4Q6RA

Crystal structure of human sphingosine-1-phosphate lyase in complex with inhibitor 6-[(2r)-4-(4-benzyl-7-chlorophthalazin-1-yl)-2-methylpiperazin-1-yl]pyridine-3-carbonitrile
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
443
structure length
442
Chain Sequence
EYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orally Active 7-Substituted (4-Benzylphthalazin-1-yl)-2-methylpiperazin-1-yl]nicotinonitriles as Active-Site Inhibitors of Sphingosine 1-Phosphate Lyase for the Treatment of Multiple Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
molecule keywords Sphingosine-1-phosphate lyase 1
total genus 144
structure length 442
sequence length 443
chains with identical sequence B
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4q6rA03
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4q6rA02
1D2FA 2VMSA 3NUIA 3FQ7A 3K40A 1M0OA 3KGXA 3TFUA 4MQPA 5IWQA 4OTLA 5AX8A 1ORDA 1WYUA 2JJGA 3DZZA 2W8WA 3I16A 1TARA 3NX3A 1KKPA 1BJWA 1M6SA 3PA9A 1JS6A 1KKJA 2QA3A 2VGUA 4MSOA 1SF2A 3EI5A 4KAMA 1B9HA 4W5KA 3WY7A 3ZRRA 3A9ZA 4RKDA 1ARIA 2C44A 3K28A 1DGEA 3RI6A 1BJ4A 5F9SA 1CL1A 4WYFA 2Z1YA 1N2TA 5D5SA 2VYCA 2Z9XA 1IX6A 4ZWVA 1AICA 3NRAA 1GC0A 3A9XA 3CQ5A 5E5IA 1AHFA 1DFOA 3B1DA 4CXRA 4GE7A 4ZAHA 4A6RA 4ADCA 4A0RA 2CB1A 4P7YA 3CQ4A 3FSLA 3RCHB 2ZP7A 5FT6A 2AY6A 2BI3A 2NMPA 2Z9VA 3GBXA 3GETA 4LNLA 5G4IA 1QIRA 2WK8A 1ASDA 3PJ0A 3N75A 1ASEA 4Y0DA 4ZM4A 4F5JA 1BKGA 4E1OA 4F5LA 3NTJA 1AHYA 4WYGA 4Y0HA 3F0HA 2D64A 3FD0A 3A8UX 1BJOB 5G09A 3H14A 5J8QA 2ZSLA 4WXFA 1LKCA 2EH6A 1S09A 3VAXA 4OBUA 3IHJA 1JS3A 5EQCA 3PIUA 2CINA 4ADBA 4BA4A 2XBNA 4RAEA 1GC2A 5M4BA 1KL1A 2VMTA 3A9YA 1WSTA 4W1WA 3PDBA 4A72A 2D63A 4LNJA 1GDEA 4LC3A 1ZODA 2GSAA 4ATQA 3UE8A 1IJIA 4Q75A 1ASAA 4OBVA 1AHGA 1TPLA 4ZDLA 1PFFA 2W7IA 1GBNA 1OATA 2W7LA 3FVXA 1ZC9A 2VMVA 3LVLB 3WGCA 3ASBA 4K2MA 1W7MA 2QB3A 4IX8A 3USFA 3AEMA 3F6TA 1UU1A 3MC6A 4IXOA 1J32A 3QM2A 2DGKA 2W7EA 3VK2A 1C9CA 1J04A 1MLZA 4AH3A 4EB5A 3JU7A 1KMKA 4FFCA 1ASLA 2EO5A 3BWOA 2V1PA 4OCAA 5EUNA 3HMUA 4WB0B 2CANA 2AY2A 3TCMA 1AMRA 1S07A 2Z61A 1GC4A 1QZ9A 2FN6A 5FT5A 3COGA 3JWBA 3HDOA 1LS3A 1FG7A 2W8UA 4RIZA 4RLGA 5M4DA 2X8UA 3E2ZA 4CBSA 2GB3A 1TOIA 4W8IA 3OP7A 4F5IA 4ISYA 4ZM3A 2GMUA 3QN6A 4A6UA 1G4XA 5G2PA 3FQ8A 3RCHA 1UU2A 1O69A 2R0TA 1I43A 3JW9A 3PD6B 3QPGA 4WBTA 1YJYA 3WKRA 3WZFA 3R9AA 1TOEA 1DTYA 4RM1A 4R5FA 1E5EA 1IBJA 3DXWA 4GDYA 3LVJA 3JZLA 2AEUA 3DYDA 2Z20A 2OGEA 4N0WA 2BWNA 1RVYA 3FFHA 3Q8NA 1XEYA 3AV7A 3HVYA 1LC7A 4GSAA 4ADEA 1CS1A 4RJYA 1V72A 3KGWA 4EMYA 9AATA 1EJIA 2YKVA 1KL2A 1D7RA 1WYVA 2QMAA 3TFTA 1GC3A 4BQ0A 1B9IA 3FVUA 5D95A 2VMUA 3PDXA 1C7NA 2ZYJA 4XJMA 1AHEA 4UHOA 3DR4A 1Y4IA 4F5HA 2YCPA 5LH9A 2W8TA 2AY4A 5DJ1A 5DJ9A 1WYTB 2VMNA 2R5EA 3I5TA 1CJ0A 4IYOB 3VK4A 1IVRA 4LNMA 4R5ZA 3BCAA 1AJRA 2BWPA 4XQ2A 2G6WA 3ZZKA 1VJOA 3K7YA 4PFNA 2OQXA 1X29A 3FZ7A 3E2YA 2AY9A 5EUEA 3B1EA 1M0PA 1DJEA 4AO4A 1CZCA 1JG8A 4XEWA 3DU4A 2XH1A 4HVKA 2VMPA 4XAUA 3BWNA 3BCBA 4W91A 2WK9A 1M32A 3W1HA 4ZSYA 2FQ6A 3GSBA 1X0MA 2AY7A 1M0QA 3LG0A 4IXZA 3W1IA 2YRRA 1ARTA 4FL0A 2OKJA 2VLFA 3MAFB 3TATA 3WGBA 4WP0A 4AZJA 5M46A 3E2ZB 1W3UA 4Q6RA 3EI8A 1BT4A 1LW4A 3AEJC 1YAAA 1H1CA 1DJ9A 1PMMA 4A00A 1YJZA 2VI9A 4UQVA 1VEFA 3N5MA 1ELQA 5FT4A 1WYVB 1O62A 2JJFA 1TOGA 3AOWA 3LVMA 1CL2A 3EZSA 3EIAA 1ASMA 2GQNA 2W7KA 2FYFA 2BIGA 3AEPA 3E9KA 5G2QA 3AEMC 1BS0A 3MC6C 4W1VA 1FG3A 2E54A 2OATA 2W8VA 3FCRA 2C7TA 3ELEA 3FRKA 1GEWA 3ACZA 3QBOA 4XJPA 2QBTA 2VI8A 1V2DA 4ZDPA 4ATPA 1IX8A 4CBRA 4NOGA 1UU0A 1ARSA 4RJ0A 3EZ1A 4JEVA 3G0TA 1GCKA 5BJ4A 2VMYA 1ELUA 3AEJA 1MGVA 2O1BA 1C0NA 1PMOA 2ZUKA 2YKUA 4ITGA 4TN4A 5G4JA 1X28A 1B4XA 2CSTA 2R5CA 3B8XA 3EIBA 1LK9A 2JJEA 2X5FA 4OYTA 1XI9A 3NU7A 1QJ3A 1GEXA 4B9BA 4N0BA 5I92A 1Z3ZA 1RVUA 2VGWA 2VMWA 3ATHA 4E3RA 2W7DA 4M2MA 1LW5A 1RV4A 5E3KA 1IAXA 2BWOA 2OGAA 4ZLVA 1SZUA 3RUYA 1TOKA 3F9TA 2RFVA 2O0RA 4AZKA 3G8MA 1OHYA 1S0AA 2DGMA 2VMOA 1W7LA 2EPJA 1ZOBA 1E5FA 5EFSA 3ZRPA 8AATA 2PO3A 3II0A 2DKJA 2BHXA 3EUCA 3M5UA 3NYUA 1ASCA 1AAMA 1SZSA 2FM1A 4AOAA 5K8BA 2W7FA 4JEXA 1AX4A 3ASAA 1C7GA 1MAPA 1WYTA 1LC8A 3HBXA 3MEBA 4GE9A 2EZ2A 1YJSA 3NUBA 4WD2A 2FNIA 4U2HA 3ZZJA 4ZDOA 3WCOA 1B5OA 1AMAA 1BQAA 1AJSB 4GRXA 1ASFA 4KXKA 2D61A 3HL2A 2HUFA 4O6ZA 1D7SA 4M2KA 1BW0A 1CZEA 3KKIA 4MY5A 2C81A 3JWAA 3AENA 3AENB 1MDZA 4XJLA 2FNUA 4ZASA 4JF1A 1IAYA 4OC9A 2BIEA 3MADA 2JISA 4QGRA 2BI2A 3E6GA 2DOUA 2R2NA 3B46A 1KMJA 3FZ8A 5EUDA 4BMKA 1YOOA 2VMZA 4A6TA 4MKJA 2VMQA 3FDBA 4H51A 1X2AA 1AY8A 2QB2A 4WXGA 5HHYA 1T3IA 2HOYA 3FZ6A 3GWPA 4EB7A 3BV0A 3UAKA 3AOVA 3H7FA 1ECXA 3HT4A 4DBCA 4ITXA 2HOXA 2BI9A 4F5MA 2AY3A 3NDNA 2C0RA 2W7HA 3NYTA 7AATA 3GR9A 2VGSA 3A2BA 2WKAA 4J8LA 3QGUA 4XJOA 3W1JA 1M0NA 3TQXA 3FQAA 1M4NA 1P3WA 1DJUA 3DR7A 4Y0IA 2W7JA 3E2FA 4F4EA 2W8JA 1CQ7A 1C7OA 2EZ1A 3B1CA 3GZDA 5HDMA 5EAVA 1S06A 2EGYA 3BB8A 3VOMA 3NYSA 2WK7A 1AKAA 1G7XA 1WKGA 3I4JA 3T32A 4MQQA 2Z67A 1AJSA 2CY8A 5EAAA 2HP1A 1IUGA 1H0CA 2JGTA 3CQ6A 1D7UA 3EI7A 2PB0A 4OMAA 1AIBA 1QITA 2BIAA 3PPLA 4HF8A 1O61A 2Z9UA 3FKDA 1TATA 2VMXA 1BJNA 3WLXA 2CTZA 4UHMA 1UKJA 3DODA 1VP4A 4UOYA 4J5UA 2AATA 2GMSA 2X3LA 1O4SA 1W7NA 2YKXA 2YRIA 1SZKA 3BCXA 3KE3A 4KYOA 4Q31A 4Q76A 1WKHA 1N8PA 4GEBA 2CJGA 4ADDA 3GZDC 2VGZA 4EFFA 2F8JA 1ARHA 4UHNA 2O7CA 1BJOA 5BJ3A 4U1TA 2D5YA 2YCTA 2BI1A 2Z1ZA 2PB2A 1AMQA 4PFFA 2HOZA 1ASNA 2YHKA 4PIWA 1EQBA 2HZPA 3QHXA 4AO9A 3ISLA 3P1TA 1C4KA 4BA5A 4OT8A 2ZY2A 2ZY3A 1PG8A 1QISA 1RV3A 2HP2A 3PD6A 5G0AA 4JF0A 4W1XA 4ZSWA 4JE5A 2VIAA 4R8DA 4CXQA 4IYOA 4R2NA 1CQ6A 5EIGB 3DXVA 2D66A 2AY8A 3AATA 3ELPA 4MQRA 1MDOA 5F8VA 4A0FA 1N31A 3D6KA 3EI9A 3FTBA 4WYAA 3VK3A 3P6KA 1AIAA 4E3QA 1AKCA 2Q7WA 4WYDA 4WYCA 3DC1A 2HORA 1YNUA 1ARGA 2CFBA 2DGLA 2D7ZA 1AAWA 3PDBB 3BC8A 1OXOA 1D7VA 5C6UA 2W7MA 4I8AA 1M7YA 2YOBA 1MAQA 2AY5A 4MKKA 2D65A 4K2BA 4WB0A 1AKBA 3HQTA 1I29A 1S08A 4P3MA 2BI5A 2E7IA 1YIYA 4JE5D 2ZY5A 1SVVA 1GEYA 5DB5A 1DGDA 2AEVA 4IXSA 5E4ZA 3RBFA 1YIZA 1W23A 4F5FA 1ASBA 1SFFA 5M49A 1AHXA 2E7UA 4LW2A 2HUUA 3FFRA 1QGNA 3FVSA 3GJUA 1AMSA 1FC4A 4WXBA 3E77A 1DKAA 5LHAA 3IF2A 3UWCA 4BHDA 3ZRQA 3BN1A 2YCNA 2R5CB 1I41A 4RKCA 4CVQA 1ASGA 4TV7A 3PGYA 2YKYA 2D7YA 3MAFA 3MAUA 3R4TA 4K2IA 3CAIA 4WLHA 3FDDA 4GE4A 1IX7A 3AELA 1CQ8A 5EIGA 1B8GA 1GD9A 2VMRA 3L44A 3LWSA 2VGVA 2TPLA 3QI6A 3VP6A 1MLYA 4JEWA 3JTXA 1EG5A 1V2EA 3EI6A 3WCNA 5HXXA 1LC5A 1G7WA 4LW4A 5FT8A 2ORDA 4E77A 3GZCA 3RQ1A 4F5GA 4PVFA 1U08A 2V0YA 2W7GA 2QLRA 1V2FA 3MKJA 2BYLA 1OXPA 3WX9A 3MBBA 4M2JA 2CH2A 2HUIA 3CBFA 4DQ6A 2VLHA 3DRDA 4F5KA 4WYEA 3LY1A 2JG2A 4XK1A 4DGTA 1BQDA 4RITA 2ZY4A 2CJDA 1G4VA 5DX5A 1JF9A 4B98A 1WYUB 3LVKA 3AEOA 1TASA 2VGTA 2DR1A 2VIBA 4WLJA 1B5PA 3LV2A 4L0OA 1TOJA 3G7QA 2BKWA 3L8AA 2OKKA 1AY4A 2ZSMA 2BYJA 3WKSA 5JAYA 1AY5A 5TF5A 2JJHA 4EU1A 3RBLA 1SPAA 3OKSA 1OHWA 2AY1A 4JEZA 3ECDA 4MGRA 1OHVA 3PAAA 4TMRA 3BS8A 3NNKA 2ZJGA 2ZC0A 2DKBA 2E7JA 3N0LA 1MDXA 4IY7A 2Z9WA 4JEYA 2CJHA 1I48A 4A0HA 2X5DA 4ZWMA 1Z7DA 1QJ5A 3HLMA 3NU8A 2CH1A 4A0GA 3BWNC 4IW7A
chains in the Genus database with same CATH superfamily
1D2FA 2VMSA 3NUIA 3FQ7A 3K40A 1M0OA 3KGXA 3TFUA 4MQPA 5IWQA 4OTLA 5AX8A 1ORDA 1WYUA 2JJGA 3DZZA 2W8WA 3I16A 1TARA 3NX3A 1KKPA 1BJWA 1M6SA 3PA9A 1JS6A 1KKJA 2QA3A 2VGUA 4MSOA 1SF2A 3EI5A 4KAMA 1B9HA 4W5KA 3WY7A 3ZRRA 3A9ZA 4RKDA 1ARIA 2C44A 3K28A 1DGEA 3RI6A 1BJ4A 5F9SA 1CL1A 4WYFA 2Z1YA 1N2TA 5D5SA 2VYCA 2Z9XA 1IX6A 4ZWVA 1AICA 3NRAA 1GC0A 3A9XA 3CQ5A 5E5IA 1AHFA 1DFOA 3B1DA 4CXRA 4GE7A 4ZAHA 4A6RA 4ADCA 4A0RA 2CB1A 4P7YA 3CQ4A 3FSLA 3RCHB 2ZP7A 5FT6A 2AY6A 2BI3A 2NMPA 2Z9VA 3GBXA 3GETA 4LNLA 5G4IA 1QIRA 2WK8A 1ASDA 3PJ0A 3N75A 1ASEA 4Y0DA 4ZM4A 4F5JA 1BKGA 4E1OA 4F5LA 3NTJA 1AHYA 4WYGA 4Y0HA 3F0HA 2D64A 3FD0A 2A1VA 3N7NA 3A8UX 1BJOB 5G09A 3H14A 5J8QA 2ZSLA 4WXFA 1LKCA 2EH6A 1S09A 3VAXA 4OBUA 3IHJA 1JS3A 5EQCA 3PIUA 2CINA 4ADBA 4BA4A 2XBNA 4RAEA 1GC2A 5M4BA 1KL1A 2VMTA 3A9YA 1WSTA 4W1WA 3PDBA 4A72A 2D63A 4LNJA 1GDEA 4LC3A 1KAFA 1ZODA 2GSAA 4ATQA 2FKIA 3UE8A 1IJIA 4Q75A 1ASAA 4OBVA 1AHGA 1TPLA 4ZDLA 1PFFA 2W7IA 1GBNA 1OATA 2W7LA 3FVXA 1ZC9A 2VMVA 3LVLB 3WGCA 3ASBA 4K2MA 1W7MA 2QB3A 4IX8A 3USFA 3AEMA 3F6TA 1UU1A 3MC6A 4IXOA 1J32A 3QM2A 2DGKA 2W7EA 3VK2A 1C9CA 1J04A 1MLZA 4AH3A 4EB5A 3JU7A 1KMKA 4FFCA 1ASLA 2EO5A 3BWOA 2V1PA 4OCAA 5EUNA 3HMUA 4WB0B 2CANA 2AY2A 3TCMA 1AMRA 1S07A 2Z61A 1GC4A 1QZ9A 2FN6A 5FT5A 3COGA 3JWBA 3HDOA 1LS3A 1FG7A 2W8UA 4RIZA 4RLGA 5M4DA 2X8UA 3E2ZA 4CBSA 2GB3A 1TOIA 4W8IA 3OP7A 4F5IA 4ISYA 4ZM3A 2GMUA 3QN6A 4A6UA 1G4XA 5G2PA 3FQ8A 3RCHA 1UU2A 1O69A 2R0TA 1I43A 3JW9A 3PD6B 3QPGA 4WBTA 1YJYA 3WKRA 3WZFA 3R9AA 1TOEA 1DTYA 4RM1A 4R5FA 1E5EA 1IBJA 3DXWA 4GDYA 3LVJA 3JZLA 2AEUA 3DYDA 2Z20A 2OGEA 4N0WA 2BWNA 1RVYA 3FFHA 3Q8NA 1XEYA 3AV7A 3HVYA 1LC7A 4GSAA 4ADEA 1CS1A 4RJYA 1V72A 3KGWA 4EMYA 9AATA 1EJIA 2YKVA 1KL2A 1D7RA 1WYVA 2QMAA 3TFTA 1GC3A 4BQ0A 1B9IA 3FVUA 5D95A 2VMUA 3PDXA 1C7NA 2ZYJA 4XJMA 1AHEA 4UHOA 3DR4A 1Y4IA 4F5HA 2YCPA 5LH9A 2W8TA 2AY4A 5DJ1A 5DJ9A 1WYTB 2VMNA 2R5EA 3I5TA 1CJ0A 4IYOB 3VK4A 1IVRA 4LNMA 4R5ZA 3BCAA 1AJRA 2BWPA 4XQ2A 2G6WA 3ZZKA 1VJOA 3K7YA 4PFNA 2G7JA 2OQXA 1X29A 3FZ7A 3E2YA 2AY9A 5EUEA 3B1EA 1M0PA 1DJEA 3N4SA 4AO4A 1CZCA 1JG8A 4XEWA 3DU4A 2XH1A 4HVKA 2VMPA 4XAUA 3BWNA 3BCBA 4W91A 2WK9A 1M32A 3W1HA 4ZSYA 2FQ6A 3GSBA 1X0MA 2AY7A 1M0QA 3LG0A 4IXZA 3W1IA 2YRRA 1ARTA 4FL0A 2OKJA 2VLFA 3MAFB 3TATA 3WGBA 4WP0A 4AZJA 5M46A 3E2ZB 1W3UA 4Q6RA 3EI8A 1BT4A 1LW4A 3AEJC 1YAAA 1H1CA 1DJ9A 1PMMA 4A00A 1YJZA 2VI9A 4UQVA 1VEFA 3N5MA 1ELQA 5FT4A 1WYVB 1O62A 2JJFA 1TOGA 3AOWA 3LVMA 1CL2A 3EZSA 3EIAA 2EYQA 1ASMA 2GQNA 2W7KA 2FYFA 2BIGA 3AEPA 3E9KA 5G2QA 3AEMC 1BS0A 3MC6C 4W1VA 1FG3A 2E54A 2OATA 2W8VA 3FCRA 2C7TA 3ELEA 3FRKA 1GEWA 3ACZA 3QBOA 4XJPA 2QBTA 2VI8A 1V2DA 4ZDPA 4ATPA 1IX8A 4CBRA 3N4RA 4NOGA 1UU0A 1ARSA 4RJ0A 3EZ1A 4JEVA 3G0TA 1GCKA 5BJ4A 2VMYA 1ELUA 3AEJA 1MGVA 2O1BA 1C0NA 1PMOA 2ZUKA 2YKUA 4ITGA 4TN4A 5G4JA 1X28A 1B4XA 2CSTA 2R5CA 3B8XA 3EIBA 1LK9A 2JJEA 2X5FA 4OYTA 1XI9A 2QSRA 3NU7A 1QJ3A 1GEXA 4B9BA 4N0BA 5I92A 1Z3ZA 1RVUA 2VGWA 2VMWA 3ATHA 4E3RA 2W7DA 4M2MA 1LW5A 1RV4A 5E3KA 1IAXA 2BWOA 2OGAA 4ZLVA 1SZUA 3RUYA 1TOKA 3F9TA 2RFVA 2O0RA 4AZKA 3G8MA 1OHYA 1S0AA 2DGMA 2VMOA 1W7LA 2EPJA 3H9XA 1ZOBA 1E5FA 5EFSA 3ZRPA 8AATA 2PO3A 3II0A 2DKJA 2BHXA 3EUCA 3M5UA 3NYUA 1ASCA 1AAMA 1SZSA 2FM1A 4AOAA 5K8BA 2W7FA 4JEXA 1AX4A 3ASAA 1C7GA 1MAPA 1WYTA 1LC8A 3HBXA 3MEBA 4GE9A 2EZ2A 1YJSA 3NUBA 4WD2A 2FNIA 4U2HA 3ZZJA 4ZDOA 3WCOA 1B5OA 1AMAA 1BQAA 1AJSB 4GRXA 1ASFA 4KXKA 2D61A 3HL2A 2HUFA 4O6ZA 1D7SA 4M2KA 1BW0A 1CZEA 3KKIA 4MY5A 2C81A 3JWAA 3AENA 3AENB 1MDZA 4XJLA 2FNUA 4ZASA 4JF1A 1IAYA 4OC9A 2BIEA 3MADA 2JISA 4QGRA 2BI2A 3E6GA 2DOUA 2R2NA 3B46A 1KMJA 3FZ8A 5EUDA 4BMKA 1YOOA 2VMZA 4A6TA 4MKJA 2VMQA 3FDBA 4H51A 1X2AA 1AY8A 2QB2A 4WXGA 5HHYA 1T3IA 2HOYA 3FZ6A 3GWPA 4EB7A 3BV0A 2KFPA 3UAKA 3AOVA 3H7FA 1ECXA 3HT4A 4DBCA 4ITXA 2HOXA 2BI9A 4F5MA 2AY3A 3NDNA 2C0RA 4H63Q 2W7HA 3NYTA 7AATA 3GR9A 2VGSA 3A2BA 2WKAA 4J8LA 3QGUA 4XJOA 3W1JA 1M0NA 3TQXA 3FQAA 1M4NA 1P3WA 1DJUA 3DR7A 4Y0IA 2W7JA 3E2FA 4F4EA 2W8JA 1CQ7A 1C7OA 2EZ1A 3B1CA 3GZDA 5HDMA 5EAVA 1S06A 2EGYA 3BB8A 3VOMA 3NYSA 2WK7A 1AKAA 1G7XA 1WKGA 3I4JA 3T32A 4MQQA 2Z67A 1AJSA 2CY8A 5EAAA 2HP1A 1IUGA 1H0CA 2JGTA 3CQ6A 1D7UA 3EI7A 2PB0A 4OMAA 1AIBA 1QITA 2BIAA 3PPLA 4HF8A 1O61A 2Z9UA 3FKDA 1TATA 2VMXA 1BJNA 3WLXA 2CTZA 4UHMA 1UKJA 3DODA 1VP4A 4UOYA 4J5UA 2AATA 2GMSA 2X3LA 1O4SA 1W7NA 2YKXA 2YRIA 1SZKA 3BCXA 3KE3A 4KYOA 4Q31A 5KTBA 4Q76A 3N4XA 1WKHA 1N8PA 4GEBA 2CJGA 4ADDA 3GZDC 2VGZA 4EFFA 2F8JA 1ARHA 4UHNA 2O7CA 1BJOA 5BJ3A 4U1TA 2D5YA 2YCTA 2BI1A 2Z1ZA 2PB2A 1AMQA 4PFFA 2HOZA 1ASNA 2YHKA 4PIWA 1EQBA 2HZPA 3QHXA 4AO9A 3ISLA 3P1TA 1C4KA 4BA5A 4OT8A 2ZY2A 2ZY3A 1PG8A 1QISA 1RV3A 2HP2A 3PD6A 5G0AA 4JF0A 4W1XA 4ZSWA 4JE5A 2VIAA 4R8DA 4CXQA 4IYOA 4R2NA 1CQ6A 5EIGB 3DXVA 2D66A 2AY8A 3AATA 3ELPA 4MQRA 1MDOA 5F8VA 4A0FA 1N31A 3D6KA 3EI9A 3FTBA 4WYAA 3VK3A 3P6KA 1AIAA 4E3QA 1AKCA 2Q7WA 4WYDA 4WYCA 3DC1A 2HORA 1YNUA 1ARGA 2CFBA 2DGLA 2D7ZA 1AAWA 3PDBB 3BC8A 1OXOA 1D7VA 5C6UA 2W7MA 4I8AA 1M7YA 2YOBA 1MAQA 2AY5A 4MKKA 2D65A 4K2BA 4WB0A 1AKBA 3HQTA 1I29A 1S08A 4P3MA 2BI5A 2E7IA 1YIYA 4JE5D 2ZY5A 1SVVA 1GEYA 5DB5A 1DGDA 2AEVA 4IXSA 5E4ZA 3RBFA 1YIZA 1W23A 4F5FA 1ASBA 1SFFA 5M49A 1AHXA 2E7UA 4LW2A 2HUUA 3FFRA 1QGNA 3FVSA 3GJUA 1AMSA 1FC4A 4WXBA 3E77A 1DKAA 5LHAA 3IF2A 3UWCA 4BHDA 3ZRQA 3BN1A 2YCNA 2R5CB 1I41A 4RKCA 4CVQA 1ASGA 4TV7A 3PGYA 2YKYA 2D7YA 3MAFA 3MAUA 3R4TA 4K2IA 3CAIA 4WLHA 3FDDA 4GE4A 1IX7A 3AELA 1CQ8A 5EIGA 1B8GA 1GD9A 2VMRA 3L44A 2WB6A 3LWSA 2VGVA 2TPLA 3QI6A 3VP6A 1MLYA 4JEWA 3JTXA 1EG5A 1V2EA 3EI6A 3WCNA 5HXXA 1LC5A 1G7WA 4LW4A 5FT8A 2ORDA 4E77A 3GZCA 3RQ1A 4F5GA 4PVFA 1U08A 2V0YA 2W7GA 2QLRA 1V2FA 3MKJA 2BYLA 1OXPA 3WX9A 3MBBA 4M2JA 2CH2A 2HUIA 3CBFA 4K05A 4DQ6A 2VLHA 3DRDA 4F5KA 4WYEA 3LY1A 2JG2A 4XK1A 4DGTA 1BQDA 4RITA 2ZY4A 2CJDA 1G4VA 5DX5A 1JF9A 4B98A 1WYUB 3LVKA 3AEOA 1TASA 2VGTA 2DR1A 2VIBA 4WLJA 1B5PA 3LV2A 4L0OA 1TOJA 3G7QA 2BKWA 3L8AA 2OKKA 1AY4A 2ZSMA 2BYJA 3WKSA 5JAYA 1AY5A 5TF5A 2JJHA 4EU1A 3RBLA 1SPAA 3OKSA 1OHWA 2AY1A 4JEZA 3ECDA 4MGRA 1OHVA 3PAAA 4TMRA 3BS8A 3NNKA 2ZJGA 2ZC0A 2DKBA 2E7JA 3N0LA 1MDXA 4IY7A 2Z9WA 4JEYA 2CJHA 1I48A 4A0HA 2X5DA 4ZWMA 1Z7DA 1QJ5A 3HLMA 3NU8A 2CH1A 4A0GA 3BWNC 4IW7A
chains in the Genus database with same CATH topology
1D2FA 2VMSA 3NUIA 3FQ7A 3K40A 1M0OA 3KGXA 3TFUA 4MQPA 5IWQA 4OTLA 5AX8A 1ORDA 1WYUA 2JJGA 3DZZA 2W8WA 3I16A 1TARA 3NX3A 1KKPA 1BJWA 1M6SA 3PA9A 1JS6A 1KKJA 2QA3A 2VGUA 4MSOA 1SF2A 3EI5A 4KAMA 1B9HA 4W5KA 3WY7A 3ZRRA 3A9ZA 4RKDA 1ARIA 2C44A 3K28A 1DGEA 3RI6A 1BJ4A 5F9SA 1CL1A 4WYFA 2Z1YA 1N2TA 5D5SA 2VYCA 2Z9XA 1IX6A 4ZWVA 1AICA 3NRAA 1GC0A 3A9XA 3CQ5A 5E5IA 1AHFA 1DFOA 3B1DA 4CXRA 4GE7A 4ZAHA 4A6RA 4ADCA 4A0RA 2CB1A 4P7YA 3CQ4A 3FSLA 3RCHB 2ZP7A 5FT6A 2AY6A 2BI3A 2NMPA 2Z9VA 3GBXA 3GETA 4LNLA 5G4IA 1QIRA 2WK8A 1ASDA 3PJ0A 3N75A 1ASEA 4Y0DA 4ZM4A 4F5JA 1BKGA 4E1OA 4F5LA 3NTJA 1AHYA 4WYGA 4Y0HA 3F0HA 2D64A 3FD0A 2A1VA 3N7NA 3A8UX 1BJOB 5G09A 3H14A 5J8QA 2ZSLA 4WXFA 1LKCA 2EH6A 1S09A 3VAXA 4OBUA 3IHJA 1JS3A 5EQCA 3PIUA 2CINA 4ADBA 4BA4A 2XBNA 4RAEA 1GC2A 5M4BA 1KL1A 2VMTA 3A9YA 1WSTA 4W1WA 3PDBA 4A72A 2D63A 4LNJA 1GDEA 4LC3A 1ZODA 2GSAA 4ATQA 2FKIA 3UE8A 1IJIA 4Q75A 1ASAA 4OBVA 1AHGA 1TPLA 4ZDLA 1PFFA 2W7IA 1GBNA 1OATA 2W7LA 3FVXA 1ZC9A 2VMVA 3LVLB 3WGCA 3ASBA 4K2MA 1W7MA 2QB3A 4IX8A 3USFA 3AEMA 3F6TA 1UU1A 3MC6A 4IXOA 1J32A 3QM2A 2DGKA 2W7EA 3VK2A 1C9CA 1J04A 1MLZA 4AH3A 4EB5A 3JU7A 1KMKA 4FFCA 1ASLA 2EO5A 3BWOA 2V1PA 4OCAA 5EUNA 3HMUA 4WB0B 2CANA 2AY2A 3TCMA 1AMRA 1S07A 2Z61A 1GC4A 1QZ9A 2FN6A 5FT5A 3COGA 3JWBA 3HDOA 1LS3A 1FG7A 2W8UA 4RIZA 4RLGA 5M4DA 2X8UA 3E2ZA 4CBSA 2GB3A 1TOIA 4W8IA 3OP7A 4F5IA 4ISYA 4ZM3A 2GMUA 3QN6A 4A6UA 1G4XA 5G2PA 3FQ8A 3RCHA 1UU2A 1O69A 2R0TA 1I43A 3JW9A 3PD6B 3QPGA 4WBTA 1YJYA 3WKRA 3WZFA 3R9AA 1TOEA 1DTYA 4RM1A 4R5FA 1E5EA 1IBJA 3DXWA 4GDYA 3LVJA 3JZLA 2AEUA 3DYDA 2Z20A 2OGEA 4N0WA 2BWNA 1RVYA 3FFHA 3Q8NA 1XEYA 3AV7A 3HVYA 1LC7A 4GSAA 4ADEA 1CS1A 4RJYA 1V72A 3KGWA 4EMYA 9AATA 1EJIA 2YKVA 1KL2A 1D7RA 1WYVA 2QMAA 3TFTA 1GC3A 4BQ0A 1B9IA 3FVUA 5D95A 2VMUA 3PDXA 1C7NA 2ZYJA 4XJMA 1AHEA 4UHOA 3DR4A 1Y4IA 4F5HA 2YCPA 5LH9A 2W8TA 2AY4A 5DJ1A 5DJ9A 1WYTB 2VMNA 2R5EA 3I5TA 1CJ0A 4IYOB 3VK4A 1IVRA 4LNMA 4R5ZA 3BCAA 1AJRA 2BWPA 4XQ2A 2G6WA 3ZZKA 1VJOA 3K7YA 4PFNA 2G7JA 2OQXA 1X29A 3FZ7A 3E2YA 2AY9A 5EUEA 3B1EA 1M0PA 1DJEA 3N4SA 4AO4A 1CZCA 1JG8A 4XEWA 3DU4A 2XH1A 4HVKA 2VMPA 4XAUA 3BWNA 3BCBA 4W91A 2WK9A 1M32A 3W1HA 4ZSYA 2FQ6A 3GSBA 1X0MA 2AY7A 1M0QA 3LG0A 4IXZA 3W1IA 2YRRA 1ARTA 4FL0A 2OKJA 2VLFA 3MAFB 3TATA 3WGBA 4WP0A 4AZJA 5M46A 3E2ZB 1W3UA 4Q6RA 3EI8A 1BT4A 1LW4A 3AEJC 1YAAA 1H1CA 1DJ9A 1PMMA 4A00A 1YJZA 2VI9A 4UQVA 1VEFA 3N5MA 1ELQA 5FT4A 1WYVB 1O62A 2JJFA 1TOGA 3AOWA 3LVMA 1CL2A 3EZSA 3EIAA 2EYQA 1ASMA 2GQNA 2W7KA 2FYFA 2BIGA 3AEPA 3E9KA 5G2QA 3AEMC 1BS0A 3MC6C 4W1VA 1FG3A 2E54A 2OATA 2W8VA 3FCRA 2C7TA 3ELEA 3FRKA 1GEWA 3ACZA 3QBOA 4XJPA 2QBTA 2VI8A 1V2DA 4ZDPA 4ATPA 1IX8A 4CBRA 3N4RA 4NOGA 1UU0A 1ARSA 4RJ0A 3EZ1A 4JEVA 3G0TA 1GCKA 5BJ4A 2VMYA 1ELUA 3AEJA 1MGVA 2O1BA 1C0NA 1PMOA 2ZUKA 2YKUA 4ITGA 4TN4A 5G4JA 1X28A 1B4XA 2CSTA 2R5CA 3B8XA 3EIBA 1LK9A 2JJEA 2X5FA 4OYTA 1XI9A 2QSRA 3NU7A 1QJ3A 1GEXA 4B9BA 4N0BA 5I92A 1Z3ZA 1RVUA 2VGWA 2VMWA 3ATHA 4E3RA 2W7DA 4M2MA 1LW5A 1RV4A 5E3KA 1IAXA 2BWOA 2OGAA 4ZLVA 1SZUA 3RUYA 1TOKA 3F9TA 2RFVA 2O0RA 4AZKA 3G8MA 1OHYA 1S0AA 2DGMA 2VMOA 1W7LA 2EPJA 3H9XA 1ZOBA 1E5FA 5EFSA 3ZRPA 8AATA 2PO3A 3II0A 2DKJA 2BHXA 3EUCA 3M5UA 3NYUA 1ASCA 1AAMA 1SZSA 2FM1A 4AOAA 5K8BA 2W7FA 4JEXA 1AX4A 3ASAA 1C7GA 1MAPA 1WYTA 1LC8A 3HBXA 3MEBA 4GE9A 2EZ2A 1YJSA 3NUBA 4WD2A 2FNIA 4U2HA 3ZZJA 4ZDOA 3WCOA 1B5OA 1AMAA 1BQAA 1AJSB 4GRXA 1ASFA 4KXKA 2D61A 3HL2A 2HUFA 4O6ZA 1D7SA 4M2KA 1BW0A 1CZEA 3KKIA 4MY5A 2C81A 3JWAA 3AENA 3AENB 1MDZA 4XJLA 2FNUA 4ZASA 4JF1A 1IAYA 4OC9A 2BIEA 3MADA 2JISA 4QGRA 2BI2A 3E6GA 2DOUA 2R2NA 3B46A 1KMJA 3FZ8A 5EUDA 4BMKA 1YOOA 2VMZA 4A6TA 4MKJA 2VMQA 3FDBA 4H51A 1X2AA 1AY8A 2QB2A 4WXGA 5HHYA 1T3IA 2HOYA 3FZ6A 3GWPA 4EB7A 3BV0A 2KFPA 3UAKA 3AOVA 3H7FA 1ECXA 3HT4A 4DBCA 4ITXA 2HOXA 2BI9A 4F5MA 2AY3A 3NDNA 2C0RA 4H63Q 2W7HA 3NYTA 7AATA 3GR9A 2VGSA 3A2BA 2WKAA 4J8LA 3QGUA 4XJOA 3W1JA 1M0NA 3TQXA 3FQAA 1M4NA 1P3WA 1DJUA 3DR7A 4Y0IA 2W7JA 3E2FA 4F4EA 2W8JA 1CQ7A 1C7OA 2EZ1A 3B1CA 3GZDA 5HDMA 5EAVA 1S06A 2EGYA 3BB8A 3VOMA 3NYSA 2WK7A 1AKAA 1G7XA 1WKGA 3I4JA 3T32A 4MQQA 2Z67A 1AJSA 2CY8A 5EAAA 2HP1A 1IUGA 1H0CA 2JGTA 3CQ6A 1D7UA 3EI7A 2PB0A 4OMAA 1AIBA 1QITA 2BIAA 3PPLA 4HF8A 1O61A 2Z9UA 3FKDA 1TATA 2VMXA 1BJNA 3WLXA 2CTZA 4UHMA 1UKJA 3DODA 1VP4A 4UOYA 4J5UA 2AATA 2GMSA 2X3LA 1O4SA 1W7NA 2YKXA 2YRIA 1SZKA 3BCXA 3KE3A 4KYOA 4Q31A 5KTBA 4Q76A 3N4XA 1WKHA 1N8PA 4GEBA 2CJGA 4ADDA 3GZDC 2VGZA 4EFFA 2F8JA 1ARHA 4UHNA 2O7CA 1BJOA 5BJ3A 4U1TA 2D5YA 2YCTA 2BI1A 2Z1ZA 2PB2A 1AMQA 4PFFA 2HOZA 1ASNA 2YHKA 4PIWA 1EQBA 2HZPA 3QHXA 4AO9A 3ISLA 3P1TA 1C4KA 4BA5A 4OT8A 2ZY2A 2ZY3A 1PG8A 1QISA 1RV3A 2HP2A 3PD6A 5G0AA 4JF0A 4W1XA 4ZSWA 4JE5A 2VIAA 4R8DA 4CXQA 4IYOA 4R2NA 1CQ6A 5EIGB 3DXVA 2D66A 2AY8A 3AATA 3ELPA 4MQRA 1MDOA 5F8VA 4A0FA 1N31A 3D6KA 3EI9A 3FTBA 4WYAA 3VK3A 3P6KA 1AIAA 4E3QA 1AKCA 2Q7WA 4WYDA 4WYCA 3DC1A 2HORA 1YNUA 1ARGA 2CFBA 2DGLA 2D7ZA 1AAWA 3PDBB 3BC8A 1OXOA 1D7VA 5C6UA 2W7MA 4I8AA 1M7YA 2YOBA 1MAQA 2AY5A 4MKKA 2D65A 4K2BA 4WB0A 1AKBA 3HQTA 1I29A 1S08A 4P3MA 2BI5A 2E7IA 1YIYA 4JE5D 2ZY5A 1SVVA 1GEYA 5DB5A 1DGDA 2AEVA 4IXSA 5E4ZA 3RBFA 1YIZA 1W23A 4F5FA 1ASBA 1SFFA 5M49A 1AHXA 2E7UA 4LW2A 2HUUA 3FFRA 1QGNA 3FVSA 3GJUA 1AMSA 1FC4A 4WXBA 3E77A 1DKAA 5LHAA 3IF2A 3UWCA 4BHDA 3ZRQA 3BN1A 2YCNA 2R5CB 1I41A 4RKCA 4CVQA 1ASGA 4TV7A 3PGYA 2YKYA 2D7YA 3MAFA 3MAUA 3R4TA 4K2IA 3CAIA 4WLHA 3FDDA 4GE4A 1IX7A 3AELA 1CQ8A 5EIGA 1B8GA 1GD9A 2VMRA 3L44A 2WB6A 3LWSA 2VGVA 2TPLA 3QI6A 3VP6A 1MLYA 4JEWA 3JTXA 1EG5A 1V2EA 3EI6A 3WCNA 5HXXA 1LC5A 1G7WA 4LW4A 5FT8A 2ORDA 4E77A 3GZCA 3RQ1A 4F5GA 4PVFA 1U08A 2V0YA 2W7GA 2QLRA 1V2FA 3MKJA 2BYLA 1OXPA 3WX9A 3MBBA 4M2JA 2CH2A 2HUIA 3CBFA 4K05A 4DQ6A 2VLHA 3DRDA 4F5KA 4WYEA 3LY1A 2JG2A 4XK1A 4DGTA 1BQDA 4RITA 2ZY4A 2CJDA 1G4VA 5DX5A 1JF9A 4B98A 1WYUB 3LVKA 3AEOA 1TASA 2VGTA 2DR1A 2VIBA 4WLJA 1B5PA 3LV2A 4L0OA 1TOJA 3G7QA 2BKWA 3L8AA 2OKKA 1AY4A 2ZSMA 2BYJA 3WKSA 5JAYA 1AY5A 5TF5A 2JJHA 4EU1A 3RBLA 1SPAA 3OKSA 1OHWA 2AY1A 4JEZA 3ECDA 4MGRA 1OHVA 3PAAA 4TMRA 3BS8A 3NNKA 2ZJGA 2ZC0A 2DKBA 2E7JA 3N0LA 1MDXA 4IY7A 2Z9WA 4JEYA 2CJHA 1I48A 4A0HA 2X5DA 4ZWMA 1Z7DA 1QJ5A 3HLMA 3NU8A 2CH1A 4A0GA 3BWNC 4IW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2F A;  2VMS A;  3NUI A;  3FQ7 A;  3K40 A;  1M0O A;  3KGX A;  3TFU A;  4MQP A;  5IWQ A;  4OTL A;  5AX8 A;  1ORD A;  1WYU A;  2JJG A;  3DZZ A;  2W8W A;  3I16 A;  1TAR A;  3NX3 A;  1KKP A;  1BJW A;  1M6S A;  3PA9 A;  1JS6 A;  1KKJ A;  2QA3 A;  2VGU A;  4MSO A;  1SF2 A;  3EI5 A;  4KAM A;  1B9H A;  4W5K A;  3WY7 A;  3ZRR A;  3A9Z A;  4RKD A;  1ARI A;  2C44 A;  3K28 A;  1DGE A;  3RI6 A;  1BJ4 A;  5F9S A;  1CL1 A;  4WYF A;  2Z1Y A;  1N2T A;  5D5S A;  2VYC A;  2Z9X A;  1IX6 A;  4ZWV A;  1AIC A;  3NRA A;  1GC0 A;  3A9X A;  3CQ5 A;  5E5I A;  1AHF A;  1DFO A;  3B1D A;  4CXR A;  4GE7 A;  4ZAH A;  4A6R A;  4ADC A;  4A0R A;  2CB1 A;  4P7Y A;  3CQ4 A;  3FSL A;  3RCH B;  2ZP7 A;  5FT6 A;  2AY6 A;  2BI3 A;  2NMP A;  2Z9V A;  3GBX A;  3GET A;  4LNL A;  5G4I A;  1QIR A;  2WK8 A;  1ASD A;  3PJ0 A;  3N75 A;  1ASE A;  4Y0D A;  4ZM4 A;  4F5J A;  1BKG A;  4E1O A;  4F5L A;  3NTJ A;  1AHY A;  4WYG A;  4Y0H A;  3F0H A;  2D64 A;  3FD0 A;  3A8U X;  1BJO B;  5G09 A;  3H14 A;  5J8Q A;  2ZSL A;  4WXF A;  1LKC A;  2EH6 A;  1S09 A;  3VAX A;  4OBU A;  3IHJ A;  1JS3 A;  5EQC A;  3PIU A;  2CIN A;  4ADB A;  4BA4 A;  2XBN A;  4RAE A;  1GC2 A;  5M4B A;  1KL1 A;  2VMT A;  3A9Y A;  1WST A;  4W1W A;  3PDB A;  4A72 A;  2D63 A;  4LNJ A;  1GDE A;  4LC3 A;  1ZOD A;  2GSA A;  4ATQ A;  3UE8 A;  1IJI A;  4Q75 A;  1ASA A;  4OBV A;  1AHG A;  1TPL A;  4ZDL A;  1PFF A;  2W7I A;  1GBN A;  1OAT A;  2W7L A;  3FVX A;  1ZC9 A;  2VMV A;  3LVL B;  3WGC A;  3ASB A;  4K2M A;  1W7M A;  2QB3 A;  4IX8 A;  3USF A;  3AEM A;  3F6T A;  1UU1 A;  3MC6 A;  4IXO A;  1J32 A;  3QM2 A;  2DGK A;  2W7E A;  3VK2 A;  1C9C A;  1J04 A;  1MLZ A;  4AH3 A;  4EB5 A;  3JU7 A;  1KMK A;  4FFC A;  1ASL A;  2EO5 A;  3BWO A;  2V1P A;  4OCA A;  5EUN A;  3HMU A;  4WB0 B;  2CAN A;  2AY2 A;  3TCM A;  1AMR A;  1S07 A;  2Z61 A;  1GC4 A;  1QZ9 A;  2FN6 A;  5FT5 A;  3COG A;  3JWB A;  3HDO A;  1LS3 A;  1FG7 A;  2W8U A;  4RIZ A;  4RLG A;  5M4D A;  2X8U A;  3E2Z A;  4CBS A;  2GB3 A;  1TOI A;  4W8I A;  3OP7 A;  4F5I A;  4ISY A;  4ZM3 A;  2GMU A;  3QN6 A;  4A6U A;  1G4X A;  5G2P A;  3FQ8 A;  3RCH A;  1UU2 A;  1O69 A;  2R0T A;  1I43 A;  3JW9 A;  3PD6 B;  3QPG A;  4WBT A;  1YJY A;  3WKR A;  3WZF A;  3R9A A;  1TOE A;  1DTY A;  4RM1 A;  4R5F A;  1E5E A;  1IBJ A;  3DXW A;  4GDY A;  3LVJ A;  3JZL A;  2AEU A;  3DYD A;  2Z20 A;  2OGE A;  4N0W A;  2BWN A;  1RVY A;  3FFH A;  3Q8N A;  1XEY A;  3AV7 A;  3HVY A;  1LC7 A;  4GSA A;  4ADE A;  1CS1 A;  4RJY A;  1V72 A;  3KGW A;  4EMY A;  9AAT A;  1EJI A;  2YKV A;  1KL2 A;  1D7R A;  1WYV A;  2QMA A;  3TFT A;  1GC3 A;  4BQ0 A;  1B9I A;  3FVU A;  5D95 A;  2VMU A;  3PDX A;  1C7N A;  2ZYJ A;  4XJM A;  1AHE A;  4UHO A;  3DR4 A;  1Y4I A;  4F5H A;  2YCP A;  5LH9 A;  2W8T A;  2AY4 A;  5DJ1 A;  5DJ9 A;  1WYT B;  2VMN A;  2R5E A;  3I5T A;  1CJ0 A;  4IYO B;  3VK4 A;  1IVR A;  4LNM A;  4R5Z A;  3BCA A;  1AJR A;  2BWP A;  4XQ2 A;  2G6W A;  3ZZK A;  1VJO A;  3K7Y A;  4PFN A;  2OQX A;  1X29 A;  3FZ7 A;  3E2Y A;  2AY9 A;  5EUE A;  3B1E A;  1M0P A;  1DJE A;  4AO4 A;  1CZC A;  1JG8 A;  4XEW A;  3DU4 A;  2XH1 A;  4HVK A;  2VMP A;  4XAU A;  3BWN A;  3BCB A;  4W91 A;  2WK9 A;  1M32 A;  3W1H A;  4ZSY A;  2FQ6 A;  3GSB A;  1X0M A;  2AY7 A;  1M0Q A;  3LG0 A;  4IXZ A;  3W1I A;  2YRR A;  1ART A;  4FL0 A;  2OKJ A;  2VLF A;  3MAF B;  3TAT A;  3WGB A;  4WP0 A;  4AZJ A;  5M46 A;  3E2Z B;  1W3U A;  4Q6R A;  3EI8 A;  1BT4 A;  1LW4 A;  3AEJ C;  1YAA A;  1H1C A;  1DJ9 A;  1PMM A;  4A00 A;  1YJZ A;  2VI9 A;  4UQV A;  1VEF A;  3N5M A;  1ELQ A;  5FT4 A;  1WYV B;  1O62 A;  2JJF A;  1TOG A;  3AOW A;  3LVM A;  1CL2 A;  3EZS A;  3EIA A;  1ASM A;  2GQN A;  2W7K A;  2FYF A;  2BIG A;  3AEP A;  3E9K A;  5G2Q A;  3AEM C;  1BS0 A;  3MC6 C;  4W1V A;  1FG3 A;  2E54 A;  2OAT A;  2W8V A;  3FCR A;  2C7T A;  3ELE A;  3FRK A;  1GEW A;  3ACZ A;  3QBO A;  4XJP A;  2QBT A;  2VI8 A;  1V2D A;  4ZDP A;  4ATP A;  1IX8 A;  4CBR A;  4NOG A;  1UU0 A;  1ARS A;  4RJ0 A;  3EZ1 A;  4JEV A;  3G0T A;  1GCK A;  5BJ4 A;  2VMY A;  1ELU A;  3AEJ A;  1MGV A;  2O1B A;  1C0N A;  1PMO A;  2ZUK A;  2YKU A;  4ITG A;  4TN4 A;  5G4J A;  1X28 A;  1B4X A;  2CST A;  2R5C A;  3B8X A;  3EIB A;  1LK9 A;  2JJE A;  2X5F A;  4OYT A;  1XI9 A;  3NU7 A;  1QJ3 A;  1GEX A;  4B9B A;  4N0B A;  5I92 A;  1Z3Z A;  1RVU A;  2VGW A;  2VMW A;  3ATH A;  4E3R A;  2W7D A;  4M2M A;  1LW5 A;  1RV4 A;  5E3K A;  1IAX A;  2BWO A;  2OGA A;  4ZLV A;  1SZU A;  3RUY A;  1TOK A;  3F9T A;  2RFV A;  2O0R A;  4AZK A;  3G8M A;  1OHY A;  1S0A A;  2DGM A;  2VMO A;  1W7L A;  2EPJ A;  1ZOB A;  1E5F A;  5EFS A;  3ZRP A;  8AAT A;  2PO3 A;  3II0 A;  2DKJ A;  2BHX A;  3EUC A;  3M5U A;  3NYU A;  1ASC A;  1AAM A;  1SZS A;  2FM1 A;  4AOA A;  5K8B A;  2W7F A;  4JEX A;  1AX4 A;  3ASA A;  1C7G A;  1MAP A;  1WYT A;  1LC8 A;  3HBX A;  3MEB A;  4GE9 A;  2EZ2 A;  1YJS A;  3NUB A;  4WD2 A;  2FNI A;  4U2H A;  3ZZJ A;  4ZDO A;  3WCO A;  1B5O A;  1AMA A;  1BQA A;  1AJS B;  4GRX A;  1ASF A;  4KXK A;  2D61 A;  3HL2 A;  2HUF A;  4O6Z A;  1D7S A;  4M2K A;  1BW0 A;  1CZE A;  3KKI A;  4MY5 A;  2C81 A;  3JWA A;  3AEN A;  3AEN B;  1MDZ A;  4XJL A;  2FNU A;  4ZAS A;  4JF1 A;  1IAY A;  4OC9 A;  2BIE A;  3MAD A;  2JIS A;  4QGR A;  2BI2 A;  3E6G A;  2DOU A;  2R2N A;  3B46 A;  1KMJ A;  3FZ8 A;  5EUD A;  4BMK A;  1YOO A;  2VMZ A;  4A6T A;  4MKJ A;  2VMQ A;  3FDB A;  4H51 A;  1X2A A;  1AY8 A;  2QB2 A;  4WXG A;  5HHY A;  1T3I A;  2HOY A;  3FZ6 A;  3GWP A;  4EB7 A;  3BV0 A;  3UAK A;  3AOV A;  3H7F A;  1ECX A;  3HT4 A;  4DBC A;  4ITX A;  2HOX A;  2BI9 A;  4F5M A;  2AY3 A;  3NDN A;  2C0R A;  2W7H A;  3NYT A;  7AAT A;  3GR9 A;  2VGS A;  3A2B A;  2WKA A;  4J8L A;  3QGU A;  4XJO A;  3W1J A;  1M0N A;  3TQX A;  3FQA A;  1M4N A;  1P3W A;  1DJU A;  3DR7 A;  4Y0I A;  2W7J A;  3E2F A;  4F4E A;  2W8J A;  1CQ7 A;  1C7O A;  2EZ1 A;  3B1C A;  3GZD A;  5HDM A;  5EAV A;  1S06 A;  2EGY A;  3BB8 A;  3VOM A;  3NYS A;  2WK7 A;  1AKA A;  1G7X A;  1WKG A;  3I4J A;  3T32 A;  4MQQ A;  2Z67 A;  1AJS A;  2CY8 A;  5EAA A;  2HP1 A;  1IUG A;  1H0C A;  2JGT A;  3CQ6 A;  1D7U A;  3EI7 A;  2PB0 A;  4OMA A;  1AIB A;  1QIT A;  2BIA A;  3PPL A;  4HF8 A;  1O61 A;  2Z9U A;  3FKD A;  1TAT A;  2VMX A;  1BJN A;  3WLX A;  2CTZ A;  4UHM A;  1UKJ A;  3DOD A;  1VP4 A;  4UOY A;  4J5U A;  2AAT A;  2GMS A;  2X3L A;  1O4S A;  1W7N A;  2YKX A;  2YRI A;  1SZK A;  3BCX A;  3KE3 A;  4KYO A;  4Q31 A;  4Q76 A;  1WKH A;  1N8P A;  4GEB A;  2CJG A;  4ADD A;  3GZD C;  2VGZ A;  4EFF A;  2F8J A;  1ARH A;  4UHN A;  2O7C A;  1BJO A;  5BJ3 A;  4U1T A;  2D5Y A;  2YCT A;  2BI1 A;  2Z1Z A;  2PB2 A;  1AMQ A;  4PFF A;  2HOZ A;  1ASN A;  2YHK A;  4PIW A;  1EQB A;  2HZP A;  3QHX A;  4AO9 A;  3ISL A;  3P1T A;  1C4K A;  4BA5 A;  4OT8 A;  2ZY2 A;  2ZY3 A;  1PG8 A;  1QIS A;  1RV3 A;  2HP2 A;  3PD6 A;  5G0A A;  4JF0 A;  4W1X A;  4ZSW A;  4JE5 A;  2VIA A;  4R8D A;  4CXQ A;  4IYO A;  4R2N A;  1CQ6 A;  5EIG B;  3DXV A;  2D66 A;  2AY8 A;  3AAT A;  3ELP A;  4MQR A;  1MDO A;  5F8V A;  4A0F A;  1N31 A;  3D6K A;  3EI9 A;  3FTB A;  4WYA A;  3VK3 A;  3P6K A;  1AIA A;  4E3Q A;  1AKC A;  2Q7W A;  4WYD A;  4WYC A;  3DC1 A;  2HOR A;  1YNU A;  1ARG A;  2CFB A;  2DGL A;  2D7Z A;  1AAW A;  3PDB B;  3BC8 A;  1OXO A;  1D7V A;  5C6U A;  2W7M A;  4I8A A;  1M7Y A;  2YOB A;  1MAQ A;  2AY5 A;  4MKK A;  2D65 A;  4K2B A;  4WB0 A;  1AKB A;  3HQT A;  1I29 A;  1S08 A;  4P3M A;  2BI5 A;  2E7I A;  1YIY A;  4JE5 D;  2ZY5 A;  1SVV A;  1GEY A;  5DB5 A;  1DGD A;  2AEV A;  4IXS A;  5E4Z A;  3RBF A;  1YIZ A;  1W23 A;  4F5F A;  1ASB A;  1SFF A;  5M49 A;  1AHX A;  2E7U A;  4LW2 A;  2HUU A;  3FFR A;  1QGN A;  3FVS A;  3GJU A;  1AMS A;  1FC4 A;  4WXB A;  3E77 A;  1DKA A;  5LHA A;  3IF2 A;  3UWC A;  4BHD A;  3ZRQ A;  3BN1 A;  2YCN A;  2R5C B;  1I41 A;  4RKC A;  4CVQ A;  1ASG A;  4TV7 A;  3PGY A;  2YKY A;  2D7Y A;  3MAF A;  3MAU A;  3R4T A;  4K2I A;  3CAI A;  4WLH A;  3FDD A;  4GE4 A;  1IX7 A;  3AEL A;  1CQ8 A;  5EIG A;  1B8G A;  1GD9 A;  2VMR A;  3L44 A;  3LWS A;  2VGV A;  2TPL A;  3QI6 A;  3VP6 A;  1MLY A;  4JEW A;  3JTX A;  1EG5 A;  1V2E A;  3EI6 A;  3WCN A;  5HXX A;  1LC5 A;  1G7W A;  4LW4 A;  5FT8 A;  2ORD A;  4E77 A;  3GZC A;  3RQ1 A;  4F5G A;  4PVF A;  1U08 A;  2V0Y A;  2W7G A;  2QLR A;  1V2F A;  3MKJ A;  2BYL A;  1OXP A;  3WX9 A;  3MBB A;  4M2J A;  2CH2 A;  2HUI A;  3CBF A;  4DQ6 A;  2VLH A;  3DRD A;  4F5K A;  4WYE A;  3LY1 A;  2JG2 A;  4XK1 A;  4DGT A;  1BQD A;  4RIT A;  2ZY4 A;  2CJD A;  1G4V A;  5DX5 A;  1JF9 A;  4B98 A;  1WYU B;  3LVK A;  3AEO A;  1TAS A;  2VGT A;  2DR1 A;  2VIB A;  4WLJ A;  1B5P A;  3LV2 A;  4L0O A;  1TOJ A;  3G7Q A;  2BKW A;  3L8A A;  2OKK A;  1AY4 A;  2ZSM A;  2BYJ A;  3WKS A;  5JAY A;  1AY5 A;  5TF5 A;  2JJH A;  4EU1 A;  3RBL A;  1SPA A;  3OKS A;  1OHW A;  2AY1 A;  4JEZ A;  3ECD A;  4MGR A;  1OHV A;  3PAA A;  4TMR A;  3BS8 A;  3NNK A;  2ZJG A;  2ZC0 A;  2DKB A;  2E7J A;  3N0L A;  1MDX A;  4IY7 A;  2Z9W A;  4JEY A;  2CJH A;  1I48 A;  4A0H A;  2X5D A;  4ZWM A;  1Z7D A;  1QJ5 A;  3HLM A;  3NU8 A;  2CH1 A;  4A0G A;  3BWN C;  4IW7 A; 
#chains in the Genus database with same CATH topology
 1D2F A;  2VMS A;  3NUI A;  3FQ7 A;  3K40 A;  1M0O A;  3KGX A;  3TFU A;  4MQP A;  5IWQ A;  4OTL A;  5AX8 A;  1ORD A;  1WYU A;  2JJG A;  3DZZ A;  2W8W A;  3I16 A;  1TAR A;  3NX3 A;  1KKP A;  1BJW A;  1M6S A;  3PA9 A;  1JS6 A;  1KKJ A;  2QA3 A;  2VGU A;  4MSO A;  1SF2 A;  3EI5 A;  4KAM A;  1B9H A;  4W5K A;  3WY7 A;  3ZRR A;  3A9Z A;  4RKD A;  1ARI A;  2C44 A;  3K28 A;  1DGE A;  3RI6 A;  1BJ4 A;  5F9S A;  1CL1 A;  4WYF A;  2Z1Y A;  1N2T A;  5D5S A;  2VYC A;  2Z9X A;  1IX6 A;  4ZWV A;  1AIC A;  3NRA A;  1GC0 A;  3A9X A;  3CQ5 A;  5E5I A;  1AHF A;  1DFO A;  3B1D A;  4CXR A;  4GE7 A;  4ZAH A;  4A6R A;  4ADC A;  4A0R A;  2CB1 A;  4P7Y A;  3CQ4 A;  3FSL A;  3RCH B;  2ZP7 A;  5FT6 A;  2AY6 A;  2BI3 A;  2NMP A;  2Z9V A;  3GBX A;  3GET A;  4LNL A;  5G4I A;  1QIR A;  2WK8 A;  1ASD A;  3PJ0 A;  3N75 A;  1ASE A;  4Y0D A;  4ZM4 A;  4F5J A;  1BKG A;  4E1O A;  4F5L A;  3NTJ A;  1AHY A;  4WYG A;  4Y0H A;  3F0H A;  2D64 A;  3FD0 A;  2A1V A;  3N7N A;  3A8U X;  1BJO B;  5G09 A;  3H14 A;  5J8Q A;  2ZSL A;  4WXF A;  1LKC A;  2EH6 A;  1S09 A;  3VAX A;  4OBU A;  3IHJ A;  1JS3 A;  5EQC A;  3PIU A;  2CIN A;  4ADB A;  4BA4 A;  2XBN A;  4RAE A;  1GC2 A;  5M4B A;  1KL1 A;  2VMT A;  3A9Y A;  1WST A;  4W1W A;  3PDB A;  4A72 A;  2D63 A;  4LNJ A;  1GDE A;  4LC3 A;  1KAF A;  1ZOD A;  2GSA A;  4ATQ A;  2FKI A;  3UE8 A;  1IJI A;  4Q75 A;  1ASA A;  4OBV A;  1AHG A;  1TPL A;  4ZDL A;  1PFF A;  2W7I A;  1GBN A;  1OAT A;  2W7L A;  3FVX A;  1ZC9 A;  2VMV A;  3LVL B;  3WGC A;  3ASB A;  4K2M A;  1W7M A;  2QB3 A;  4IX8 A;  3USF A;  3AEM A;  3F6T A;  1UU1 A;  3MC6 A;  4IXO A;  1J32 A;  3QM2 A;  2DGK A;  2W7E A;  3VK2 A;  1C9C A;  1J04 A;  1MLZ A;  4AH3 A;  4EB5 A;  3JU7 A;  1KMK A;  4FFC A;  1ASL A;  2EO5 A;  3BWO A;  2V1P A;  4OCA A;  5EUN A;  3HMU A;  4WB0 B;  2CAN A;  2AY2 A;  3TCM A;  1AMR A;  1S07 A;  2Z61 A;  1GC4 A;  1QZ9 A;  2FN6 A;  5FT5 A;  3COG A;  3JWB A;  3HDO A;  1LS3 A;  1FG7 A;  2W8U A;  4RIZ A;  4RLG A;  5M4D A;  2X8U A;  3E2Z A;  4CBS A;  2GB3 A;  1TOI A;  4W8I A;  3OP7 A;  4F5I A;  4ISY A;  4ZM3 A;  2GMU A;  3QN6 A;  4A6U A;  1G4X A;  5G2P A;  3FQ8 A;  3RCH A;  1UU2 A;  1O69 A;  2R0T A;  1I43 A;  3JW9 A;  3PD6 B;  3QPG A;  4WBT A;  1YJY A;  3WKR A;  3WZF A;  3R9A A;  1TOE A;  1DTY A;  4RM1 A;  4R5F A;  1E5E A;  1IBJ A;  3DXW A;  4GDY A;  3LVJ A;  3JZL A;  2AEU A;  3DYD A;  2Z20 A;  2OGE A;  4N0W A;  2BWN A;  1RVY A;  3FFH A;  3Q8N A;  1XEY A;  3AV7 A;  3HVY A;  1LC7 A;  4GSA A;  4ADE A;  1CS1 A;  4RJY A;  1V72 A;  3KGW A;  4EMY A;  9AAT A;  1EJI A;  2YKV A;  1KL2 A;  1D7R A;  1WYV A;  2QMA A;  3TFT A;  1GC3 A;  4BQ0 A;  1B9I A;  3FVU A;  5D95 A;  2VMU A;  3PDX A;  1C7N A;  2ZYJ A;  4XJM A;  1AHE A;  4UHO A;  3DR4 A;  1Y4I A;  4F5H A;  2YCP A;  5LH9 A;  2W8T A;  2AY4 A;  5DJ1 A;  5DJ9 A;  1WYT B;  2VMN A;  2R5E A;  3I5T A;  1CJ0 A;  4IYO B;  3VK4 A;  1IVR A;  4LNM A;  4R5Z A;  3BCA A;  1AJR A;  2BWP A;  4XQ2 A;  2G6W A;  3ZZK A;  1VJO A;  3K7Y A;  4PFN A;  2G7J A;  2OQX A;  1X29 A;  3FZ7 A;  3E2Y A;  2AY9 A;  5EUE A;  3B1E A;  1M0P A;  1DJE A;  3N4S A;  4AO4 A;  1CZC A;  1JG8 A;  4XEW A;  3DU4 A;  2XH1 A;  4HVK A;  2VMP A;  4XAU A;  3BWN A;  3BCB A;  4W91 A;  2WK9 A;  1M32 A;  3W1H A;  4ZSY A;  2FQ6 A;  3GSB A;  1X0M A;  2AY7 A;  1M0Q A;  3LG0 A;  4IXZ A;  3W1I A;  2YRR A;  1ART A;  4FL0 A;  2OKJ A;  2VLF A;  3MAF B;  3TAT A;  3WGB A;  4WP0 A;  4AZJ A;  5M46 A;  3E2Z B;  1W3U A;  4Q6R A;  3EI8 A;  1BT4 A;  1LW4 A;  3AEJ C;  1YAA A;  1H1C A;  1DJ9 A;  1PMM A;  4A00 A;  1YJZ A;  2VI9 A;  4UQV A;  1VEF A;  3N5M A;  1ELQ A;  5FT4 A;  1WYV B;  1O62 A;  2JJF A;  1TOG A;  3AOW A;  3LVM A;  1CL2 A;  3EZS A;  3EIA A;  2EYQ A;  1ASM A;  2GQN A;  2W7K A;  2FYF A;  2BIG A;  3AEP A;  3E9K A;  5G2Q A;  3AEM C;  1BS0 A;  3MC6 C;  4W1V A;  1FG3 A;  2E54 A;  2OAT A;  2W8V A;  3FCR A;  2C7T A;  3ELE A;  3FRK A;  1GEW A;  3ACZ A;  3QBO A;  4XJP A;  2QBT A;  2VI8 A;  1V2D A;  4ZDP A;  4ATP A;  1IX8 A;  4CBR A;  3N4R A;  4NOG A;  1UU0 A;  1ARS A;  4RJ0 A;  3EZ1 A;  4JEV A;  3G0T A;  1GCK A;  5BJ4 A;  2VMY A;  1ELU A;  3AEJ A;  1MGV A;  2O1B A;  1C0N A;  1PMO A;  2ZUK A;  2YKU A;  4ITG A;  4TN4 A;  5G4J A;  1X28 A;  1B4X A;  2CST A;  2R5C A;  3B8X A;  3EIB A;  1LK9 A;  2JJE A;  2X5F A;  4OYT A;  1XI9 A;  2QSR A;  3NU7 A;  1QJ3 A;  1GEX A;  4B9B A;  4N0B A;  5I92 A;  1Z3Z A;  1RVU A;  2VGW A;  2VMW A;  3ATH A;  4E3R A;  2W7D A;  4M2M A;  1LW5 A;  1RV4 A;  5E3K A;  1IAX A;  2BWO A;  2OGA A;  4ZLV A;  1SZU A;  3RUY A;  1TOK A;  3F9T A;  2RFV A;  2O0R A;  4AZK A;  3G8M A;  1OHY A;  1S0A A;  2DGM A;  2VMO A;  1W7L A;  2EPJ A;  3H9X A;  1ZOB A;  1E5F A;  5EFS A;  3ZRP A;  8AAT A;  2PO3 A;  3II0 A;  2DKJ A;  2BHX A;  3EUC A;  3M5U A;  3NYU A;  1ASC A;  1AAM A;  1SZS A;  2FM1 A;  4AOA A;  5K8B A;  2W7F A;  4JEX A;  1AX4 A;  3ASA A;  1C7G A;  1MAP A;  1WYT A;  1LC8 A;  3HBX A;  3MEB A;  4GE9 A;  2EZ2 A;  1YJS A;  3NUB A;  4WD2 A;  2FNI A;  4U2H A;  3ZZJ A;  4ZDO A;  3WCO A;  1B5O A;  1AMA A;  1BQA A;  1AJS B;  4GRX A;  1ASF A;  4KXK A;  2D61 A;  3HL2 A;  2HUF A;  4O6Z A;  1D7S A;  4M2K A;  1BW0 A;  1CZE A;  3KKI A;  4MY5 A;  2C81 A;  3JWA A;  3AEN A;  3AEN B;  1MDZ A;  4XJL A;  2FNU A;  4ZAS A;  4JF1 A;  1IAY A;  4OC9 A;  2BIE A;  3MAD A;  2JIS A;  4QGR A;  2BI2 A;  3E6G A;  2DOU A;  2R2N A;  3B46 A;  1KMJ A;  3FZ8 A;  5EUD A;  4BMK A;  1YOO A;  2VMZ A;  4A6T A;  4MKJ A;  2VMQ A;  3FDB A;  4H51 A;  1X2A A;  1AY8 A;  2QB2 A;  4WXG A;  5HHY A;  1T3I A;  2HOY A;  3FZ6 A;  3GWP A;  4EB7 A;  3BV0 A;  2KFP A;  3UAK A;  3AOV A;  3H7F A;  1ECX A;  3HT4 A;  4DBC A;  4ITX A;  2HOX A;  2BI9 A;  4F5M A;  2AY3 A;  3NDN A;  2C0R A;  4H63 Q;  2W7H A;  3NYT A;  7AAT A;  3GR9 A;  2VGS A;  3A2B A;  2WKA A;  4J8L A;  3QGU A;  4XJO A;  3W1J A;  1M0N A;  3TQX A;  3FQA A;  1M4N A;  1P3W A;  1DJU A;  3DR7 A;  4Y0I A;  2W7J A;  3E2F A;  4F4E A;  2W8J A;  1CQ7 A;  1C7O A;  2EZ1 A;  3B1C A;  3GZD A;  5HDM A;  5EAV A;  1S06 A;  2EGY A;  3BB8 A;  3VOM A;  3NYS A;  2WK7 A;  1AKA A;  1G7X A;  1WKG A;  3I4J A;  3T32 A;  4MQQ A;  2Z67 A;  1AJS A;  2CY8 A;  5EAA A;  2HP1 A;  1IUG A;  1H0C A;  2JGT A;  3CQ6 A;  1D7U A;  3EI7 A;  2PB0 A;  4OMA A;  1AIB A;  1QIT A;  2BIA A;  3PPL A;  4HF8 A;  1O61 A;  2Z9U A;  3FKD A;  1TAT A;  2VMX A;  1BJN A;  3WLX A;  2CTZ A;  4UHM A;  1UKJ A;  3DOD A;  1VP4 A;  4UOY A;  4J5U A;  2AAT A;  2GMS A;  2X3L A;  1O4S A;  1W7N A;  2YKX A;  2YRI A;  1SZK A;  3BCX A;  3KE3 A;  4KYO A;  4Q31 A;  5KTB A;  4Q76 A;  3N4X A;  1WKH A;  1N8P A;  4GEB A;  2CJG A;  4ADD A;  3GZD C;  2VGZ A;  4EFF A;  2F8J A;  1ARH A;  4UHN A;  2O7C A;  1BJO A;  5BJ3 A;  4U1T A;  2D5Y A;  2YCT A;  2BI1 A;  2Z1Z A;  2PB2 A;  1AMQ A;  4PFF A;  2HOZ A;  1ASN A;  2YHK A;  4PIW A;  1EQB A;  2HZP A;  3QHX A;  4AO9 A;  3ISL A;  3P1T A;  1C4K A;  4BA5 A;  4OT8 A;  2ZY2 A;  2ZY3 A;  1PG8 A;  1QIS A;  1RV3 A;  2HP2 A;  3PD6 A;  5G0A A;  4JF0 A;  4W1X A;  4ZSW A;  4JE5 A;  2VIA A;  4R8D A;  4CXQ A;  4IYO A;  4R2N A;  1CQ6 A;  5EIG B;  3DXV A;  2D66 A;  2AY8 A;  3AAT A;  3ELP A;  4MQR A;  1MDO A;  5F8V A;  4A0F A;  1N31 A;  3D6K A;  3EI9 A;  3FTB A;  4WYA A;  3VK3 A;  3P6K A;  1AIA A;  4E3Q A;  1AKC A;  2Q7W A;  4WYD A;  4WYC A;  3DC1 A;  2HOR A;  1YNU A;  1ARG A;  2CFB A;  2DGL A;  2D7Z A;  1AAW A;  3PDB B;  3BC8 A;  1OXO A;  1D7V A;  5C6U A;  2W7M A;  4I8A A;  1M7Y A;  2YOB A;  1MAQ A;  2AY5 A;  4MKK A;  2D65 A;  4K2B A;  4WB0 A;  1AKB A;  3HQT A;  1I29 A;  1S08 A;  4P3M A;  2BI5 A;  2E7I A;  1YIY A;  4JE5 D;  2ZY5 A;  1SVV A;  1GEY A;  5DB5 A;  1DGD A;  2AEV A;  4IXS A;  5E4Z A;  3RBF A;  1YIZ A;  1W23 A;  4F5F A;  1ASB A;  1SFF A;  5M49 A;  1AHX A;  2E7U A;  4LW2 A;  2HUU A;  3FFR A;  1QGN A;  3FVS A;  3GJU A;  1AMS A;  1FC4 A;  4WXB A;  3E77 A;  1DKA A;  5LHA A;  3IF2 A;  3UWC A;  4BHD A;  3ZRQ A;  3BN1 A;  2YCN A;  2R5C B;  1I41 A;  4RKC A;  4CVQ A;  1ASG A;  4TV7 A;  3PGY A;  2YKY A;  2D7Y A;  3MAF A;  3MAU A;  3R4T A;  4K2I A;  3CAI A;  4WLH A;  3FDD A;  4GE4 A;  1IX7 A;  3AEL A;  1CQ8 A;  5EIG A;  1B8G A;  1GD9 A;  2VMR A;  3L44 A;  2WB6 A;  3LWS A;  2VGV A;  2TPL A;  3QI6 A;  3VP6 A;  1MLY A;  4JEW A;  3JTX A;  1EG5 A;  1V2E A;  3EI6 A;  3WCN A;  5HXX A;  1LC5 A;  1G7W A;  4LW4 A;  5FT8 A;  2ORD A;  4E77 A;  3GZC A;  3RQ1 A;  4F5G A;  4PVF A;  1U08 A;  2V0Y A;  2W7G A;  2QLR A;  1V2F A;  3MKJ A;  2BYL A;  1OXP A;  3WX9 A;  3MBB A;  4M2J A;  2CH2 A;  2HUI A;  3CBF A;  4K05 A;  4DQ6 A;  2VLH A;  3DRD A;  4F5K A;  4WYE A;  3LY1 A;  2JG2 A;  4XK1 A;  4DGT A;  1BQD A;  4RIT A;  2ZY4 A;  2CJD A;  1G4V A;  5DX5 A;  1JF9 A;  4B98 A;  1WYU B;  3LVK A;  3AEO A;  1TAS A;  2VGT A;  2DR1 A;  2VIB A;  4WLJ A;  1B5P A;  3LV2 A;  4L0O A;  1TOJ A;  3G7Q A;  2BKW A;  3L8A A;  2OKK A;  1AY4 A;  2ZSM A;  2BYJ A;  3WKS A;  5JAY A;  1AY5 A;  5TF5 A;  2JJH A;  4EU1 A;  3RBL A;  1SPA A;  3OKS A;  1OHW A;  2AY1 A;  4JEZ A;  3ECD A;  4MGR A;  1OHV A;  3PAA A;  4TMR A;  3BS8 A;  3NNK A;  2ZJG A;  2ZC0 A;  2DKB A;  2E7J A;  3N0L A;  1MDX A;  4IY7 A;  2Z9W A;  4JEY A;  2CJH A;  1I48 A;  4A0H A;  2X5D A;  4ZWM A;  1Z7D A;  1QJ5 A;  3HLM A;  3NU8 A;  2CH1 A;  4A0G A;  3BWN C;  4IW7 A; 
#chains in the Genus database with same CATH homology
 1D2F A;  2VMS A;  3NUI A;  3FQ7 A;  3K40 A;  1M0O A;  3KGX A;  3TFU A;  4MQP A;  5IWQ A;  4OTL A;  5AX8 A;  1ORD A;  1WYU A;  2JJG A;  3DZZ A;  2W8W A;  3I16 A;  1TAR A;  3NX3 A;  1KKP A;  1BJW A;  1M6S A;  3PA9 A;  1JS6 A;  1KKJ A;  2QA3 A;  2VGU A;  4MSO A;  1SF2 A;  3EI5 A;  4KAM A;  1B9H A;  4W5K A;  3WY7 A;  3ZRR A;  3A9Z A;  4RKD A;  1ARI A;  2C44 A;  3K28 A;  1DGE A;  3RI6 A;  1BJ4 A;  5F9S A;  1CL1 A;  4WYF A;  2Z1Y A;  1N2T A;  5D5S A;  2VYC A;  2Z9X A;  1IX6 A;  4ZWV A;  1AIC A;  3NRA A;  1GC0 A;  3A9X A;  3CQ5 A;  5E5I A;  1AHF A;  1DFO A;  3B1D A;  4CXR A;  4GE7 A;  4ZAH A;  4A6R A;  4ADC A;  4A0R A;  2CB1 A;  4P7Y A;  3CQ4 A;  3FSL A;  3RCH B;  2ZP7 A;  5FT6 A;  2AY6 A;  2BI3 A;  2NMP A;  2Z9V A;  3GBX A;  3GET A;  4LNL A;  5G4I A;  1QIR A;  2WK8 A;  1ASD A;  3PJ0 A;  3N75 A;  1ASE A;  4Y0D A;  4ZM4 A;  4F5J A;  1BKG A;  4E1O A;  4F5L A;  3NTJ A;  1AHY A;  4WYG A;  4Y0H A;  3F0H A;  2D64 A;  3FD0 A;  2A1V A;  3N7N A;  3A8U X;  1BJO B;  5G09 A;  3H14 A;  5J8Q A;  2ZSL A;  4WXF A;  1LKC A;  2EH6 A;  1S09 A;  3VAX A;  4OBU A;  3IHJ A;  1JS3 A;  5EQC A;  3PIU A;  2CIN A;  4ADB A;  4BA4 A;  2XBN A;  4RAE A;  1GC2 A;  5M4B A;  1KL1 A;  2VMT A;  3A9Y A;  1WST A;  4W1W A;  3PDB A;  4A72 A;  2D63 A;  4LNJ A;  1GDE A;  4LC3 A;  1ZOD A;  2GSA A;  4ATQ A;  2FKI A;  3UE8 A;  1IJI A;  4Q75 A;  1ASA A;  4OBV A;  1AHG A;  1TPL A;  4ZDL A;  1PFF A;  2W7I A;  1GBN A;  1OAT A;  2W7L A;  3FVX A;  1ZC9 A;  2VMV A;  3LVL B;  3WGC A;  3ASB A;  4K2M A;  1W7M A;  2QB3 A;  4IX8 A;  3USF A;  3AEM A;  3F6T A;  1UU1 A;  3MC6 A;  4IXO A;  1J32 A;  3QM2 A;  2DGK A;  2W7E A;  3VK2 A;  1C9C A;  1J04 A;  1MLZ A;  4AH3 A;  4EB5 A;  3JU7 A;  1KMK A;  4FFC A;  1ASL A;  2EO5 A;  3BWO A;  2V1P A;  4OCA A;  5EUN A;  3HMU A;  4WB0 B;  2CAN A;  2AY2 A;  3TCM A;  1AMR A;  1S07 A;  2Z61 A;  1GC4 A;  1QZ9 A;  2FN6 A;  5FT5 A;  3COG A;  3JWB A;  3HDO A;  1LS3 A;  1FG7 A;  2W8U A;  4RIZ A;  4RLG A;  5M4D A;  2X8U A;  3E2Z A;  4CBS A;  2GB3 A;  1TOI A;  4W8I A;  3OP7 A;  4F5I A;  4ISY A;  4ZM3 A;  2GMU A;  3QN6 A;  4A6U A;  1G4X A;  5G2P A;  3FQ8 A;  3RCH A;  1UU2 A;  1O69 A;  2R0T A;  1I43 A;  3JW9 A;  3PD6 B;  3QPG A;  4WBT A;  1YJY A;  3WKR A;  3WZF A;  3R9A A;  1TOE A;  1DTY A;  4RM1 A;  4R5F A;  1E5E A;  1IBJ A;  3DXW A;  4GDY A;  3LVJ A;  3JZL A;  2AEU A;  3DYD A;  2Z20 A;  2OGE A;  4N0W A;  2BWN A;  1RVY A;  3FFH A;  3Q8N A;  1XEY A;  3AV7 A;  3HVY A;  1LC7 A;  4GSA A;  4ADE A;  1CS1 A;  4RJY A;  1V72 A;  3KGW A;  4EMY A;  9AAT A;  1EJI A;  2YKV A;  1KL2 A;  1D7R A;  1WYV A;  2QMA A;  3TFT A;  1GC3 A;  4BQ0 A;  1B9I A;  3FVU A;  5D95 A;  2VMU A;  3PDX A;  1C7N A;  2ZYJ A;  4XJM A;  1AHE A;  4UHO A;  3DR4 A;  1Y4I A;  4F5H A;  2YCP A;  5LH9 A;  2W8T A;  2AY4 A;  5DJ1 A;  5DJ9 A;  1WYT B;  2VMN A;  2R5E A;  3I5T A;  1CJ0 A;  4IYO B;  3VK4 A;  1IVR A;  4LNM A;  4R5Z A;  3BCA A;  1AJR A;  2BWP A;  4XQ2 A;  2G6W A;  3ZZK A;  1VJO A;  3K7Y A;  4PFN A;  2G7J A;  2OQX A;  1X29 A;  3FZ7 A;  3E2Y A;  2AY9 A;  5EUE A;  3B1E A;  1M0P A;  1DJE A;  3N4S A;  4AO4 A;  1CZC A;  1JG8 A;  4XEW A;  3DU4 A;  2XH1 A;  4HVK A;  2VMP A;  4XAU A;  3BWN A;  3BCB A;  4W91 A;  2WK9 A;  1M32 A;  3W1H A;  4ZSY A;  2FQ6 A;  3GSB A;  1X0M A;  2AY7 A;  1M0Q A;  3LG0 A;  4IXZ A;  3W1I A;  2YRR A;  1ART A;  4FL0 A;  2OKJ A;  2VLF A;  3MAF B;  3TAT A;  3WGB A;  4WP0 A;  4AZJ A;  5M46 A;  3E2Z B;  1W3U A;  4Q6R A;  3EI8 A;  1BT4 A;  1LW4 A;  3AEJ C;  1YAA A;  1H1C A;  1DJ9 A;  1PMM A;  4A00 A;  1YJZ A;  2VI9 A;  4UQV A;  1VEF A;  3N5M A;  1ELQ A;  5FT4 A;  1WYV B;  1O62 A;  2JJF A;  1TOG A;  3AOW A;  3LVM A;  1CL2 A;  3EZS A;  3EIA A;  2EYQ A;  1ASM A;  2GQN A;  2W7K A;  2FYF A;  2BIG A;  3AEP A;  3E9K A;  5G2Q A;  3AEM C;  1BS0 A;  3MC6 C;  4W1V A;  1FG3 A;  2E54 A;  2OAT A;  2W8V A;  3FCR A;  2C7T A;  3ELE A;  3FRK A;  1GEW A;  3ACZ A;  3QBO A;  4XJP A;  2QBT A;  2VI8 A;  1V2D A;  4ZDP A;  4ATP A;  1IX8 A;  4CBR A;  3N4R A;  4NOG A;  1UU0 A;  1ARS A;  4RJ0 A;  3EZ1 A;  4JEV A;  3G0T A;  1GCK A;  5BJ4 A;  2VMY A;  1ELU A;  3AEJ A;  1MGV A;  2O1B A;  1C0N A;  1PMO A;  2ZUK A;  2YKU A;  4ITG A;  4TN4 A;  5G4J A;  1X28 A;  1B4X A;  2CST A;  2R5C A;  3B8X A;  3EIB A;  1LK9 A;  2JJE A;  2X5F A;  4OYT A;  1XI9 A;  2QSR A;  3NU7 A;  1QJ3 A;  1GEX A;  4B9B A;  4N0B A;  5I92 A;  1Z3Z A;  1RVU A;  2VGW A;  2VMW A;  3ATH A;  4E3R A;  2W7D A;  4M2M A;  1LW5 A;  1RV4 A;  5E3K A;  1IAX A;  2BWO A;  2OGA A;  4ZLV A;  1SZU A;  3RUY A;  1TOK A;  3F9T A;  2RFV A;  2O0R A;  4AZK A;  3G8M A;  1OHY A;  1S0A A;  2DGM A;  2VMO A;  1W7L A;  2EPJ A;  3H9X A;  1ZOB A;  1E5F A;  5EFS A;  3ZRP A;  8AAT A;  2PO3 A;  3II0 A;  2DKJ A;  2BHX A;  3EUC A;  3M5U A;  3NYU A;  1ASC A;  1AAM A;  1SZS A;  2FM1 A;  4AOA A;  5K8B A;  2W7F A;  4JEX A;  1AX4 A;  3ASA A;  1C7G A;  1MAP A;  1WYT A;  1LC8 A;  3HBX A;  3MEB A;  4GE9 A;  2EZ2 A;  1YJS A;  3NUB A;  4WD2 A;  2FNI A;  4U2H A;  3ZZJ A;  4ZDO A;  3WCO A;  1B5O A;  1AMA A;  1BQA A;  1AJS B;  4GRX A;  1ASF A;  4KXK A;  2D61 A;  3HL2 A;  2HUF A;  4O6Z A;  1D7S A;  4M2K A;  1BW0 A;  1CZE A;  3KKI A;  4MY5 A;  2C81 A;  3JWA A;  3AEN A;  3AEN B;  1MDZ A;  4XJL A;  2FNU A;  4ZAS A;  4JF1 A;  1IAY A;  4OC9 A;  2BIE A;  3MAD A;  2JIS A;  4QGR A;  2BI2 A;  3E6G A;  2DOU A;  2R2N A;  3B46 A;  1KMJ A;  3FZ8 A;  5EUD A;  4BMK A;  1YOO A;  2VMZ A;  4A6T A;  4MKJ A;  2VMQ A;  3FDB A;  4H51 A;  1X2A A;  1AY8 A;  2QB2 A;  4WXG A;  5HHY A;  1T3I A;  2HOY A;  3FZ6 A;  3GWP A;  4EB7 A;  3BV0 A;  2KFP A;  3UAK A;  3AOV A;  3H7F A;  1ECX A;  3HT4 A;  4DBC A;  4ITX A;  2HOX A;  2BI9 A;  4F5M A;  2AY3 A;  3NDN A;  2C0R A;  4H63 Q;  2W7H A;  3NYT A;  7AAT A;  3GR9 A;  2VGS A;  3A2B A;  2WKA A;  4J8L A;  3QGU A;  4XJO A;  3W1J A;  1M0N A;  3TQX A;  3FQA A;  1M4N A;  1P3W A;  1DJU A;  3DR7 A;  4Y0I A;  2W7J A;  3E2F A;  4F4E A;  2W8J A;  1CQ7 A;  1C7O A;  2EZ1 A;  3B1C A;  3GZD A;  5HDM A;  5EAV A;  1S06 A;  2EGY A;  3BB8 A;  3VOM A;  3NYS A;  2WK7 A;  1AKA A;  1G7X A;  1WKG A;  3I4J A;  3T32 A;  4MQQ A;  2Z67 A;  1AJS A;  2CY8 A;  5EAA A;  2HP1 A;  1IUG A;  1H0C A;  2JGT A;  3CQ6 A;  1D7U A;  3EI7 A;  2PB0 A;  4OMA A;  1AIB A;  1QIT A;  2BIA A;  3PPL A;  4HF8 A;  1O61 A;  2Z9U A;  3FKD A;  1TAT A;  2VMX A;  1BJN A;  3WLX A;  2CTZ A;  4UHM A;  1UKJ A;  3DOD A;  1VP4 A;  4UOY A;  4J5U A;  2AAT A;  2GMS A;  2X3L A;  1O4S A;  1W7N A;  2YKX A;  2YRI A;  1SZK A;  3BCX A;  3KE3 A;  4KYO A;  4Q31 A;  5KTB A;  4Q76 A;  3N4X A;  1WKH A;  1N8P A;  4GEB A;  2CJG A;  4ADD A;  3GZD C;  2VGZ A;  4EFF A;  2F8J A;  1ARH A;  4UHN A;  2O7C A;  1BJO A;  5BJ3 A;  4U1T A;  2D5Y A;  2YCT A;  2BI1 A;  2Z1Z A;  2PB2 A;  1AMQ A;  4PFF A;  2HOZ A;  1ASN A;  2YHK A;  4PIW A;  1EQB A;  2HZP A;  3QHX A;  4AO9 A;  3ISL A;  3P1T A;  1C4K A;  4BA5 A;  4OT8 A;  2ZY2 A;  2ZY3 A;  1PG8 A;  1QIS A;  1RV3 A;  2HP2 A;  3PD6 A;  5G0A A;  4JF0 A;  4W1X A;  4ZSW A;  4JE5 A;  2VIA A;  4R8D A;  4CXQ A;  4IYO A;  4R2N A;  1CQ6 A;  5EIG B;  3DXV A;  2D66 A;  2AY8 A;  3AAT A;  3ELP A;  4MQR A;  1MDO A;  5F8V A;  4A0F A;  1N31 A;  3D6K A;  3EI9 A;  3FTB A;  4WYA A;  3VK3 A;  3P6K A;  1AIA A;  4E3Q A;  1AKC A;  2Q7W A;  4WYD A;  4WYC A;  3DC1 A;  2HOR A;  1YNU A;  1ARG A;  2CFB A;  2DGL A;  2D7Z A;  1AAW A;  3PDB B;  3BC8 A;  1OXO A;  1D7V A;  5C6U A;  2W7M A;  4I8A A;  1M7Y A;  2YOB A;  1MAQ A;  2AY5 A;  4MKK A;  2D65 A;  4K2B A;  4WB0 A;  1AKB A;  3HQT A;  1I29 A;  1S08 A;  4P3M A;  2BI5 A;  2E7I A;  1YIY A;  4JE5 D;  2ZY5 A;  1SVV A;  1GEY A;  5DB5 A;  1DGD A;  2AEV A;  4IXS A;  5E4Z A;  3RBF A;  1YIZ A;  1W23 A;  4F5F A;  1ASB A;  1SFF A;  5M49 A;  1AHX A;  2E7U A;  4LW2 A;  2HUU A;  3FFR A;  1QGN A;  3FVS A;  3GJU A;  1AMS A;  1FC4 A;  4WXB A;  3E77 A;  1DKA A;  5LHA A;  3IF2 A;  3UWC A;  4BHD A;  3ZRQ A;  3BN1 A;  2YCN A;  2R5C B;  1I41 A;  4RKC A;  4CVQ A;  1ASG A;  4TV7 A;  3PGY A;  2YKY A;  2D7Y A;  3MAF A;  3MAU A;  3R4T A;  4K2I A;  3CAI A;  4WLH A;  3FDD A;  4GE4 A;  1IX7 A;  3AEL A;  1CQ8 A;  5EIG A;  1B8G A;  1GD9 A;  2VMR A;  3L44 A;  2WB6 A;  3LWS A;  2VGV A;  2TPL A;  3QI6 A;  3VP6 A;  1MLY A;  4JEW A;  3JTX A;  1EG5 A;  1V2E A;  3EI6 A;  3WCN A;  5HXX A;  1LC5 A;  1G7W A;  4LW4 A;  5FT8 A;  2ORD A;  4E77 A;  3GZC A;  3RQ1 A;  4F5G A;  4PVF A;  1U08 A;  2V0Y A;  2W7G A;  2QLR A;  1V2F A;  3MKJ A;  2BYL A;  1OXP A;  3WX9 A;  3MBB A;  4M2J A;  2CH2 A;  2HUI A;  3CBF A;  4K05 A;  4DQ6 A;  2VLH A;  3DRD A;  4F5K A;  4WYE A;  3LY1 A;  2JG2 A;  4XK1 A;  4DGT A;  1BQD A;  4RIT A;  2ZY4 A;  2CJD A;  1G4V A;  5DX5 A;  1JF9 A;  4B98 A;  1WYU B;  3LVK A;  3AEO A;  1TAS A;  2VGT A;  2DR1 A;  2VIB A;  4WLJ A;  1B5P A;  3LV2 A;  4L0O A;  1TOJ A;  3G7Q A;  2BKW A;  3L8A A;  2OKK A;  1AY4 A;  2ZSM A;  2BYJ A;  3WKS A;  5JAY A;  1AY5 A;  5TF5 A;  2JJH A;  4EU1 A;  3RBL A;  1SPA A;  3OKS A;  1OHW A;  2AY1 A;  4JEZ A;  3ECD A;  4MGR A;  1OHV A;  3PAA A;  4TMR A;  3BS8 A;  3NNK A;  2ZJG A;  2ZC0 A;  2DKB A;  2E7J A;  3N0L A;  1MDX A;  4IY7 A;  2Z9W A;  4JEY A;  2CJH A;  1I48 A;  4A0H A;  2X5D A;  4ZWM A;  1Z7D A;  1QJ5 A;  3HLM A;  3NU8 A;  2CH1 A;  4A0G A;  3BWN C;  4IW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...