4Q69A

Crystal structure of a susd homolog (bt2259) from bacteroides thetaiotaomicron vpi-5482 at 2.50 a resolution
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
456
structure length
456
Chain Sequence
PNTAEKVDPGYLFNYVAVNWAGTRTGGDFYIPLSMSSQCQVDGGLDYGGWDESVYTISPYSTGNTWKHYYSVGGNNLMLAIKNAEEADPVNHNAIAQCKILLAEHMYEATMLWGDIPFTESWNGTIKYPKFDSQESVLNGVLSLLDEALQIMDLNDANAIDEYDIYYKGDMNKWMTLAKSLKFRTLMVMVDKDPSKATAIGTLLQAGGMVSSASDNLVFPYSAEPGNQNPKYELIELVGGTQILFFASNYMLKPMQERNDPRIPCYFEPGADGVYRGLGNREPAVTDDKDNMLSSVVSSYLFRKDAPELIYSCQEQLLLEAEAYARGLGVAQNLSKANELYKKGIREACAFYGVAEADIDTYVTGLPELTALTQEKALYEIHMQQWIDLMDRPFEEFVQWRRSGTAGNEVPTLQVPEDATSKELIRRWEYSPEEMTANINAPKESPKIWEKLWFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a SusD homolog (BT2259) from Bacteroides thetaiotaomicron VPI-5482 at 2.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords Putative lipoprotein
total genus 143
structure length 456
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12771 SusD-like_2 Starch-binding associating with outer membrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4q69A00
3MCXA 4L7TA 3JYSA 3FDHA 3OTNA 3P1UA 3JQ0A 3LEWA 4Q69A 3CGHA 3SGHA 5FQ4A 4LERA 5E76A 5T3RA 3EHNA 3CKBA 3CKCA 3IV0A 5T4YA 5LX8A 3QNKA 3L22A 5FQ6A 5J90A 3GZSA 4PUCA 4MRUA 3KEZA 5E75A 3MX3A 3SNXA 3CK8A 3CK7A 3HDXA 3CK9A 4F53A 3JQ1A 3EHMA 5FQ8A 4F7AA 3EJNA 3I4GA 3NQPA 3MYVA 5FQ7A
chains in the Genus database with same CATH superfamily
3C3OA 4JZYA 3Q7FA 1E8ZA 3BQOA 4HRMB 3UX4A 3FTUA 5ENSD 1FVFA 3CKCA 5ANLA 2WXLA 1WM5A 2L6BA 5BXOA 4I2WA 5C2YA 1N0RA 3NOCD 4G26A 2X6FA 3E33A 5LP0A 3FUMA 2E2EA 4UUCA 1N54A 3E4BA 3IHVA 3MKQB 5HRYA 3AG4E 3LXUX 5CERB 1MX4A 3FTYA 2I6HA 3DRAA 2VTBB 1NFIE 4TV3A 1LD7A 2GGFA 1Y6IA 4BWRA 2WXPA 3ONKA 2LUHA 2YHEA 2VGEA 3KSQA 3HRAA 3EDTB 3R7RA 3D9IA 3SY2A 3PZ1A 1N4QA 4UWLA 3JUIA 3CVUA 4YVOA 3ZNGA 3LVRE 3CHOA 3CV0A 2CHWA 3CVXA 2I1KA 1RW2A 4UI9J 2R17C 4GZ5A 1DVPA 3FU6A 5ARGA 3L17A 3ZGQA 1X5BA 3SQVA 3APDA 4ILGA 4KYOB 1HXIA 1N9AA 5HQ8A 3AU4A 2IFUA 2QC9A 4ACLA 3FTXA 4EZJA 3QOUA 2PNNA 2BEDA 2YQ8A 1TN6A 4G24A 3MZLB 1N0QA 2F0YA 3ESLA 3CEQA 3SBTB 4ANUA 3LY7A 1NA3A 1S63A 3ZYLA 3LCAA 2ZISA 3FDHA 4ZHBA 4BETA 3TWUA 2X6JA 3VLDA 4GTRA 3S7FA 1SQMA 3FUFA 5FQ8A 2IQCA 4LNUD 3UTMA 2XS1A 3RRNB 1OUVA 3MYVA 4CRWA 3DSUA 3SO8A 1OCOE 1N11A 3Q79A 3J5QB 3HIZA 4ZFHA 4N3BA 4HFGA 4MKTA 5FZRA 2DYRE 1TNBA 4BSZB 3CK8A 3EIJA 3HDXA 3OAWA 3RRMB 3Q78A 2P9SG 4DUIA 1U2VG 5T3RA 4J6IA 4M3OA 3TL5A 4DX1A 3TWWA 5D0OD 4UWKA 3TWQA 2QZAA 4NRHB 5AJLA 4EPZA 2VGXB 3HYMB 5KNGA 5ENNA 4ANVA 4HXIA 5CEAA 4BTAA 4IYPA 5ENRD 2XRZA 3ISMC 2J4DA 1B89A 4GMJA 3ZFWA 4I9EA 4CGWA 3UXGA 4XE0A 4RG6A 3CK9A 2P9IG 2V5FA 3UINC 4UQZA 4JA9A 2LNIA 3B7SA 4CDNA 1MHQA 5FZSA 1EPUA 4C0EA 1FT1A 5G04J 4G1TA 3CR3A 2OEWA 4G8KA 4F7AA 1ELWA 2V5QC 2VTBA 1IKND 2XCCA 3X2QE 4NACA 4X8QA 3ULQA 4QFVA 4BX8A 1QQEA 3LY9A 2XZTG 4BERA 4P29A 3UM0A 3SHFA 3RSEG 2WQ7A 5BV0A 3L54A 3B95A 2CG3A 5JJ6A 4YDYA 3L13A 2UY1B 5CRVA 5BT1A 2VYIA 2ZIRA 4A1GA 2A5UA 4B8AA 2J07A 4RG9A 2ETAA 4HI8A 3EUVA 4LNBA 3ML9A 4JHJA 3CHMA 1EF1C 3LEWA 1E8WA 3U66A 5CCMA 2IY0C 3SZ7A 5HS0A 1WAO1 4GYYA 3UQ3A 3MV3B 2LSUA 4XKCA 3J5PA 4C9BB 3AJIA 3BEEA 3FH8A 3DXKG 2P9UG 3KEAA 5EIBE 4L23A 3E30A 3W9FA 2A5EA 2Y4UA 5J90A 2HE0A 3VLFA 4B8CB 3SNXA 4RLYA 4U0UA 3PRZA 4J8YA 3S7JA 1NI1A 3NBNB 1HG2A 5JJTA 2IOLA 5FQ4A 3DXMG 2FULA 4OVVA 3IHYA 1HU3A 5EDSA 1ZU2A 2MRIA 4ATZD 1OCRE 4HRLA 2YINA 3UPVA 3APFA 1O1RA 3FU5A 1SVXA 5JHAA 3O48A 4ATGA 1LF8A 4TXRA 2EILE 2JABA 1HE8A 1MZCA 1KT0A 4GA1A 3SF4A 3ZYQA 3EIQC 2L9BA 5AENA 4O1PA 5G05J 1N4SA 3HG0D 3VTXA 4G23A 1G3NB 1UJKA 4PS7A 4CEMA 2Y0BG 1H0AA 4OAVB 2XEVA 2PM7A 1TNYA 3TAXA 2V8SE 3G2VA 4MS6A 1HS6A 3FH7A 4I6GA 4FADA 3RAUA 5BW8C 3RO2A 2VJ8A 4N5CA 1OY3D 3FTWA 1TNZA 4JPSA 3B7TA 4YDEA 3DSTA 4G8LA 2AWIA 2OVFA 5HI7A 2RFAA 5BNWA 3SFYA 5LX8A 1HG5A 3UMVA 3KAEA 4KVOA 1FPPA 4N2QA 3HXBA 5AQAA 3JQ1A 4R7LA 4LEUA 1H2VC 3ULYA 3UUXA 2VGYA 3C72A 3IEGA 3PUKA 5T8IA 4F1SA 2PM6A 4JXTA 1KT1A 2IONA 4XEIG 2WXKA 5J08A 1FVHA 4U07A 3CQGB 2DIWA 3T5XA 3MJWA 2IOSA 3R7QA 5BXUA 4Q94A 3ONLA 3QWWA 1UN8A 4C0MA 3TGOA 4B94A 2FF4A 4N5QA 3N71A 1LD8A 5E75A 3G2WA 3ZYKA 1BI7B 5FQ7A 4BX9A 2HR2A 4WWNA 1QNFA 3K9IA 4GYOA 4L2LA 4HB5A 1TYQG 3CVWA 3L22A 3FUJA 3B7RL 3TG5A 5JHBA 3FHEA 4V3IA 5G2NA 3Q75A 1UN9A 4WNDA 2J8SD 4I6EA 4U96D 2CFZA 5KJNA 4GCNA 3Q49B 1MJ0A 3IV0A 4GMRA 1INZA 3FULA 1V55E 3IKOB 1L5JA 4LSZE 2J08A 4NURA 5FTPA 3WXXA 1KZPA 4I1AA 5BV1A 4HLLA 5H7PA 5AARA 2GRQB 2X6KA 4CGVA 5C1DA 1XNFA 3AG1E 2R05A 2ZGGA 3G2UA 4L1BA 3SI5A 1IHGA 1K1BA 4U8VD 1UW4B 3EHQA 2L6JA 2EIME 5LFAA 4OYSA 1NP7A 1P5QA 2ETCA 5DBKA 2WPVA 3CKBA 4UWFA 2HO1A 5CMWA 1JWFA 4L2YA 4YVQC 4JB8P 4U04A 1E7UA 1Q2ZA 2RKKA 3PNLB 4C48B 3EJNA 3ABME 3HVEA 2IJGX 4EZLA 1IYGA 3AG3E 1SZ9A 3DSVA 5CBNA 4DLOA 4EBAG 1U3DA 2F37A 3D9PA 3R9MA 4BY6A 2HYZA 2P9NG 4I2ZA 3ULEG 5JMND 3DSSA 4ACKA 5AQBA 2WM9A 4U0SA 1TR4A 3FU0A 2LO6A 1JCSA 3P1UA 5EIDA 4U8HA 4BTBA 2I1JA 1H6PA 3D9KA 3QWVA 3ZVVA 5AJDA 4CDRA 2XRYA 2XPIA 4YNDA 3C5RA 4WAFA 1O1SA 4F6RD 1S70B 4DI3A 1TJFA 5FINA 4BT9A 1E7VA 2KCVA 4RQIA 3RKVA 5E76A 1OWMA 3DPYA 2IU1A 2MYOA 2QY7A 3D9HA 4L9PA 3I5PA 3U64A 2A4ZA 1KZOA 3UT7A 5EKQD 3ZPJA 4UWHA 2E0IA 3GZ2A 5LCWJ 1SW6A 3LYAA 4KZ0A 4FLHA 1HO8A 3DPDA 2F8XK 4I1OB 4WWPA 3GZSA 3E32A 1D9SA 3GZ1A 3ZU7B 3BU8A 5DIZA 2BF0X 2RFMA 3ZUVB 2WXIA 4FULA 2P2CP 1AP7A 1H2UA 1OXJA 3W9GA 2WXMA 1OWOA 2GRMA 5AYWD 1JCRA 1A5EA 1TN7A 5ARFA 4AV7A 1FCHA 4MBGA 4D10C 4APOA 2OEVA 5A7DB 4GCOA 5ANRA 4HOQA 4I43A 5D66A 1DCEA 1UG3A 2ONDA 3UIPC 1RZ4A 1MX2A 4LNGA 2KZTA 5EYLA 2IEJA 3MCXA 3JYSA 2AXZA 1V54E 5G55A 2X6HA 4GTVA 4DX7D 3Q9UC 3APCA 3TJPA 4GPMA 4HBDA 2DVWA 3UT4A 4J8EA 3ZHEA 4LUNU 2DYSE 2P9KG 3QDNA 4HORA 1HH8A 4DJAA 3VLEA 4G2VA 3B7UX 3P2BA 1XGWA 3AG2E 3HHMA 3LY8A 1OWPA 4NQ0A 3MEKA 4J8DA 4ILHB 3NF1A 4EZKA 4U0ZA 4CCAA 3MGBA 4UQXA 4H7YA 2WMNA 3CHSA 3L08A 1O5MA 1E8YA 3TWVA 2WXFA 4JEUA 3NOGD 1D8EA 4AOFA 4DI4A 3URZA 2AXVA 1SA4A 3O4ZA 4B89A 4B0ZA 2RD0A 3U4TA 3S2AA 2ETBA 3PZ2A 2L0IA 2JLBA 1BLXB 3E34A 3CHQA 1FT2A 2FO7A 3SGHA 3OXGA 5D2MC 5CHEE 3UM2A 3FUNA 3ASFA 3TWTA 4XI0A 2OCCE 3V31A 2AVPA 1GW6A 3UM3A 2XS8A 3D9MA 3ZIMA 3QB2A 2GRNB 2GRLA 3TG4A 2J4BA 1E96B 2B6CA 3QWPA 3C98A 4O6FA 4AY5A 3S7BA 4ANWA 4GYWA 2C2LA 2LXMA 2ZXWE 3FUKA 4HNAD 1Z6TA 4CZ2D 2XZDG 4KBQA 3TXNA 4AEZC 3CVPA 4J0UA 5M72A 3FUDA 4JHKA 2WXRA 4Q96A 4BEPA 4PS8A 4GPKA 5EX3A 3CIAA 2VSXE 4IRUA 3I3NA 3T9KA 4BSXA 2Y69E 3T8KA 4FLBA 4FA6A 4J8FA 1TEZA 4HS2A 2BUGA 4RSYA 2V4LA 4M7CA 2DBAA 2MHKA 5CECB 1ZBPA 3RRUA 2V0PA 3TXMA 5KNHD 2WB2A 1A17A 4PDXA 4K0RA 3PREA 4OAUC 2Y4TA 3U3WA 1NA0A 2DZNA 2Y3AA 1DCQA 2J9QA 2YNQA 4TUUA 3QC1A 5CRUA 4EHMA 2QYUA 4K03A 2LAHA 2Q7FA 4PUCA 4KXKB 4CYMD 4GTPA 3TWRA 4JW1A 2HM8A 1OWLA 1N52A 3CSTA 4KMOA 5ITZF 4GB9A 3SBSA 3MKRA 4CDMA 2IO3C 1U3CA 5LOZA 1HZ4A 1S64A 4LCTA 1Z5SC 1H2TC 2X38A 5B1BE 3WG7E 4I1MA 2XENA 3RO3A 4PS3A 3T8MA 5AQ7A 3LPZA 2R59A 2JEKA 1JPLA 2LAIA 2VSNA 4UQYA 4JA7A 4HOUA 4FHKA 1PY1A 4Y6CA 3S7DA 4WNEA 4XX5A 3CHPA 4U7EB 2NSZA 2YHCA 2C0LA 4AY6A 3PNTB 3BG0B 3RIBA 1HF8A 4J8SA 1YA0A 3CVLA 2PQNA 4KT6B 2J49A 1YYHA 4N39A 2QFCA 3AS5A 5LCWC 4DX2A 3Q9NC 3FY4A 3ZW3A 3L16A 4H7XA 3UIOC 4DX5D 3DWLG 1N4PA 4GU5A 2H6HA 3ZXPA 1YMPA 3PZ4A 3PDNA 3ZRHA 3SFXA 5FJYA 1SA5A 2GROB 4WNGA 2X3MA 3AU5A 3CVVA 3PVLA 4ME2A 3V2XA 3TWSA 3DBSA 1NL4A 4XZ4A 2KZTB 4HI9A 3G2SA 3IBEA 4I17A 5ENTD 2I2OA 4G11A 4HOSA 3Q15A 3LDZA 2XEHA 2R5SA 3AAAC 5D0QD 1IHBA 2VSOE 4EQFA 3EHRA 3CVQA 1H19A 4GTQA 4G25A 4F3VA 1TNOA 5CEDB 2UY1A 2BKGA 3EU9A 1K8KG 4GAAA 4UWGA 3ENEA 1D8DA 4L7TA 2FBNA 2KATA 3IXEA 2FO1E 4APFA 3Q5MA 2OV8A 4A1SA 2CHXA 4GTOA 5EYPF 3Q7AA 2GRPB 4F1PA 2X6IA 2CHZA 2XPYA 4XKBA 2KBXA 1WG0A 4WWOA 5A23A 3OXFA 3DSWA 4JVSA 3FP3A 2KCLA 4HRNA 3BUAA 3JQ0A 4Y6WA 3JXJA 3FEYA 3JXIA 4GTTA 4Z68A 1TJCA 4K5CA 3FH5A 4EBAA 4AVXA 3R9AB 2WVIA 1WDYA 4E6HA 2KCKA 1ELRA 3HXCA 4UI9K 3FU3A 2ILRA 2ZGDA 5AN8A 3LKUA 4BESA 3LJNA 3V79K 5AAOA 3FWVA 3DEPA 3KEZA 1AWCB 5ENQD 2WXNA 1ZB1A 2VGXA 4N3CA 4OVUA 2C0MA 3ML8A 3UM1A 3CSFA 4A3TA 5CMYA 3T5VA 3DSXA 5JA4D 4RVBA 2DCPA 5JJ7A 3B7BA 4I6JA 4U63A 2MOWA 1OCZE 4IN3B 3U9WA 4J7WA 1UJJA 3MX3A 3AS8A 2WXQA 1X81A 4ILIA 4ABNA 1OT8A 4HQDA 3I4GA 4TXPA 2WXJA 2IF4A 5AQ9A 4ANXA 2NXPA 1N94A 3JCKC 4KVMA 1BD8A 4YDWA 3D9JA 2PQRA 3JUEA 1KLXA 4GTMA 2CG2A 1HFAA 1K3ZD 1DNPA 2DWZA 4Q69A 2V4HC 5ENPD 2R02A 3D9OA 4AM9A 1IQUA 3HVEB 3QNKA 3QAQA 4PH4B 1Y8MA 3C3RA 4A63B 4A55A 5CBOA 3NQPA 1YCSB 2EQXA 3UT8A 3KSLA 2WQ6A 5A6CA 2KC7A 1Z3YA 4BFRA 4LG6A 1TNUA 4AXHA 1UOHA 2EINE 2WXHA 2QYJA 3PZ3A 4O1OA 3LS8A 5IY5E 3RJVA 4O60A 4JHRA 3TWXA 4CT4A 4LRZA 1JUQA 3UI2A 3D9NA 4FP7A 5BUZA 3ASHA 1JCQA 3OXLA 3ZXSA 2XEEA 1W3BA 3MV2B 4IULA 3V30A 4AP2A 2RG8A 3D3MA 5BPPA 3FTSA 2H6GA 3FUHA 2Y1LE 3AS4A 4FJYA 3VTYA 3FEXA 4DLQA 2FI7A 1H6OA 1E8XA 1TN8A 3C3QA 3SFZA 3L82A 2WQHA 5G05C 4FJZA 2OVBA 4K5BA 1SZAA 4GA0A 5FIOA 5ENOD 3HXDA 5KCMA 4TXQA 3GW4A 2R03A 3MA5A 3SD5A 4GA2A 2LXLA 1DC2A 3QKYA 3ZYMA 2J09A 2CFUA 4GZ3A 4JL0A 3FFLA 2XGMA 3MKQA 1MQSA 2BTDA 3I4RB 3L6AA 1IXVA 2H6FA 4TRQA 3EHMA 4QQIA 1MYOA 3PUJA 1HX8A 1BU9A 4JD2G 3GYZA 5KJLA 1PC2A 2LSVA 1EYHA 3PZDA 2L0TB 1EDUA 2AW6A 4YDOA 2PL2A 4GZCA 2AJAA 4F53A 3CQCB 4MLPA 5CCLA 3NZSA 1LTXA 4FHJA 5B1AE 4JEHA 4AIFA 3CGHA 3KS2A 4AJWA 2H6IA 3EHNA 2B0OE 5FWQA 5KJKA 2OOEA 5T4YA 1Z3XA 5EN5D 2VSYA 3LJ3A 2KM4A 3D9LA 5KWDA 1N95A 4BT8A 2WXOA 3FTZA 3RK6A 3OTNA 1H6KA 1S0PA 3CHRA 1K1AA 4E85A 3FUIA 4W9RA 3PEVB 1ELKA 4TUMA 3ZN3A 5G04C 3QARA 3QJZA 1NZNA 3V2OA 3HXFA 4GTSA 2KXPC 3HXEA 4UI9C 3BG1B 2XGSA 5FQ6A 5EX0A 4WUYA 4MRUA 3ASNE 4FU3A 1JWGA 2GRRB 4DK5A 1QBQA 2FEZA 2IO2C 1QYMA 2BKKB 2AXUA 3ESKA 2XHEA 3RU0A 2WXGA 1IQRA 4XIFA 4DRXE 2P58C 3G2TA 2WMOA 3CK7A 2NYJA 2XCBA 4KZCA 3NB2A 1BI8B 2EIKE 1N4RA 3NAWA 4XI9A 1O1TA 3FTVA 4LERA 3Q47B 4A3VA 1KPSB 2P9LG 2XPZA 3ABLE 3ASGA 4URKA 4CT0A 5HKPA 2PZIA 3CVNA 5EILA 2UWJG 2VQ2A 5KJMA 2GW1A 4DX6D 5FT9A 3KD7A 1BPOA 1OCCE 3ZEFA 2DZOA 2P9PG 4B93B 2R2LA 1WY6A 3Q4AB 3CLJA 2XGOA 3QK0A 4JC8A 1PAQA 4NIKA 4K5AB 4U95D 1OWNA 3LVQE 4N3AA 4HOTA 4WNFA 5B3SE 3ZHEB 4FC8A 2EIJE 4GZDA 3B13A 3PE3A 4GMLA 1MX6A 1VDYA 4GZ6A 2M63A 2ZU6B 4U8YD 3PE4A 3PS6A 3UKRG 3ASDA 3CVYA 5AIJA 1QZ2A 2NC9A 4HVBA 3E37A 3L9TA 3UKUG 3Q73A 3PH0C 5KBAA 2I9CA 4N2SA 3ABKE 3NZUA 4DPRA 3F6QA 2F8YA 3FUEA 5FZQA 1E90A 3PEUB 4HLEA 3ASOE 3EU5A 4I9CA 3ZKJA 2XQ0A 4EECA 3DEOA
chains in the Genus database with same CATH topology
3VLEA 4G2VA 4JZYA 3CSFA 5G05J 3B7UX 4A3TA 5CMYA 3P2BA 1E8ZA 3T5VA 1XGWA 4RVBA 3HHMA 3UX4A 2DCPA 3FTUA 3LY8A 5JJ7A 3VTXA 1FVFA 3CKCA 4G23A 4I6JA 5ANLA 1OWPA 2WXLA 4NQ0A 4U63A 1WM5A 3MEKA 1UJKA 4J8DA 2MOWA 4ILHB 4PS7A 3U9WA 4IN3B 4CEMA 1H0AA 4I2WA 3NF1A 5C2YA 1UJJA 4EZKA 4U0ZA 3MX3A 3AS8A 2X6FA 4G26A 2WXQA 4CCAA 2XEVA 3MGBA 4UQXA 4ILIA 5LP0A 4ABNA 3FUMA 2PM7A 2E2EA 3I4GA 1N54A 3E4BA 3TAXA 3IHVA 3MKQB 2V8SE 4H7YA 2WMNA 3CHSA 2WXJA 3L08A 3LXUX 3G2VA 3FTYA 2IF4A 4ANXA 1E8YA 2NXPA 4MS6A 1HS6A 3FH7A 2I6HA 3JCKC 4KVMA 2VTBB 4I6GA 4FADA 2WXFA 4JEUA 4TV3A 4AOFA 4DI4A 5BW8C 3D9JA 2VJ8A 3RO2A 2GGFA 3URZA 2AXVA 3O4ZA 4N5CA 1Y6IA 4BWRA 2WXPA 4B89A 4B0ZA 2PQRA 3ONKA 2RD0A 3U4TA 3FTWA 3S2AA 2YHEA 1KLXA 4JPSA 2CG2A 3EDTB 2L0IA 3B7TA 1HFAA 1DNPA 3R7RA 2JLBA 3D9IA 3CHQA 2AWIA 4UWLA 2OVFA 2FO7A 4Q69A 3SGHA 3JUIA 5HI7A 3CVUA 5BNWA 3OXGA 3D9OA 4AM9A 1IQUA 4YVOA 3HVEB 5CHEE 5LX8A 3QNKA 3FUNA 3ASFA 3QAQA 3LVRE 4XI0A 3CHOA 1HG5A 3UMVA 3KAEA 4KVOA 3CV0A 4N2QA 2AVPA 4PH4B 1Y8MA 1GW6A 2CHWA 3CVXA 2I1KA 3JQ1A 4A55A 4R7LA 3D9MA 4UI9J 4LEUA 3ZIMA 1H2VC 3NQPA 2R17C 3UUXA 4GZ5A 2EQXA 2VGYA 3QB2A 3UT8A 2WQ6A 5A6CA 1DVPA 2GRLA 3IEGA 3PUKA 2KC7A 2J4BA 3FU6A 1Z3YA 1E96B 5ARGA 5T8IA 3TG4A 2PM6A 4BFRA 4JXTA 4F1SA 3QWPA 3C98A 1KT1A 4O6FA 3L17A 4AY5A 2IONA 3S7BA 4ANWA 4AXHA 4GYWA 2C2LA 3ZGQA 1X5BA 2WXKA 3FUKA 2WXHA 3APDA 4ILGA 1Z6TA 5J08A 1FVHA 4KYOB 1HXIA 3LS8A 3RJVA 4U07A 3CQGB 2DIWA 3T5XA 3MJWA 4KBQA 3TXNA 4AEZC 4JHRA 5HQ8A 3CVPA 4CT4A 2IOSA 3AU4A 4J0UA 3R7QA 4LRZA 1JUQA 5M72A 2IFUA 4Q94A 3ONLA 3FTXA 3D9NA 3FUDA 4ACLA 4EZJA 3QOUA 4JHKA 3QWWA 4FP7A 5BUZA 3ASHA 2YQ8A 2WXRA 4Q96A 3OXLA 3ZXSA 1UN8A 4PS8A 4G24A 4C0MA 3MZLB 3TGOA 4GPKA 1W3BA 4B94A 5EX3A 3CIAA 3MV2B 2FF4A 2VSXE 3ESLA 3CEQA 4IRUA 4IULA 3I3NA 4AP2A 3SBTB 4ANUA 2RG8A 3N71A 3LY7A 5E75A 1NA3A 4BSXA 3D3MA 5BPPA 3FTSA 3G2WA 4FLBA 4FA6A 3ZYKA 4J8FA 3FUHA 3ZYLA 3LCAA 1TEZA 3AS4A 2BUGA 4HS2A 4FJYA 4RSYA 2V4LA 5FQ7A 3VTYA 4BX9A 3FEXA 4DLQA 2HR2A 3FDHA 4WWNA 2FI7A 1QNFA 3K9IA 4GYOA 2DBAA 4L2LA 2MHKA 3CVWA 1ZBPA 3RRUA 2V0PA 2X6JA 3TXMA 3VLDA 3L22A 1E8XA 3FUJA 3B7RL 3S7FA 2WB2A 1SQMA 1A17A 4PDXA 3SFZA 3TG5A 5JHBA 4K0RA 2WQHA 3FHEA 4V3IA 4FJZA 5G05C 5G2NA 3PREA 3FUFA 1UN9A 2OVBA 2Y4TA 5FQ8A 3U3WA 2IQCA 1NA0A 4WNDA 1SZAA 4GA0A 3RRNB 1OUVA 4I6EA 3MYVA 4CRWA 2CFZA 2Y3AA 5KCMA 3SD5A 3GW4A 3MA5A 5KJNA 4GCNA 2J9QA 2YNQA 4GA2A 4TUUA 3QC1A 3Q49B 3IV0A 3HIZA 3QKYA 3ZYMA 4N3BA 1INZA 4K03A 2J09A 4HFGA 4MKTA 2CFUA 2LAHA 3FULA 4GZ3A 2Q7FA 5FZRA 4JL0A 3FFLA 4PUCA 2XGMA 3IKOB 3MKQA 4KXKB 1MQSA 2BTDA 3CK8A 3I4RB 3L6AA 3EIJA 1L5JA 3HDXA 2J08A 4TRQA 3EHMA 4JW1A 4NURA 2HM8A 3PUJA 1OWLA 1N52A 3CSTA 1HX8A 3OAWA 5FTPA 4KMOA 3WXXA 4GB9A 3SBSA 4I1AA 3RRMB 5BV1A 3GYZA 5KJLA 1PC2A 3MKRA 2X6KA 2LSVA 5C1DA 4CGVA 5T3RA 4J6IA 1EYHA 4M3OA 4CDMA 3TL5A 3PZDA 1XNFA 1U3CA 5D0OD 5LOZA 2L0TB 1HZ4A 1EDUA 2AW6A 4LCTA 4UWKA 3G2UA 2PL2A 1H2TC 2X38A 4GZCA 4L1BA 3SI5A 4NRHB 5AJLA 4I1MA 4EPZA 1IHGA 4F53A 3CQCB 2VGXB 4MLPA 3NZSA 4FHJA 3RO3A 5CCLA 3HYMB 4PS3A 1UW4B 2L6JA 5LFAA 3T8MA 4OYSA 5ENNA 4JEHA 1NP7A 3LPZA 1P5QA 2R59A 4AIFA 2JEKA 3CGHA 4ANVA 1JPLA 3KS2A 4AJWA 4HXIA 2WPVA 2LAIA 5DBKA 2VSNA 3EHNA 4UQYA 3CKBA 5FWQA 4IYPA 4UWFA 4BTAA 2OOEA 5T4YA 5KJKA 2XRZA 2J4DA 1B89A 4GMJA 4HOUA 4JA7A 1Z3XA 3ZFWA 2HO1A 4I9EA 4CGWA 4FHKA 2VSYA 1PY1A 4Y6CA 3LJ3A 5CMWA 3S7DA 2KM4A 4WNEA 1JWFA 4L2YA 4XE0A 4XX5A 3D9LA 4RG6A 3CHPA 4YVQC 4U04A 1E7UA 2NSZA 2YHCA 3CK9A 2V5FA 3PNLB 4UQZA 2C0LA 4AY6A 4JA9A 2LNIA 4BT8A 3PNTB 3EJNA 3HVEA 2WXOA 3BG0B 3RIBA 3B7SA 2IJGX 4EZLA 4CDNA 1IYGA 3FTZA 3RK6A 3OTNA 1H6KA 1SZ9A 1S0PA 3CHRA 1HF8A 4J8SA 1YA0A 4DLOA 3CVLA 4EBAG 1MHQA 4E85A 1U3DA 2PQNA 1EPUA 3FUIA 4KT6B 5FZSA 2J49A 4W9RA 4C0EA 3PEVB 3D9PA 4BY6A 4N39A 1ELKA 5G04J 2QFCA 4G1TA 2HYZA 3AS5A 5LCWC 3CR3A 3ZN3A 3FY4A 4I2ZA 5G04C 3QARA 4ACKA 3ZW3A 3QJZA 3L16A 1NZNA 4H7XA 2WM9A 4F7AA 4U0SA 1ELWA 2VTBA 3FU0A 2XCCA 2LO6A 3P1UA 4NACA 4U8HA 4BTBA 2I1JA 3D9KA 3QWVA 4GU5A 3ZVVA 3ULQA 4QFVA 4BX8A 1QQEA 5AJDA 3PDNA 4UI9C 3BG1B 3ZRHA 3LY9A 5FJYA 4CDRA 2XGSA 5FQ6A 5EX0A 4WUYA 2XRYA 4WNGA 2XPIA 4MRUA 4P29A 2X3MA 3AU5A 4YNDA 4FU3A 3CVVA 3PVLA 4ME2A 3SHFA 4WAFA 1JWGA 4DI3A 2WQ7A 1TJFA 5BV0A 4BT9A 3L54A 3DBSA 4DK5A 1E7VA 2CG3A 5JJ6A 2KCVA 2FEZA 3L13A 4XZ4A 2UY1B 2KZTB 2AXUA 3RKVA 3ESKA 2XHEA 5E76A 3RU0A 5BT1A 2VYIA 3G2SA 2WXGA 4A1GA 1OWMA 2A5UA 3IBEA 4B8AA 2IU1A 4I17A 1IQRA 2QY7A 4XIFA 2I2OA 2P58C 3G2TA 4G11A 2WMOA 3I5PA 4HOSA 2J07A 3CK7A 4RG9A 3U64A 2A4ZA 2XCBA 3UT7A 4KZCA 3Q15A 3ML9A 4JHJA 3LDZA 5EKQD 3CHMA 3ZPJA 2R5SA 4UWHA 1EF1C 2E0IA 4XI9A 3GZ2A 3LEWA 3FTVA 5LCWJ 5D0QD 2VSOE 4LERA 4EQFA 1E8WA 3Q47B 3U66A 3CVQA 3LYAA 5CCMA 4KZ0A 3SZ7A 4A3VA 4FLHA 1HO8A 1H19A 2XPZA 1WAO1 3DPDA 3ASGA 4G25A 4GYYA 3UQ3A 4CT0A 4I1OB 3MV3B 4WWPA 4URKA 3GZSA 4F3VA 2UY1A 2PZIA 3CVNA 4GAAA 2LSUA 3GZ1A 4XKCA 2UWJG 4UWGA 2VQ2A 4C9BB 5DIZA 5KJMA 2BF0X 3ENEA 2GW1A 2WXIA 3BEEA 3FH8A 4FULA 5FT9A 4L7TA 3KD7A 2FBNA 1BPOA 2KATA 4APFA 3ZEFA 3Q5MA 2OV8A 1H2UA 4A1SA 2CHXA 4L23A 2WXMA 1OWOA 2Y4UA 5J90A 1WY6A 2X6IA 2GRMA 2CHZA 3Q4AB 3CLJA 2XPYA 2XGOA 3QK0A 4XKBA 5AYWD 3VLFA 4B8CB 3SNXA 4JC8A 1PAQA 4U0UA 4WWOA 5A23A 1OWNA 3PRZA 3LVQE 4N3AA 4HOTA 5ARFA 3S7JA 4WNFA 1FCHA 4AV7A 3OXFA 4JVSA 3FP3A 4D10C 2KCLA 4APOA 3ZHEB 1HG2A 5JJTA 2IOLA 3JQ0A 4FC8A 4Y6WA 5A7DB 4GZDA 5FQ4A 3FEYA 3B13A 3PE3A 4GMLA 2FULA 4OVVA 1TJCA 4GCOA 1VDYA 5ANRA 4GZ6A 2M63A 2ZU6B 3FH5A 3PE4A 3IHYA 1HU3A 3PS6A 5EDSA 1ZU2A 4EBAA 4AVXA 3ASDA 3R9AB 2WVIA 4HOQA 2MRIA 4I43A 4E6HA 1UG3A 2KCKA 2ONDA 3CVYA 5AIJA 1QZ2A 2NC9A 4HVBA 2YINA 1ELRA 3PH0C 2KZTA 4UI9K 3MCXA 2I9CA 3JYSA 4N2SA 2AXZA 3UPVA 3APFA 3NZUA 5G55A 3FU3A 4DPRA 2ILRA 2X6HA 3FUEA 5FZQA 1E90A 3APCA 3PEUB 3TJPA 3FU5A 4HLEA 5JHAA 3O48A 3LKUA 4ATGA 1LF8A 3UT4A 4J8EA 4I9CA 3FWVA 3KEZA 2XQ0A 1HE8A 2WXNA 3ZHEA 4LUNU 4EECA 1KT0A 4GA1A 3SF4A 3QDNA 2VGXA 4N3CA 4OVUA 2C0MA 4HORA 3ZYQA 3ML8A 1HH8A 3EIQC 4DJAA 2L9BA 5AENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCX A;  4L7T A;  3JYS A;  3FDH A;  3OTN A;  3P1U A;  3JQ0 A;  3LEW A;  4Q69 A;  3CGH A;  3SGH A;  5FQ4 A;  4LER A;  5E76 A;  5T3R A;  3EHN A;  3CKB A;  3CKC A;  3IV0 A;  5T4Y A;  5LX8 A;  3QNK A;  3L22 A;  5FQ6 A;  5J90 A;  3GZS A;  4PUC A;  4MRU A;  3KEZ A;  5E75 A;  3MX3 A;  3SNX A;  3CK8 A;  3CK7 A;  3HDX A;  3CK9 A;  4F53 A;  3JQ1 A;  3EHM A;  5FQ8 A;  4F7A A;  3EJN A;  3I4G A;  3NQP A;  3MYV A;  5FQ7 A; 
#chains in the Genus database with same CATH topology
 3C3O A;  4JZY A;  3Q7F A;  1E8Z A;  3BQO A;  4HRM B;  3UX4 A;  3FTU A;  5ENS D;  1FVF A;  3CKC A;  5ANL A;  2WXL A;  1WM5 A;  2L6B A;  5BXO A;  4I2W A;  5C2Y A;  1N0R A;  3NOC D;  4G26 A;  2X6F A;  3E33 A;  5LP0 A;  3FUM A;  2E2E A;  4UUC A;  1N54 A;  3E4B A;  3IHV A;  3MKQ B;  5HRY A;  3AG4 E;  3LXU X;  5CER B;  1MX4 A;  3FTY A;  2I6H A;  3DRA A;  2VTB B;  1NFI E;  4TV3 A;  1LD7 A;  2GGF A;  1Y6I A;  4BWR A;  2WXP A;  3ONK A;  2LUH A;  2YHE A;  2VGE A;  3KSQ A;  3HRA A;  3EDT B;  3R7R A;  3D9I A;  3SY2 A;  3PZ1 A;  1N4Q A;  4UWL A;  3JUI A;  3CVU A;  4YVO A;  3ZNG A;  3LVR E;  3CHO A;  3CV0 A;  2CHW A;  3CVX A;  2I1K A;  1RW2 A;  4UI9 J;  2R17 C;  4GZ5 A;  1DVP A;  3FU6 A;  5ARG A;  3L17 A;  3ZGQ A;  1X5B A;  3SQV A;  3APD A;  4ILG A;  4KYO B;  1HXI A;  1N9A A;  5HQ8 A;  3AU4 A;  2IFU A;  2QC9 A;  4ACL A;  3FTX A;  4EZJ A;  3QOU A;  2PNN A;  2BED A;  2YQ8 A;  1TN6 A;  4G24 A;  3MZL B;  1N0Q A;  2F0Y A;  3ESL A;  3CEQ A;  3SBT B;  4ANU A;  3LY7 A;  1NA3 A;  1S63 A;  3ZYL A;  3LCA A;  2ZIS A;  3FDH A;  4ZHB A;  4BET A;  3TWU A;  2X6J A;  3VLD A;  4GTR A;  3S7F A;  1SQM A;  3FUF A;  5FQ8 A;  2IQC A;  4LNU D;  3UTM A;  2XS1 A;  3RRN B;  1OUV A;  3MYV A;  4CRW A;  3DSU A;  3SO8 A;  1OCO E;  1N11 A;  3Q79 A;  3J5Q B;  3HIZ A;  4ZFH A;  4N3B A;  4HFG A;  4MKT A;  5FZR A;  2DYR E;  1TNB A;  4BSZ B;  3CK8 A;  3EIJ A;  3HDX A;  3OAW A;  3RRM B;  3Q78 A;  2P9S G;  4DUI A;  1U2V G;  5T3R A;  4J6I A;  4M3O A;  3TL5 A;  4DX1 A;  3TWW A;  5D0O D;  4UWK A;  3TWQ A;  2QZA A;  4NRH B;  5AJL A;  4EPZ A;  2VGX B;  3HYM B;  5KNG A;  5ENN A;  4ANV A;  4HXI A;  5CEA A;  4BTA A;  4IYP A;  5ENR D;  2XRZ A;  3ISM C;  2J4D A;  1B89 A;  4GMJ A;  3ZFW A;  4I9E A;  4CGW A;  3UXG A;  4XE0 A;  4RG6 A;  3CK9 A;  2P9I G;  2V5F A;  3UIN C;  4UQZ A;  4JA9 A;  2LNI A;  3B7S A;  4CDN A;  1MHQ A;  5FZS A;  1EPU A;  4C0E A;  1FT1 A;  5G04 J;  4G1T A;  3CR3 A;  2OEW A;  4G8K A;  4F7A A;  1ELW A;  2V5Q C;  2VTB A;  1IKN D;  2XCC A;  3X2Q E;  4NAC A;  4X8Q A;  3ULQ A;  4QFV A;  4BX8 A;  1QQE A;  3LY9 A;  2XZT G;  4BER A;  4P29 A;  3UM0 A;  3SHF A;  3RSE G;  2WQ7 A;  5BV0 A;  3L54 A;  3B95 A;  2CG3 A;  5JJ6 A;  4YDY A;  3L13 A;  2UY1 B;  5CRV A;  5BT1 A;  2VYI A;  2ZIR A;  4A1G A;  2A5U A;  4B8A A;  2J07 A;  4RG9 A;  2ETA A;  4HI8 A;  3EUV A;  4LNB A;  3ML9 A;  4JHJ A;  3CHM A;  1EF1 C;  3LEW A;  1E8W A;  3U66 A;  5CCM A;  2IY0 C;  3SZ7 A;  5HS0 A;  1WAO 1;  4GYY A;  3UQ3 A;  3MV3 B;  2LSU A;  4XKC A;  3J5P A;  4C9B B;  3AJI A;  3BEE A;  3FH8 A;  3DXK G;  2P9U G;  3KEA A;  5EIB E;  4L23 A;  3E30 A;  3W9F A;  2A5E A;  2Y4U A;  5J90 A;  2HE0 A;  3VLF A;  4B8C B;  3SNX A;  4RLY A;  4U0U A;  3PRZ A;  4J8Y A;  3S7J A;  1NI1 A;  3NBN B;  1HG2 A;  5JJT A;  2IOL A;  5FQ4 A;  3DXM G;  2FUL A;  4OVV A;  3IHY A;  1HU3 A;  5EDS A;  1ZU2 A;  2MRI A;  4ATZ D;  1OCR E;  4HRL A;  2YIN A;  3UPV A;  3APF A;  1O1R A;  3FU5 A;  1SVX A;  5JHA A;  3O48 A;  4ATG A;  1LF8 A;  4TXR A;  2EIL E;  2JAB A;  1HE8 A;  1MZC A;  1KT0 A;  4GA1 A;  3SF4 A;  3ZYQ A;  3EIQ C;  2L9B A;  5AEN A;  4O1P A;  5G05 J;  1N4S A;  3HG0 D;  3VTX A;  4G23 A;  1G3N B;  1UJK A;  4PS7 A;  4CEM A;  2Y0B G;  1H0A A;  4OAV B;  2XEV A;  2PM7 A;  1TNY A;  3TAX A;  2V8S E;  3G2V A;  4MS6 A;  1HS6 A;  3FH7 A;  4I6G A;  4FAD A;  3RAU A;  5BW8 C;  3RO2 A;  2VJ8 A;  4N5C A;  1OY3 D;  3FTW A;  1TNZ A;  4JPS A;  3B7T A;  4YDE A;  3DST A;  4G8L A;  2AWI A;  2OVF A;  5HI7 A;  2RFA A;  5BNW A;  3SFY A;  5LX8 A;  1HG5 A;  3UMV A;  3KAE A;  4KVO A;  1FPP A;  4N2Q A;  3HXB A;  5AQA A;  3JQ1 A;  4R7L A;  4LEU A;  1H2V C;  3ULY A;  3UUX A;  2VGY A;  3C72 A;  3IEG A;  3PUK A;  5T8I A;  4F1S A;  2PM6 A;  4JXT A;  1KT1 A;  2ION A;  4XEI G;  2WXK A;  5J08 A;  1FVH A;  4U07 A;  3CQG B;  2DIW A;  3T5X A;  3MJW A;  2IOS A;  3R7Q A;  5BXU A;  4Q94 A;  3ONL A;  3QWW A;  1UN8 A;  4C0M A;  3TGO A;  4B94 A;  2FF4 A;  4N5Q A;  3N71 A;  1LD8 A;  5E75 A;  3G2W A;  3ZYK A;  1BI7 B;  5FQ7 A;  4BX9 A;  2HR2 A;  4WWN A;  1QNF A;  3K9I A;  4GYO A;  4L2L A;  4HB5 A;  1TYQ G;  3CVW A;  3L22 A;  3FUJ A;  3B7R L;  3TG5 A;  5JHB A;  3FHE A;  4V3I A;  5G2N A;  3Q75 A;  1UN9 A;  4WND A;  2J8S D;  4I6E A;  4U96 D;  2CFZ A;  5KJN A;  4GCN A;  3Q49 B;  1MJ0 A;  3IV0 A;  4GMR A;  1INZ A;  3FUL A;  1V55 E;  3IKO B;  1L5J A;  4LSZ E;  2J08 A;  4NUR A;  5FTP A;  3WXX A;  1KZP A;  4I1A A;  5BV1 A;  4HLL A;  5H7P A;  5AAR A;  2GRQ B;  2X6K A;  4CGV A;  5C1D A;  1XNF A;  3AG1 E;  2R05 A;  2ZGG A;  3G2U A;  4L1B A;  3SI5 A;  1IHG A;  1K1B A;  4U8V D;  1UW4 B;  3EHQ A;  2L6J A;  2EIM E;  5LFA A;  4OYS A;  1NP7 A;  1P5Q A;  2ETC A;  5DBK A;  2WPV A;  3CKB A;  4UWF A;  2HO1 A;  5CMW A;  1JWF A;  4L2Y A;  4YVQ C;  4JB8 P;  4U04 A;  1E7U A;  1Q2Z A;  2RKK A;  3PNL B;  4C48 B;  3EJN A;  3ABM E;  3HVE A;  2IJG X;  4EZL A;  1IYG A;  3AG3 E;  1SZ9 A;  3DSV A;  5CBN A;  4DLO A;  4EBA G;  1U3D A;  2F37 A;  3D9P A;  3R9M A;  4BY6 A;  2HYZ A;  2P9N G;  4I2Z A;  3ULE G;  5JMN D;  3DSS A;  4ACK A;  5AQB A;  2WM9 A;  4U0S A;  1TR4 A;  3FU0 A;  2LO6 A;  1JCS A;  3P1U A;  5EID A;  4U8H A;  4BTB A;  2I1J A;  1H6P A;  3D9K A;  3QWV A;  3ZVV A;  5AJD A;  4CDR A;  2XRY A;  2XPI A;  4YND A;  3C5R A;  4WAF A;  1O1S A;  4F6R D;  1S70 B;  4DI3 A;  1TJF A;  5FIN A;  4BT9 A;  1E7V A;  2KCV A;  4RQI A;  3RKV A;  5E76 A;  1OWM A;  3DPY A;  2IU1 A;  2MYO A;  2QY7 A;  3D9H A;  4L9P A;  3I5P A;  3U64 A;  2A4Z A;  1KZO A;  3UT7 A;  5EKQ D;  3ZPJ A;  4UWH A;  2E0I A;  3GZ2 A;  5LCW J;  1SW6 A;  3LYA A;  4KZ0 A;  4FLH A;  1HO8 A;  3DPD A;  2F8X K;  4I1O B;  4WWP A;  3GZS A;  3E32 A;  1D9S A;  3GZ1 A;  3ZU7 B;  3BU8 A;  5DIZ A;  2BF0 X;  2RFM A;  3ZUV B;  2WXI A;  4FUL A;  2P2C P;  1AP7 A;  1H2U A;  1OXJ A;  3W9G A;  2WXM A;  1OWO A;  2GRM A;  5AYW D;  1JCR A;  1A5E A;  1TN7 A;  5ARF A;  4AV7 A;  1FCH A;  4MBG A;  4D10 C;  4APO A;  2OEV A;  5A7D B;  4GCO A;  5ANR A;  4HOQ A;  4I43 A;  5D66 A;  1DCE A;  1UG3 A;  2OND A;  3UIP C;  1RZ4 A;  1MX2 A;  4LNG A;  2KZT A;  5EYL A;  2IEJ A;  3MCX A;  3JYS A;  2AXZ A;  1V54 E;  5G55 A;  2X6H A;  4GTV A;  4DX7 D;  3Q9U C;  3APC A;  3TJP A;  4GPM A;  4HBD A;  2DVW A;  3UT4 A;  4J8E A;  3ZHE A;  4LUN U;  2DYS E;  2P9K G;  3QDN A;  4HOR A;  1HH8 A;  4DJA A;  3VLE A;  4G2V A;  3B7U X;  3P2B A;  1XGW A;  3AG2 E;  3HHM A;  3LY8 A;  1OWP A;  4NQ0 A;  3MEK A;  4J8D A;  4ILH B;  3NF1 A;  4EZK A;  4U0Z A;  4CCA A;  3MGB A;  4UQX A;  4H7Y A;  2WMN A;  3CHS A;  3L08 A;  1O5M A;  1E8Y A;  3TWV A;  2WXF A;  4JEU A;  3NOG D;  1D8E A;  4AOF A;  4DI4 A;  3URZ A;  2AXV A;  1SA4 A;  3O4Z A;  4B89 A;  4B0Z A;  2RD0 A;  3U4T A;  3S2A A;  2ETB A;  3PZ2 A;  2L0I A;  2JLB A;  1BLX B;  3E34 A;  3CHQ A;  1FT2 A;  2FO7 A;  3SGH A;  3OXG A;  5D2M C;  5CHE E;  3UM2 A;  3FUN A;  3ASF A;  3TWT A;  4XI0 A;  2OCC E;  3V31 A;  2AVP A;  1GW6 A;  3UM3 A;  2XS8 A;  3D9M A;  3ZIM A;  3QB2 A;  2GRN B;  2GRL A;  3TG4 A;  2J4B A;  1E96 B;  2B6C A;  3QWP A;  3C98 A;  4O6F A;  4AY5 A;  3S7B A;  4ANW A;  4GYW A;  2C2L A;  2LXM A;  2ZXW E;  3FUK A;  4HNA D;  1Z6T A;  4CZ2 D;  2XZD G;  4KBQ A;  3TXN A;  4AEZ C;  3CVP A;  4J0U A;  5M72 A;  3FUD A;  4JHK A;  2WXR A;  4Q96 A;  4BEP A;  4PS8 A;  4GPK A;  5EX3 A;  3CIA A;  2VSX E;  4IRU A;  3I3N A;  3T9K A;  4BSX A;  2Y69 E;  3T8K A;  4FLB A;  4FA6 A;  4J8F A;  1TEZ A;  4HS2 A;  2BUG A;  4RSY A;  2V4L A;  4M7C A;  2DBA A;  2MHK A;  5CEC B;  1ZBP A;  3RRU A;  2V0P A;  3TXM A;  5KNH D;  2WB2 A;  1A17 A;  4PDX A;  4K0R A;  3PRE A;  4OAU C;  2Y4T A;  3U3W A;  1NA0 A;  2DZN A;  2Y3A A;  1DCQ A;  2J9Q A;  2YNQ A;  4TUU A;  3QC1 A;  5CRU A;  4EHM A;  2QYU A;  4K03 A;  2LAH A;  2Q7F A;  4PUC A;  4KXK B;  4CYM D;  4GTP A;  3TWR A;  4JW1 A;  2HM8 A;  1OWL A;  1N52 A;  3CST A;  4KMO A;  5ITZ F;  4GB9 A;  3SBS A;  3MKR A;  4CDM A;  2IO3 C;  1U3C A;  5LOZ A;  1HZ4 A;  1S64 A;  4LCT A;  1Z5S C;  1H2T C;  2X38 A;  5B1B E;  3WG7 E;  4I1M A;  2XEN A;  3RO3 A;  4PS3 A;  3T8M A;  5AQ7 A;  3LPZ A;  2R59 A;  2JEK A;  1JPL A;  2LAI A;  2VSN A;  4UQY A;  4JA7 A;  4HOU A;  4FHK A;  1PY1 A;  4Y6C A;  3S7D A;  4WNE A;  4XX5 A;  3CHP A;  4U7E B;  2NSZ A;  2YHC A;  2C0L A;  4AY6 A;  3PNT B;  3BG0 B;  3RIB A;  1HF8 A;  4J8S A;  1YA0 A;  3CVL A;  2PQN A;  4KT6 B;  2J49 A;  1YYH A;  4N39 A;  2QFC A;  3AS5 A;  5LCW C;  4DX2 A;  3Q9N C;  3FY4 A;  3ZW3 A;  3L16 A;  4H7X A;  3UIO C;  4DX5 D;  3DWL G;  1N4P A;  4GU5 A;  2H6H A;  3ZXP A;  1YMP A;  3PZ4 A;  3PDN A;  3ZRH A;  3SFX A;  5FJY A;  1SA5 A;  2GRO B;  4WNG A;  2X3M A;  3AU5 A;  3CVV A;  3PVL A;  4ME2 A;  3V2X A;  3TWS A;  3DBS A;  1NL4 A;  4XZ4 A;  2KZT B;  4HI9 A;  3G2S A;  3IBE A;  4I17 A;  5ENT D;  2I2O A;  4G11 A;  4HOS A;  3Q15 A;  3LDZ A;  2XEH A;  2R5S A;  3AAA C;  5D0Q D;  1IHB A;  2VSO E;  4EQF A;  3EHR A;  3CVQ A;  1H19 A;  4GTQ A;  4G25 A;  4F3V A;  1TNO A;  5CED B;  2UY1 A;  2BKG A;  3EU9 A;  1K8K G;  4GAA A;  4UWG A;  3ENE A;  1D8D A;  4L7T A;  2FBN A;  2KAT A;  3IXE A;  2FO1 E;  4APF A;  3Q5M A;  2OV8 A;  4A1S A;  2CHX A;  4GTO A;  5EYP F;  3Q7A A;  2GRP B;  4F1P A;  2X6I A;  2CHZ A;  2XPY A;  4XKB A;  2KBX A;  1WG0 A;  4WWO A;  5A23 A;  3OXF A;  3DSW A;  4JVS A;  3FP3 A;  2KCL A;  4HRN A;  3BUA A;  3JQ0 A;  4Y6W A;  3JXJ A;  3FEY A;  3JXI A;  4GTT A;  4Z68 A;  1TJC A;  4K5C A;  3FH5 A;  4EBA A;  4AVX A;  3R9A B;  2WVI A;  1WDY A;  4E6H A;  2KCK A;  1ELR A;  3HXC A;  4UI9 K;  3FU3 A;  2ILR A;  2ZGD A;  5AN8 A;  3LKU A;  4BES A;  3LJN A;  3V79 K;  5AAO A;  3FWV A;  3DEP A;  3KEZ A;  1AWC B;  5ENQ D;  2WXN A;  1ZB1 A;  2VGX A;  4N3C A;  4OVU A;  2C0M A;  3ML8 A;  3UM1 A;  3CSF A;  4A3T A;  5CMY A;  3T5V A;  3DSX A;  5JA4 D;  4RVB A;  2DCP A;  5JJ7 A;  3B7B A;  4I6J A;  4U63 A;  2MOW A;  1OCZ E;  4IN3 B;  3U9W A;  4J7W A;  1UJJ A;  3MX3 A;  3AS8 A;  2WXQ A;  1X81 A;  4ILI A;  4ABN A;  1OT8 A;  4HQD A;  3I4G A;  4TXP A;  2WXJ A;  2IF4 A;  5AQ9 A;  4ANX A;  2NXP A;  1N94 A;  3JCK C;  4KVM A;  1BD8 A;  4YDW A;  3D9J A;  2PQR A;  3JUE A;  1KLX A;  4GTM A;  2CG2 A;  1HFA A;  1K3Z D;  1DNP A;  2DWZ A;  4Q69 A;  2V4H C;  5ENP D;  2R02 A;  3D9O A;  4AM9 A;  1IQU A;  3HVE B;  3QNK A;  3QAQ A;  4PH4 B;  1Y8M A;  3C3R A;  4A63 B;  4A55 A;  5CBO A;  3NQP A;  1YCS B;  2EQX A;  3UT8 A;  3KSL A;  2WQ6 A;  5A6C A;  2KC7 A;  1Z3Y A;  4BFR A;  4LG6 A;  1TNU A;  4AXH A;  1UOH A;  2EIN E;  2WXH A;  2QYJ A;  3PZ3 A;  4O1O A;  3LS8 A;  5IY5 E;  3RJV A;  4O60 A;  4JHR A;  3TWX A;  4CT4 A;  4LRZ A;  1JUQ A;  3UI2 A;  3D9N A;  4FP7 A;  5BUZ A;  3ASH A;  1JCQ A;  3OXL A;  3ZXS A;  2XEE A;  1W3B A;  3MV2 B;  4IUL A;  3V30 A;  4AP2 A;  2RG8 A;  3D3M A;  5BPP A;  3FTS A;  2H6G A;  3FUH A;  2Y1L E;  3AS4 A;  4FJY A;  3VTY A;  3FEX A;  4DLQ A;  2FI7 A;  1H6O A;  1E8X A;  1TN8 A;  3C3Q A;  3SFZ A;  3L82 A;  2WQH A;  5G05 C;  4FJZ A;  2OVB A;  4K5B A;  1SZA A;  4GA0 A;  5FIO A;  5ENO D;  3HXD A;  5KCM A;  4TXQ A;  3GW4 A;  2R03 A;  3MA5 A;  3SD5 A;  4GA2 A;  2LXL A;  1DC2 A;  3QKY A;  3ZYM A;  2J09 A;  2CFU A;  4GZ3 A;  4JL0 A;  3FFL A;  2XGM A;  3MKQ A;  1MQS A;  2BTD A;  3I4R B;  3L6A A;  1IXV A;  2H6F A;  4TRQ A;  3EHM A;  4QQI A;  1MYO A;  3PUJ A;  1HX8 A;  1BU9 A;  4JD2 G;  3GYZ A;  5KJL A;  1PC2 A;  2LSV A;  1EYH A;  3PZD A;  2L0T B;  1EDU A;  2AW6 A;  4YDO A;  2PL2 A;  4GZC A;  2AJA A;  4F53 A;  3CQC B;  4MLP A;  5CCL A;  3NZS A;  1LTX A;  4FHJ A;  5B1A E;  4JEH A;  4AIF A;  3CGH A;  3KS2 A;  4AJW A;  2H6I A;  3EHN A;  2B0O E;  5FWQ A;  5KJK A;  2OOE A;  5T4Y A;  1Z3X A;  5EN5 D;  2VSY A;  3LJ3 A;  2KM4 A;  3D9L A;  5KWD A;  1N95 A;  4BT8 A;  2WXO A;  3FTZ A;  3RK6 A;  3OTN A;  1H6K A;  1S0P A;  3CHR A;  1K1A A;  4E85 A;  3FUI A;  4W9R A;  3PEV B;  1ELK A;  4TUM A;  3ZN3 A;  5G04 C;  3QAR A;  3QJZ A;  1NZN A;  3V2O A;  3HXF A;  4GTS A;  2KXP C;  3HXE A;  4UI9 C;  3BG1 B;  2XGS A;  5FQ6 A;  5EX0 A;  4WUY A;  4MRU A;  3ASN E;  4FU3 A;  1JWG A;  2GRR B;  4DK5 A;  1QBQ A;  2FEZ A;  2IO2 C;  1QYM A;  2BKK B;  2AXU A;  3ESK A;  2XHE A;  3RU0 A;  2WXG A;  1IQR A;  4XIF A;  4DRX E;  2P58 C;  3G2T A;  2WMO A;  3CK7 A;  2NYJ A;  2XCB A;  4KZC A;  3NB2 A;  1BI8 B;  2EIK E;  1N4R A;  3NAW A;  4XI9 A;  1O1T A;  3FTV A;  4LER A;  3Q47 B;  4A3V A;  1KPS B;  2P9L G;  2XPZ A;  3ABL E;  3ASG A;  4URK A;  4CT0 A;  5HKP A;  2PZI A;  3CVN A;  5EIL A;  2UWJ G;  2VQ2 A;  5KJM A;  2GW1 A;  4DX6 D;  5FT9 A;  3KD7 A;  1BPO A;  1OCC E;  3ZEF A;  2DZO A;  2P9P G;  4B93 B;  2R2L A;  1WY6 A;  3Q4A B;  3CLJ A;  2XGO A;  3QK0 A;  4JC8 A;  1PAQ A;  4NIK A;  4K5A B;  4U95 D;  1OWN A;  3LVQ E;  4N3A A;  4HOT A;  4WNF A;  5B3S E;  3ZHE B;  4FC8 A;  2EIJ E;  4GZD A;  3B13 A;  3PE3 A;  4GML A;  1MX6 A;  1VDY A;  4GZ6 A;  2M63 A;  2ZU6 B;  4U8Y D;  3PE4 A;  3PS6 A;  3UKR G;  3ASD A;  3CVY A;  5AIJ A;  1QZ2 A;  2NC9 A;  4HVB A;  3E37 A;  3L9T A;  3UKU G;  3Q73 A;  3PH0 C;  5KBA A;  2I9C A;  4N2S A;  3ABK E;  3NZU A;  4DPR A;  3F6Q A;  2F8Y A;  3FUE A;  5FZQ A;  1E90 A;  3PEU B;  4HLE A;  3ASO E;  3EU5 A;  4I9C A;  3ZKJ A;  2XQ0 A;  4EEC A;  3DEO A; 
#chains in the Genus database with same CATH homology
 3VLE A;  4G2V A;  4JZY A;  3CSF A;  5G05 J;  3B7U X;  4A3T A;  5CMY A;  3P2B A;  1E8Z A;  3T5V A;  1XGW A;  4RVB A;  3HHM A;  3UX4 A;  2DCP A;  3FTU A;  3LY8 A;  5JJ7 A;  3VTX A;  1FVF A;  3CKC A;  4G23 A;  4I6J A;  5ANL A;  1OWP A;  2WXL A;  4NQ0 A;  4U63 A;  1WM5 A;  3MEK A;  1UJK A;  4J8D A;  2MOW A;  4ILH B;  4PS7 A;  3U9W A;  4IN3 B;  4CEM A;  1H0A A;  4I2W A;  3NF1 A;  5C2Y A;  1UJJ A;  4EZK A;  4U0Z A;  3MX3 A;  3AS8 A;  2X6F A;  4G26 A;  2WXQ A;  4CCA A;  2XEV A;  3MGB A;  4UQX A;  4ILI A;  5LP0 A;  4ABN A;  3FUM A;  2PM7 A;  2E2E A;  3I4G A;  1N54 A;  3E4B A;  3TAX A;  3IHV A;  3MKQ B;  2V8S E;  4H7Y A;  2WMN A;  3CHS A;  2WXJ A;  3L08 A;  3LXU X;  3G2V A;  3FTY A;  2IF4 A;  4ANX A;  1E8Y A;  2NXP A;  4MS6 A;  1HS6 A;  3FH7 A;  2I6H A;  3JCK C;  4KVM A;  2VTB B;  4I6G A;  4FAD A;  2WXF A;  4JEU A;  4TV3 A;  4AOF A;  4DI4 A;  5BW8 C;  3D9J A;  2VJ8 A;  3RO2 A;  2GGF A;  3URZ A;  2AXV A;  3O4Z A;  4N5C A;  1Y6I A;  4BWR A;  2WXP A;  4B89 A;  4B0Z A;  2PQR A;  3ONK A;  2RD0 A;  3U4T A;  3FTW A;  3S2A A;  2YHE A;  1KLX A;  4JPS A;  2CG2 A;  3EDT B;  2L0I A;  3B7T A;  1HFA A;  1DNP A;  3R7R A;  2JLB A;  3D9I A;  3CHQ A;  2AWI A;  4UWL A;  2OVF A;  2FO7 A;  4Q69 A;  3SGH A;  3JUI A;  5HI7 A;  3CVU A;  5BNW A;  3OXG A;  3D9O A;  4AM9 A;  1IQU A;  4YVO A;  3HVE B;  5CHE E;  5LX8 A;  3QNK A;  3FUN A;  3ASF A;  3QAQ A;  3LVR E;  4XI0 A;  3CHO A;  1HG5 A;  3UMV A;  3KAE A;  4KVO A;  3CV0 A;  4N2Q A;  2AVP A;  4PH4 B;  1Y8M A;  1GW6 A;  2CHW A;  3CVX A;  2I1K A;  3JQ1 A;  4A55 A;  4R7L A;  3D9M A;  4UI9 J;  4LEU A;  3ZIM A;  1H2V C;  3NQP A;  2R17 C;  3UUX A;  4GZ5 A;  2EQX A;  2VGY A;  3QB2 A;  3UT8 A;  2WQ6 A;  5A6C A;  1DVP A;  2GRL A;  3IEG A;  3PUK A;  2KC7 A;  2J4B A;  3FU6 A;  1Z3Y A;  1E96 B;  5ARG A;  5T8I A;  3TG4 A;  2PM6 A;  4BFR A;  4JXT A;  4F1S A;  3QWP A;  3C98 A;  1KT1 A;  4O6F A;  3L17 A;  4AY5 A;  2ION A;  3S7B A;  4ANW A;  4AXH A;  4GYW A;  2C2L A;  3ZGQ A;  1X5B A;  2WXK A;  3FUK A;  2WXH A;  3APD A;  4ILG A;  1Z6T A;  5J08 A;  1FVH A;  4KYO B;  1HXI A;  3LS8 A;  3RJV A;  4U07 A;  3CQG B;  2DIW A;  3T5X A;  3MJW A;  4KBQ A;  3TXN A;  4AEZ C;  4JHR A;  5HQ8 A;  3CVP A;  4CT4 A;  2IOS A;  3AU4 A;  4J0U A;  3R7Q A;  4LRZ A;  1JUQ A;  5M72 A;  2IFU A;  4Q94 A;  3ONL A;  3FTX A;  3D9N A;  3FUD A;  4ACL A;  4EZJ A;  3QOU A;  4JHK A;  3QWW A;  4FP7 A;  5BUZ A;  3ASH A;  2YQ8 A;  2WXR A;  4Q96 A;  3OXL A;  3ZXS A;  1UN8 A;  4PS8 A;  4G24 A;  4C0M A;  3MZL B;  3TGO A;  4GPK A;  1W3B A;  4B94 A;  5EX3 A;  3CIA A;  3MV2 B;  2FF4 A;  2VSX E;  3ESL A;  3CEQ A;  4IRU A;  4IUL A;  3I3N A;  4AP2 A;  3SBT B;  4ANU A;  2RG8 A;  3N71 A;  3LY7 A;  5E75 A;  1NA3 A;  4BSX A;  3D3M A;  5BPP A;  3FTS A;  3G2W A;  4FLB A;  4FA6 A;  3ZYK A;  4J8F A;  3FUH A;  3ZYL A;  3LCA A;  1TEZ A;  3AS4 A;  2BUG A;  4HS2 A;  4FJY A;  4RSY A;  2V4L A;  5FQ7 A;  3VTY A;  4BX9 A;  3FEX A;  4DLQ A;  2HR2 A;  3FDH A;  4WWN A;  2FI7 A;  1QNF A;  3K9I A;  4GYO A;  2DBA A;  4L2L A;  2MHK A;  3CVW A;  1ZBP A;  3RRU A;  2V0P A;  2X6J A;  3TXM A;  3VLD A;  3L22 A;  1E8X A;  3FUJ A;  3B7R L;  3S7F A;  2WB2 A;  1SQM A;  1A17 A;  4PDX A;  3SFZ A;  3TG5 A;  5JHB A;  4K0R A;  2WQH A;  3FHE A;  4V3I A;  4FJZ A;  5G05 C;  5G2N A;  3PRE A;  3FUF A;  1UN9 A;  2OVB A;  2Y4T A;  5FQ8 A;  3U3W A;  2IQC A;  1NA0 A;  4WND A;  1SZA A;  4GA0 A;  3RRN B;  1OUV A;  4I6E A;  3MYV A;  4CRW A;  2CFZ A;  2Y3A A;  5KCM A;  3SD5 A;  3GW4 A;  3MA5 A;  5KJN A;  4GCN A;  2J9Q A;  2YNQ A;  4GA2 A;  4TUU A;  3QC1 A;  3Q49 B;  3IV0 A;  3HIZ A;  3QKY A;  3ZYM A;  4N3B A;  1INZ A;  4K03 A;  2J09 A;  4HFG A;  4MKT A;  2CFU A;  2LAH A;  3FUL A;  4GZ3 A;  2Q7F A;  5FZR A;  4JL0 A;  3FFL A;  4PUC A;  2XGM A;  3IKO B;  3MKQ A;  4KXK B;  1MQS A;  2BTD A;  3CK8 A;  3I4R B;  3L6A A;  3EIJ A;  1L5J A;  3HDX A;  2J08 A;  4TRQ A;  3EHM A;  4JW1 A;  4NUR A;  2HM8 A;  3PUJ A;  1OWL A;  1N52 A;  3CST A;  1HX8 A;  3OAW A;  5FTP A;  4KMO A;  3WXX A;  4GB9 A;  3SBS A;  4I1A A;  3RRM B;  5BV1 A;  3GYZ A;  5KJL A;  1PC2 A;  3MKR A;  2X6K A;  2LSV A;  5C1D A;  4CGV A;  5T3R A;  4J6I A;  1EYH A;  4M3O A;  4CDM A;  3TL5 A;  3PZD A;  1XNF A;  1U3C A;  5D0O D;  5LOZ A;  2L0T B;  1HZ4 A;  1EDU A;  2AW6 A;  4LCT A;  4UWK A;  3G2U A;  2PL2 A;  1H2T C;  2X38 A;  4GZC A;  4L1B A;  3SI5 A;  4NRH B;  5AJL A;  4I1M A;  4EPZ A;  1IHG A;  4F53 A;  3CQC B;  2VGX B;  4MLP A;  3NZS A;  4FHJ A;  3RO3 A;  5CCL A;  3HYM B;  4PS3 A;  1UW4 B;  2L6J A;  5LFA A;  3T8M A;  4OYS A;  5ENN A;  4JEH A;  1NP7 A;  3LPZ A;  1P5Q A;  2R59 A;  4AIF A;  2JEK A;  3CGH A;  4ANV A;  1JPL A;  3KS2 A;  4AJW A;  4HXI A;  2WPV A;  2LAI A;  5DBK A;  2VSN A;  3EHN A;  4UQY A;  3CKB A;  5FWQ A;  4IYP A;  4UWF A;  4BTA A;  2OOE A;  5T4Y A;  5KJK A;  2XRZ A;  2J4D A;  1B89 A;  4GMJ A;  4HOU A;  4JA7 A;  1Z3X A;  3ZFW A;  2HO1 A;  4I9E A;  4CGW A;  4FHK A;  2VSY A;  1PY1 A;  4Y6C A;  3LJ3 A;  5CMW A;  3S7D A;  2KM4 A;  4WNE A;  1JWF A;  4L2Y A;  4XE0 A;  4XX5 A;  3D9L A;  4RG6 A;  3CHP A;  4YVQ C;  4U04 A;  1E7U A;  2NSZ A;  2YHC A;  3CK9 A;  2V5F A;  3PNL B;  4UQZ A;  2C0L A;  4AY6 A;  4JA9 A;  2LNI A;  4BT8 A;  3PNT B;  3EJN A;  3HVE A;  2WXO A;  3BG0 B;  3RIB A;  3B7S A;  2IJG X;  4EZL A;  4CDN A;  1IYG A;  3FTZ A;  3RK6 A;  3OTN A;  1H6K A;  1SZ9 A;  1S0P A;  3CHR A;  1HF8 A;  4J8S A;  1YA0 A;  4DLO A;  3CVL A;  4EBA G;  1MHQ A;  4E85 A;  1U3D A;  2PQN A;  1EPU A;  3FUI A;  4KT6 B;  5FZS A;  2J49 A;  4W9R A;  4C0E A;  3PEV B;  3D9P A;  4BY6 A;  4N39 A;  1ELK A;  5G04 J;  2QFC A;  4G1T A;  2HYZ A;  3AS5 A;  5LCW C;  3CR3 A;  3ZN3 A;  3FY4 A;  4I2Z A;  5G04 C;  3QAR A;  4ACK A;  3ZW3 A;  3QJZ A;  3L16 A;  1NZN A;  4H7X A;  2WM9 A;  4F7A A;  4U0S A;  1ELW A;  2VTB A;  3FU0 A;  2XCC A;  2LO6 A;  3P1U A;  4NAC A;  4U8H A;  4BTB A;  2I1J A;  3D9K A;  3QWV A;  4GU5 A;  3ZVV A;  3ULQ A;  4QFV A;  4BX8 A;  1QQE A;  5AJD A;  3PDN A;  4UI9 C;  3BG1 B;  3ZRH A;  3LY9 A;  5FJY A;  4CDR A;  2XGS A;  5FQ6 A;  5EX0 A;  4WUY A;  2XRY A;  4WNG A;  2XPI A;  4MRU A;  4P29 A;  2X3M A;  3AU5 A;  4YND A;  4FU3 A;  3CVV A;  3PVL A;  4ME2 A;  3SHF A;  4WAF A;  1JWG A;  4DI3 A;  2WQ7 A;  1TJF A;  5BV0 A;  4BT9 A;  3L54 A;  3DBS A;  4DK5 A;  1E7V A;  2CG3 A;  5JJ6 A;  2KCV A;  2FEZ A;  3L13 A;  4XZ4 A;  2UY1 B;  2KZT B;  2AXU A;  3RKV A;  3ESK A;  2XHE A;  5E76 A;  3RU0 A;  5BT1 A;  2VYI A;  3G2S A;  2WXG A;  4A1G A;  1OWM A;  2A5U A;  3IBE A;  4B8A A;  2IU1 A;  4I17 A;  1IQR A;  2QY7 A;  4XIF A;  2I2O A;  2P58 C;  3G2T A;  4G11 A;  2WMO A;  3I5P A;  4HOS A;  2J07 A;  3CK7 A;  4RG9 A;  3U64 A;  2A4Z A;  2XCB A;  3UT7 A;  4KZC A;  3Q15 A;  3ML9 A;  4JHJ A;  3LDZ A;  5EKQ D;  3CHM A;  3ZPJ A;  2R5S A;  4UWH A;  1EF1 C;  2E0I A;  4XI9 A;  3GZ2 A;  3LEW A;  3FTV A;  5LCW J;  5D0Q D;  2VSO E;  4LER A;  4EQF A;  1E8W A;  3Q47 B;  3U66 A;  3CVQ A;  3LYA A;  5CCM A;  4KZ0 A;  3SZ7 A;  4A3V A;  4FLH A;  1HO8 A;  1H19 A;  2XPZ A;  1WAO 1;  3DPD A;  3ASG A;  4G25 A;  4GYY A;  3UQ3 A;  4CT0 A;  4I1O B;  3MV3 B;  4WWP A;  4URK A;  3GZS A;  4F3V A;  2UY1 A;  2PZI A;  3CVN A;  4GAA A;  2LSU A;  3GZ1 A;  4XKC A;  2UWJ G;  4UWG A;  2VQ2 A;  4C9B B;  5DIZ A;  5KJM A;  2BF0 X;  3ENE A;  2GW1 A;  2WXI A;  3BEE A;  3FH8 A;  4FUL A;  5FT9 A;  4L7T A;  3KD7 A;  2FBN A;  1BPO A;  2KAT A;  4APF A;  3ZEF A;  3Q5M A;  2OV8 A;  1H2U A;  4A1S A;  2CHX A;  4L23 A;  2WXM A;  1OWO A;  2Y4U A;  5J90 A;  1WY6 A;  2X6I A;  2GRM A;  2CHZ A;  3Q4A B;  3CLJ A;  2XPY A;  2XGO A;  3QK0 A;  4XKB A;  5AYW D;  3VLF A;  4B8C B;  3SNX A;  4JC8 A;  1PAQ A;  4U0U A;  4WWO A;  5A23 A;  1OWN A;  3PRZ A;  3LVQ E;  4N3A A;  4HOT A;  5ARF A;  3S7J A;  4WNF A;  1FCH A;  4AV7 A;  3OXF A;  4JVS A;  3FP3 A;  4D10 C;  2KCL A;  4APO A;  3ZHE B;  1HG2 A;  5JJT A;  2IOL A;  3JQ0 A;  4FC8 A;  4Y6W A;  5A7D B;  4GZD A;  5FQ4 A;  3FEY A;  3B13 A;  3PE3 A;  4GML A;  2FUL A;  4OVV A;  1TJC A;  4GCO A;  1VDY A;  5ANR A;  4GZ6 A;  2M63 A;  2ZU6 B;  3FH5 A;  3PE4 A;  3IHY A;  1HU3 A;  3PS6 A;  5EDS A;  1ZU2 A;  4EBA A;  4AVX A;  3ASD A;  3R9A B;  2WVI A;  4HOQ A;  2MRI A;  4I43 A;  4E6H A;  1UG3 A;  2KCK A;  2OND A;  3CVY A;  5AIJ A;  1QZ2 A;  2NC9 A;  4HVB A;  2YIN A;  1ELR A;  3PH0 C;  2KZT A;  4UI9 K;  3MCX A;  2I9C A;  3JYS A;  4N2S A;  2AXZ A;  3UPV A;  3APF A;  3NZU A;  5G55 A;  3FU3 A;  4DPR A;  2ILR A;  2X6H A;  3FUE A;  5FZQ A;  1E90 A;  3APC A;  3PEU B;  3TJP A;  3FU5 A;  4HLE A;  5JHA A;  3O48 A;  3LKU A;  4ATG A;  1LF8 A;  3UT4 A;  4J8E A;  4I9C A;  3FWV A;  3KEZ A;  2XQ0 A;  1HE8 A;  2WXN A;  3ZHE A;  4LUN U;  4EEC A;  1KT0 A;  4GA1 A;  3SF4 A;  3QDN A;  2VGX A;  4N3C A;  4OVU A;  2C0M A;  4HOR A;  3ZYQ A;  3ML8 A;  1HH8 A;  3EIQ C;  4DJA A;  2L9B A;  5AEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...