;  3Q9N C;  1DNP A;  4MRU A;  4BT9 A;  5ENO D;  3FU5 A;  5ARF A;  2R59 A;  2EIL E;  1P5Q A;  3MKR A;  4G23 A;  3EIQ C;  2J49 A;  5AN8 A;  3ZHE A;  4AEZ C;  4P29 A;  3AS4 A;  3HXF A;  4O1O A;  4BY6 A;  4FLB A;  3KSL A;  4LG6 A;  3O4Z A;  5A23 A;  1LF8 A;  3GYZ A;  1E7U A;  1JWG A;  3D9M A;  4HLE A;  3PUJ A;  3VLE A;  2XCB A;  3NQP A;  2KCL A;  3FDH A;  4YDO A;  1RW2 A;  3D9O A;  3CLJ A;  4F1S A;  3CVW A;  1O1T A;  4CDM A;  2J4D A;  3UM1 A;  3FUK A;  1IQU A;  2Y4U A;  4PUC A;  2IQC A;  2LNI A;  4JEU A;  4JXT A;  3C98 A;  5IY5 E;  4F1P A;  4K0R A;  2KBX A;  3NBN B;  5ENQ D;  3Q15 A;  5EYL A;  3FP3 A;  4JHR A;  3ESK A;  3W9F A;  2GRP B;  2C0M A;  3G2T A;  2FF4 A;  3FU0 A;  4FP7 A;  3CKC A;  1UN8 A;  3TGO A;  1WM5 A;  1OWN A;  3HXE A;  2R02 A;  3ASD A;  3LCA A;  3RO2 A;  2P9S G;  2KAT A;  4EEC A;  3MA5 A;  3L08 A;  4ACK A;  5D0O D;  3ZYL A;  2LUH A;  1INZ A;  4J6I A;  4U63 A;  3FUI A;  4F3V A;  1H6O A;  2OOE A;  5D66 A;  3SQV A;  1ZBP A;  3E37 A;  2ION A;  4NRH B;  2FEZ A;  4NIK A;  2EIJ E;  5A7D B;  4JVS A;  3CST A;  1TJF A;  4BER A;  4YVO A;  3ENE A;  3ASO E;  1O1S A;  5C2Y A;  2CFU A;  3HXB A;  2EIN E;  3C72 A;  2ETA A;  5CHE E;  1NA3 A;  1S63 A;  4N5Q A;  1OWO A;  2R5S A;  4PH4 B;  4I2Z A;  4Q94 A;  2P9P G;  4Q69 A;  4U7E B;  3C3R A;  1HZ4 A;  5CMY A;  1HXI A;  3PH0 C;  3LY9 A;  1MYO A;  3ML9 A;  1TR4 A;  3UTM A;  1TNU A;  2DWZ A;  3ZW3 A;  2GRN B;  1VDY A;  3QB2 A;  4I1O B;  2V4H C;  2XRZ A;  4N5C A;  1DC2 A;  3D9K A;  4L2L A;  2WMO A;  4BTA A;  4CDN A;  2A5E A;  1JCR A;  1KT0 A;  1N52 A;  1H2V C;  1S70 B;  4PS7 A;  4G25 A;  2YHE A;  2ETC A;  2Y1L E; 
#chains in the Genus database with same CATH homology
 4HS2 A;  4ME2 A;  5KJN A;  3CK7 A;  3L17 A;  4U07 A;  4LER A;  3ZXS A;  5G04 J;  3ESL A;  4EZJ A;  1FCH A;  2CHW A;  1W3B A;  1HG5 A;  2KZT B;  4J8E A;  4L1B A;  4MS6 A;  3AS8 A;  4WAF A;  4GZC A;  2P58 C;  3CK9 A;  3LDZ A;  3SNX A;  4CEM A;  3FU6 A;  4KZ0 A;  4KVO A;  2VJ8 A;  2FO7 A;  3CQG B;  4EPZ A;  4J8D A;  3ZPJ A;  4A1S A;  3ASG A;  1OWP A;  4GZ6 A;  5JJ6 A;  4I6J A;  3L6A A;  3RKV A;  2XQ0 A;  4GZ3 A;  4HVB A;  3ZRH A;  3D9P A;  3GZ2 A;  2PQN A;  1EYH A;  2KC7 A;  2XPY A;  2LAI A;  4U0U A;  1KT1 A;  3NF1 A;  5LOZ A;  4GYO A;  2J4B A;  1GW6 A;  2VGX A;  1S0P A;  3ZIM A;  3GW4 A;  3JCK C;  3UT7 A;  3CVQ A;  5AEN A;  2VGY A;  3CHS A;  1BPO A;  4JZY A;  1PY1 A;  2PM6 A;  4RSY A;  4B8C B;  3LVR E;  4TRQ A;  5FQ4 A;  4MKT A;  5CCL A;  2NSZ A;  3CHM A;  4N3B A;  4I1A A;  5EX3 A;  3NZS A;  3PNT B;  1MHQ A;  3FU3 A;  5CCM A;  5CMW A;  1ELW A;  4I6E A;  3RO3 A;  3LS8 A;  3AU5 A;  2FUL A;  3QK0 A;  3ZGQ A;  4C0E A;  4PDX A;  4A1G A;  3S7F A;  4BX8 A;  3FUE A;  4BFR A;  3E4B A;  5KCM A;  3SHF A;  3LXU X;  4A3V A;  5A6C A;  2X38 A;  4L23 A;  3S7D A;  4HOR A;  3U4T A;  3BG0 B;  4KT6 B;  5M72 A;  1HU3 A;  3QOU A;  3CVP A;  2L0I A;  4AOF A;  3SZ7 A;  3LKU A;  2HR2 A;  3KD7 A;  3ONL A;  3PRE A;  2ILR A;  2V0P A;  4FUL A;  4GZD A;  4A3T A;  3CQC B;  3D9L A;  3P2B A;  2VQ2 A;  4DJA A;  3O48 A;  1HX8 A;  1SQM A;  4N3A A;  4UWG A;  2WXP A;  5ARG A;  4AY5 A;  1SZ9 A;  3MV2 B;  5FQ8 A;  4AV7 A;  5J08 A;  4LCT A;  5T3R A;  3PUK A;  4JHK A;  1QNF A;  3G2S A;  1PAQ A;  1UJJ A;  1TJC A;  4ILH B;  4I2W A;  2IJG X;  4I6G A;  4JHJ A;  2IF4 A;  5AJD A;  4ILG A;  4CDR A;  5HQ8 A;  2E2E A;  1NP7 A;  4UQY A;  1TEZ A;  2DCP A;  2WXM A;  3RIB A;  1JUQ A;  3PRZ A;  2XPI A;  4AM9 A;  2Y3A A;  3MYV A;  3FTY A;  4C0M A;  4E85 A;  4JEH A;  3ZYK A;  4N39 A;  3FHE A;  3LYA A;  4DLO A;  4HOT A;  2VGX B;  3PS6 A;  4WWP A;  4HOS A;  4CCA A;  3SGH A;  3SFZ A;  5AYW D;  1IYG A;  3G2U A;  4B0Z A;  1E90 A;  2XCC A;  4NUR A;  4URK A;  3FTV A;  3APD A;  1WY6 A;  2WXG A;  3AU4 A;  3S2A A;  2GW1 A;  3BEE A;  1NZN A;  2I6H A;  4GYW A;  3I4R B;  4G1T A;  4CRW A;  4ILI A;  1ELK A;  4XIF A;  3RK6 A;  2WXK A;  5JHA A;  2CG2 A;  2WXN A;  4JA9 A;  2WQ7 A;  3APF A;  4CT4 A;  5HI7 A;  5G2N A;  2XGM A;  3NZU A;  2XPZ A;  2AXZ A;  2WXJ A;  3CV0 A;  4M3O A;  5AJL A;  2LSV A;  4H7X A;  4B94 A;  3HVE A;  2HM8 A;  2YQ8 A;  2VTB A;  3ZYM A;  3UPV A;  3FTZ A;  5BPP A;  4FJZ A;  3JYS A;  2WMN A;  5BV1 A;  1U3D A;  3PEU B;  1JWF A;  4EZK A;  3B13 A;  3B7T A;  4GML A;  2NC9 A;  4Q96 A;  3OXL A;  4ANX A;  3Q49 B;  3LY7 A;  2HYZ A;  3FH7 A;  4GCN A;  2RG8 A;  4WUY A;  1Y8M A;  4U0S A;  4EZL A;  2L0T B;  4XZ4 A;  2OV8 A;  4B89 A;  2I1J A;  3CR3 A;  3FUN A;  3LJ3 A;  1Z6T A;  2AWI A;  4FHK A;  1A17 A;  4XKB A;  5FZQ A;  5BV0 A;  5LP0 A;  5KJM A;  4IUL A;  2PQR A;  2FBN A;  1JPL A;  4NQ0 A;  3N71 A;  1HO8 A;  1B89 A;  2LSU A;  3KEZ A;  5DIZ A;  3TJP A;  3SI5 A;  5BW8 C;  2J09 A;  3PE3 A;  4RG6 A;  4BX9 A;  3L54 A;  4GA1 A;  5FQ7 A;  3FEY A;  2J07 A;  4ABN A;  3FTS A;  3FUL A;  3DBS A;  3FUH A;  4WND A;  3UT4 A;  3QDN A;  3PVL A;  1XNF A;  1ZU2 A;  5FT9 A;  1N54 A;  4U04 A;  2EQX A;  4AY6 A;  2GRM A;  3FY4 A;  2GGF A;  1ELR A;  4FJY A;  4DI4 A;  2HO1 A;  3SBS A;  4YVQ C;  2AXU A;  2MOW A;  3CHQ A;  4JL0 A;  1HFA A;  1U3C A;  5KJL A;  4QFV A;  1E8W A;  2AW6 A;  2WXO A;  3BG1 B;  4R7L A;  4XI9 A;  3TXN A;  4KMO A;  3CEQ A;  2UY1 A;  3D9I A;  4J8F A;  4UWF A;  5LFA A;  1XGW A;  2JEK A;  3L16 A;  2VTB B;  3EHM A;  3HHM A;  3VTX A;  4NAC A;  3MCX A;  1IHG A;  2VYI A;  3LEW A;  3PEV B;  4FLH A;  3UQ3 A;  3FTW A;  5FZR A;  3CKB A;  3CK8 A;  1EF1 C;  2WB2 A;  2WPV A;  4CT0 A;  4AP2 A;  1H6K A;  3OXG A;  4FC8 A;  2X6I A;  2VSN A;  3GZ1 A;  4J0U A;  3SF4 A;  4WWN A;  3G2V A;  1H0A A;  2IOS A;  2X6F A;  3T5X A;  4APO A;  4AVX A;  2BTD A;  3HDX A;  3RRU A;  3FEX A;  3FH5 A;  4BWR A;  4G11 A;  3FUJ A;  3S7J A;  2V4L A;  4IRU A;  5G55 A;  3ZVV A;  1OUV A;  2RD0 A;  5DBK A;  2FI7 A;  5JJT A;  1NA0 A;  3JQ1 A;  1EDU A;  3T5V A;  2VSY A;  4UWL A;  4G24 A;  4DPR A;  4PS8 A;  1DVP A;  4GYY A;  4LEU A;  2MRI A;  5BNW A;  2DIW A;  3VTY A;  2XHE A;  4FHJ A;  2Q7F A;  2L6J A;  3U64 A;  3IHY A;  4LRZ A;  2I9C A;  2XGS A;  3LY8 A;  4XI0 A;  4N2S A;  3MGB A;  2I1K A;  4XX5 A;  1SZA A;  4UWH A;  2BUG A;  5E75 A;  3I3N A;  5JJ7 A;  1HS6 A;  4KZC A;  3RRN B;  1H2U A;  1Z3Y A;  1HF8 A;  4OVV A;  5AIJ A;  2A4Z A;  3U3W A;  4N3C A;  3TAX A;  4G26 A;  4PS3 A;  3SBT B;  1PC2 A;  4J8S A;  5G05 C;  3TG5 A;  5LCW C;  3DPD A;  4I9E A;  4HOQ A;  3QJZ A;  3T8M A;  3LPZ A;  4H7Y A;  5EDS A;  2UY1 B;  2GRL A;  3IV0 A;  2WVI A;  3QNK A;  3MEK A;  3B7U X;  1YA0 A;  3IEG A;  3JUI A;  2XRY A;  3PE4 A;  2CG3 A;  2YNQ A;  1IQR A;  1FVH A;  1HH8 A;  2WXR A;  3IHV A;  5FZS A;  3EJN A;  2IOL A;  4YND A;  3FH8 A;  3QAQ A;  4ACL A;  3U66 A;  4MLP A;  1Z3X A;  2XGO A;  4EBA A;  3CGH A;  5LX8 A;  3R7R A;  4DK5 A;  3UUX A;  4GZ5 A;  1DNP A;  2VSO E;  4MRU A;  5C1D A;  1HG2 A;  2X6J A;  4BT9 A;  3FU5 A;  2QFC A;  4F7A A;  3RJV A;  3R9A B;  1L5J A;  2KCV A;  3WXX A;  5ARF A;  1X5B A;  2R59 A;  3ASH A;  1P5Q A;  3D9J A;  3MKR A;  3URZ A;  4G23 A;  3EIQ C;  2J49 A;  3D3M A;  2WQ6 A;  2KCK A;  4BTB A;  2DBA A;  3QWW A;  1UW4 B;  2J9Q A;  2MHK A;  2PZI A;  3ZHE A;  4AEZ C;  4ANW A;  4P29 A;  3AS4 A;  4UWK A;  3S7B A;  4WNF A;  5KJK A;  1KLX A;  4O6F A;  4BY6 A;  4JA7 A;  4TV3 A;  4I1M A;  3IBE A;  4FLB A;  4KYO B;  4UI9 C;  4UI9 J;  3CVX A;  3O4Z A;  1UG3 A;  2UWJ G;  3EDT B;  3KS2 A;  3QWP A;  3CIA A;  3CHR A;  3KAE A;  4WWO A;  4BSX A;  1HE8 A;  5FQ6 A;  4E6H A;  5A23 A;  2WQH A;  5FJY A;  4D10 C;  1LF8 A;  3FWV A;  3ML8 A;  3GYZ A;  3PDN A;  1E7U A;  4GB9 A;  4AIF A;  1JWG A;  4HOU A;  3MZL B;  3D9M A;  4HLE A;  4HXI A;  5FTP A;  3APC A;  3EIJ A;  3PUJ A;  3VLE A;  2XCB A;  3NQP A;  3HYM B;  2KCL A;  4KXK B;  3FDH A;  4UI9 K;  1OWM A;  4DLQ A;  1FVF A;  2AXV A;  3D9O A;  1E8Z A;  1EPU A;  3CLJ A;  4AJW A;  4F1S A;  3CVW A;  3UMV A;  2VSX E;  1H19 A;  4ATG A;  4CDM A;  2J4D A;  1UN9 A;  4HFG A;  3EHN A;  3ZEF A;  3ZYQ A;  4I43 A;  4ANV A;  3Q47 B;  3FUK A;  1IQU A;  1OWL A;  2Y4U A;  2KM4 A;  3TXM A;  4PUC A;  5BUZ A;  2IQC A;  2LNI A;  3OTN A;  4JEU A;  4JXT A;  2WXI A;  3C98 A;  4IYP A;  2OVB A;  4ANU A;  3CHP A;  4GU5 A;  4GA0 A;  4K0R A;  3MKQ A;  4TUU A;  5G04 C;  4K03 A;  2WXH A;  3QWV A;  3HVE B;  3RU0 A;  4WNE A;  3Q15 A;  3FP3 A;  2ZU6 B;  3QKY A;  5EX0 A;  3OAW A;  3ZHE B;  2C2L A;  2L9B A;  4WNG A;  4W9R A;  3G2W A;  2LO6 A;  2BF0 X;  4APF A;  4CGW A;  4JHR A;  3ESK A;  4L2Y A;  1H2T C;  2C0L A;  3QAR A;  4U8H A;  3FUM A;  3OXF A;  2WXL A;  2C0M A;  2M63 A;  3G2T A;  2LAH A;  3UT8 A;  4N2Q A;  2IU1 A;  2FF4 A;  3FU0 A;  4FP7 A;  2X3M A;  3FTU A;  3CKC A;  1QQE A;  2QY7 A;  2PM7 A;  1UN8 A;  4C9B B;  3TGO A;  2YIN A;  1WM5 A;  3CVL A;  3FTX A;  5ANR A;  1OWN A;  3B7S A;  2CHX A;  4AXH A;  3ASD A;  3RRM B;  2Y4T A;  3LCA A;  3RO2 A;  2PL2 A;  1E8Y A;  4GA2 A;  4XKC A;  2R17 C;  5JHB A;  2KAT A;  4I17 A;  4EEC A;  3MA5 A;  3L08 A;  3TL5 A;  4ACK A;  2CFZ A;  3MV3 B;  3CVV A;  5D0O D;  3ZYL A;  1INZ A;  4J6I A;  3D9N A;  5T4Y A;  3I5P A;  4U63 A;  4XE0 A;  3FUI A;  4F3V A;  2OOE A;  5G05 J;  5LCW J;  4GCO A;  4JC8 A;  4KVM A;  4Y6W A;  4GPK A;  3MKQ B;  3HIZ A;  3Q4A B;  2XEV A;  5J90 A;  4LUN U;  1ZBP A;  4RVB A;  2JLB A;  2J08 A;  4A55 A;  3CSF A;  5ENN A;  3MX3 A;  2ION A;  3IKO B;  2A5U A;  3ONK A;  3CVU A;  3K9I A;  2V5F A;  4NRH B;  1E96 B;  5ANL A;  3I4G A;  4U0Z A;  2FEZ A;  4L7T A;  3ULQ A;  5A7D B;  4JVS A;  5T8I A;  2OND A;  4EBA G;  3CST A;  4JW1 A;  1TJF A;  3CHO A;  3Q5M A;  3TG4 A;  4YVO A;  4OVU A;  5FWQ A;  3CVY A;  2YHC A;  3ENE A;  4F53 A;  2E0I A;  2WXQ A;  4DI3 A;  2KZT A;  3PNL B;  2X6H A;  4V3I A;  5C2Y A;  2CFU A;  4IN3 B;  4UQX A;  2CHZ A;  1WAO 1;  4JPS A;  3FUD A;  4GMJ A;  5CHE E;  3JQ0 A;  1NA3 A;  1OWO A;  5BT1 A;  2R5S A;  4PH4 B;  4I2Z A;  4Q94 A;  3VLF A;  3L13 A;  3B7R L;  3MJW A;  4EQF A;  4Q69 A;  4RG9 A;  1HZ4 A;  3R7Q A;  4GAA A;  5CMY A;  1HXI A;  2NXP A;  3PH0 C;  3L22 A;  3LY9 A;  2AVP A;  3ML9 A;  3P1U A;  4Y6C A;  4B8A A;  3ZN3 A;  4OYS A;  1Y6I A;  4I9C A;  1QZ2 A;  4FAD A;  4G2V A;  3ZW3 A;  1VDY A;  3QB2 A;  1MQS A;  2WM9 A;  4I1O B;  3SD5 A;  2XRZ A;  5EKQ D;  4N5C A;  1UJK A;  3LVQ E;  3UX4 A;  1E8X A;  3D9K A;  4L2L A;  3GZS A;  2X6K A;  4KBQ A;  2WMO A;  4BTA A;  4FA6 A;  4CDN A;  2V8S E;  4BT8 A;  3FUF A;  3CVN A;  3AS5 A;  3PZD A;  4CGV A;  2OVF A;  2IFU A;  1KT0 A;  5E76 A;  3VLD A;  3ZFW A;  1N52 A;  1H2V C;  3QC1 A;  3U9W A;  1E7V A;  4UQZ A;  5D0Q D;  4FU3 A;  4PS7 A;  2I2O A;  3FFL A;  4G25 A;  2WXF A;  2YHE A;  3ASF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...