4Q6RA

Crystal structure of human sphingosine-1-phosphate lyase in complex with inhibitor 6-[(2r)-4-(4-benzyl-7-chlorophthalazin-1-yl)-2-methylpiperazin-1-yl]pyridine-3-carbonitrile
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
443
structure length
442
Chain Sequence
EYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orally Active 7-Substituted (4-Benzylphthalazin-1-yl)-2-methylpiperazin-1-yl]nicotinonitriles as Active-Site Inhibitors of Sphingosine 1-Phosphate Lyase for the Treatment of Multiple Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
molecule keywords Sphingosine-1-phosphate lyase 1
total genus 144
structure length 442
sequence length 443
chains with identical sequence B
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4q6rA03
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4q6rA02
5D5SA 1CZEA 2JJFA 1GC0A 2AEVA 5IWQA 3PD6B 4KYOA 1C9CA 2R5EA 1TOGA 4EB7A 3WY7A 4AO4A 4AH3A 2W8JA 3LG0A 3E2ZB 3RUYA 2VMXA 1UU2A 2W8UA 2D65A 1M6SA 1YJZA 5G09A 2C44A 1YIZA 2GMUA 2VMPA 3AV7A 3WGBA 1Y4IA 2JJEA 3A8UX 4EFFA 4WBTA 3W1JA 1M32A 3N5MA 1E5EA 5EFSA 3AEOA 1GC3A 1JS6A 3OP7A 3GWPA 2AATA 2VMZA 1B9IA 2AY5A 3FQ8A 4ITGA 1IVRA 2BI5A 1ASFA 1LS3A 1BT4A 2W7FA 3NYSA 1O4SA 2AY6A 4F5FA 2VMWA 2VMUA 3NTJA 3WX9A 1D7UA 4A6TA 3RCHA 3H14A 2TPLA 1BQDA 3AEJC 2BWNA 3UAKA 3E2ZA 1I43A 3BCAA 3MAUA 2AY1A 1PMMA 1QGNA 2D61A 2CH1A 3BB8A 1O62A 3CBFA 3LVKA 3VAXA 4ADDA 2HUIA 5C6UA 4IW7A 3AEMC 2V1PA 5EUNA 1DFOA 2R0TA 3PD6A 3DXVA 4JF1A 4A0RA 3AOWA 3CQ5A 1MDZA 1LC7A 3QM2A 2Z1YA 2HUFA 2W8WA 3D6KA 5J8QA 1ASEA 1TATA 3FVSA 5D95A 4F5KA 4ADEA 1BS0A 1B5OA 3LVLB 2CINA 5BJ4A 3QBOA 4OTLA 1GC2A 1WKGA 4WLHA 3P1TA 3BWNC 2BIGA 4P7YA 1AMRA 1GBNA 1TARA 1ARTA 3G8MA 2YKYA 4K2BA 3TCMA 3UWCA 3HMUA 3ZZKA 2GMSA 4IYOA 1CJ0A 4ATPA 2W7DA 4BMKA 1J04A 1CS1A 2E7JA 1YOOA 3HQTA 3TATA 1LC8A 3TFTA 1OXOA 1B8GA 2OKKA 2W8VA 2CB1A 2YOBA 1YJYA 4Q75A 3RI6A 2PB2A 4CBRA 5DJ9A 3OKSA 1J32A 4ZSWA 5FT4A 4F5LA 5HDMA 2R2NA 1FC4A 1W7NA 4W1WA 3FDDA 3FFHA 4MQRA 1C7GA 2CH2A 4JEYA 1W7LA 3BC8A 1QISA 3QI6A 4EU1A 1N8PA 3AATA 2BYJA 3BWOA 3VP6A 4E77A 4F5GA 1MAPA 1MGVA 1X28A 2WKAA 3WCOA 1ASBA 2YCNA 5G0AA 2ORDA 1KMKA 1WYTB 2RFVA 3DZZA 3A9XA 1D7VA 1BW0A 2X8UA 4GE9A 1KKJA 5BJ3A 2HP2A 1AMSA 3N0LA 3PAAA 1YNUA 1JS3A 3G7QA 1LC5A 4GE7A 4PVFA 4RIZA 1AHYA 1SZKA 2ZY3A 1AKAA 3PDBB 2CY8A 3B1CA 4IY7A 4M2KA 1M0NA 2Z1ZA 1AJSB 1D7RA 4M2JA 1P3WA 3EI6A 1XEYA 4GDYA 3ZZJA 1SZUA 2FN6A 5G4JA 3B1DA 1N31A 1W23A 1AICA 4RJ0A 5DB5A 2DOUA 1XI9A 1YAAA 1PFFA 1DJ9A 5M4BA 1TOKA 2EGYA 3P6KA 2X5FA 8AATA 4DQ6A 1MLYA 1G4XA 1I29A 2AY2A 2JJHA 4N0WA 1OHYA 3HDOA 3JTXA 1YIYA 2FYFA 1C0NA 1KKPA 3PDBA 2OGEA 4GRXA 3VOMA 2G6WA 3JZLA 4LC3A 4B9BA 4GEBA 2BI3A 2C0RA 1AJRA 2QMAA 3BN1A 3FZ7A 3EZSA 4MGRA 4WB0B 4F5JA 3MC6C 2QLRA 4CXQA 3K28A 4WXGA 3E2YA 4ZWMA 2VYCA 3PJ0A 5EIGB 1BJOB 4AZKA 3GZCA 1DKAA 4WXFA 5E5IA 2O0RA 1BJNA 1LW4A 3ISLA 1M7YA 3FDBA 2W7GA 4LW4A 4RJYA 2D7YA 2D66A 2ZY5A 7AATA 1TASA 1WYVA 2E54A 4ZM4A 1CL2A 4LNMA 3FKDA 4KXKA 2BKWA 1ASGA 1MAQA 1ARHA 1IX6A 1O69A 2QB2A 3F6TA 4W5KA 1V72A 3K7YA 1M0OA 3AELA 4NOGA 4BA5A 4OMAA 2DR1A 1WSTA 4RAEA 4WYFA 2EZ1A 2ZY2A 3W1HA 1AHFA 4E3QA 3NRAA 2YRIA 2PO3A 3CAIA 3N75A 5M46A 2EZ2A 1BJ4A 2JGTA 3GJUA 3BWNA 3F0HA 4UQVA 4XEWA 5M49A 2Q7WA 1LK9A 3FTBA 5G2QA 2EO5A 4UHNA 4Q6RA 3M5UA 2EH6A 3IHJA 1GC4A 1QJ5A 1BJWA 2BIEA 4DGTA 4W1VA 3JW9A 1AAMA 4IXZA 1DTYA 1ARGA 4UHMA 3W1IA 4O6ZA 1MLZA 4K2IA 2DGKA 4KAMA 3RCHB 1M0PA 2JJGA 5EAAA 5E3KA 1AHXA 1RVYA 4EMYA 1ECXA 3FQAA 2VMQA 1MDXA 4EB5A 2Z20A 4W8IA 2QA3A 3II0A 1S06A 4E3RA 2NMPA 3EIBA 4FL0A 2ZP7A 3L8AA 2XBNA 4ITXA 5G2PA 4ADCA 3HL2A 4W91A 4XK1A 4LNLA 1BJOA 1GCKA 1ASDA 3ELEA 1MDOA 1W3UA 3FVUA 4R8DA 5EIGA 1ASCA 1VJOA 3VK4A 3COGA 2BWPA 2ZUKA 3PGYA 4MSOA 4JE5A 2XH1A 2C81A 3GR9A 3MKJA 1U08A 3ZRQA 3Q8NA 3TFUA 3AEPA 4OYTA 4WXBA 2W7KA 2JG2A 1S08A 5FT5A 2HOXA 2CTZA 2QB3A 1BKGA 2BI1A 4IXOA 4A6RA 2ZJGA 5TF5A 3A9ZA 3BCBA 5FT8A 1GEXA 3KGXA 1E5FA 2EPJA 4OBVA 2X3LA 1GDEA 1D7SA 3MEBA 4ISYA 4DBCA 5HHYA 1IJIA 2GB3A 3EI9A 3F9TA 4PFFA 4JE5D 3LV2A 2CANA 1G4VA 2BHXA 3DODA 2FNIA 2HP1A 2VI9A 3E6GA 4TV7A 1I48A 1IAYA 2YHKA 2QBTA 2PB0A 4U1TA 3GZDA 5K8BA 2GSAA 1CL1A 1V2FA 3QN6A 1S0AA 2VMSA 4N0BA 4BHDA 1AIBA 2CJHA 2ZSMA 3GSBA 2V0YA 4A0FA 5EAVA 4AO9A 2E7UA 3NNKA 1N2TA 1KL2A 3A9YA 1AJSA 1TOEA 4GSAA 5LH9A 3PPLA 3KKIA 2ZY4A 4K2MA 3DYDA 3ASAA 4WYAA 1LKCA 1WYUA 4A6UA 1ARIA 3FQ7A 3MC6A 1ELQA 3H7FA 3NYTA 1GD9A 3DRDA 3EI5A 3MAFA 2D5YA 1OXPA 1SVVA 5DJ1A 3CQ6A 2CSTA 1B9HA 2Z9XA 2D64A 2W7EA 4J5UA 1DJEA 2VGUA 4OCAA 1C7OA 1D2FA 4RLGA 1UU0A 1SFFA 1X29A 2F8JA 2W7IA 3AENA 5AX8A 3FZ8A 1T3IA 2VGTA 3NU8A 4IX8A 4XJPA 1ASAA 2HOZA 4WYEA 3WKSA 2OQXA 3NUBA 3NX3A 1IX8A 2C7TA 4J8LA 3BV0A 3JU7A 1ARSA 2WK7A 1AKCA 3ASBA 4RM1A 1S07A 1DGDA 1AIAA 1TOIA 1S09A 2FNUA 2VMVA 4IXSA 3FZ6A 1AX4A 2AY9A 1WYUB 2FQ6A 4XJOA 4A72A 1EG5A 1KL1A 1V2DA 1AKBA 1AY4A 2CJGA 4MKJA 1VP4A 3EUCA 4OBUA 4IYOB 4UHOA 3ECDA 4HF8A 5I92A 4ZASA 3GZDC 4MQPA 3CQ4A 1AY5A 1G7WA 1IBJA 4ADBA 1OATA 2DGLA 4P3MA 4CVQA 2O1BA 1C4KA 2VMNA 5EQCA 1H0CA 4W1XA 2YRRA 4RKCA 3I4JA 3K40A 3ACZA 3HT4A 2R5CB 3EI7A 4CBSA 3QHXA 2AY3A 3E2FA 3BCXA 2VIBA 1VEFA 3NYUA 4TN4A 1FG7A 4GE4A 4WYCA 3T32A 1V2EA 1ZOBA 1UU1A 4WYGA 4F5MA 3ZRPA 1DJUA 1X0MA 3MAFB 1Z3ZA 1RV4A 1GEYA 3EI8A 2VMOA 4WB0A 1ASLA 3ZRRA 1ELUA 3NUIA 1AHEA 3PA9A 1ASNA 3R4TA 2W7HA 4XAUA 3R9AA 3AENB 3WCNA 1ZC9A 3QPGA 4RITA 2HOYA 4Y0DA 2AY4A 5E4ZA 4A0GA 1W7MA 2GQNA 4TMRA 3EIAA 1EJIA 4F4EA 1GEWA 1KMJA 2HZPA 1M4NA 2BWOA 2CFBA 3FFRA 4U2HA 4XJLA 4XQ2A 4CXRA 4QGRA 1ORDA 1TOJA 2YKXA 3FRKA 3EZ1A 3IF2A 2BI2A 4MKKA 4ZDLA 2AY8A 2YKVA 3DC1A 2Z61A 4A00A 4BA4A 1YJSA 4ATQA 2BI9A 1RV3A 3HLMA 1Z7DA 1O61A 1QZ9A 5EUDA 2DKBA 1M0QA 2DKJA 2VMRA 3LVJA 4F5HA 1TPLA 3DU4A 3I5TA 4HVKA 3VK2A 4ZM3A 3DR7A 1EQBA 4PFNA 1JF9A 2VGZA 2W7LA 2VMTA 1ASMA 3KE3A 3DR4A 4ZDPA 1G7XA 3I16A 4M2MA 1C7NA 2CJDA 1FG3A 3WKRA 4Y0IA 1QIRA 4FFCA 5G4IA 5HXXA 2X5DA 4H51A 2DGMA 1I41A 4WLJA 3RBFA 1LW5A 1B5PA 3KGWA 4JEXA 1CQ8A 4JEZA 4L0OA 5F8VA 5M4DA 3PIUA 1SZSA 4Q76A 1OHWA 4Q31A 2OATA 5F9SA 3AEMA 2R5CA 3GETA 1BQAA 2BYLA 2VLHA 2HUUA 3HVYA 4OC9A 1WYVB 3B46A 3GBXA 9AATA 3WZFA 3A2BA 1OHVA 2VLFA 2YKUA 3B1EA 3WLXA 3NDNA 2ZYJA 4OT8A 3HBXA 3QGUA 4PIWA 4UOYA 4ZDOA 1UKJA 3LWSA 4MQQA 5EUEA 4A0HA 2W7JA 4AOAA 4LW2A 3FD0A 3PDXA 3FCRA 4JF0A 3ATHA 3USFA 3G0TA 1IUGA 4AZJA 3LY1A 4E1OA 2AY7A 2WK8A 3E9KA 4XJMA 3L44A 2VI8A 2OGAA 4WD2A 5DX5A 4R2NA 1WYTA 1IAXA 4R5FA 1DGEA 1PG8A 4RKDA 2Z9VA 3MADA 1CZCA 1PMOA 1RVUA 3MBBA 1X2AA 1AMQA 1AY8A 1AHGA 2AEUA 2HORA 2OKJA 2O7CA 1WKHA 4ZSYA 1CQ7A 3AOVA 2W7MA 4I8AA 3ELPA 2D7ZA 2VGSA 1JG8A 3FVXA 2BIAA 4BQ0A 3RQ1A 5JAYA 3NU7A 3VK3A 4MY5A 1CQ6A 4B98A 3WGCA 4WP0A 2WK9A 4F5IA 2YCPA 1SPAA 2VIAA 3BS8A 3TQXA 5FT6A 3B8XA 2D63A 2W8TA 4ZLVA 2E7IA 2FM1A 2VMYA 4ZWVA 2JISA 1H1CA 4R5ZA 4WYDA 2YCTA 3UE8A 2VGVA 4ZAHA 2ZC0A 5LHAA 3E77A 3RBLA 3JWBA 3JWAA 4JEWA 2Z9WA 3LVMA 1QJ3A 1QITA 4JEVA 3AEJA 1B4XA 2Z9UA 1ZODA 3FSLA 4LNJA 1AMAA 2Z67A 1IX7A 1AAWA 3DXWA 4Y0HA 2VGWA 2ZSLA 1SF2A
chains in the Genus database with same CATH superfamily
5D5SA 1CZEA 2JJFA 1GC0A 2AEVA 5IWQA 3PD6B 4KYOA 1C9CA 2R5EA 1TOGA 4EB7A 3WY7A 4AO4A 4AH3A 2W8JA 3LG0A 3E2ZB 3RUYA 2VMXA 1UU2A 2W8UA 2D65A 1M6SA 1YJZA 5G09A 2C44A 1YIZA 2GMUA 2VMPA 3AV7A 3WGBA 1Y4IA 2JJEA 3A8UX 4EFFA 4WBTA 3W1JA 1M32A 4K05A 3N5MA 1E5EA 5EFSA 3AEOA 1GC3A 1JS6A 3OP7A 3GWPA 2AATA 2VMZA 1B9IA 2AY5A 3FQ8A 4ITGA 1IVRA 2BI5A 2QSRA 1ASFA 1LS3A 1BT4A 2W7FA 3NYSA 1O4SA 2AY6A 4F5FA 2VMWA 2VMUA 3NTJA 3WX9A 1D7UA 4A6TA 2EYQA 3RCHA 3H14A 2TPLA 1BQDA 3AEJC 2BWNA 3UAKA 3E2ZA 1I43A 3BCAA 3MAUA 2AY1A 1PMMA 1QGNA 2D61A 2CH1A 3BB8A 1O62A 3CBFA 3LVKA 3VAXA 4ADDA 2HUIA 5C6UA 4IW7A 3AEMC 2V1PA 5EUNA 1DFOA 2R0TA 3PD6A 3DXVA 4JF1A 4A0RA 3AOWA 3CQ5A 1MDZA 1LC7A 3QM2A 2Z1YA 2HUFA 2W8WA 3D6KA 5J8QA 1ASEA 1TATA 3FVSA 5D95A 4F5KA 4ADEA 1BS0A 1B5OA 3LVLB 2CINA 5BJ4A 3QBOA 4OTLA 1GC2A 1WKGA 4WLHA 3P1TA 3BWNC 2BIGA 4P7YA 1AMRA 1GBNA 1TARA 1ARTA 3G8MA 2YKYA 4K2BA 3TCMA 3UWCA 3HMUA 3ZZKA 2GMSA 4IYOA 1CJ0A 4ATPA 2W7DA 4BMKA 1J04A 1CS1A 2E7JA 1YOOA 3HQTA 3TATA 1LC8A 3TFTA 1OXOA 4H63Q 1B8GA 2OKKA 2W8VA 2CB1A 2YOBA 1YJYA 4Q75A 3RI6A 2PB2A 4CBRA 5DJ9A 3OKSA 1J32A 4ZSWA 5FT4A 4F5LA 5HDMA 2R2NA 1FC4A 1W7NA 4W1WA 3FDDA 3FFHA 4MQRA 1C7GA 2CH2A 4JEYA 1W7LA 3BC8A 1QISA 3QI6A 4EU1A 1N8PA 3AATA 2BYJA 3BWOA 3VP6A 4E77A 4F5GA 1MAPA 1MGVA 1X28A 2WKAA 3WCOA 1ASBA 2YCNA 5G0AA 2ORDA 1KMKA 1WYTB 2RFVA 3DZZA 3A9XA 1D7VA 1BW0A 2X8UA 4GE9A 1KKJA 5BJ3A 2HP2A 1AMSA 3N0LA 3PAAA 1YNUA 1JS3A 3G7QA 1LC5A 4GE7A 4PVFA 4RIZA 1AHYA 1SZKA 2ZY3A 1AKAA 3PDBB 2CY8A 3B1CA 2A1VA 4IY7A 4M2KA 1M0NA 2Z1ZA 1AJSB 1D7RA 4M2JA 1P3WA 3EI6A 1XEYA 4GDYA 3ZZJA 1SZUA 2FN6A 5G4JA 3B1DA 1N31A 1W23A 1AICA 4RJ0A 5DB5A 2DOUA 1XI9A 1YAAA 1PFFA 1DJ9A 5M4BA 1TOKA 2EGYA 3P6KA 2X5FA 8AATA 4DQ6A 1MLYA 1G4XA 1I29A 2AY2A 2JJHA 4N0WA 1OHYA 3HDOA 3JTXA 1YIYA 2FYFA 1C0NA 1KKPA 3PDBA 2OGEA 4GRXA 3VOMA 2G6WA 3JZLA 4LC3A 4B9BA 4GEBA 2BI3A 2C0RA 1AJRA 2QMAA 3BN1A 3FZ7A 3EZSA 4MGRA 4WB0B 4F5JA 3MC6C 2QLRA 4CXQA 3K28A 4WXGA 3E2YA 4ZWMA 2VYCA 3PJ0A 5EIGB 1BJOB 4AZKA 3GZCA 1DKAA 4WXFA 5E5IA 2O0RA 1BJNA 3N4XA 1LW4A 3ISLA 1M7YA 3FDBA 2W7GA 4LW4A 4RJYA 2D7YA 2D66A 2ZY5A 7AATA 1TASA 1WYVA 2E54A 4ZM4A 1CL2A 4LNMA 3FKDA 4KXKA 2BKWA 1ASGA 1MAQA 1ARHA 1IX6A 1O69A 2QB2A 3F6TA 4W5KA 1V72A 3K7YA 1M0OA 3AELA 4NOGA 4BA5A 4OMAA 2DR1A 1WSTA 4RAEA 4WYFA 2EZ1A 2ZY2A 3W1HA 1AHFA 4E3QA 3NRAA 2YRIA 2PO3A 3CAIA 3N75A 2KFPA 5M46A 2EZ2A 1BJ4A 2JGTA 3GJUA 3BWNA 3F0HA 4UQVA 4XEWA 5M49A 2Q7WA 1LK9A 3FTBA 5G2QA 2EO5A 4UHNA 4Q6RA 3M5UA 2EH6A 3IHJA 1GC4A 1QJ5A 1BJWA 2BIEA 4DGTA 2G7JA 4W1VA 3JW9A 1AAMA 4IXZA 1KAFA 3N4RA 1DTYA 1ARGA 4UHMA 3W1IA 4O6ZA 1MLZA 4K2IA 2DGKA 4KAMA 3RCHB 1M0PA 2JJGA 5EAAA 5E3KA 1AHXA 1RVYA 4EMYA 1ECXA 3FQAA 2VMQA 1MDXA 4EB5A 2Z20A 4W8IA 2QA3A 3II0A 1S06A 4E3RA 2NMPA 3EIBA 4FL0A 2ZP7A 3L8AA 2XBNA 4ITXA 5G2PA 4ADCA 3HL2A 4W91A 4XK1A 4LNLA 1BJOA 1GCKA 1ASDA 3ELEA 1MDOA 1W3UA 3FVUA 4R8DA 5EIGA 1ASCA 1VJOA 3VK4A 3COGA 2BWPA 2ZUKA 3PGYA 4MSOA 4JE5A 2XH1A 2C81A 3GR9A 3MKJA 1U08A 3ZRQA 3Q8NA 3TFUA 3AEPA 4OYTA 4WXBA 2W7KA 2JG2A 1S08A 5FT5A 2HOXA 2CTZA 2QB3A 1BKGA 2BI1A 4IXOA 4A6RA 2ZJGA 5TF5A 3A9ZA 3BCBA 5FT8A 1GEXA 3KGXA 1E5FA 2EPJA 4OBVA 2X3LA 1GDEA 1D7SA 3MEBA 4ISYA 4DBCA 5HHYA 1IJIA 2GB3A 3EI9A 3F9TA 4PFFA 4JE5D 3LV2A 2CANA 1G4VA 2BHXA 3DODA 2FNIA 2HP1A 2VI9A 3E6GA 4TV7A 1I48A 1IAYA 2YHKA 2QBTA 2PB0A 4U1TA 3GZDA 5K8BA 2GSAA 1CL1A 1V2FA 3QN6A 1S0AA 2VMSA 4N0BA 4BHDA 1AIBA 2CJHA 2ZSMA 3GSBA 2V0YA 4A0FA 5EAVA 4AO9A 2E7UA 3NNKA 1N2TA 1KL2A 3A9YA 1AJSA 1TOEA 4GSAA 5LH9A 3PPLA 3KKIA 2ZY4A 4K2MA 3DYDA 3ASAA 4WYAA 1LKCA 1WYUA 4A6UA 1ARIA 3FQ7A 3MC6A 2WB6A 1ELQA 3H7FA 3NYTA 1GD9A 3DRDA 3EI5A 3MAFA 2D5YA 1OXPA 1SVVA 5DJ1A 3CQ6A 2CSTA 1B9HA 2Z9XA 2D64A 2W7EA 4J5UA 1DJEA 2VGUA 4OCAA 1C7OA 1D2FA 4RLGA 1UU0A 1SFFA 1X29A 2F8JA 2W7IA 3AENA 5AX8A 3FZ8A 1T3IA 2VGTA 3NU8A 4IX8A 4XJPA 1ASAA 2HOZA 4WYEA 3WKSA 2OQXA 3NUBA 3NX3A 1IX8A 2C7TA 4J8LA 3BV0A 3JU7A 1ARSA 2WK7A 1AKCA 3ASBA 4RM1A 1S07A 1DGDA 1AIAA 1TOIA 1S09A 2FNUA 2VMVA 4IXSA 3FZ6A 1AX4A 2AY9A 1WYUB 2FQ6A 4XJOA 4A72A 1EG5A 1KL1A 1V2DA 1AKBA 1AY4A 2CJGA 4MKJA 1VP4A 3EUCA 4OBUA 4IYOB 4UHOA 3ECDA 4HF8A 5I92A 4ZASA 3GZDC 4MQPA 3CQ4A 1AY5A 1G7WA 1IBJA 4ADBA 1OATA 2DGLA 4P3MA 4CVQA 2O1BA 1C4KA 2VMNA 5EQCA 1H0CA 4W1XA 2YRRA 4RKCA 3I4JA 3K40A 3ACZA 3HT4A 2R5CB 3EI7A 4CBSA 3QHXA 2AY3A 3E2FA 3BCXA 2VIBA 1VEFA 3NYUA 4TN4A 1FG7A 4GE4A 4WYCA 3T32A 1V2EA 3N7NA 1ZOBA 1UU1A 4WYGA 4F5MA 3ZRPA 1DJUA 1X0MA 3MAFB 1Z3ZA 1RV4A 1GEYA 3EI8A 2VMOA 4WB0A 1ASLA 3ZRRA 1ELUA 3NUIA 1AHEA 3PA9A 1ASNA 3R4TA 2W7HA 4XAUA 3R9AA 3AENB 3WCNA 1ZC9A 3QPGA 4RITA 2HOYA 4Y0DA 2AY4A 5E4ZA 4A0GA 1W7MA 2GQNA 4TMRA 3EIAA 1EJIA 4F4EA 1GEWA 1KMJA 2HZPA 1M4NA 2BWOA 2CFBA 3FFRA 4U2HA 4XJLA 4XQ2A 4CXRA 4QGRA 1ORDA 1TOJA 2YKXA 3FRKA 3EZ1A 3IF2A 2BI2A 4MKKA 4ZDLA 2AY8A 2YKVA 3DC1A 2Z61A 4A00A 4BA4A 1YJSA 4ATQA 2BI9A 1RV3A 3HLMA 1Z7DA 1O61A 1QZ9A 5EUDA 2DKBA 1M0QA 2DKJA 2VMRA 3LVJA 4F5HA 1TPLA 3DU4A 3I5TA 4HVKA 3VK2A 4ZM3A 3DR7A 1EQBA 4PFNA 1JF9A 2VGZA 2W7LA 2VMTA 1ASMA 3KE3A 3DR4A 4ZDPA 1G7XA 3I16A 4M2MA 1C7NA 2CJDA 1FG3A 3WKRA 4Y0IA 1QIRA 4FFCA 5G4IA 5HXXA 2X5DA 4H51A 3H9XA 2DGMA 1I41A 4WLJA 3RBFA 1LW5A 1B5PA 3KGWA 4JEXA 1CQ8A 4JEZA 4L0OA 5F8VA 5M4DA 3PIUA 1SZSA 4Q76A 1OHWA 4Q31A 2OATA 5F9SA 3AEMA 2R5CA 3GETA 1BQAA 2BYLA 2VLHA 2HUUA 3HVYA 4OC9A 1WYVB 3B46A 3GBXA 9AATA 3WZFA 3A2BA 1OHVA 2VLFA 2YKUA 3B1EA 3WLXA 3NDNA 2ZYJA 4OT8A 3HBXA 3QGUA 4PIWA 4UOYA 4ZDOA 1UKJA 3LWSA 4MQQA 5EUEA 4A0HA 2W7JA 4AOAA 4LW2A 3FD0A 3PDXA 3FCRA 4JF0A 3ATHA 3USFA 3G0TA 1IUGA 4AZJA 3LY1A 4E1OA 2AY7A 2WK8A 3E9KA 4XJMA 3L44A 2VI8A 2OGAA 4WD2A 5DX5A 3N4SA 4R2NA 1WYTA 1IAXA 4R5FA 1DGEA 1PG8A 4RKDA 2Z9VA 3MADA 1CZCA 1PMOA 1RVUA 3MBBA 1X2AA 1AMQA 1AY8A 1AHGA 2AEUA 2HORA 2OKJA 2O7CA 1WKHA 4ZSYA 1CQ7A 3AOVA 2W7MA 4I8AA 3ELPA 2D7ZA 2VGSA 1JG8A 3FVXA 2BIAA 4BQ0A 3RQ1A 2FKIA 5JAYA 3NU7A 3VK3A 4MY5A 1CQ6A 4B98A 3WGCA 4WP0A 2WK9A 4F5IA 2YCPA 1SPAA 2VIAA 3BS8A 3TQXA 5FT6A 3B8XA 2D63A 2W8TA 4ZLVA 2E7IA 2FM1A 2VMYA 4ZWVA 2JISA 1H1CA 4R5ZA 4WYDA 5KTBA 2YCTA 3UE8A 2VGVA 4ZAHA 2ZC0A 5LHAA 3E77A 3RBLA 3JWBA 3JWAA 4JEWA 2Z9WA 3LVMA 1QJ3A 1QITA 4JEVA 3AEJA 1B4XA 2Z9UA 1ZODA 3FSLA 4LNJA 1AMAA 2Z67A 1IX7A 1AAWA 3DXWA 4Y0HA 2VGWA 2ZSLA 1SF2A
chains in the Genus database with same CATH topology
5D5SA 1CZEA 2JJFA 1GC0A 2AEVA 5IWQA 3PD6B 4KYOA 1C9CA 2R5EA 1TOGA 4EB7A 3WY7A 4AO4A 4AH3A 2W8JA 3LG0A 3E2ZB 3RUYA 2VMXA 1UU2A 2W8UA 2D65A 1M6SA 1YJZA 5G09A 2C44A 1YIZA 2GMUA 2VMPA 3AV7A 3WGBA 1Y4IA 2JJEA 3A8UX 4EFFA 4WBTA 3W1JA 1M32A 4K05A 3N5MA 1E5EA 5EFSA 3AEOA 1GC3A 1JS6A 3OP7A 3GWPA 2AATA 2VMZA 1B9IA 2AY5A 3FQ8A 4ITGA 1IVRA 2BI5A 2QSRA 1ASFA 1LS3A 1BT4A 2W7FA 3NYSA 1O4SA 2AY6A 4F5FA 2VMWA 2VMUA 3NTJA 3WX9A 1D7UA 4A6TA 2EYQA 3RCHA 3H14A 2TPLA 1BQDA 3AEJC 2BWNA 3UAKA 3E2ZA 1I43A 3BCAA 3MAUA 2AY1A 1PMMA 1QGNA 2D61A 2CH1A 3BB8A 1O62A 3CBFA 3LVKA 3VAXA 4ADDA 2HUIA 5C6UA 4IW7A 3AEMC 2V1PA 5EUNA 1DFOA 2R0TA 3PD6A 3DXVA 4JF1A 4A0RA 3AOWA 3CQ5A 1MDZA 1LC7A 3QM2A 2Z1YA 2HUFA 2W8WA 3D6KA 5J8QA 1ASEA 1TATA 3FVSA 5D95A 4F5KA 4ADEA 1BS0A 1B5OA 3LVLB 2CINA 5BJ4A 3QBOA 4OTLA 1GC2A 1WKGA 4WLHA 3P1TA 3BWNC 2BIGA 4P7YA 1AMRA 1GBNA 1TARA 1ARTA 3G8MA 2YKYA 4K2BA 3TCMA 3UWCA 3HMUA 3ZZKA 2GMSA 4IYOA 1CJ0A 4ATPA 2W7DA 4BMKA 1J04A 1CS1A 2E7JA 1YOOA 3HQTA 3TATA 1LC8A 3TFTA 1OXOA 4H63Q 1B8GA 2OKKA 2W8VA 2CB1A 2YOBA 1YJYA 4Q75A 3RI6A 2PB2A 4CBRA 5DJ9A 3OKSA 1J32A 4ZSWA 5FT4A 4F5LA 5HDMA 2R2NA 1FC4A 1W7NA 4W1WA 3FDDA 3FFHA 4MQRA 1C7GA 2CH2A 4JEYA 1W7LA 3BC8A 1QISA 3QI6A 4EU1A 1N8PA 3AATA 2BYJA 3BWOA 3VP6A 4E77A 4F5GA 1MAPA 1MGVA 1X28A 2WKAA 3WCOA 1ASBA 2YCNA 5G0AA 2ORDA 1KMKA 1WYTB 2RFVA 3DZZA 3A9XA 1D7VA 1BW0A 2X8UA 4GE9A 1KKJA 5BJ3A 2HP2A 1AMSA 3N0LA 3PAAA 1YNUA 1JS3A 3G7QA 1LC5A 4GE7A 4PVFA 4RIZA 1AHYA 1SZKA 2ZY3A 1AKAA 3PDBB 2CY8A 3B1CA 2A1VA 4IY7A 4M2KA 1M0NA 2Z1ZA 1AJSB 1D7RA 4M2JA 1P3WA 3EI6A 1XEYA 4GDYA 3ZZJA 1SZUA 2FN6A 5G4JA 3B1DA 1N31A 1W23A 1AICA 4RJ0A 5DB5A 2DOUA 1XI9A 1YAAA 1PFFA 1DJ9A 5M4BA 1TOKA 2EGYA 3P6KA 2X5FA 8AATA 4DQ6A 1MLYA 1G4XA 1I29A 2AY2A 2JJHA 4N0WA 1OHYA 3HDOA 3JTXA 1YIYA 2FYFA 1C0NA 1KKPA 3PDBA 2OGEA 4GRXA 3VOMA 2G6WA 3JZLA 4LC3A 4B9BA 4GEBA 2BI3A 2C0RA 1AJRA 2QMAA 3BN1A 3FZ7A 3EZSA 4MGRA 4WB0B 4F5JA 3MC6C 2QLRA 4CXQA 3K28A 4WXGA 3E2YA 4ZWMA 2VYCA 3PJ0A 5EIGB 1BJOB 4AZKA 3GZCA 1DKAA 4WXFA 5E5IA 2O0RA 1BJNA 3N4XA 1LW4A 3ISLA 1M7YA 3FDBA 2W7GA 4LW4A 4RJYA 2D7YA 2D66A 2ZY5A 7AATA 1TASA 1WYVA 2E54A 4ZM4A 1CL2A 4LNMA 3FKDA 4KXKA 2BKWA 1ASGA 1MAQA 1ARHA 1IX6A 1O69A 2QB2A 3F6TA 4W5KA 1V72A 3K7YA 1M0OA 3AELA 4NOGA 4BA5A 4OMAA 2DR1A 1WSTA 4RAEA 4WYFA 2EZ1A 2ZY2A 3W1HA 1AHFA 4E3QA 3NRAA 2YRIA 2PO3A 3CAIA 3N75A 2KFPA 5M46A 2EZ2A 1BJ4A 2JGTA 3GJUA 3BWNA 3F0HA 4UQVA 4XEWA 5M49A 2Q7WA 1LK9A 3FTBA 5G2QA 2EO5A 4UHNA 4Q6RA 3M5UA 2EH6A 3IHJA 1GC4A 1QJ5A 1BJWA 2BIEA 4DGTA 2G7JA 4W1VA 3JW9A 1AAMA 4IXZA 3N4RA 1DTYA 1ARGA 4UHMA 3W1IA 4O6ZA 1MLZA 4K2IA 2DGKA 4KAMA 3RCHB 1M0PA 2JJGA 5EAAA 5E3KA 1AHXA 1RVYA 4EMYA 1ECXA 3FQAA 2VMQA 1MDXA 4EB5A 2Z20A 4W8IA 2QA3A 3II0A 1S06A 4E3RA 2NMPA 3EIBA 4FL0A 2ZP7A 3L8AA 2XBNA 4ITXA 5G2PA 4ADCA 3HL2A 4W91A 4XK1A 4LNLA 1BJOA 1GCKA 1ASDA 3ELEA 1MDOA 1W3UA 3FVUA 4R8DA 5EIGA 1ASCA 1VJOA 3VK4A 3COGA 2BWPA 2ZUKA 3PGYA 4MSOA 4JE5A 2XH1A 2C81A 3GR9A 3MKJA 1U08A 3ZRQA 3Q8NA 3TFUA 3AEPA 4OYTA 4WXBA 2W7KA 2JG2A 1S08A 5FT5A 2HOXA 2CTZA 2QB3A 1BKGA 2BI1A 4IXOA 4A6RA 2ZJGA 5TF5A 3A9ZA 3BCBA 5FT8A 1GEXA 3KGXA 1E5FA 2EPJA 4OBVA 2X3LA 1GDEA 1D7SA 3MEBA 4ISYA 4DBCA 5HHYA 1IJIA 2GB3A 3EI9A 3F9TA 4PFFA 4JE5D 3LV2A 2CANA 1G4VA 2BHXA 3DODA 2FNIA 2HP1A 2VI9A 3E6GA 4TV7A 1I48A 1IAYA 2YHKA 2QBTA 2PB0A 4U1TA 3GZDA 5K8BA 2GSAA 1CL1A 1V2FA 3QN6A 1S0AA 2VMSA 4N0BA 4BHDA 1AIBA 2CJHA 2ZSMA 3GSBA 2V0YA 4A0FA 5EAVA 4AO9A 2E7UA 3NNKA 1N2TA 1KL2A 3A9YA 1AJSA 1TOEA 4GSAA 5LH9A 3PPLA 3KKIA 2ZY4A 4K2MA 3DYDA 3ASAA 4WYAA 1LKCA 1WYUA 4A6UA 1ARIA 3FQ7A 3MC6A 2WB6A 1ELQA 3H7FA 3NYTA 1GD9A 3DRDA 3EI5A 3MAFA 2D5YA 1OXPA 1SVVA 5DJ1A 3CQ6A 2CSTA 1B9HA 2Z9XA 2D64A 2W7EA 4J5UA 1DJEA 2VGUA 4OCAA 1C7OA 1D2FA 4RLGA 1UU0A 1SFFA 1X29A 2F8JA 2W7IA 3AENA 5AX8A 3FZ8A 1T3IA 2VGTA 3NU8A 4IX8A 4XJPA 1ASAA 2HOZA 4WYEA 3WKSA 2OQXA 3NUBA 3NX3A 1IX8A 2C7TA 4J8LA 3BV0A 3JU7A 1ARSA 2WK7A 1AKCA 3ASBA 4RM1A 1S07A 1DGDA 1AIAA 1TOIA 1S09A 2FNUA 2VMVA 4IXSA 3FZ6A 1AX4A 2AY9A 1WYUB 2FQ6A 4XJOA 4A72A 1EG5A 1KL1A 1V2DA 1AKBA 1AY4A 2CJGA 4MKJA 1VP4A 3EUCA 4OBUA 4IYOB 4UHOA 3ECDA 4HF8A 5I92A 4ZASA 3GZDC 4MQPA 3CQ4A 1AY5A 1G7WA 1IBJA 4ADBA 1OATA 2DGLA 4P3MA 4CVQA 2O1BA 1C4KA 2VMNA 5EQCA 1H0CA 4W1XA 2YRRA 4RKCA 3I4JA 3K40A 3ACZA 3HT4A 2R5CB 3EI7A 4CBSA 3QHXA 2AY3A 3E2FA 3BCXA 2VIBA 1VEFA 3NYUA 4TN4A 1FG7A 4GE4A 4WYCA 3T32A 1V2EA 3N7NA 1ZOBA 1UU1A 4WYGA 4F5MA 3ZRPA 1DJUA 1X0MA 3MAFB 1Z3ZA 1RV4A 1GEYA 3EI8A 2VMOA 4WB0A 1ASLA 3ZRRA 1ELUA 3NUIA 1AHEA 3PA9A 1ASNA 3R4TA 2W7HA 4XAUA 3R9AA 3AENB 3WCNA 1ZC9A 3QPGA 4RITA 2HOYA 4Y0DA 2AY4A 5E4ZA 4A0GA 1W7MA 2GQNA 4TMRA 3EIAA 1EJIA 4F4EA 1GEWA 1KMJA 2HZPA 1M4NA 2BWOA 2CFBA 3FFRA 4U2HA 4XJLA 4XQ2A 4CXRA 4QGRA 1ORDA 1TOJA 2YKXA 3FRKA 3EZ1A 3IF2A 2BI2A 4MKKA 4ZDLA 2AY8A 2YKVA 3DC1A 2Z61A 4A00A 4BA4A 1YJSA 4ATQA 2BI9A 1RV3A 3HLMA 1Z7DA 1O61A 1QZ9A 5EUDA 2DKBA 1M0QA 2DKJA 2VMRA 3LVJA 4F5HA 1TPLA 3DU4A 3I5TA 4HVKA 3VK2A 4ZM3A 3DR7A 1EQBA 4PFNA 1JF9A 2VGZA 2W7LA 2VMTA 1ASMA 3KE3A 3DR4A 4ZDPA 1G7XA 3I16A 4M2MA 1C7NA 2CJDA 1FG3A 3WKRA 4Y0IA 1QIRA 4FFCA 5G4IA 5HXXA 2X5DA 4H51A 3H9XA 2DGMA 1I41A 4WLJA 3RBFA 1LW5A 1B5PA 3KGWA 4JEXA 1CQ8A 4JEZA 4L0OA 5F8VA 5M4DA 3PIUA 1SZSA 4Q76A 1OHWA 4Q31A 2OATA 5F9SA 3AEMA 2R5CA 3GETA 1BQAA 2BYLA 2VLHA 2HUUA 3HVYA 4OC9A 1WYVB 3B46A 3GBXA 9AATA 3WZFA 3A2BA 1OHVA 2VLFA 2YKUA 3B1EA 3WLXA 3NDNA 2ZYJA 4OT8A 3HBXA 3QGUA 4PIWA 4UOYA 4ZDOA 1UKJA 3LWSA 4MQQA 5EUEA 4A0HA 2W7JA 4AOAA 4LW2A 3FD0A 3PDXA 3FCRA 4JF0A 3ATHA 3USFA 3G0TA 1IUGA 4AZJA 3LY1A 4E1OA 2AY7A 2WK8A 3E9KA 4XJMA 3L44A 2VI8A 2OGAA 4WD2A 5DX5A 3N4SA 4R2NA 1WYTA 1IAXA 4R5FA 1DGEA 1PG8A 4RKDA 2Z9VA 3MADA 1CZCA 1PMOA 1RVUA 3MBBA 1X2AA 1AMQA 1AY8A 1AHGA 2AEUA 2HORA 2OKJA 2O7CA 1WKHA 4ZSYA 1CQ7A 3AOVA 2W7MA 4I8AA 3ELPA 2D7ZA 2VGSA 1JG8A 3FVXA 2BIAA 4BQ0A 3RQ1A 2FKIA 5JAYA 3NU7A 3VK3A 4MY5A 1CQ6A 4B98A 3WGCA 4WP0A 2WK9A 4F5IA 2YCPA 1SPAA 2VIAA 3BS8A 3TQXA 5FT6A 3B8XA 2D63A 2W8TA 4ZLVA 2E7IA 2FM1A 2VMYA 4ZWVA 2JISA 1H1CA 4R5ZA 4WYDA 5KTBA 2YCTA 3UE8A 2VGVA 4ZAHA 2ZC0A 5LHAA 3E77A 3RBLA 3JWBA 3JWAA 4JEWA 2Z9WA 3LVMA 1QJ3A 1QITA 4JEVA 3AEJA 1B4XA 2Z9UA 1ZODA 3FSLA 4LNJA 1AMAA 2Z67A 1IX7A 1AAWA 3DXWA 4Y0HA 2VGWA 2ZSLA 1SF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5S A;  1CZE A;  2JJF A;  1GC0 A;  2AEV A;  5IWQ A;  3PD6 B;  4KYO A;  1C9C A;  2R5E A;  1TOG A;  4EB7 A;  3WY7 A;  4AO4 A;  4AH3 A;  2W8J A;  3LG0 A;  3E2Z B;  3RUY A;  2VMX A;  1UU2 A;  2W8U A;  2D65 A;  1M6S A;  1YJZ A;  5G09 A;  2C44 A;  1YIZ A;  2GMU A;  2VMP A;  3AV7 A;  3WGB A;  1Y4I A;  2JJE A;  3A8U X;  4EFF A;  4WBT A;  3W1J A;  1M32 A;  3N5M A;  1E5E A;  5EFS A;  3AEO A;  1GC3 A;  1JS6 A;  3OP7 A;  3GWP A;  2AAT A;  2VMZ A;  1B9I A;  2AY5 A;  3FQ8 A;  4ITG A;  1IVR A;  2BI5 A;  1ASF A;  1LS3 A;  1BT4 A;  2W7F A;  3NYS A;  1O4S A;  2AY6 A;  4F5F A;  2VMW A;  2VMU A;  3NTJ A;  3WX9 A;  1D7U A;  4A6T A;  3RCH A;  3H14 A;  2TPL A;  1BQD A;  3AEJ C;  2BWN A;  3UAK A;  3E2Z A;  1I43 A;  3BCA A;  3MAU A;  2AY1 A;  1PMM A;  1QGN A;  2D61 A;  2CH1 A;  3BB8 A;  1O62 A;  3CBF A;  3LVK A;  3VAX A;  4ADD A;  2HUI A;  5C6U A;  4IW7 A;  3AEM C;  2V1P A;  5EUN A;  1DFO A;  2R0T A;  3PD6 A;  3DXV A;  4JF1 A;  4A0R A;  3AOW A;  3CQ5 A;  1MDZ A;  1LC7 A;  3QM2 A;  2Z1Y A;  2HUF A;  2W8W A;  3D6K A;  5J8Q A;  1ASE A;  1TAT A;  3FVS A;  5D95 A;  4F5K A;  4ADE A;  1BS0 A;  1B5O A;  3LVL B;  2CIN A;  5BJ4 A;  3QBO A;  4OTL A;  1GC2 A;  1WKG A;  4WLH A;  3P1T A;  3BWN C;  2BIG A;  4P7Y A;  1AMR A;  1GBN A;  1TAR A;  1ART A;  3G8M A;  2YKY A;  4K2B A;  3TCM A;  3UWC A;  3HMU A;  3ZZK A;  2GMS A;  4IYO A;  1CJ0 A;  4ATP A;  2W7D A;  4BMK A;  1J04 A;  1CS1 A;  2E7J A;  1YOO A;  3HQT A;  3TAT A;  1LC8 A;  3TFT A;  1OXO A;  1B8G A;  2OKK A;  2W8V A;  2CB1 A;  2YOB A;  1YJY A;  4Q75 A;  3RI6 A;  2PB2 A;  4CBR A;  5DJ9 A;  3OKS A;  1J32 A;  4ZSW A;  5FT4 A;  4F5L A;  5HDM A;  2R2N A;  1FC4 A;  1W7N A;  4W1W A;  3FDD A;  3FFH A;  4MQR A;  1C7G A;  2CH2 A;  4JEY A;  1W7L A;  3BC8 A;  1QIS A;  3QI6 A;  4EU1 A;  1N8P A;  3AAT A;  2BYJ A;  3BWO A;  3VP6 A;  4E77 A;  4F5G A;  1MAP A;  1MGV A;  1X28 A;  2WKA A;  3WCO A;  1ASB A;  2YCN A;  5G0A A;  2ORD A;  1KMK A;  1WYT B;  2RFV A;  3DZZ A;  3A9X A;  1D7V A;  1BW0 A;  2X8U A;  4GE9 A;  1KKJ A;  5BJ3 A;  2HP2 A;  1AMS A;  3N0L A;  3PAA A;  1YNU A;  1JS3 A;  3G7Q A;  1LC5 A;  4GE7 A;  4PVF A;  4RIZ A;  1AHY A;  1SZK A;  2ZY3 A;  1AKA A;  3PDB B;  2CY8 A;  3B1C A;  4IY7 A;  4M2K A;  1M0N A;  2Z1Z A;  1AJS B;  1D7R A;  4M2J A;  1P3W A;  3EI6 A;  1XEY A;  4GDY A;  3ZZJ A;  1SZU A;  2FN6 A;  5G4J A;  3B1D A;  1N31 A;  1W23 A;  1AIC A;  4RJ0 A;  5DB5 A;  2DOU A;  1XI9 A;  1YAA A;  1PFF A;  1DJ9 A;  5M4B A;  1TOK A;  2EGY A;  3P6K A;  2X5F A;  8AAT A;  4DQ6 A;  1MLY A;  1G4X A;  1I29 A;  2AY2 A;  2JJH A;  4N0W A;  1OHY A;  3HDO A;  3JTX A;  1YIY A;  2FYF A;  1C0N A;  1KKP A;  3PDB A;  2OGE A;  4GRX A;  3VOM A;  2G6W A;  3JZL A;  4LC3 A;  4B9B A;  4GEB A;  2BI3 A;  2C0R A;  1AJR A;  2QMA A;  3BN1 A;  3FZ7 A;  3EZS A;  4MGR A;  4WB0 B;  4F5J A;  3MC6 C;  2QLR A;  4CXQ A;  3K28 A;  4WXG A;  3E2Y A;  4ZWM A;  2VYC A;  3PJ0 A;  5EIG B;  1BJO B;  4AZK A;  3GZC A;  1DKA A;  4WXF A;  5E5I A;  2O0R A;  1BJN A;  1LW4 A;  3ISL A;  1M7Y A;  3FDB A;  2W7G A;  4LW4 A;  4RJY A;  2D7Y A;  2D66 A;  2ZY5 A;  7AAT A;  1TAS A;  1WYV A;  2E54 A;  4ZM4 A;  1CL2 A;  4LNM A;  3FKD A;  4KXK A;  2BKW A;  1ASG A;  1MAQ A;  1ARH A;  1IX6 A;  1O69 A;  2QB2 A;  3F6T A;  4W5K A;  1V72 A;  3K7Y A;  1M0O A;  3AEL A;  4NOG A;  4BA5 A;  4OMA A;  2DR1 A;  1WST A;  4RAE A;  4WYF A;  2EZ1 A;  2ZY2 A;  3W1H A;  1AHF A;  4E3Q A;  3NRA A;  2YRI A;  2PO3 A;  3CAI A;  3N75 A;  5M46 A;  2EZ2 A;  1BJ4 A;  2JGT A;  3GJU A;  3BWN A;  3F0H A;  4UQV A;  4XEW A;  5M49 A;  2Q7W A;  1LK9 A;  3FTB A;  5G2Q A;  2EO5 A;  4UHN A;  4Q6R A;  3M5U A;  2EH6 A;  3IHJ A;  1GC4 A;  1QJ5 A;  1BJW A;  2BIE A;  4DGT A;  4W1V A;  3JW9 A;  1AAM A;  4IXZ A;  1DTY A;  1ARG A;  4UHM A;  3W1I A;  4O6Z A;  1MLZ A;  4K2I A;  2DGK A;  4KAM A;  3RCH B;  1M0P A;  2JJG A;  5EAA A;  5E3K A;  1AHX A;  1RVY A;  4EMY A;  1ECX A;  3FQA A;  2VMQ A;  1MDX A;  4EB5 A;  2Z20 A;  4W8I A;  2QA3 A;  3II0 A;  1S06 A;  4E3R A;  2NMP A;  3EIB A;  4FL0 A;  2ZP7 A;  3L8A A;  2XBN A;  4ITX A;  5G2P A;  4ADC A;  3HL2 A;  4W91 A;  4XK1 A;  4LNL A;  1BJO A;  1GCK A;  1ASD A;  3ELE A;  1MDO A;  1W3U A;  3FVU A;  4R8D A;  5EIG A;  1ASC A;  1VJO A;  3VK4 A;  3COG A;  2BWP A;  2ZUK A;  3PGY A;  4MSO A;  4JE5 A;  2XH1 A;  2C81 A;  3GR9 A;  3MKJ A;  1U08 A;  3ZRQ A;  3Q8N A;  3TFU A;  3AEP A;  4OYT A;  4WXB A;  2W7K A;  2JG2 A;  1S08 A;  5FT5 A;  2HOX A;  2CTZ A;  2QB3 A;  1BKG A;  2BI1 A;  4IXO A;  4A6R A;  2ZJG A;  5TF5 A;  3A9Z A;  3BCB A;  5FT8 A;  1GEX A;  3KGX A;  1E5F A;  2EPJ A;  4OBV A;  2X3L A;  1GDE A;  1D7S A;  3MEB A;  4ISY A;  4DBC A;  5HHY A;  1IJI A;  2GB3 A;  3EI9 A;  3F9T A;  4PFF A;  4JE5 D;  3LV2 A;  2CAN A;  1G4V A;  2BHX A;  3DOD A;  2FNI A;  2HP1 A;  2VI9 A;  3E6G A;  4TV7 A;  1I48 A;  1IAY A;  2YHK A;  2QBT A;  2PB0 A;  4U1T A;  3GZD A;  5K8B A;  2GSA A;  1CL1 A;  1V2F A;  3QN6 A;  1S0A A;  2VMS A;  4N0B A;  4BHD A;  1AIB A;  2CJH A;  2ZSM A;  3GSB A;  2V0Y A;  4A0F A;  5EAV A;  4AO9 A;  2E7U A;  3NNK A;  1N2T A;  1KL2 A;  3A9Y A;  1AJS A;  1TOE A;  4GSA A;  5LH9 A;  3PPL A;  3KKI A;  2ZY4 A;  4K2M A;  3DYD A;  3ASA A;  4WYA A;  1LKC A;  1WYU A;  4A6U A;  1ARI A;  3FQ7 A;  3MC6 A;  1ELQ A;  3H7F A;  3NYT A;  1GD9 A;  3DRD A;  3EI5 A;  3MAF A;  2D5Y A;  1OXP A;  1SVV A;  5DJ1 A;  3CQ6 A;  2CST A;  1B9H A;  2Z9X A;  2D64 A;  2W7E A;  4J5U A;  1DJE A;  2VGU A;  4OCA A;  1C7O A;  1D2F A;  4RLG A;  1UU0 A;  1SFF A;  1X29 A;  2F8J A;  2W7I A;  3AEN A;  5AX8 A;  3FZ8 A;  1T3I A;  2VGT A;  3NU8 A;  4IX8 A;  4XJP A;  1ASA A;  2HOZ A;  4WYE A;  3WKS A;  2OQX A;  3NUB A;  3NX3 A;  1IX8 A;  2C7T A;  4J8L A;  3BV0 A;  3JU7 A;  1ARS A;  2WK7 A;  1AKC A;  3ASB A;  4RM1 A;  1S07 A;  1DGD A;  1AIA A;  1TOI A;  1S09 A;  2FNU A;  2VMV A;  4IXS A;  3FZ6 A;  1AX4 A;  2AY9 A;  1WYU B;  2FQ6 A;  4XJO A;  4A72 A;  1EG5 A;  1KL1 A;  1V2D A;  1AKB A;  1AY4 A;  2CJG A;  4MKJ A;  1VP4 A;  3EUC A;  4OBU A;  4IYO B;  4UHO A;  3ECD A;  4HF8 A;  5I92 A;  4ZAS A;  3GZD C;  4MQP A;  3CQ4 A;  1AY5 A;  1G7W A;  1IBJ A;  4ADB A;  1OAT A;  2DGL A;  4P3M A;  4CVQ A;  2O1B A;  1C4K A;  2VMN A;  5EQC A;  1H0C A;  4W1X A;  2YRR A;  4RKC A;  3I4J A;  3K40 A;  3ACZ A;  3HT4 A;  2R5C B;  3EI7 A;  4CBS A;  3QHX A;  2AY3 A;  3E2F A;  3BCX A;  2VIB A;  1VEF A;  3NYU A;  4TN4 A;  1FG7 A;  4GE4 A;  4WYC A;  3T32 A;  1V2E A;  1ZOB A;  1UU1 A;  4WYG A;  4F5M A;  3ZRP A;  1DJU A;  1X0M A;  3MAF B;  1Z3Z A;  1RV4 A;  1GEY A;  3EI8 A;  2VMO A;  4WB0 A;  1ASL A;  3ZRR A;  1ELU A;  3NUI A;  1AHE A;  3PA9 A;  1ASN A;  3R4T A;  2W7H A;  4XAU A;  3R9A A;  3AEN B;  3WCN A;  1ZC9 A;  3QPG A;  4RIT A;  2HOY A;  4Y0D A;  2AY4 A;  5E4Z A;  4A0G A;  1W7M A;  2GQN A;  4TMR A;  3EIA A;  1EJI A;  4F4E A;  1GEW A;  1KMJ A;  2HZP A;  1M4N A;  2BWO A;  2CFB A;  3FFR A;  4U2H A;  4XJL A;  4XQ2 A;  4CXR A;  4QGR A;  1ORD A;  1TOJ A;  2YKX A;  3FRK A;  3EZ1 A;  3IF2 A;  2BI2 A;  4MKK A;  4ZDL A;  2AY8 A;  2YKV A;  3DC1 A;  2Z61 A;  4A00 A;  4BA4 A;  1YJS A;  4ATQ A;  2BI9 A;  1RV3 A;  3HLM A;  1Z7D A;  1O61 A;  1QZ9 A;  5EUD A;  2DKB A;  1M0Q A;  2DKJ A;  2VMR A;  3LVJ A;  4F5H A;  1TPL A;  3DU4 A;  3I5T A;  4HVK A;  3VK2 A;  4ZM3 A;  3DR7 A;  1EQB A;  4PFN A;  1JF9 A;  2VGZ A;  2W7L A;  2VMT A;  1ASM A;  3KE3 A;  3DR4 A;  4ZDP A;  1G7X A;  3I16 A;  4M2M A;  1C7N A;  2CJD A;  1FG3 A;  3WKR A;  4Y0I A;  1QIR A;  4FFC A;  5G4I A;  5HXX A;  2X5D A;  4H51 A;  2DGM A;  1I41 A;  4WLJ A;  3RBF A;  1LW5 A;  1B5P A;  3KGW A;  4JEX A;  1CQ8 A;  4JEZ A;  4L0O A;  5F8V A;  5M4D A;  3PIU A;  1SZS A;  4Q76 A;  1OHW A;  4Q31 A;  2OAT A;  5F9S A;  3AEM A;  2R5C A;  3GET A;  1BQA A;  2BYL A;  2VLH A;  2HUU A;  3HVY A;  4OC9 A;  1WYV B;  3B46 A;  3GBX A;  9AAT A;  3WZF A;  3A2B A;  1OHV A;  2VLF A;  2YKU A;  3B1E A;  3WLX A;  3NDN A;  2ZYJ A;  4OT8 A;  3HBX A;  3QGU A;  4PIW A;  4UOY A;  4ZDO A;  1UKJ A;  3LWS A;  4MQQ A;  5EUE A;  4A0H A;  2W7J A;  4AOA A;  4LW2 A;  3FD0 A;  3PDX A;  3FCR A;  4JF0 A;  3ATH A;  3USF A;  3G0T A;  1IUG A;  4AZJ A;  3LY1 A;  4E1O A;  2AY7 A;  2WK8 A;  3E9K A;  4XJM A;  3L44 A;  2VI8 A;  2OGA A;  4WD2 A;  5DX5 A;  4R2N A;  1WYT A;  1IAX A;  4R5F A;  1DGE A;  1PG8 A;  4RKD A;  2Z9V A;  3MAD A;  1CZC A;  1PMO A;  1RVU A;  3MBB A;  1X2A A;  1AMQ A;  1AY8 A;  1AHG A;  2AEU A;  2HOR A;  2OKJ A;  2O7C A;  1WKH A;  4ZSY A;  1CQ7 A;  3AOV A;  2W7M A;  4I8A A;  3ELP A;  2D7Z A;  2VGS A;  1JG8 A;  3FVX A;  2BIA A;  4BQ0 A;  3RQ1 A;  5JAY A;  3NU7 A;  3VK3 A;  4MY5 A;  1CQ6 A;  4B98 A;  3WGC A;  4WP0 A;  2WK9 A;  4F5I A;  2YCP A;  1SPA A;  2VIA A;  3BS8 A;  3TQX A;  5FT6 A;  3B8X A;  2D63 A;  2W8T A;  4ZLV A;  2E7I A;  2FM1 A;  2VMY A;  4ZWV A;  2JIS A;  1H1C A;  4R5Z A;  4WYD A;  2YCT A;  3UE8 A;  2VGV A;  4ZAH A;  2ZC0 A;  5LHA A;  3E77 A;  3RBL A;  3JWB A;  3JWA A;  4JEW A;  2Z9W A;  3LVM A;  1QJ3 A;  1QIT A;  4JEV A;  3AEJ A;  1B4X A;  2Z9U A;  1ZOD A;  3FSL A;  4LNJ A;  1AMA A;  2Z67 A;  1IX7 A;  1AAW A;  3DXW A;  4Y0H A;  2VGW A;  2ZSL A;  1SF2 A; 
#chains in the Genus database with same CATH topology
 5D5S A;  1CZE A;  2JJF A;  1GC0 A;  2AEV A;  5IWQ A;  3PD6 B;  4KYO A;  1C9C A;  2R5E A;  1TOG A;  4EB7 A;  3WY7 A;  4AO4 A;  4AH3 A;  2W8J A;  3LG0 A;  3E2Z B;  3RUY A;  2VMX A;  1UU2 A;  2W8U A;  2D65 A;  1M6S A;  1YJZ A;  5G09 A;  2C44 A;  1YIZ A;  2GMU A;  2VMP A;  3AV7 A;  3WGB A;  1Y4I A;  2JJE A;  3A8U X;  4EFF A;  4WBT A;  3W1J A;  1M32 A;  4K05 A;  3N5M A;  1E5E A;  5EFS A;  3AEO A;  1GC3 A;  1JS6 A;  3OP7 A;  3GWP A;  2AAT A;  2VMZ A;  1B9I A;  2AY5 A;  3FQ8 A;  4ITG A;  1IVR A;  2BI5 A;  2QSR A;  1ASF A;  1LS3 A;  1BT4 A;  2W7F A;  3NYS A;  1O4S A;  2AY6 A;  4F5F A;  2VMW A;  2VMU A;  3NTJ A;  3WX9 A;  1D7U A;  4A6T A;  2EYQ A;  3RCH A;  3H14 A;  2TPL A;  1BQD A;  3AEJ C;  2BWN A;  3UAK A;  3E2Z A;  1I43 A;  3BCA A;  3MAU A;  2AY1 A;  1PMM A;  1QGN A;  2D61 A;  2CH1 A;  3BB8 A;  1O62 A;  3CBF A;  3LVK A;  3VAX A;  4ADD A;  2HUI A;  5C6U A;  4IW7 A;  3AEM C;  2V1P A;  5EUN A;  1DFO A;  2R0T A;  3PD6 A;  3DXV A;  4JF1 A;  4A0R A;  3AOW A;  3CQ5 A;  1MDZ A;  1LC7 A;  3QM2 A;  2Z1Y A;  2HUF A;  2W8W A;  3D6K A;  5J8Q A;  1ASE A;  1TAT A;  3FVS A;  5D95 A;  4F5K A;  4ADE A;  1BS0 A;  1B5O A;  3LVL B;  2CIN A;  5BJ4 A;  3QBO A;  4OTL A;  1GC2 A;  1WKG A;  4WLH A;  3P1T A;  3BWN C;  2BIG A;  4P7Y A;  1AMR A;  1GBN A;  1TAR A;  1ART A;  3G8M A;  2YKY A;  4K2B A;  3TCM A;  3UWC A;  3HMU A;  3ZZK A;  2GMS A;  4IYO A;  1CJ0 A;  4ATP A;  2W7D A;  4BMK A;  1J04 A;  1CS1 A;  2E7J A;  1YOO A;  3HQT A;  3TAT A;  1LC8 A;  3TFT A;  1OXO A;  4H63 Q;  1B8G A;  2OKK A;  2W8V A;  2CB1 A;  2YOB A;  1YJY A;  4Q75 A;  3RI6 A;  2PB2 A;  4CBR A;  5DJ9 A;  3OKS A;  1J32 A;  4ZSW A;  5FT4 A;  4F5L A;  5HDM A;  2R2N A;  1FC4 A;  1W7N A;  4W1W A;  3FDD A;  3FFH A;  4MQR A;  1C7G A;  2CH2 A;  4JEY A;  1W7L A;  3BC8 A;  1QIS A;  3QI6 A;  4EU1 A;  1N8P A;  3AAT A;  2BYJ A;  3BWO A;  3VP6 A;  4E77 A;  4F5G A;  1MAP A;  1MGV A;  1X28 A;  2WKA A;  3WCO A;  1ASB A;  2YCN A;  5G0A A;  2ORD A;  1KMK A;  1WYT B;  2RFV A;  3DZZ A;  3A9X A;  1D7V A;  1BW0 A;  2X8U A;  4GE9 A;  1KKJ A;  5BJ3 A;  2HP2 A;  1AMS A;  3N0L A;  3PAA A;  1YNU A;  1JS3 A;  3G7Q A;  1LC5 A;  4GE7 A;  4PVF A;  4RIZ A;  1AHY A;  1SZK A;  2ZY3 A;  1AKA A;  3PDB B;  2CY8 A;  3B1C A;  2A1V A;  4IY7 A;  4M2K A;  1M0N A;  2Z1Z A;  1AJS B;  1D7R A;  4M2J A;  1P3W A;  3EI6 A;  1XEY A;  4GDY A;  3ZZJ A;  1SZU A;  2FN6 A;  5G4J A;  3B1D A;  1N31 A;  1W23 A;  1AIC A;  4RJ0 A;  5DB5 A;  2DOU A;  1XI9 A;  1YAA A;  1PFF A;  1DJ9 A;  5M4B A;  1TOK A;  2EGY A;  3P6K A;  2X5F A;  8AAT A;  4DQ6 A;  1MLY A;  1G4X A;  1I29 A;  2AY2 A;  2JJH A;  4N0W A;  1OHY A;  3HDO A;  3JTX A;  1YIY A;  2FYF A;  1C0N A;  1KKP A;  3PDB A;  2OGE A;  4GRX A;  3VOM A;  2G6W A;  3JZL A;  4LC3 A;  4B9B A;  4GEB A;  2BI3 A;  2C0R A;  1AJR A;  2QMA A;  3BN1 A;  3FZ7 A;  3EZS A;  4MGR A;  4WB0 B;  4F5J A;  3MC6 C;  2QLR A;  4CXQ A;  3K28 A;  4WXG A;  3E2Y A;  4ZWM A;  2VYC A;  3PJ0 A;  5EIG B;  1BJO B;  4AZK A;  3GZC A;  1DKA A;  4WXF A;  5E5I A;  2O0R A;  1BJN A;  3N4X A;  1LW4 A;  3ISL A;  1M7Y A;  3FDB A;  2W7G A;  4LW4 A;  4RJY A;  2D7Y A;  2D66 A;  2ZY5 A;  7AAT A;  1TAS A;  1WYV A;  2E54 A;  4ZM4 A;  1CL2 A;  4LNM A;  3FKD A;  4KXK A;  2BKW A;  1ASG A;  1MAQ A;  1ARH A;  1IX6 A;  1O69 A;  2QB2 A;  3F6T A;  4W5K A;  1V72 A;  3K7Y A;  1M0O A;  3AEL A;  4NOG A;  4BA5 A;  4OMA A;  2DR1 A;  1WST A;  4RAE A;  4WYF A;  2EZ1 A;  2ZY2 A;  3W1H A;  1AHF A;  4E3Q A;  3NRA A;  2YRI A;  2PO3 A;  3CAI A;  3N75 A;  2KFP A;  5M46 A;  2EZ2 A;  1BJ4 A;  2JGT A;  3GJU A;  3BWN A;  3F0H A;  4UQV A;  4XEW A;  5M49 A;  2Q7W A;  1LK9 A;  3FTB A;  5G2Q A;  2EO5 A;  4UHN A;  4Q6R A;  3M5U A;  2EH6 A;  3IHJ A;  1GC4 A;  1QJ5 A;  1BJW A;  2BIE A;  4DGT A;  2G7J A;  4W1V A;  3JW9 A;  1AAM A;  4IXZ A;  1KAF A;  3N4R A;  1DTY A;  1ARG A;  4UHM A;  3W1I A;  4O6Z A;  1MLZ A;  4K2I A;  2DGK A;  4KAM A;  3RCH B;  1M0P A;  2JJG A;  5EAA A;  5E3K A;  1AHX A;  1RVY A;  4EMY A;  1ECX A;  3FQA A;  2VMQ A;  1MDX A;  4EB5 A;  2Z20 A;  4W8I A;  2QA3 A;  3II0 A;  1S06 A;  4E3R A;  2NMP A;  3EIB A;  4FL0 A;  2ZP7 A;  3L8A A;  2XBN A;  4ITX A;  5G2P A;  4ADC A;  3HL2 A;  4W91 A;  4XK1 A;  4LNL A;  1BJO A;  1GCK A;  1ASD A;  3ELE A;  1MDO A;  1W3U A;  3FVU A;  4R8D A;  5EIG A;  1ASC A;  1VJO A;  3VK4 A;  3COG A;  2BWP A;  2ZUK A;  3PGY A;  4MSO A;  4JE5 A;  2XH1 A;  2C81 A;  3GR9 A;  3MKJ A;  1U08 A;  3ZRQ A;  3Q8N A;  3TFU A;  3AEP A;  4OYT A;  4WXB A;  2W7K A;  2JG2 A;  1S08 A;  5FT5 A;  2HOX A;  2CTZ A;  2QB3 A;  1BKG A;  2BI1 A;  4IXO A;  4A6R A;  2ZJG A;  5TF5 A;  3A9Z A;  3BCB A;  5FT8 A;  1GEX A;  3KGX A;  1E5F A;  2EPJ A;  4OBV A;  2X3L A;  1GDE A;  1D7S A;  3MEB A;  4ISY A;  4DBC A;  5HHY A;  1IJI A;  2GB3 A;  3EI9 A;  3F9T A;  4PFF A;  4JE5 D;  3LV2 A;  2CAN A;  1G4V A;  2BHX A;  3DOD A;  2FNI A;  2HP1 A;  2VI9 A;  3E6G A;  4TV7 A;  1I48 A;  1IAY A;  2YHK A;  2QBT A;  2PB0 A;  4U1T A;  3GZD A;  5K8B A;  2GSA A;  1CL1 A;  1V2F A;  3QN6 A;  1S0A A;  2VMS A;  4N0B A;  4BHD A;  1AIB A;  2CJH A;  2ZSM A;  3GSB A;  2V0Y A;  4A0F A;  5EAV A;  4AO9 A;  2E7U A;  3NNK A;  1N2T A;  1KL2 A;  3A9Y A;  1AJS A;  1TOE A;  4GSA A;  5LH9 A;  3PPL A;  3KKI A;  2ZY4 A;  4K2M A;  3DYD A;  3ASA A;  4WYA A;  1LKC A;  1WYU A;  4A6U A;  1ARI A;  3FQ7 A;  3MC6 A;  2WB6 A;  1ELQ A;  3H7F A;  3NYT A;  1GD9 A;  3DRD A;  3EI5 A;  3MAF A;  2D5Y A;  1OXP A;  1SVV A;  5DJ1 A;  3CQ6 A;  2CST A;  1B9H A;  2Z9X A;  2D64 A;  2W7E A;  4J5U A;  1DJE A;  2VGU A;  4OCA A;  1C7O A;  1D2F A;  4RLG A;  1UU0 A;  1SFF A;  1X29 A;  2F8J A;  2W7I A;  3AEN A;  5AX8 A;  3FZ8 A;  1T3I A;  2VGT A;  3NU8 A;  4IX8 A;  4XJP A;  1ASA A;  2HOZ A;  4WYE A;  3WKS A;  2OQX A;  3NUB A;  3NX3 A;  1IX8 A;  2C7T A;  4J8L A;  3BV0 A;  3JU7 A;  1ARS A;  2WK7 A;  1AKC A;  3ASB A;  4RM1 A;  1S07 A;  1DGD A;  1AIA A;  1TOI A;  1S09 A;  2FNU A;  2VMV A;  4IXS A;  3FZ6 A;  1AX4 A;  2AY9 A;  1WYU B;  2FQ6 A;  4XJO A;  4A72 A;  1EG5 A;  1KL1 A;  1V2D A;  1AKB A;  1AY4 A;  2CJG A;  4MKJ A;  1VP4 A;  3EUC A;  4OBU A;  4IYO B;  4UHO A;  3ECD A;  4HF8 A;  5I92 A;  4ZAS A;  3GZD C;  4MQP A;  3CQ4 A;  1AY5 A;  1G7W A;  1IBJ A;  4ADB A;  1OAT A;  2DGL A;  4P3M A;  4CVQ A;  2O1B A;  1C4K A;  2VMN A;  5EQC A;  1H0C A;  4W1X A;  2YRR A;  4RKC A;  3I4J A;  3K40 A;  3ACZ A;  3HT4 A;  2R5C B;  3EI7 A;  4CBS A;  3QHX A;  2AY3 A;  3E2F A;  3BCX A;  2VIB A;  1VEF A;  3NYU A;  4TN4 A;  1FG7 A;  4GE4 A;  4WYC A;  3T32 A;  1V2E A;  3N7N A;  1ZOB A;  1UU1 A;  4WYG A;  4F5M A;  3ZRP A;  1DJU A;  1X0M A;  3MAF B;  1Z3Z A;  1RV4 A;  1GEY A;  3EI8 A;  2VMO A;  4WB0 A;  1ASL A;  3ZRR A;  1ELU A;  3NUI A;  1AHE A;  3PA9 A;  1ASN A;  3R4T A;  2W7H A;  4XAU A;  3R9A A;  3AEN B;  3WCN A;  1ZC9 A;  3QPG A;  4RIT A;  2HOY A;  4Y0D A;  2AY4 A;  5E4Z A;  4A0G A;  1W7M A;  2GQN A;  4TMR A;  3EIA A;  1EJI A;  4F4E A;  1GEW A;  1KMJ A;  2HZP A;  1M4N A;  2BWO A;  2CFB A;  3FFR A;  4U2H A;  4XJL A;  4XQ2 A;  4CXR A;  4QGR A;  1ORD A;  1TOJ A;  2YKX A;  3FRK A;  3EZ1 A;  3IF2 A;  2BI2 A;  4MKK A;  4ZDL A;  2AY8 A;  2YKV A;  3DC1 A;  2Z61 A;  4A00 A;  4BA4 A;  1YJS A;  4ATQ A;  2BI9 A;  1RV3 A;  3HLM A;  1Z7D A;  1O61 A;  1QZ9 A;  5EUD A;  2DKB A;  1M0Q A;  2DKJ A;  2VMR A;  3LVJ A;  4F5H A;  1TPL A;  3DU4 A;  3I5T A;  4HVK A;  3VK2 A;  4ZM3 A;  3DR7 A;  1EQB A;  4PFN A;  1JF9 A;  2VGZ A;  2W7L A;  2VMT A;  1ASM A;  3KE3 A;  3DR4 A;  4ZDP A;  1G7X A;  3I16 A;  4M2M A;  1C7N A;  2CJD A;  1FG3 A;  3WKR A;  4Y0I A;  1QIR A;  4FFC A;  5G4I A;  5HXX A;  2X5D A;  4H51 A;  3H9X A;  2DGM A;  1I41 A;  4WLJ A;  3RBF A;  1LW5 A;  1B5P A;  3KGW A;  4JEX A;  1CQ8 A;  4JEZ A;  4L0O A;  5F8V A;  5M4D A;  3PIU A;  1SZS A;  4Q76 A;  1OHW A;  4Q31 A;  2OAT A;  5F9S A;  3AEM A;  2R5C A;  3GET A;  1BQA A;  2BYL A;  2VLH A;  2HUU A;  3HVY A;  4OC9 A;  1WYV B;  3B46 A;  3GBX A;  9AAT A;  3WZF A;  3A2B A;  1OHV A;  2VLF A;  2YKU A;  3B1E A;  3WLX A;  3NDN A;  2ZYJ A;  4OT8 A;  3HBX A;  3QGU A;  4PIW A;  4UOY A;  4ZDO A;  1UKJ A;  3LWS A;  4MQQ A;  5EUE A;  4A0H A;  2W7J A;  4AOA A;  4LW2 A;  3FD0 A;  3PDX A;  3FCR A;  4JF0 A;  3ATH A;  3USF A;  3G0T A;  1IUG A;  4AZJ A;  3LY1 A;  4E1O A;  2AY7 A;  2WK8 A;  3E9K A;  4XJM A;  3L44 A;  2VI8 A;  2OGA A;  4WD2 A;  5DX5 A;  3N4S A;  4R2N A;  1WYT A;  1IAX A;  4R5F A;  1DGE A;  1PG8 A;  4RKD A;  2Z9V A;  3MAD A;  1CZC A;  1PMO A;  1RVU A;  3MBB A;  1X2A A;  1AMQ A;  1AY8 A;  1AHG A;  2AEU A;  2HOR A;  2OKJ A;  2O7C A;  1WKH A;  4ZSY A;  1CQ7 A;  3AOV A;  2W7M A;  4I8A A;  3ELP A;  2D7Z A;  2VGS A;  1JG8 A;  3FVX A;  2BIA A;  4BQ0 A;  3RQ1 A;  2FKI A;  5JAY A;  3NU7 A;  3VK3 A;  4MY5 A;  1CQ6 A;  4B98 A;  3WGC A;  4WP0 A;  2WK9 A;  4F5I A;  2YCP A;  1SPA A;  2VIA A;  3BS8 A;  3TQX A;  5FT6 A;  3B8X A;  2D63 A;  2W8T A;  4ZLV A;  2E7I A;  2FM1 A;  2VMY A;  4ZWV A;  2JIS A;  1H1C A;  4R5Z A;  4WYD A;  5KTB A;  2YCT A;  3UE8 A;  2VGV A;  4ZAH A;  2ZC0 A;  5LHA A;  3E77 A;  3RBL A;  3JWB A;  3JWA A;  4JEW A;  2Z9W A;  3LVM A;  1QJ3 A;  1QIT A;  4JEV A;  3AEJ A;  1B4X A;  2Z9U A;  1ZOD A;  3FSL A;  4LNJ A;  1AMA A;  2Z67 A;  1IX7 A;  1AAW A;  3DXW A;  4Y0H A;  2VGW A;  2ZSL A;  1SF2 A; 
#chains in the Genus database with same CATH homology
 5D5S A;  1CZE A;  2JJF A;  1GC0 A;  2AEV A;  5IWQ A;  3PD6 B;  4KYO A;  1C9C A;  2R5E A;  1TOG A;  4EB7 A;  3WY7 A;  4AO4 A;  4AH3 A;  2W8J A;  3LG0 A;  3E2Z B;  3RUY A;  2VMX A;  1UU2 A;  2W8U A;  2D65 A;  1M6S A;  1YJZ A;  5G09 A;  2C44 A;  1YIZ A;  2GMU A;  2VMP A;  3AV7 A;  3WGB A;  1Y4I A;  2JJE A;  3A8U X;  4EFF A;  4WBT A;  3W1J A;  1M32 A;  4K05 A;  3N5M A;  1E5E A;  5EFS A;  3AEO A;  1GC3 A;  1JS6 A;  3OP7 A;  3GWP A;  2AAT A;  2VMZ A;  1B9I A;  2AY5 A;  3FQ8 A;  4ITG A;  1IVR A;  2BI5 A;  2QSR A;  1ASF A;  1LS3 A;  1BT4 A;  2W7F A;  3NYS A;  1O4S A;  2AY6 A;  4F5F A;  2VMW A;  2VMU A;  3NTJ A;  3WX9 A;  1D7U A;  4A6T A;  2EYQ A;  3RCH A;  3H14 A;  2TPL A;  1BQD A;  3AEJ C;  2BWN A;  3UAK A;  3E2Z A;  1I43 A;  3BCA A;  3MAU A;  2AY1 A;  1PMM A;  1QGN A;  2D61 A;  2CH1 A;  3BB8 A;  1O62 A;  3CBF A;  3LVK A;  3VAX A;  4ADD A;  2HUI A;  5C6U A;  4IW7 A;  3AEM C;  2V1P A;  5EUN A;  1DFO A;  2R0T A;  3PD6 A;  3DXV A;  4JF1 A;  4A0R A;  3AOW A;  3CQ5 A;  1MDZ A;  1LC7 A;  3QM2 A;  2Z1Y A;  2HUF A;  2W8W A;  3D6K A;  5J8Q A;  1ASE A;  1TAT A;  3FVS A;  5D95 A;  4F5K A;  4ADE A;  1BS0 A;  1B5O A;  3LVL B;  2CIN A;  5BJ4 A;  3QBO A;  4OTL A;  1GC2 A;  1WKG A;  4WLH A;  3P1T A;  3BWN C;  2BIG A;  4P7Y A;  1AMR A;  1GBN A;  1TAR A;  1ART A;  3G8M A;  2YKY A;  4K2B A;  3TCM A;  3UWC A;  3HMU A;  3ZZK A;  2GMS A;  4IYO A;  1CJ0 A;  4ATP A;  2W7D A;  4BMK A;  1J04 A;  1CS1 A;  2E7J A;  1YOO A;  3HQT A;  3TAT A;  1LC8 A;  3TFT A;  1OXO A;  4H63 Q;  1B8G A;  2OKK A;  2W8V A;  2CB1 A;  2YOB A;  1YJY A;  4Q75 A;  3RI6 A;  2PB2 A;  4CBR A;  5DJ9 A;  3OKS A;  1J32 A;  4ZSW A;  5FT4 A;  4F5L A;  5HDM A;  2R2N A;  1FC4 A;  1W7N A;  4W1W A;  3FDD A;  3FFH A;  4MQR A;  1C7G A;  2CH2 A;  4JEY A;  1W7L A;  3BC8 A;  1QIS A;  3QI6 A;  4EU1 A;  1N8P A;  3AAT A;  2BYJ A;  3BWO A;  3VP6 A;  4E77 A;  4F5G A;  1MAP A;  1MGV A;  1X28 A;  2WKA A;  3WCO A;  1ASB A;  2YCN A;  5G0A A;  2ORD A;  1KMK A;  1WYT B;  2RFV A;  3DZZ A;  3A9X A;  1D7V A;  1BW0 A;  2X8U A;  4GE9 A;  1KKJ A;  5BJ3 A;  2HP2 A;  1AMS A;  3N0L A;  3PAA A;  1YNU A;  1JS3 A;  3G7Q A;  1LC5 A;  4GE7 A;  4PVF A;  4RIZ A;  1AHY A;  1SZK A;  2ZY3 A;  1AKA A;  3PDB B;  2CY8 A;  3B1C A;  2A1V A;  4IY7 A;  4M2K A;  1M0N A;  2Z1Z A;  1AJS B;  1D7R A;  4M2J A;  1P3W A;  3EI6 A;  1XEY A;  4GDY A;  3ZZJ A;  1SZU A;  2FN6 A;  5G4J A;  3B1D A;  1N31 A;  1W23 A;  1AIC A;  4RJ0 A;  5DB5 A;  2DOU A;  1XI9 A;  1YAA A;  1PFF A;  1DJ9 A;  5M4B A;  1TOK A;  2EGY A;  3P6K A;  2X5F A;  8AAT A;  4DQ6 A;  1MLY A;  1G4X A;  1I29 A;  2AY2 A;  2JJH A;  4N0W A;  1OHY A;  3HDO A;  3JTX A;  1YIY A;  2FYF A;  1C0N A;  1KKP A;  3PDB A;  2OGE A;  4GRX A;  3VOM A;  2G6W A;  3JZL A;  4LC3 A;  4B9B A;  4GEB A;  2BI3 A;  2C0R A;  1AJR A;  2QMA A;  3BN1 A;  3FZ7 A;  3EZS A;  4MGR A;  4WB0 B;  4F5J A;  3MC6 C;  2QLR A;  4CXQ A;  3K28 A;  4WXG A;  3E2Y A;  4ZWM A;  2VYC A;  3PJ0 A;  5EIG B;  1BJO B;  4AZK A;  3GZC A;  1DKA A;  4WXF A;  5E5I A;  2O0R A;  1BJN A;  3N4X A;  1LW4 A;  3ISL A;  1M7Y A;  3FDB A;  2W7G A;  4LW4 A;  4RJY A;  2D7Y A;  2D66 A;  2ZY5 A;  7AAT A;  1TAS A;  1WYV A;  2E54 A;  4ZM4 A;  1CL2 A;  4LNM A;  3FKD A;  4KXK A;  2BKW A;  1ASG A;  1MAQ A;  1ARH A;  1IX6 A;  1O69 A;  2QB2 A;  3F6T A;  4W5K A;  1V72 A;  3K7Y A;  1M0O A;  3AEL A;  4NOG A;  4BA5 A;  4OMA A;  2DR1 A;  1WST A;  4RAE A;  4WYF A;  2EZ1 A;  2ZY2 A;  3W1H A;  1AHF A;  4E3Q A;  3NRA A;  2YRI A;  2PO3 A;  3CAI A;  3N75 A;  2KFP A;  5M46 A;  2EZ2 A;  1BJ4 A;  2JGT A;  3GJU A;  3BWN A;  3F0H A;  4UQV A;  4XEW A;  5M49 A;  2Q7W A;  1LK9 A;  3FTB A;  5G2Q A;  2EO5 A;  4UHN A;  4Q6R A;  3M5U A;  2EH6 A;  3IHJ A;  1GC4 A;  1QJ5 A;  1BJW A;  2BIE A;  4DGT A;  2G7J A;  4W1V A;  3JW9 A;  1AAM A;  4IXZ A;  3N4R A;  1DTY A;  1ARG A;  4UHM A;  3W1I A;  4O6Z A;  1MLZ A;  4K2I A;  2DGK A;  4KAM A;  3RCH B;  1M0P A;  2JJG A;  5EAA A;  5E3K A;  1AHX A;  1RVY A;  4EMY A;  1ECX A;  3FQA A;  2VMQ A;  1MDX A;  4EB5 A;  2Z20 A;  4W8I A;  2QA3 A;  3II0 A;  1S06 A;  4E3R A;  2NMP A;  3EIB A;  4FL0 A;  2ZP7 A;  3L8A A;  2XBN A;  4ITX A;  5G2P A;  4ADC A;  3HL2 A;  4W91 A;  4XK1 A;  4LNL A;  1BJO A;  1GCK A;  1ASD A;  3ELE A;  1MDO A;  1W3U A;  3FVU A;  4R8D A;  5EIG A;  1ASC A;  1VJO A;  3VK4 A;  3COG A;  2BWP A;  2ZUK A;  3PGY A;  4MSO A;  4JE5 A;  2XH1 A;  2C81 A;  3GR9 A;  3MKJ A;  1U08 A;  3ZRQ A;  3Q8N A;  3TFU A;  3AEP A;  4OYT A;  4WXB A;  2W7K A;  2JG2 A;  1S08 A;  5FT5 A;  2HOX A;  2CTZ A;  2QB3 A;  1BKG A;  2BI1 A;  4IXO A;  4A6R A;  2ZJG A;  5TF5 A;  3A9Z A;  3BCB A;  5FT8 A;  1GEX A;  3KGX A;  1E5F A;  2EPJ A;  4OBV A;  2X3L A;  1GDE A;  1D7S A;  3MEB A;  4ISY A;  4DBC A;  5HHY A;  1IJI A;  2GB3 A;  3EI9 A;  3F9T A;  4PFF A;  4JE5 D;  3LV2 A;  2CAN A;  1G4V A;  2BHX A;  3DOD A;  2FNI A;  2HP1 A;  2VI9 A;  3E6G A;  4TV7 A;  1I48 A;  1IAY A;  2YHK A;  2QBT A;  2PB0 A;  4U1T A;  3GZD A;  5K8B A;  2GSA A;  1CL1 A;  1V2F A;  3QN6 A;  1S0A A;  2VMS A;  4N0B A;  4BHD A;  1AIB A;  2CJH A;  2ZSM A;  3GSB A;  2V0Y A;  4A0F A;  5EAV A;  4AO9 A;  2E7U A;  3NNK A;  1N2T A;  1KL2 A;  3A9Y A;  1AJS A;  1TOE A;  4GSA A;  5LH9 A;  3PPL A;  3KKI A;  2ZY4 A;  4K2M A;  3DYD A;  3ASA A;  4WYA A;  1LKC A;  1WYU A;  4A6U A;  1ARI A;  3FQ7 A;  3MC6 A;  2WB6 A;  1ELQ A;  3H7F A;  3NYT A;  1GD9 A;  3DRD A;  3EI5 A;  3MAF A;  2D5Y A;  1OXP A;  1SVV A;  5DJ1 A;  3CQ6 A;  2CST A;  1B9H A;  2Z9X A;  2D64 A;  2W7E A;  4J5U A;  1DJE A;  2VGU A;  4OCA A;  1C7O A;  1D2F A;  4RLG A;  1UU0 A;  1SFF A;  1X29 A;  2F8J A;  2W7I A;  3AEN A;  5AX8 A;  3FZ8 A;  1T3I A;  2VGT A;  3NU8 A;  4IX8 A;  4XJP A;  1ASA A;  2HOZ A;  4WYE A;  3WKS A;  2OQX A;  3NUB A;  3NX3 A;  1IX8 A;  2C7T A;  4J8L A;  3BV0 A;  3JU7 A;  1ARS A;  2WK7 A;  1AKC A;  3ASB A;  4RM1 A;  1S07 A;  1DGD A;  1AIA A;  1TOI A;  1S09 A;  2FNU A;  2VMV A;  4IXS A;  3FZ6 A;  1AX4 A;  2AY9 A;  1WYU B;  2FQ6 A;  4XJO A;  4A72 A;  1EG5 A;  1KL1 A;  1V2D A;  1AKB A;  1AY4 A;  2CJG A;  4MKJ A;  1VP4 A;  3EUC A;  4OBU A;  4IYO B;  4UHO A;  3ECD A;  4HF8 A;  5I92 A;  4ZAS A;  3GZD C;  4MQP A;  3CQ4 A;  1AY5 A;  1G7W A;  1IBJ A;  4ADB A;  1OAT A;  2DGL A;  4P3M A;  4CVQ A;  2O1B A;  1C4K A;  2VMN A;  5EQC A;  1H0C A;  4W1X A;  2YRR A;  4RKC A;  3I4J A;  3K40 A;  3ACZ A;  3HT4 A;  2R5C B;  3EI7 A;  4CBS A;  3QHX A;  2AY3 A;  3E2F A;  3BCX A;  2VIB A;  1VEF A;  3NYU A;  4TN4 A;  1FG7 A;  4GE4 A;  4WYC A;  3T32 A;  1V2E A;  3N7N A;  1ZOB A;  1UU1 A;  4WYG A;  4F5M A;  3ZRP A;  1DJU A;  1X0M A;  3MAF B;  1Z3Z A;  1RV4 A;  1GEY A;  3EI8 A;  2VMO A;  4WB0 A;  1ASL A;  3ZRR A;  1ELU A;  3NUI A;  1AHE A;  3PA9 A;  1ASN A;  3R4T A;  2W7H A;  4XAU A;  3R9A A;  3AEN B;  3WCN A;  1ZC9 A;  3QPG A;  4RIT A;  2HOY A;  4Y0D A;  2AY4 A;  5E4Z A;  4A0G A;  1W7M A;  2GQN A;  4TMR A;  3EIA A;  1EJI A;  4F4E A;  1GEW A;  1KMJ A;  2HZP A;  1M4N A;  2BWO A;  2CFB A;  3FFR A;  4U2H A;  4XJL A;  4XQ2 A;  4CXR A;  4QGR A;  1ORD A;  1TOJ A;  2YKX A;  3FRK A;  3EZ1 A;  3IF2 A;  2BI2 A;  4MKK A;  4ZDL A;  2AY8 A;  2YKV A;  3DC1 A;  2Z61 A;  4A00 A;  4BA4 A;  1YJS A;  4ATQ A;  2BI9 A;  1RV3 A;  3HLM A;  1Z7D A;  1O61 A;  1QZ9 A;  5EUD A;  2DKB A;  1M0Q A;  2DKJ A;  2VMR A;  3LVJ A;  4F5H A;  1TPL A;  3DU4 A;  3I5T A;  4HVK A;  3VK2 A;  4ZM3 A;  3DR7 A;  1EQB A;  4PFN A;  1JF9 A;  2VGZ A;  2W7L A;  2VMT A;  1ASM A;  3KE3 A;  3DR4 A;  4ZDP A;  1G7X A;  3I16 A;  4M2M A;  1C7N A;  2CJD A;  1FG3 A;  3WKR A;  4Y0I A;  1QIR A;  4FFC A;  5G4I A;  5HXX A;  2X5D A;  4H51 A;  3H9X A;  2DGM A;  1I41 A;  4WLJ A;  3RBF A;  1LW5 A;  1B5P A;  3KGW A;  4JEX A;  1CQ8 A;  4JEZ A;  4L0O A;  5F8V A;  5M4D A;  3PIU A;  1SZS A;  4Q76 A;  1OHW A;  4Q31 A;  2OAT A;  5F9S A;  3AEM A;  2R5C A;  3GET A;  1BQA A;  2BYL A;  2VLH A;  2HUU A;  3HVY A;  4OC9 A;  1WYV B;  3B46 A;  3GBX A;  9AAT A;  3WZF A;  3A2B A;  1OHV A;  2VLF A;  2YKU A;  3B1E A;  3WLX A;  3NDN A;  2ZYJ A;  4OT8 A;  3HBX A;  3QGU A;  4PIW A;  4UOY A;  4ZDO A;  1UKJ A;  3LWS A;  4MQQ A;  5EUE A;  4A0H A;  2W7J A;  4AOA A;  4LW2 A;  3FD0 A;  3PDX A;  3FCR A;  4JF0 A;  3ATH A;  3USF A;  3G0T A;  1IUG A;  4AZJ A;  3LY1 A;  4E1O A;  2AY7 A;  2WK8 A;  3E9K A;  4XJM A;  3L44 A;  2VI8 A;  2OGA A;  4WD2 A;  5DX5 A;  3N4S A;  4R2N A;  1WYT A;  1IAX A;  4R5F A;  1DGE A;  1PG8 A;  4RKD A;  2Z9V A;  3MAD A;  1CZC A;  1PMO A;  1RVU A;  3MBB A;  1X2A A;  1AMQ A;  1AY8 A;  1AHG A;  2AEU A;  2HOR A;  2OKJ A;  2O7C A;  1WKH A;  4ZSY A;  1CQ7 A;  3AOV A;  2W7M A;  4I8A A;  3ELP A;  2D7Z A;  2VGS A;  1JG8 A;  3FVX A;  2BIA A;  4BQ0 A;  3RQ1 A;  2FKI A;  5JAY A;  3NU7 A;  3VK3 A;  4MY5 A;  1CQ6 A;  4B98 A;  3WGC A;  4WP0 A;  2WK9 A;  4F5I A;  2YCP A;  1SPA A;  2VIA A;  3BS8 A;  3TQX A;  5FT6 A;  3B8X A;  2D63 A;  2W8T A;  4ZLV A;  2E7I A;  2FM1 A;  2VMY A;  4ZWV A;  2JIS A;  1H1C A;  4R5Z A;  4WYD A;  5KTB A;  2YCT A;  3UE8 A;  2VGV A;  4ZAH A;  2ZC0 A;  5LHA A;  3E77 A;  3RBL A;  3JWB A;  3JWA A;  4JEW A;  2Z9W A;  3LVM A;  1QJ3 A;  1QIT A;  4JEV A;  3AEJ A;  1B4X A;  2Z9U A;  1ZOD A;  3FSL A;  4LNJ A;  1AMA A;  2Z67 A;  1IX7 A;  1AAW A;  3DXW A;  4Y0H A;  2VGW A;  2ZSL A;  1SF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...