4Q6RA

Crystal structure of human sphingosine-1-phosphate lyase in complex with inhibitor 6-[(2r)-4-(4-benzyl-7-chlorophthalazin-1-yl)-2-methylpiperazin-1-yl]pyridine-3-carbonitrile
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
443
structure length
442
Chain Sequence
EYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sphingosine-1-phosphate lyase 1
publication title Orally Active 7-Substituted (4-Benzylphthalazin-1-yl)-2-methylpiperazin-1-yl]nicotinonitriles as Active-Site Inhibitors of Sphingosine 1-Phosphate Lyase for the Treatment of Multiple Sclerosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/lyase inhibitor
total genus 144
structure length 442
sequence length 443
chains with identical sequence B
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4q6rA03
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4q6rA02
3RCHA 4LW4A 3I5TA 4JEVA 4N0WA 1VP4A 3B1EA 1C7OA 4WLHA 4RJ0A 2BIGA 2HP2A 4F5FA 4AO9A 4UHNA 3R4TA 1AY5A 4M2KA 1FG7A 1BQAA 1GC0A 1KMJA 2BI9A 4UHMA 5LH9A 2EZ1A 3WCOA 1M32A 1AICA 1BJ4A 1CL1A 4W91A 2YKUA 4R5FA 5DX5A 2VMQA 2GMSA 4F5HA 3VK2A 2DGKA 1U08A 1ASAA 1GEWA 2EO5A 2W7LA 4JEWA 2CH1A 4E77A 1CS1A 2EGYA 3COGA 4AZKA 1G4XA 2QBTA 4J5UA 2BI5A 3AEOA 1D7SA 3DRDA 3FVUA 3AENB 1SFFA 3NYUA 2D7YA 1AAWA 1M7YA 3E2FA 4PVFA 4E1OA 4W1XA 4GE4A 2O1BA 4WYFA 2EPJA 5EAVA 2PO3A 4J8LA 3JZLA 3UE8A 3EI9A 4RKCA 4GEBA 5C6UA 1RV3A 8AATA 1ASNA 5IWQA 4GE9A 2CB1A 2ZSMA 3OP7A 5M49A 3FZ7A 1ASEA 2D66A 1LW4A 3ACZA 3BCAA 1OATA 2VIAA 1TATA 3W1HA 3FQ8A 7AATA 2JISA 2W8WA 1YIYA 3CBFA 4ADCA 3LWSA 4IYOB 2AATA 1UU0A 2QB3A 4IXOA 3F9TA 3UWCA 1KMKA 3NUIA 1W3UA 1JS6A 2CY8A 3FQ7A 3JWBA 4MKKA 2Z9VA 3DYDA 3MEBA 4OYTA 1QIRA 3QGUA 1MAQA 2RFVA 2YCNA 1MLZA 3PDBB 3NU7A 2XBNA 1ASDA 4ZSYA 1B8GA 4E3RA 2DGLA 5HXXA 3ZRRA 4FFCA 3BV0A 5G4JA 1WKGA 3QBOA 3QM2A 4TV7A 3GJUA 5TF5A 1G7WA 1MDZA 5BJ4A 5LHAA 4WXBA 3VOMA 1WYUB 1GBNA 1GC4A 5FT5A 3FCRA 2W7HA 2CINA 2VMWA 2CSTA 2W8TA 4WBTA 3DXVA 2W7JA 1S07A 3GBXA 4OT8A 3E9KA 4ZAHA 4A72A 3BS8A 1CZEA 3OKSA 2VMRA 3GETA 3ATHA 2HUUA 4WLJA 3FKDA 2VGVA 2D65A 4GE7A 1AKCA 3F6TA 3FVSA 3HT4A 5FT8A 1MGVA 1IJIA 1MLYA 2CTZA 3L44A 4M2JA 5M46A 1SZKA 1ELQA 3TCMA 3VAXA 1QITA 4ISYA 4ITGA 4RJYA 2VGTA 4JEZA 3K40A 1O4SA 2PB2A 3PJ0A 3AELA 4OC9A 2HOYA 3E6GA 5G09A 1W7MA 4Q76A 4E3QA 2ZY3A 1I43A 3KGXA 3FFRA 3ZRQA 3AATA 1QJ3A 2GQNA 2VMPA 1AKAA 1OXOA 3LV2A 5JAYA 1ASBA 1M0QA 3FFHA 4RM1A 3EI8A 2R5CB 1CQ6A 4Q75A 3QHXA 2VMUA 4K2BA 3E2ZB 3Q8NA 4ADBA 1B9HA 2EH6A 3CQ4A 3GZDC 4WB0B 1D7VA 1M0PA 2YCPA 3PGYA 3FZ6A 1CQ8A 1RV4A 4EFFA 2Z67A 1B5OA 4GSAA 3IF2A 4ADDA 4L0OA 3AOWA 4W5KA 1M0OA 1LW5A 5AX8A 3NYSA 3GZDA 2CFBA 3KE3A 3W1JA 4HVKA 1OHYA 1V2DA 4IXZA 4Y0HA 2W7DA 3LY1A 4UHOA 2HUFA 4F4EA 1SF2A 4A0RA 4AO4A 2ZY5A 1LS3A 2BWPA 3HVYA 2V1PA 1AIBA 5G2QA 1TARA 3FTBA 3NU8A 3LVKA 4LNJA 1V2FA 1C7NA 1WYTB 2AEUA 4I8AA 5F9SA 1FG3A 4GRXA 3JU7A 4OCAA 4RIZA 3PDBA 1CZCA 4JF0A 2JG2A 1BKGA 3TATA 4U1TA 1Z3ZA 1ZC9A 4ZASA 3L8AA 4IW7A 1IAYA 1QZ9A 2W7EA 2QA3A 1J32A 3EIAA 4MQRA 1TOEA 4HF8A 4OTLA 3NDNA 4ADEA 1AHEA 4ZLVA 1WYUA 2VIBA 4A0GA 3LVJA 3RI6A 2BHXA 3KKIA 4ATPA 1I29A 5EAAA 1TASA 3KGWA 1C0NA 2VMOA 1O69A 3P1TA 1H0CA 1AKBA 2X5FA 3AEJC 3VP6A 2YKYA 4MSOA 4LNLA 2HOXA 3R9AA 1TOGA 3WLXA 4XQ2A 4RITA 1S09A 4WXGA 4M2MA 2R2NA 1WKHA 2XH1A 1JF9A 4CBSA 3LVMA 1GCKA 4R8DA 2BI3A 4P3MA 4TN4A 3AEJA 3K7YA 3I16A 4JEXA 2JJEA 4JF1A 2Z9UA 1YIZA 4A0FA 1AAMA 1B4XA 2O7CA 5E5IA 1VJOA 4N0BA 1MDXA 2HORA 3DZZA 3HBXA 2HUIA 4W8IA 1OHWA 3WCNA 1Z7DA 1XEYA 5K8BA 2ZC0A 3A9XA 1IBJA 1W7NA 4Y0IA 1GC2A 1AJSB 1JG8A 3FRKA 5G2PA 1LKCA 2X5DA 1DFOA 2JGTA 2VMYA 3CQ6A 3T32A 4CXQA 2ZY2A 2AEVA 4MY5A 1VEFA 3MKJA 1IX7A 3DODA 4WYAA 2AY3A 4A6TA 2BWOA 2ZP7A 3W1IA 2Z20A 3MBBA 1O61A 2Z9XA 2C81A 4WB0A 2ORDA 2D61A 4TMRA 3ASAA 2YRRA 4IXSA 3EI5A 5HHYA 2CJHA 3F0HA 5E4ZA 3USFA 1AJRA 1ASFA 2AY4A 3ZZKA 1S06A 2CJDA 3DR7A 4A6RA 1WYVB 1FC4A 1MDOA 3NYTA 2VI8A 1DKAA 1BT4A 3G0TA 1M6SA 3G8MA 4FL0A 1GD9A 2ZYJA 3GR9A 2EZ2A 1AMQA 5EFSA 1N31A 2G6WA 3WKRA 2W7FA 2E7IA 4MQQA 3WKSA 3BCBA 1D7UA 2BI1A 3N0LA 1BW0A 2E54A 2DR1A 3WY7A 5FT4A 1CL2A 2Z9WA 4LC3A 1DJ9A 1WYTA 3D6KA 4CXRA 1TOKA 1V2EA 4KYOA 3B8XA 4JE5A 1TOIA 3ELPA 2YKVA 4BA5A 4BHDA 1ARTA 5FT6A 5EUDA 5D95A 2CJGA 2QB2A 1YOOA 4MKJA 2JJFA 2OQXA 1OXPA 4Y0DA 4EB7A 1LC8A 2R5EA 3FDBA 2VGSA 3FD0A 3LVLB 2X3LA 4XJLA 3MAUA 5DJ1A 1P3WA 1DJUA 2BWNA 1G7XA 4F5GA 2WK8A 3B46A 4ZDOA 1SZSA 2Z1ZA 3NNKA 4NOGA 2DKBA 3EZSA 4KXKA 2R0TA 3N5MA 1G4VA 1ARHA 2X8UA 3BWNC 4F5KA 3EI7A 5EUEA 1TOJA 4H51A 3FQAA 2FNIA 5EIGB 4F5LA 2OKKA 2W7KA 1DGDA 3FSLA 3AENA 3HDOA 3PD6B 4LNMA 3B1DA 1H1CA 3TFTA 3ECDA 3E2YA 3HMUA 2AY9A 3MADA 3CQ5A 4F5IA 4K2IA 3VK3A 3ZRPA 2FQ6A 1DTYA 2YKXA 4CBRA 3A8UX 2VMNA 2TPLA 3FDDA 2VGZA 1IX8A 2W8VA 4R5ZA 5I92A 1SZUA 1XI9A 5DB5A 1X28A 1IVRA 4LW2A 4OBVA 3EUCA 1AJSA 1I48A 2HZPA 3BWOA 4IYOA 2NMPA 1AMRA 1ASCA 3I4JA 4DBCA 3A2BA 2GSAA 4WYEA 5BJ3A 1PG8A 3EI6A 5M4DA 4DGTA 3CAIA 1GC3A 1S08A 2VMXA 3NRAA 4EMYA 2C7TA 2FYFA 4WXFA 3TQXA 3UAKA 4R2NA 4AH3A 1ELUA 4BA4A 1UU1A 2JJHA 1N8PA 2HP1A 3B1CA 3II0A 2CANA 1KKPA 3G7QA 1WYVA 3PDXA 4ZWVA 3FVXA 3M5UA 1QGNA 1PMMA 3PIUA 3MAFB 4JE5D 2ZSLA 1EG5A 1BQDA 4OMAA 2QMAA 3EIBA 2Z61A 3QI6A 1J04A 3BN1A 4JEYA 4RLGA 1EJIA 2YCTA 2W7GA 4WYDA 1UKJA 3H7FA 1ZOBA 2D5YA 4Q31A 4WD2A 3RUYA 3PA9A 1BJOB 2VLFA 4A00A 4BQ0A 4ZDLA 1KL1A 3NX3A 4WP0A 2BIAA 3DU4A 1CJ0A 9AATA 4IX8A 2WKAA 4EU1A 3A9YA 1GEXA 2AY8A 2DKJA 4XAUA 4BMKA 2VYCA 1DGEA 4QGRA 1W23A 4O6ZA 4W1VA 1I41A 2BKWA 1M4NA 3AEPA 1AMSA 2YOBA 1AX4A 3DXWA 3PPLA 2VI9A 3ELEA 3BC8A 2AY2A 1GDEA 2ZJGA 1WSTA 4UOYA 3WGBA 4EB5A 1IUGA 5EIGA 3JW9A 2R5CA 3EZ1A 2BI2A 3PD6A 1YJYA 3E2ZA 4XJPA 4XJOA 2VLHA 4PIWA 1YJSA 2OGEA 3P6KA 2AY5A 4PFFA 4PFNA 4XK1A 1ZODA 3WX9A 1C9CA 3JWAA 3ZZJA 4DQ6A 5G4IA 1B9IA 1IAXA 1BJNA 3RBLA 1X0MA 4ATQA 4W1WA 5E3KA 1QISA 1CQ7A 4Q6RA 3IHJA 1ASLA 4ZM4A 2FN6A 1Y4IA 3K28A 1LK9A 3BCXA 1E5EA 4B98A 3RCHB 2HOZA 2ZUKA 4A6UA 2W7MA 3WZFA 1DJEA 2FNUA 3NTJA 4IY7A 5G0AA 2W7IA 1ARIA 1O62A 1AMAA 1GEYA 2VGWA 3GSBA 4K2MA 4ZWMA 3VK4A 1AHXA 3AOVA 2QLRA 2YHKA 3FZ8A 1RVYA 1PMOA 4ZM3A 2OKJA 1M0NA 2D7ZA 1C7GA 4U2HA 2BIEA 2VGUA 3MC6C 1QJ5A 1T3IA 2CH2A 2AY6A 2DGMA 3E77A 5EQCA 3JTXA 2FM1A 3NUBA 2YRIA 1B5PA 3DR4A 1LC7A 1JS3A 3ASBA 3MAFA 2VMVA 2BYLA 2DOUA 1AHFA 4ZDPA 1W7LA 3BB8A 1ASMA 4WYCA 3MC6A 1AY4A 4RKDA 5HDMA 4ZSWA 2VMTA 1X29A 2GB3A 2WK9A 2OGAA 3HLMA 2PB0A 4F5JA 2VMZA 1RVUA 1ORDA 3AV7A 3N75A 5F8VA 2E7UA 1KKJA 1BJOA 4AZJA 1V72A 4KAMA 1ECXA 2BYJA 3DC1A 4F5MA 1E5FA 2V0YA 3HL2A 2Q7WA 3BWNA 4WYGA 2C0RA 1LC5A 3RQ1A 2VMSA 2Z1YA 3AEMC 1PFFA 1KL2A 2ZY4A 2OATA 1D2FA 1X2AA 1AHGA 3GZCA 1AIAA 1N2TA 1MAPA 4RAEA 4A0HA 5M4BA 1AHYA 1BS0A 1YJZA 3WGCA 3H14A 3TFUA 4CVQA 5D5SA 2GMUA 4MQPA 2AY7A 1EQBA 3AEMA 4ITXA 2WK7A 1UU2A 5EUNA 1AY8A 1IX6A 1YNUA 2W8JA 4P7YA 1OHVA 2D63A 2D64A 3RBFA 1BJWA 1ASGA 4XJMA 4AOAA 2C44A 5J8QA 3ISLA 4OBUA 1YAAA 2W8UA 2E7JA 1C4KA 4GDYA 3PAAA 3HQTA 2AY1A 4MGRA 1S0AA 2O0RA 3QPGA 1SPAA 5DJ9A 2JJGA 4XEWA 1D7RA 1ARGA 3A9ZA 1TPLA 1ARSA 1SVVA 3GWPA 3LG0A 2F8JA 4B9BA 4UQVA 3QN6A
chains in the Genus database with same CATH superfamily
3RCHA 4LW4A 3I5TA 4JEVA 4N0WA 1VP4A 3B1EA 1C7OA 4WLHA 4RJ0A 2BIGA 1KAFA 2HP2A 4F5FA 4AO9A 4UHNA 3R4TA 1AY5A 3N4SA 4M2KA 1FG7A 1BQAA 1GC0A 1KMJA 2BI9A 4UHMA 5LH9A 2EZ1A 3WCOA 1M32A 1AICA 1BJ4A 1CL1A 4W91A 2YKUA 4R5FA 5DX5A 2VMQA 2GMSA 4F5HA 3VK2A 2DGKA 1U08A 1ASAA 1GEWA 2EO5A 2W7LA 4JEWA 2CH1A 4E77A 1CS1A 2EGYA 3COGA 4AZKA 1G4XA 2QBTA 4J5UA 2BI5A 3AEOA 1D7SA 3DRDA 3FVUA 3AENB 1SFFA 3NYUA 2D7YA 3N7NA 1AAWA 1M7YA 3E2FA 4PVFA 4E1OA 4W1XA 4GE4A 2O1BA 4WYFA 2EPJA 5EAVA 2PO3A 4J8LA 3JZLA 3UE8A 3EI9A 4RKCA 4GEBA 5C6UA 1RV3A 8AATA 1ASNA 5IWQA 4GE9A 2CB1A 2ZSMA 3OP7A 5M49A 3FZ7A 1ASEA 2D66A 1LW4A 4K05A 3ACZA 3BCAA 1OATA 2VIAA 1TATA 3W1HA 3FQ8A 7AATA 2JISA 2W8WA 1YIYA 3CBFA 4ADCA 3LWSA 4IYOB 2AATA 1UU0A 2QB3A 4IXOA 2QSRA 3F9TA 3UWCA 1KMKA 3NUIA 1W3UA 1JS6A 2CY8A 3FQ7A 3JWBA 4MKKA 2Z9VA 3DYDA 3MEBA 4OYTA 1QIRA 3QGUA 1MAQA 2RFVA 2YCNA 1MLZA 3PDBB 3NU7A 2XBNA 1ASDA 4ZSYA 1B8GA 4E3RA 2DGLA 5HXXA 3ZRRA 4FFCA 3BV0A 5G4JA 1WKGA 3QBOA 3QM2A 4TV7A 3GJUA 5TF5A 1G7WA 1MDZA 5BJ4A 5LHAA 4WXBA 3VOMA 1WYUB 1GBNA 1GC4A 5FT5A 3FCRA 2W7HA 2CINA 2VMWA 2CSTA 2W8TA 4WBTA 3DXVA 2W7JA 1S07A 3GBXA 4OT8A 3E9KA 4ZAHA 4A72A 3BS8A 1CZEA 3OKSA 2VMRA 3GETA 3ATHA 2HUUA 4WLJA 3FKDA 2VGVA 2D65A 4GE7A 1AKCA 3F6TA 3FVSA 3HT4A 5FT8A 1MGVA 1IJIA 1MLYA 2CTZA 3L44A 4M2JA 5M46A 1SZKA 1ELQA 3TCMA 3VAXA 1QITA 4ISYA 4ITGA 4RJYA 2VGTA 4JEZA 3K40A 2FKIA 3H9XA 1O4SA 2PB2A 3PJ0A 3AELA 4OC9A 2HOYA 3E6GA 5G09A 1W7MA 4Q76A 4E3QA 2ZY3A 1I43A 3KGXA 3FFRA 3ZRQA 3AATA 1QJ3A 2GQNA 2VMPA 1AKAA 1OXOA 3LV2A 5JAYA 1ASBA 1M0QA 3FFHA 4RM1A 3EI8A 2R5CB 1CQ6A 4Q75A 3QHXA 2VMUA 4K2BA 3E2ZB 3Q8NA 4ADBA 1B9HA 2EH6A 3CQ4A 3GZDC 4WB0B 1D7VA 1M0PA 2YCPA 3PGYA 3FZ6A 1CQ8A 1RV4A 4EFFA 2Z67A 1B5OA 4GSAA 3IF2A 4ADDA 4L0OA 3AOWA 4W5KA 1M0OA 1LW5A 5AX8A 3NYSA 3GZDA 2CFBA 3KE3A 3W1JA 4HVKA 1OHYA 3N4XA 1V2DA 4IXZA 4Y0HA 2W7DA 3LY1A 4UHOA 2HUFA 4F4EA 1SF2A 4A0RA 4AO4A 2ZY5A 1LS3A 2BWPA 3HVYA 2V1PA 1AIBA 5G2QA 1TARA 3FTBA 3NU8A 3LVKA 4LNJA 1V2FA 1C7NA 1WYTB 2AEUA 4I8AA 5F9SA 1FG3A 4GRXA 3JU7A 4OCAA 4RIZA 3PDBA 1CZCA 4JF0A 2JG2A 1BKGA 3TATA 4U1TA 1Z3ZA 1ZC9A 4ZASA 3L8AA 4IW7A 1IAYA 1QZ9A 2W7EA 2QA3A 1J32A 3EIAA 4MQRA 1TOEA 4HF8A 4OTLA 3NDNA 4ADEA 1AHEA 4ZLVA 1WYUA 2VIBA 4A0GA 3LVJA 3RI6A 2BHXA 3KKIA 4ATPA 1I29A 5EAAA 1TASA 3KGWA 1C0NA 2VMOA 1O69A 3P1TA 1H0CA 1AKBA 2X5FA 3AEJC 3VP6A 2YKYA 4MSOA 4LNLA 2HOXA 3R9AA 1TOGA 3WLXA 4XQ2A 4RITA 1S09A 4WXGA 4M2MA 2R2NA 1WKHA 2XH1A 1JF9A 4CBSA 3LVMA 1GCKA 4R8DA 2BI3A 4P3MA 4TN4A 3AEJA 3K7YA 3I16A 4JEXA 2JJEA 4JF1A 2Z9UA 1YIZA 4A0FA 1AAMA 1B4XA 2O7CA 5E5IA 1VJOA 4N0BA 1MDXA 2HORA 3DZZA 3HBXA 2HUIA 4W8IA 1OHWA 3WCNA 1Z7DA 1XEYA 5K8BA 2ZC0A 3A9XA 1IBJA 1W7NA 4Y0IA 1GC2A 1AJSB 1JG8A 3FRKA 5G2PA 1LKCA 2X5DA 1DFOA 2JGTA 2VMYA 3CQ6A 3T32A 4CXQA 2ZY2A 2AEVA 4MY5A 1VEFA 3MKJA 1IX7A 3DODA 4WYAA 2AY3A 4A6TA 2BWOA 2ZP7A 3W1IA 2Z20A 3MBBA 1O61A 2Z9XA 2C81A 4WB0A 2ORDA 2D61A 4TMRA 3ASAA 2YRRA 4IXSA 3EI5A 5HHYA 2CJHA 3F0HA 5E4ZA 3USFA 1AJRA 1ASFA 4H63Q 2AY4A 3ZZKA 1S06A 2CJDA 3DR7A 4A6RA 1WYVB 1FC4A 1MDOA 3NYTA 2VI8A 1DKAA 1BT4A 3G0TA 1M6SA 3G8MA 4FL0A 1GD9A 2KFPA 2ZYJA 3GR9A 2EZ2A 1AMQA 5EFSA 1N31A 2G6WA 3WKRA 2W7FA 2E7IA 4MQQA 3WKSA 3BCBA 1D7UA 2BI1A 3N0LA 1BW0A 2E54A 2DR1A 3WY7A 5FT4A 1CL2A 2Z9WA 4LC3A 1DJ9A 1WYTA 3D6KA 4CXRA 1TOKA 1V2EA 4KYOA 3B8XA 4JE5A 1TOIA 3ELPA 2YKVA 4BA5A 4BHDA 1ARTA 5FT6A 5EUDA 5D95A 2CJGA 2QB2A 1YOOA 4MKJA 2JJFA 2OQXA 1OXPA 4Y0DA 4EB7A 1LC8A 2R5EA 3FDBA 2VGSA 3FD0A 3LVLB 2X3LA 4XJLA 3MAUA 5DJ1A 1P3WA 1DJUA 2BWNA 1G7XA 4F5GA 2WK8A 3B46A 4ZDOA 1SZSA 2Z1ZA 3NNKA 4NOGA 2DKBA 3EZSA 4KXKA 2R0TA 3N5MA 1G4VA 1ARHA 2X8UA 3BWNC 4F5KA 3EI7A 5EUEA 1TOJA 4H51A 3FQAA 2FNIA 5EIGB 4F5LA 2OKKA 2W7KA 1DGDA 3FSLA 3AENA 3HDOA 3PD6B 4LNMA 3B1DA 1H1CA 3TFTA 3ECDA 3E2YA 3HMUA 2AY9A 3MADA 3CQ5A 4F5IA 4K2IA 3VK3A 3ZRPA 2FQ6A 1DTYA 2YKXA 4CBRA 3A8UX 2VMNA 2TPLA 3FDDA 2VGZA 1IX8A 2W8VA 4R5ZA 5I92A 1SZUA 1XI9A 5DB5A 1X28A 1IVRA 4LW2A 4OBVA 3EUCA 1AJSA 1I48A 2HZPA 3BWOA 4IYOA 2NMPA 1AMRA 1ASCA 3I4JA 4DBCA 3A2BA 2GSAA 4WYEA 5BJ3A 1PG8A 3EI6A 5M4DA 4DGTA 3CAIA 1GC3A 1S08A 2VMXA 3NRAA 4EMYA 2C7TA 2FYFA 4WXFA 3TQXA 3UAKA 4R2NA 4AH3A 1ELUA 4BA4A 1UU1A 2JJHA 1N8PA 2HP1A 3B1CA 3II0A 2CANA 1KKPA 3G7QA 1WYVA 3PDXA 4ZWVA 3FVXA 3M5UA 1QGNA 1PMMA 3PIUA 3MAFB 4JE5D 2ZSLA 1EG5A 1BQDA 4OMAA 2QMAA 3EIBA 2Z61A 3QI6A 1J04A 3BN1A 4JEYA 4RLGA 1EJIA 2YCTA 2W7GA 4WYDA 1UKJA 3H7FA 1ZOBA 2D5YA 4Q31A 4WD2A 3RUYA 3PA9A 1BJOB 2VLFA 4A00A 4BQ0A 4ZDLA 1KL1A 3NX3A 4WP0A 2BIAA 3DU4A 1CJ0A 9AATA 4IX8A 2WKAA 4EU1A 3A9YA 1GEXA 2AY8A 2DKJA 4XAUA 4BMKA 2VYCA 1DGEA 4QGRA 1W23A 4O6ZA 4W1VA 1I41A 2BKWA 1M4NA 3AEPA 1AMSA 2YOBA 1AX4A 3DXWA 3PPLA 2VI9A 3ELEA 3BC8A 2AY2A 1GDEA 2ZJGA 1WSTA 4UOYA 3WGBA 4EB5A 1IUGA 5EIGA 3JW9A 2R5CA 3EZ1A 2BI2A 3PD6A 1YJYA 3E2ZA 4XJPA 4XJOA 2VLHA 4PIWA 1YJSA 2OGEA 3P6KA 2AY5A 4PFFA 4PFNA 4XK1A 1ZODA 3WX9A 1C9CA 3JWAA 3ZZJA 4DQ6A 5G4IA 1B9IA 1IAXA 1BJNA 3RBLA 1X0MA 4ATQA 2EYQA 4W1WA 5E3KA 1QISA 1CQ7A 4Q6RA 3IHJA 1ASLA 4ZM4A 2FN6A 1Y4IA 3K28A 1LK9A 3BCXA 1E5EA 4B98A 3RCHB 2HOZA 2ZUKA 4A6UA 2W7MA 3WZFA 1DJEA 2FNUA 3NTJA 4IY7A 5G0AA 2W7IA 1ARIA 1O62A 1AMAA 1GEYA 2VGWA 3GSBA 4K2MA 4ZWMA 3VK4A 1AHXA 3AOVA 2QLRA 2A1VA 2YHKA 3FZ8A 1RVYA 2G7JA 1PMOA 4ZM3A 2OKJA 1M0NA 2D7ZA 1C7GA 4U2HA 2BIEA 2VGUA 3MC6C 1QJ5A 1T3IA 2CH2A 2AY6A 2DGMA 3E77A 5EQCA 3JTXA 2FM1A 3NUBA 2YRIA 1B5PA 3DR4A 1LC7A 1JS3A 3ASBA 3MAFA 2VMVA 2BYLA 2DOUA 1AHFA 4ZDPA 1W7LA 3BB8A 1ASMA 4WYCA 3MC6A 1AY4A 4RKDA 5HDMA 4ZSWA 2VMTA 1X29A 2GB3A 2WK9A 2OGAA 3HLMA 2PB0A 4F5JA 2VMZA 1RVUA 1ORDA 3AV7A 3N75A 5F8VA 2E7UA 1KKJA 1BJOA 4AZJA 1V72A 4KAMA 1ECXA 2BYJA 3DC1A 4F5MA 1E5FA 2V0YA 3HL2A 2Q7WA 3BWNA 4WYGA 2C0RA 1LC5A 3RQ1A 2VMSA 2Z1YA 3AEMC 1PFFA 1KL2A 2ZY4A 2OATA 1D2FA 1X2AA 1AHGA 3GZCA 1AIAA 1N2TA 1MAPA 4RAEA 4A0HA 5M4BA 1AHYA 1BS0A 1YJZA 3WGCA 3H14A 3TFUA 4CVQA 5D5SA 2WB6A 2GMUA 4MQPA 2AY7A 1EQBA 3AEMA 4ITXA 2WK7A 1UU2A 5EUNA 1AY8A 1IX6A 1YNUA 2W8JA 4P7YA 1OHVA 2D63A 2D64A 3RBFA 1BJWA 1ASGA 4XJMA 4AOAA 2C44A 5J8QA 3ISLA 4OBUA 1YAAA 2W8UA 2E7JA 1C4KA 4GDYA 5KTBA 3PAAA 3HQTA 2AY1A 4MGRA 1S0AA 2O0RA 3QPGA 1SPAA 5DJ9A 2JJGA 4XEWA 1D7RA 1ARGA 3N4RA 3A9ZA 1TPLA 1ARSA 1SVVA 3GWPA 3LG0A 2F8JA 4B9BA 4UQVA 3QN6A
chains in the Genus database with same CATH topology
3RCHA 4LW4A 3I5TA 4JEVA 4N0WA 1VP4A 3B1EA 1C7OA 4WLHA 4RJ0A 2BIGA 2HP2A 4F5FA 4AO9A 4UHNA 3R4TA 1AY5A 3N4SA 4M2KA 1FG7A 1BQAA 1GC0A 1KMJA 2BI9A 4UHMA 5LH9A 2EZ1A 3WCOA 1M32A 1AICA 1BJ4A 1CL1A 4W91A 2YKUA 4R5FA 5DX5A 2VMQA 2GMSA 4F5HA 3VK2A 2DGKA 1U08A 1ASAA 1GEWA 2EO5A 2W7LA 4JEWA 2CH1A 4E77A 1CS1A 2EGYA 3COGA 4AZKA 1G4XA 2QBTA 4J5UA 2BI5A 3AEOA 1D7SA 3DRDA 3FVUA 3AENB 1SFFA 3NYUA 2D7YA 3N7NA 1AAWA 1M7YA 3E2FA 4PVFA 4E1OA 4W1XA 4GE4A 2O1BA 4WYFA 2EPJA 5EAVA 2PO3A 4J8LA 3JZLA 3UE8A 3EI9A 4RKCA 4GEBA 5C6UA 1RV3A 8AATA 1ASNA 5IWQA 4GE9A 2CB1A 2ZSMA 3OP7A 5M49A 3FZ7A 1ASEA 2D66A 1LW4A 4K05A 3ACZA 3BCAA 1OATA 2VIAA 1TATA 3W1HA 3FQ8A 7AATA 2JISA 2W8WA 1YIYA 3CBFA 4ADCA 3LWSA 4IYOB 2AATA 1UU0A 2QB3A 4IXOA 2QSRA 3F9TA 3UWCA 1KMKA 3NUIA 1W3UA 1JS6A 2CY8A 3FQ7A 3JWBA 4MKKA 2Z9VA 3DYDA 3MEBA 4OYTA 1QIRA 3QGUA 1MAQA 2RFVA 2YCNA 1MLZA 3PDBB 3NU7A 2XBNA 1ASDA 4ZSYA 1B8GA 4E3RA 2DGLA 5HXXA 3ZRRA 4FFCA 3BV0A 5G4JA 1WKGA 3QBOA 3QM2A 4TV7A 3GJUA 5TF5A 1G7WA 1MDZA 5BJ4A 5LHAA 4WXBA 3VOMA 1WYUB 1GBNA 1GC4A 5FT5A 3FCRA 2W7HA 2CINA 2VMWA 2CSTA 2W8TA 4WBTA 3DXVA 2W7JA 1S07A 3GBXA 4OT8A 3E9KA 4ZAHA 4A72A 3BS8A 1CZEA 3OKSA 2VMRA 3GETA 3ATHA 2HUUA 4WLJA 3FKDA 2VGVA 2D65A 4GE7A 1AKCA 3F6TA 3FVSA 3HT4A 5FT8A 1MGVA 1IJIA 1MLYA 2CTZA 3L44A 4M2JA 5M46A 1SZKA 1ELQA 3TCMA 3VAXA 1QITA 4ISYA 4ITGA 4RJYA 2VGTA 4JEZA 3K40A 2FKIA 3H9XA 1O4SA 2PB2A 3PJ0A 3AELA 4OC9A 2HOYA 3E6GA 5G09A 1W7MA 4Q76A 4E3QA 2ZY3A 1I43A 3KGXA 3FFRA 3ZRQA 3AATA 1QJ3A 2GQNA 2VMPA 1AKAA 1OXOA 3LV2A 5JAYA 1ASBA 1M0QA 3FFHA 4RM1A 3EI8A 2R5CB 1CQ6A 4Q75A 3QHXA 2VMUA 4K2BA 3E2ZB 3Q8NA 4ADBA 1B9HA 2EH6A 3CQ4A 3GZDC 4WB0B 1D7VA 1M0PA 2YCPA 3PGYA 3FZ6A 1CQ8A 1RV4A 4EFFA 2Z67A 1B5OA 4GSAA 3IF2A 4ADDA 4L0OA 3AOWA 4W5KA 1M0OA 1LW5A 5AX8A 3NYSA 3GZDA 2CFBA 3KE3A 3W1JA 4HVKA 1OHYA 3N4XA 1V2DA 4IXZA 4Y0HA 2W7DA 3LY1A 4UHOA 2HUFA 4F4EA 1SF2A 4A0RA 4AO4A 2ZY5A 1LS3A 2BWPA 3HVYA 2V1PA 1AIBA 5G2QA 1TARA 3FTBA 3NU8A 3LVKA 4LNJA 1V2FA 1C7NA 1WYTB 2AEUA 4I8AA 5F9SA 1FG3A 4GRXA 3JU7A 4OCAA 4RIZA 3PDBA 1CZCA 4JF0A 2JG2A 1BKGA 3TATA 4U1TA 1Z3ZA 1ZC9A 4ZASA 3L8AA 4IW7A 1IAYA 1QZ9A 2W7EA 2QA3A 1J32A 3EIAA 4MQRA 1TOEA 4HF8A 4OTLA 3NDNA 4ADEA 1AHEA 4ZLVA 1WYUA 2VIBA 4A0GA 3LVJA 3RI6A 2BHXA 3KKIA 4ATPA 1I29A 5EAAA 1TASA 3KGWA 1C0NA 2VMOA 1O69A 3P1TA 1H0CA 1AKBA 2X5FA 3AEJC 3VP6A 2YKYA 4MSOA 4LNLA 2HOXA 3R9AA 1TOGA 3WLXA 4XQ2A 4RITA 1S09A 4WXGA 4M2MA 2R2NA 1WKHA 2XH1A 1JF9A 4CBSA 3LVMA 1GCKA 4R8DA 2BI3A 4P3MA 4TN4A 3AEJA 3K7YA 3I16A 4JEXA 2JJEA 4JF1A 2Z9UA 1YIZA 4A0FA 1AAMA 1B4XA 2O7CA 5E5IA 1VJOA 4N0BA 1MDXA 2HORA 3DZZA 3HBXA 2HUIA 4W8IA 1OHWA 3WCNA 1Z7DA 1XEYA 5K8BA 2ZC0A 3A9XA 1IBJA 1W7NA 4Y0IA 1GC2A 1AJSB 1JG8A 3FRKA 5G2PA 1LKCA 2X5DA 1DFOA 2JGTA 2VMYA 3CQ6A 3T32A 4CXQA 2ZY2A 2AEVA 4MY5A 1VEFA 3MKJA 1IX7A 3DODA 4WYAA 2AY3A 4A6TA 2BWOA 2ZP7A 3W1IA 2Z20A 3MBBA 1O61A 2Z9XA 2C81A 4WB0A 2ORDA 2D61A 4TMRA 3ASAA 2YRRA 4IXSA 3EI5A 5HHYA 2CJHA 3F0HA 5E4ZA 3USFA 1AJRA 1ASFA 4H63Q 2AY4A 3ZZKA 1S06A 2CJDA 3DR7A 4A6RA 1WYVB 1FC4A 1MDOA 3NYTA 2VI8A 1DKAA 1BT4A 3G0TA 1M6SA 3G8MA 4FL0A 1GD9A 2KFPA 2ZYJA 3GR9A 2EZ2A 1AMQA 5EFSA 1N31A 2G6WA 3WKRA 2W7FA 2E7IA 4MQQA 3WKSA 3BCBA 1D7UA 2BI1A 3N0LA 1BW0A 2E54A 2DR1A 3WY7A 5FT4A 1CL2A 2Z9WA 4LC3A 1DJ9A 1WYTA 3D6KA 4CXRA 1TOKA 1V2EA 4KYOA 3B8XA 4JE5A 1TOIA 3ELPA 2YKVA 4BA5A 4BHDA 1ARTA 5FT6A 5EUDA 5D95A 2CJGA 2QB2A 1YOOA 4MKJA 2JJFA 2OQXA 1OXPA 4Y0DA 4EB7A 1LC8A 2R5EA 3FDBA 2VGSA 3FD0A 3LVLB 2X3LA 4XJLA 3MAUA 5DJ1A 1P3WA 1DJUA 2BWNA 1G7XA 4F5GA 2WK8A 3B46A 4ZDOA 1SZSA 2Z1ZA 3NNKA 4NOGA 2DKBA 3EZSA 4KXKA 2R0TA 3N5MA 1G4VA 1ARHA 2X8UA 3BWNC 4F5KA 3EI7A 5EUEA 1TOJA 4H51A 3FQAA 2FNIA 5EIGB 4F5LA 2OKKA 2W7KA 1DGDA 3FSLA 3AENA 3HDOA 3PD6B 4LNMA 3B1DA 1H1CA 3TFTA 3ECDA 3E2YA 3HMUA 2AY9A 3MADA 3CQ5A 4F5IA 4K2IA 3VK3A 3ZRPA 2FQ6A 1DTYA 2YKXA 4CBRA 3A8UX 2VMNA 2TPLA 3FDDA 2VGZA 1IX8A 2W8VA 4R5ZA 5I92A 1SZUA 1XI9A 5DB5A 1X28A 1IVRA 4LW2A 4OBVA 3EUCA 1AJSA 1I48A 2HZPA 3BWOA 4IYOA 2NMPA 1AMRA 1ASCA 3I4JA 4DBCA 3A2BA 2GSAA 4WYEA 5BJ3A 1PG8A 3EI6A 5M4DA 4DGTA 3CAIA 1GC3A 1S08A 2VMXA 3NRAA 4EMYA 2C7TA 2FYFA 4WXFA 3TQXA 3UAKA 4R2NA 4AH3A 1ELUA 4BA4A 1UU1A 2JJHA 1N8PA 2HP1A 3B1CA 3II0A 2CANA 1KKPA 3G7QA 1WYVA 3PDXA 4ZWVA 3FVXA 3M5UA 1QGNA 1PMMA 3PIUA 3MAFB 4JE5D 2ZSLA 1EG5A 1BQDA 4OMAA 2QMAA 3EIBA 2Z61A 3QI6A 1J04A 3BN1A 4JEYA 4RLGA 1EJIA 2YCTA 2W7GA 4WYDA 1UKJA 3H7FA 1ZOBA 2D5YA 4Q31A 4WD2A 3RUYA 3PA9A 1BJOB 2VLFA 4A00A 4BQ0A 4ZDLA 1KL1A 3NX3A 4WP0A 2BIAA 3DU4A 1CJ0A 9AATA 4IX8A 2WKAA 4EU1A 3A9YA 1GEXA 2AY8A 2DKJA 4XAUA 4BMKA 2VYCA 1DGEA 4QGRA 1W23A 4O6ZA 4W1VA 1I41A 2BKWA 1M4NA 3AEPA 1AMSA 2YOBA 1AX4A 3DXWA 3PPLA 2VI9A 3ELEA 3BC8A 2AY2A 1GDEA 2ZJGA 1WSTA 4UOYA 3WGBA 4EB5A 1IUGA 5EIGA 3JW9A 2R5CA 3EZ1A 2BI2A 3PD6A 1YJYA 3E2ZA 4XJPA 4XJOA 2VLHA 4PIWA 1YJSA 2OGEA 3P6KA 2AY5A 4PFFA 4PFNA 4XK1A 1ZODA 3WX9A 1C9CA 3JWAA 3ZZJA 4DQ6A 5G4IA 1B9IA 1IAXA 1BJNA 3RBLA 1X0MA 4ATQA 2EYQA 4W1WA 5E3KA 1QISA 1CQ7A 4Q6RA 3IHJA 1ASLA 4ZM4A 2FN6A 1Y4IA 3K28A 1LK9A 3BCXA 1E5EA 4B98A 3RCHB 2HOZA 2ZUKA 4A6UA 2W7MA 3WZFA 1DJEA 2FNUA 3NTJA 4IY7A 5G0AA 2W7IA 1ARIA 1O62A 1AMAA 1GEYA 2VGWA 3GSBA 4K2MA 4ZWMA 3VK4A 1AHXA 3AOVA 2QLRA 2A1VA 2YHKA 3FZ8A 1RVYA 2G7JA 1PMOA 4ZM3A 2OKJA 1M0NA 2D7ZA 1C7GA 4U2HA 2BIEA 2VGUA 3MC6C 1QJ5A 1T3IA 2CH2A 2AY6A 2DGMA 3E77A 5EQCA 3JTXA 2FM1A 3NUBA 2YRIA 1B5PA 3DR4A 1LC7A 1JS3A 3ASBA 3MAFA 2VMVA 2BYLA 2DOUA 1AHFA 4ZDPA 1W7LA 3BB8A 1ASMA 4WYCA 3MC6A 1AY4A 4RKDA 5HDMA 4ZSWA 2VMTA 1X29A 2GB3A 2WK9A 2OGAA 3HLMA 2PB0A 4F5JA 2VMZA 1RVUA 1ORDA 3AV7A 3N75A 5F8VA 2E7UA 1KKJA 1BJOA 4AZJA 1V72A 4KAMA 1ECXA 2BYJA 3DC1A 4F5MA 1E5FA 2V0YA 3HL2A 2Q7WA 3BWNA 4WYGA 2C0RA 1LC5A 3RQ1A 2VMSA 2Z1YA 3AEMC 1PFFA 1KL2A 2ZY4A 2OATA 1D2FA 1X2AA 1AHGA 3GZCA 1AIAA 1N2TA 1MAPA 4RAEA 4A0HA 5M4BA 1AHYA 1BS0A 1YJZA 3WGCA 3H14A 3TFUA 4CVQA 5D5SA 2WB6A 2GMUA 4MQPA 2AY7A 1EQBA 3AEMA 4ITXA 2WK7A 1UU2A 5EUNA 1AY8A 1IX6A 1YNUA 2W8JA 4P7YA 1OHVA 2D63A 2D64A 3RBFA 1BJWA 1ASGA 4XJMA 4AOAA 2C44A 5J8QA 3ISLA 4OBUA 1YAAA 2W8UA 2E7JA 1C4KA 4GDYA 5KTBA 3PAAA 3HQTA 2AY1A 4MGRA 1S0AA 2O0RA 3QPGA 1SPAA 5DJ9A 2JJGA 4XEWA 1D7RA 1ARGA 3N4RA 3A9ZA 1TPLA 1ARSA 1SVVA 3GWPA 3LG0A 2F8JA 4B9BA 4UQVA 3QN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCH A;  4LW4 A;  3I5T A;  4JEV A;  4N0W A;  1VP4 A;  3B1E A;  1C7O A;  4WLH A;  4RJ0 A;  2BIG A;  2HP2 A;  4F5F A;  4AO9 A;  4UHN A;  3R4T A;  1AY5 A;  4M2K A;  1FG7 A;  1BQA A;  1GC0 A;  1KMJ A;  2BI9 A;  4UHM A;  5LH9 A;  2EZ1 A;  3WCO A;  1M32 A;  1AIC A;  1BJ4 A;  1CL1 A;  4W91 A;  2YKU A;  4R5F A;  5DX5 A;  2VMQ A;  2GMS A;  4F5H A;  3VK2 A;  2DGK A;  1U08 A;  1ASA A;  1GEW A;  2EO5 A;  2W7L A;  4JEW A;  2CH1 A;  4E77 A;  1CS1 A;  2EGY A;  3COG A;  4AZK A;  1G4X A;  2QBT A;  4J5U A;  2BI5 A;  3AEO A;  1D7S A;  3DRD A;  3FVU A;  3AEN B;  1SFF A;  3NYU A;  2D7Y A;  1AAW A;  1M7Y A;  3E2F A;  4PVF A;  4E1O A;  4W1X A;  4GE4 A;  2O1B A;  4WYF A;  2EPJ A;  5EAV A;  2PO3 A;  4J8L A;  3JZL A;  3UE8 A;  3EI9 A;  4RKC A;  4GEB A;  5C6U A;  1RV3 A;  8AAT A;  1ASN A;  5IWQ A;  4GE9 A;  2CB1 A;  2ZSM A;  3OP7 A;  5M49 A;  3FZ7 A;  1ASE A;  2D66 A;  1LW4 A;  3ACZ A;  3BCA A;  1OAT A;  2VIA A;  1TAT A;  3W1H A;  3FQ8 A;  7AAT A;  2JIS A;  2W8W A;  1YIY A;  3CBF A;  4ADC A;  3LWS A;  4IYO B;  2AAT A;  1UU0 A;  2QB3 A;  4IXO A;  3F9T A;  3UWC A;  1KMK A;  3NUI A;  1W3U A;  1JS6 A;  2CY8 A;  3FQ7 A;  3JWB A;  4MKK A;  2Z9V A;  3DYD A;  3MEB A;  4OYT A;  1QIR A;  3QGU A;  1MAQ A;  2RFV A;  2YCN A;  1MLZ A;  3PDB B;  3NU7 A;  2XBN A;  1ASD A;  4ZSY A;  1B8G A;  4E3R A;  2DGL A;  5HXX A;  3ZRR A;  4FFC A;  3BV0 A;  5G4J A;  1WKG A;  3QBO A;  3QM2 A;  4TV7 A;  3GJU A;  5TF5 A;  1G7W A;  1MDZ A;  5BJ4 A;  5LHA A;  4WXB A;  3VOM A;  1WYU B;  1GBN A;  1GC4 A;  5FT5 A;  3FCR A;  2W7H A;  2CIN A;  2VMW A;  2CST A;  2W8T A;  4WBT A;  3DXV A;  2W7J A;  1S07 A;  3GBX A;  4OT8 A;  3E9K A;  4ZAH A;  4A72 A;  3BS8 A;  1CZE A;  3OKS A;  2VMR A;  3GET A;  3ATH A;  2HUU A;  4WLJ A;  3FKD A;  2VGV A;  2D65 A;  4GE7 A;  1AKC A;  3F6T A;  3FVS A;  3HT4 A;  5FT8 A;  1MGV A;  1IJI A;  1MLY A;  2CTZ A;  3L44 A;  4M2J A;  5M46 A;  1SZK A;  1ELQ A;  3TCM A;  3VAX A;  1QIT A;  4ISY A;  4ITG A;  4RJY A;  2VGT A;  4JEZ A;  3K40 A;  1O4S A;  2PB2 A;  3PJ0 A;  3AEL A;  4OC9 A;  2HOY A;  3E6G A;  5G09 A;  1W7M A;  4Q76 A;  4E3Q A;  2ZY3 A;  1I43 A;  3KGX A;  3FFR A;  3ZRQ A;  3AAT A;  1QJ3 A;  2GQN A;  2VMP A;  1AKA A;  1OXO A;  3LV2 A;  5JAY A;  1ASB A;  1M0Q A;  3FFH A;  4RM1 A;  3EI8 A;  2R5C B;  1CQ6 A;  4Q75 A;  3QHX A;  2VMU A;  4K2B A;  3E2Z B;  3Q8N A;  4ADB A;  1B9H A;  2EH6 A;  3CQ4 A;  3GZD C;  4WB0 B;  1D7V A;  1M0P A;  2YCP A;  3PGY A;  3FZ6 A;  1CQ8 A;  1RV4 A;  4EFF A;  2Z67 A;  1B5O A;  4GSA A;  3IF2 A;  4ADD A;  4L0O A;  3AOW A;  4W5K A;  1M0O A;  1LW5 A;  5AX8 A;  3NYS A;  3GZD A;  2CFB A;  3KE3 A;  3W1J A;  4HVK A;  1OHY A;  1V2D A;  4IXZ A;  4Y0H A;  2W7D A;  3LY1 A;  4UHO A;  2HUF A;  4F4E A;  1SF2 A;  4A0R A;  4AO4 A;  2ZY5 A;  1LS3 A;  2BWP A;  3HVY A;  2V1P A;  1AIB A;  5G2Q A;  1TAR A;  3FTB A;  3NU8 A;  3LVK A;  4LNJ A;  1V2F A;  1C7N A;  1WYT B;  2AEU A;  4I8A A;  5F9S A;  1FG3 A;  4GRX A;  3JU7 A;  4OCA A;  4RIZ A;  3PDB A;  1CZC A;  4JF0 A;  2JG2 A;  1BKG A;  3TAT A;  4U1T A;  1Z3Z A;  1ZC9 A;  4ZAS A;  3L8A A;  4IW7 A;  1IAY A;  1QZ9 A;  2W7E A;  2QA3 A;  1J32 A;  3EIA A;  4MQR A;  1TOE A;  4HF8 A;  4OTL A;  3NDN A;  4ADE A;  1AHE A;  4ZLV A;  1WYU A;  2VIB A;  4A0G A;  3LVJ A;  3RI6 A;  2BHX A;  3KKI A;  4ATP A;  1I29 A;  5EAA A;  1TAS A;  3KGW A;  1C0N A;  2VMO A;  1O69 A;  3P1T A;  1H0C A;  1AKB A;  2X5F A;  3AEJ C;  3VP6 A;  2YKY A;  4MSO A;  4LNL A;  2HOX A;  3R9A A;  1TOG A;  3WLX A;  4XQ2 A;  4RIT A;  1S09 A;  4WXG A;  4M2M A;  2R2N A;  1WKH A;  2XH1 A;  1JF9 A;  4CBS A;  3LVM A;  1GCK A;  4R8D A;  2BI3 A;  4P3M A;  4TN4 A;  3AEJ A;  3K7Y A;  3I16 A;  4JEX A;  2JJE A;  4JF1 A;  2Z9U A;  1YIZ A;  4A0F A;  1AAM A;  1B4X A;  2O7C A;  5E5I A;  1VJO A;  4N0B A;  1MDX A;  2HOR A;  3DZZ A;  3HBX A;  2HUI A;  4W8I A;  1OHW A;  3WCN A;  1Z7D A;  1XEY A;  5K8B A;  2ZC0 A;  3A9X A;  1IBJ A;  1W7N A;  4Y0I A;  1GC2 A;  1AJS B;  1JG8 A;  3FRK A;  5G2P A;  1LKC A;  2X5D A;  1DFO A;  2JGT A;  2VMY A;  3CQ6 A;  3T32 A;  4CXQ A;  2ZY2 A;  2AEV A;  4MY5 A;  1VEF A;  3MKJ A;  1IX7 A;  3DOD A;  4WYA A;  2AY3 A;  4A6T A;  2BWO A;  2ZP7 A;  3W1I A;  2Z20 A;  3MBB A;  1O61 A;  2Z9X A;  2C81 A;  4WB0 A;  2ORD A;  2D61 A;  4TMR A;  3ASA A;  2YRR A;  4IXS A;  3EI5 A;  5HHY A;  2CJH A;  3F0H A;  5E4Z A;  3USF A;  1AJR A;  1ASF A;  2AY4 A;  3ZZK A;  1S06 A;  2CJD A;  3DR7 A;  4A6R A;  1WYV B;  1FC4 A;  1MDO A;  3NYT A;  2VI8 A;  1DKA A;  1BT4 A;  3G0T A;  1M6S A;  3G8M A;  4FL0 A;  1GD9 A;  2ZYJ A;  3GR9 A;  2EZ2 A;  1AMQ A;  5EFS A;  1N31 A;  2G6W A;  3WKR A;  2W7F A;  2E7I A;  4MQQ A;  3WKS A;  3BCB A;  1D7U A;  2BI1 A;  3N0L A;  1BW0 A;  2E54 A;  2DR1 A;  3WY7 A;  5FT4 A;  1CL2 A;  2Z9W A;  4LC3 A;  1DJ9 A;  1WYT A;  3D6K A;  4CXR A;  1TOK A;  1V2E A;  4KYO A;  3B8X A;  4JE5 A;  1TOI A;  3ELP A;  2YKV A;  4BA5 A;  4BHD A;  1ART A;  5FT6 A;  5EUD A;  5D95 A;  2CJG A;  2QB2 A;  1YOO A;  4MKJ A;  2JJF A;  2OQX A;  1OXP A;  4Y0D A;  4EB7 A;  1LC8 A;  2R5E A;  3FDB A;  2VGS A;  3FD0 A;  3LVL B;  2X3L A;  4XJL A;  3MAU A;  5DJ1 A;  1P3W A;  1DJU A;  2BWN A;  1G7X A;  4F5G A;  2WK8 A;  3B46 A;  4ZDO A;  1SZS A;  2Z1Z A;  3NNK A;  4NOG A;  2DKB A;  3EZS A;  4KXK A;  2R0T A;  3N5M A;  1G4V A;  1ARH A;  2X8U A;  3BWN C;  4F5K A;  3EI7 A;  5EUE A;  1TOJ A;  4H51 A;  3FQA A;  2FNI A;  5EIG B;  4F5L A;  2OKK A;  2W7K A;  1DGD A;  3FSL A;  3AEN A;  3HDO A;  3PD6 B;  4LNM A;  3B1D A;  1H1C A;  3TFT A;  3ECD A;  3E2Y A;  3HMU A;  2AY9 A;  3MAD A;  3CQ5 A;  4F5I A;  4K2I A;  3VK3 A;  3ZRP A;  2FQ6 A;  1DTY A;  2YKX A;  4CBR A;  3A8U X;  2VMN A;  2TPL A;  3FDD A;  2VGZ A;  1IX8 A;  2W8V A;  4R5Z A;  5I92 A;  1SZU A;  1XI9 A;  5DB5 A;  1X28 A;  1IVR A;  4LW2 A;  4OBV A;  3EUC A;  1AJS A;  1I48 A;  2HZP A;  3BWO A;  4IYO A;  2NMP A;  1AMR A;  1ASC A;  3I4J A;  4DBC A;  3A2B A;  2GSA A;  4WYE A;  5BJ3 A;  1PG8 A;  3EI6 A;  5M4D A;  4DGT A;  3CAI A;  1GC3 A;  1S08 A;  2VMX A;  3NRA A;  4EMY A;  2C7T A;  2FYF A;  4WXF A;  3TQX A;  3UAK A;  4R2N A;  4AH3 A;  1ELU A;  4BA4 A;  1UU1 A;  2JJH A;  1N8P A;  2HP1 A;  3B1C A;  3II0 A;  2CAN A;  1KKP A;  3G7Q A;  1WYV A;  3PDX A;  4ZWV A;  3FVX A;  3M5U A;  1QGN A;  1PMM A;  3PIU A;  3MAF B;  4JE5 D;  2ZSL A;  1EG5 A;  1BQD A;  4OMA A;  2QMA A;  3EIB A;  2Z61 A;  3QI6 A;  1J04 A;  3BN1 A;  4JEY A;  4RLG A;  1EJI A;  2YCT A;  2W7G A;  4WYD A;  1UKJ A;  3H7F A;  1ZOB A;  2D5Y A;  4Q31 A;  4WD2 A;  3RUY A;  3PA9 A;  1BJO B;  2VLF A;  4A00 A;  4BQ0 A;  4ZDL A;  1KL1 A;  3NX3 A;  4WP0 A;  2BIA A;  3DU4 A;  1CJ0 A;  9AAT A;  4IX8 A;  2WKA A;  4EU1 A;  3A9Y A;  1GEX A;  2AY8 A;  2DKJ A;  4XAU A;  4BMK A;  2VYC A;  1DGE A;  4QGR A;  1W23 A;  4O6Z A;  4W1V A;  1I41 A;  2BKW A;  1M4N A;  3AEP A;  1AMS A;  2YOB A;  1AX4 A;  3DXW A;  3PPL A;  2VI9 A;  3ELE A;  3BC8 A;  2AY2 A;  1GDE A;  2ZJG A;  1WST A;  4UOY A;  3WGB A;  4EB5 A;  1IUG A;  5EIG A;  3JW9 A;  2R5C A;  3EZ1 A;  2BI2 A;  3PD6 A;  1YJY A;  3E2Z A;  4XJP A;  4XJO A;  2VLH A;  4PIW A;  1YJS A;  2OGE A;  3P6K A;  2AY5 A;  4PFF A;  4PFN A;  4XK1 A;  1ZOD A;  3WX9 A;  1C9C A;  3JWA A;  3ZZJ A;  4DQ6 A;  5G4I A;  1B9I A;  1IAX A;  1BJN A;  3RBL A;  1X0M A;  4ATQ A;  4W1W A;  5E3K A;  1QIS A;  1CQ7 A;  4Q6R A;  3IHJ A;  1ASL A;  4ZM4 A;  2FN6 A;  1Y4I A;  3K28 A;  1LK9 A;  3BCX A;  1E5E A;  4B98 A;  3RCH B;  2HOZ A;  2ZUK A;  4A6U A;  2W7M A;  3WZF A;  1DJE A;  2FNU A;  3NTJ A;  4IY7 A;  5G0A A;  2W7I A;  1ARI A;  1O62 A;  1AMA A;  1GEY A;  2VGW A;  3GSB A;  4K2M A;  4ZWM A;  3VK4 A;  1AHX A;  3AOV A;  2QLR A;  2YHK A;  3FZ8 A;  1RVY A;  1PMO A;  4ZM3 A;  2OKJ A;  1M0N A;  2D7Z A;  1C7G A;  4U2H A;  2BIE A;  2VGU A;  3MC6 C;  1QJ5 A;  1T3I A;  2CH2 A;  2AY6 A;  2DGM A;  3E77 A;  5EQC A;  3JTX A;  2FM1 A;  3NUB A;  2YRI A;  1B5P A;  3DR4 A;  1LC7 A;  1JS3 A;  3ASB A;  3MAF A;  2VMV A;  2BYL A;  2DOU A;  1AHF A;  4ZDP A;  1W7L A;  3BB8 A;  1ASM A;  4WYC A;  3MC6 A;  1AY4 A;  4RKD A;  5HDM A;  4ZSW A;  2VMT A;  1X29 A;  2GB3 A;  2WK9 A;  2OGA A;  3HLM A;  2PB0 A;  4F5J A;  2VMZ A;  1RVU A;  1ORD A;  3AV7 A;  3N75 A;  5F8V A;  2E7U A;  1KKJ A;  1BJO A;  4AZJ A;  1V72 A;  4KAM A;  1ECX A;  2BYJ A;  3DC1 A;  4F5M A;  1E5F A;  2V0Y A;  3HL2 A;  2Q7W A;  3BWN A;  4WYG A;  2C0R A;  1LC5 A;  3RQ1 A;  2VMS A;  2Z1Y A;  3AEM C;  1PFF A;  1KL2 A;  2ZY4 A;  2OAT A;  1D2F A;  1X2A A;  1AHG A;  3GZC A;  1AIA A;  1N2T A;  1MAP A;  4RAE A;  4A0H A;  5M4B A;  1AHY A;  1BS0 A;  1YJZ A;  3WGC A;  3H14 A;  3TFU A;  4CVQ A;  5D5S A;  2GMU A;  4MQP A;  2AY7 A;  1EQB A;  3AEM A;  4ITX A;  2WK7 A;  1UU2 A;  5EUN A;  1AY8 A;  1IX6 A;  1YNU A;  2W8J A;  4P7Y A;  1OHV A;  2D63 A;  2D64 A;  3RBF A;  1BJW A;  1ASG A;  4XJM A;  4AOA A;  2C44 A;  5J8Q A;  3ISL A;  4OBU A;  1YAA A;  2W8U A;  2E7J A;  1C4K A;  4GDY A;  3PAA A;  3HQT A;  2AY1 A;  4MGR A;  1S0A A;  2O0R A;  3QPG A;  1SPA A;  5DJ9 A;  2JJG A;  4XEW A;  1D7R A;  1ARG A;  3A9Z A;  1TPL A;  1ARS A;  1SVV A;  3GWP A;  3LG0 A;  2F8J A;  4B9B A;  4UQV A;  3QN6 A; 
#chains in the Genus database with same CATH topology
 3RCH A;  4LW4 A;  3I5T A;  4JEV A;  4N0W A;  1VP4 A;  3B1E A;  1C7O A;  4WLH A;  4RJ0 A;  2BIG A;  1KAF A;  2HP2 A;  4F5F A;  4AO9 A;  4UHN A;  3R4T A;  1AY5 A;  3N4S A;  4M2K A;  1FG7 A;  1BQA A;  1GC0 A;  1KMJ A;  2BI9 A;  4UHM A;  5LH9 A;  2EZ1 A;  3WCO A;  1M32 A;  1AIC A;  1BJ4 A;  1CL1 A;  4W91 A;  2YKU A;  4R5F A;  5DX5 A;  2VMQ A;  2GMS A;  4F5H A;  3VK2 A;  2DGK A;  1U08 A;  1ASA A;  1GEW A;  2EO5 A;  2W7L A;  4JEW A;  2CH1 A;  4E77 A;  1CS1 A;  2EGY A;  3COG A;  4AZK A;  1G4X A;  2QBT A;  4J5U A;  2BI5 A;  3AEO A;  1D7S A;  3DRD A;  3FVU A;  3AEN B;  1SFF A;  3NYU A;  2D7Y A;  3N7N A;  1AAW A;  1M7Y A;  3E2F A;  4PVF A;  4E1O A;  4W1X A;  4GE4 A;  2O1B A;  4WYF A;  2EPJ A;  5EAV A;  2PO3 A;  4J8L A;  3JZL A;  3UE8 A;  3EI9 A;  4RKC A;  4GEB A;  5C6U A;  1RV3 A;  8AAT A;  1ASN A;  5IWQ A;  4GE9 A;  2CB1 A;  2ZSM A;  3OP7 A;  5M49 A;  3FZ7 A;  1ASE A;  2D66 A;  1LW4 A;  4K05 A;  3ACZ A;  3BCA A;  1OAT A;  2VIA A;  1TAT A;  3W1H A;  3FQ8 A;  7AAT A;  2JIS A;  2W8W A;  1YIY A;  3CBF A;  4ADC A;  3LWS A;  4IYO B;  2AAT A;  1UU0 A;  2QB3 A;  4IXO A;  2QSR A;  3F9T A;  3UWC A;  1KMK A;  3NUI A;  1W3U A;  1JS6 A;  2CY8 A;  3FQ7 A;  3JWB A;  4MKK A;  2Z9V A;  3DYD A;  3MEB A;  4OYT A;  1QIR A;  3QGU A;  1MAQ A;  2RFV A;  2YCN A;  1MLZ A;  3PDB B;  3NU7 A;  2XBN A;  1ASD A;  4ZSY A;  1B8G A;  4E3R A;  2DGL A;  5HXX A;  3ZRR A;  4FFC A;  3BV0 A;  5G4J A;  1WKG A;  3QBO A;  3QM2 A;  4TV7 A;  3GJU A;  5TF5 A;  1G7W A;  1MDZ A;  5BJ4 A;  5LHA A;  4WXB A;  3VOM A;  1WYU B;  1GBN A;  1GC4 A;  5FT5 A;  3FCR A;  2W7H A;  2CIN A;  2VMW A;  2CST A;  2W8T A;  4WBT A;  3DXV A;  2W7J A;  1S07 A;  3GBX A;  4OT8 A;  3E9K A;  4ZAH A;  4A72 A;  3BS8 A;  1CZE A;  3OKS A;  2VMR A;  3GET A;  3ATH A;  2HUU A;  4WLJ A;  3FKD A;  2VGV A;  2D65 A;  4GE7 A;  1AKC A;  3F6T A;  3FVS A;  3HT4 A;  5FT8 A;  1MGV A;  1IJI A;  1MLY A;  2CTZ A;  3L44 A;  4M2J A;  5M46 A;  1SZK A;  1ELQ A;  3TCM A;  3VAX A;  1QIT A;  4ISY A;  4ITG A;  4RJY A;  2VGT A;  4JEZ A;  3K40 A;  2FKI A;  3H9X A;  1O4S A;  2PB2 A;  3PJ0 A;  3AEL A;  4OC9 A;  2HOY A;  3E6G A;  5G09 A;  1W7M A;  4Q76 A;  4E3Q A;  2ZY3 A;  1I43 A;  3KGX A;  3FFR A;  3ZRQ A;  3AAT A;  1QJ3 A;  2GQN A;  2VMP A;  1AKA A;  1OXO A;  3LV2 A;  5JAY A;  1ASB A;  1M0Q A;  3FFH A;  4RM1 A;  3EI8 A;  2R5C B;  1CQ6 A;  4Q75 A;  3QHX A;  2VMU A;  4K2B A;  3E2Z B;  3Q8N A;  4ADB A;  1B9H A;  2EH6 A;  3CQ4 A;  3GZD C;  4WB0 B;  1D7V A;  1M0P A;  2YCP A;  3PGY A;  3FZ6 A;  1CQ8 A;  1RV4 A;  4EFF A;  2Z67 A;  1B5O A;  4GSA A;  3IF2 A;  4ADD A;  4L0O A;  3AOW A;  4W5K A;  1M0O A;  1LW5 A;  5AX8 A;  3NYS A;  3GZD A;  2CFB A;  3KE3 A;  3W1J A;  4HVK A;  1OHY A;  3N4X A;  1V2D A;  4IXZ A;  4Y0H A;  2W7D A;  3LY1 A;  4UHO A;  2HUF A;  4F4E A;  1SF2 A;  4A0R A;  4AO4 A;  2ZY5 A;  1LS3 A;  2BWP A;  3HVY A;  2V1P A;  1AIB A;  5G2Q A;  1TAR A;  3FTB A;  3NU8 A;  3LVK A;  4LNJ A;  1V2F A;  1C7N A;  1WYT B;  2AEU A;  4I8A A;  5F9S A;  1FG3 A;  4GRX A;  3JU7 A;  4OCA A;  4RIZ A;  3PDB A;  1CZC A;  4JF0 A;  2JG2 A;  1BKG A;  3TAT A;  4U1T A;  1Z3Z A;  1ZC9 A;  4ZAS A;  3L8A A;  4IW7 A;  1IAY A;  1QZ9 A;  2W7E A;  2QA3 A;  1J32 A;  3EIA A;  4MQR A;  1TOE A;  4HF8 A;  4OTL A;  3NDN A;  4ADE A;  1AHE A;  4ZLV A;  1WYU A;  2VIB A;  4A0G A;  3LVJ A;  3RI6 A;  2BHX A;  3KKI A;  4ATP A;  1I29 A;  5EAA A;  1TAS A;  3KGW A;  1C0N A;  2VMO A;  1O69 A;  3P1T A;  1H0C A;  1AKB A;  2X5F A;  3AEJ C;  3VP6 A;  2YKY A;  4MSO A;  4LNL A;  2HOX A;  3R9A A;  1TOG A;  3WLX A;  4XQ2 A;  4RIT A;  1S09 A;  4WXG A;  4M2M A;  2R2N A;  1WKH A;  2XH1 A;  1JF9 A;  4CBS A;  3LVM A;  1GCK A;  4R8D A;  2BI3 A;  4P3M A;  4TN4 A;  3AEJ A;  3K7Y A;  3I16 A;  4JEX A;  2JJE A;  4JF1 A;  2Z9U A;  1YIZ A;  4A0F A;  1AAM A;  1B4X A;  2O7C A;  5E5I A;  1VJO A;  4N0B A;  1MDX A;  2HOR A;  3DZZ A;  3HBX A;  2HUI A;  4W8I A;  1OHW A;  3WCN A;  1Z7D A;  1XEY A;  5K8B A;  2ZC0 A;  3A9X A;  1IBJ A;  1W7N A;  4Y0I A;  1GC2 A;  1AJS B;  1JG8 A;  3FRK A;  5G2P A;  1LKC A;  2X5D A;  1DFO A;  2JGT A;  2VMY A;  3CQ6 A;  3T32 A;  4CXQ A;  2ZY2 A;  2AEV A;  4MY5 A;  1VEF A;  3MKJ A;  1IX7 A;  3DOD A;  4WYA A;  2AY3 A;  4A6T A;  2BWO A;  2ZP7 A;  3W1I A;  2Z20 A;  3MBB A;  1O61 A;  2Z9X A;  2C81 A;  4WB0 A;  2ORD A;  2D61 A;  4TMR A;  3ASA A;  2YRR A;  4IXS A;  3EI5 A;  5HHY A;  2CJH A;  3F0H A;  5E4Z A;  3USF A;  1AJR A;  1ASF A;  4H63 Q;  2AY4 A;  3ZZK A;  1S06 A;  2CJD A;  3DR7 A;  4A6R A;  1WYV B;  1FC4 A;  1MDO A;  3NYT A;  2VI8 A;  1DKA A;  1BT4 A;  3G0T A;  1M6S A;  3G8M A;  4FL0 A;  1GD9 A;  2KFP A;  2ZYJ A;  3GR9 A;  2EZ2 A;  1AMQ A;  5EFS A;  1N31 A;  2G6W A;  3WKR A;  2W7F A;  2E7I A;  4MQQ A;  3WKS A;  3BCB A;  1D7U A;  2BI1 A;  3N0L A;  1BW0 A;  2E54 A;  2DR1 A;  3WY7 A;  5FT4 A;  1CL2 A;  2Z9W A;  4LC3 A;  1DJ9 A;  1WYT A;  3D6K A;  4CXR A;  1TOK A;  1V2E A;  4KYO A;  3B8X A;  4JE5 A;  1TOI A;  3ELP A;  2YKV A;  4BA5 A;  4BHD A;  1ART A;  5FT6 A;  5EUD A;  5D95 A;  2CJG A;  2QB2 A;  1YOO A;  4MKJ A;  2JJF A;  2OQX A;  1OXP A;  4Y0D A;  4EB7 A;  1LC8 A;  2R5E A;  3FDB A;  2VGS A;  3FD0 A;  3LVL B;  2X3L A;  4XJL A;  3MAU A;  5DJ1 A;  1P3W A;  1DJU A;  2BWN A;  1G7X A;  4F5G A;  2WK8 A;  3B46 A;  4ZDO A;  1SZS A;  2Z1Z A;  3NNK A;  4NOG A;  2DKB A;  3EZS A;  4KXK A;  2R0T A;  3N5M A;  1G4V A;  1ARH A;  2X8U A;  3BWN C;  4F5K A;  3EI7 A;  5EUE A;  1TOJ A;  4H51 A;  3FQA A;  2FNI A;  5EIG B;  4F5L A;  2OKK A;  2W7K A;  1DGD A;  3FSL A;  3AEN A;  3HDO A;  3PD6 B;  4LNM A;  3B1D A;  1H1C A;  3TFT A;  3ECD A;  3E2Y A;  3HMU A;  2AY9 A;  3MAD A;  3CQ5 A;  4F5I A;  4K2I A;  3VK3 A;  3ZRP A;  2FQ6 A;  1DTY A;  2YKX A;  4CBR A;  3A8U X;  2VMN A;  2TPL A;  3FDD A;  2VGZ A;  1IX8 A;  2W8V A;  4R5Z A;  5I92 A;  1SZU A;  1XI9 A;  5DB5 A;  1X28 A;  1IVR A;  4LW2 A;  4OBV A;  3EUC A;  1AJS A;  1I48 A;  2HZP A;  3BWO A;  4IYO A;  2NMP A;  1AMR A;  1ASC A;  3I4J A;  4DBC A;  3A2B A;  2GSA A;  4WYE A;  5BJ3 A;  1PG8 A;  3EI6 A;  5M4D A;  4DGT A;  3CAI A;  1GC3 A;  1S08 A;  2VMX A;  3NRA A;  4EMY A;  2C7T A;  2FYF A;  4WXF A;  3TQX A;  3UAK A;  4R2N A;  4AH3 A;  1ELU A;  4BA4 A;  1UU1 A;  2JJH A;  1N8P A;  2HP1 A;  3B1C A;  3II0 A;  2CAN A;  1KKP A;  3G7Q A;  1WYV A;  3PDX A;  4ZWV A;  3FVX A;  3M5U A;  1QGN A;  1PMM A;  3PIU A;  3MAF B;  4JE5 D;  2ZSL A;  1EG5 A;  1BQD A;  4OMA A;  2QMA A;  3EIB A;  2Z61 A;  3QI6 A;  1J04 A;  3BN1 A;  4JEY A;  4RLG A;  1EJI A;  2YCT A;  2W7G A;  4WYD A;  1UKJ A;  3H7F A;  1ZOB A;  2D5Y A;  4Q31 A;  4WD2 A;  3RUY A;  3PA9 A;  1BJO B;  2VLF A;  4A00 A;  4BQ0 A;  4ZDL A;  1KL1 A;  3NX3 A;  4WP0 A;  2BIA A;  3DU4 A;  1CJ0 A;  9AAT A;  4IX8 A;  2WKA A;  4EU1 A;  3A9Y A;  1GEX A;  2AY8 A;  2DKJ A;  4XAU A;  4BMK A;  2VYC A;  1DGE A;  4QGR A;  1W23 A;  4O6Z A;  4W1V A;  1I41 A;  2BKW A;  1M4N A;  3AEP A;  1AMS A;  2YOB A;  1AX4 A;  3DXW A;  3PPL A;  2VI9 A;  3ELE A;  3BC8 A;  2AY2 A;  1GDE A;  2ZJG A;  1WST A;  4UOY A;  3WGB A;  4EB5 A;  1IUG A;  5EIG A;  3JW9 A;  2R5C A;  3EZ1 A;  2BI2 A;  3PD6 A;  1YJY A;  3E2Z A;  4XJP A;  4XJO A;  2VLH A;  4PIW A;  1YJS A;  2OGE A;  3P6K A;  2AY5 A;  4PFF A;  4PFN A;  4XK1 A;  1ZOD A;  3WX9 A;  1C9C A;  3JWA A;  3ZZJ A;  4DQ6 A;  5G4I A;  1B9I A;  1IAX A;  1BJN A;  3RBL A;  1X0M A;  4ATQ A;  2EYQ A;  4W1W A;  5E3K A;  1QIS A;  1CQ7 A;  4Q6R A;  3IHJ A;  1ASL A;  4ZM4 A;  2FN6 A;  1Y4I A;  3K28 A;  1LK9 A;  3BCX A;  1E5E A;  4B98 A;  3RCH B;  2HOZ A;  2ZUK A;  4A6U A;  2W7M A;  3WZF A;  1DJE A;  2FNU A;  3NTJ A;  4IY7 A;  5G0A A;  2W7I A;  1ARI A;  1O62 A;  1AMA A;  1GEY A;  2VGW A;  3GSB A;  4K2M A;  4ZWM A;  3VK4 A;  1AHX A;  3AOV A;  2QLR A;  2A1V A;  2YHK A;  3FZ8 A;  1RVY A;  2G7J A;  1PMO A;  4ZM3 A;  2OKJ A;  1M0N A;  2D7Z A;  1C7G A;  4U2H A;  2BIE A;  2VGU A;  3MC6 C;  1QJ5 A;  1T3I A;  2CH2 A;  2AY6 A;  2DGM A;  3E77 A;  5EQC A;  3JTX A;  2FM1 A;  3NUB A;  2YRI A;  1B5P A;  3DR4 A;  1LC7 A;  1JS3 A;  3ASB A;  3MAF A;  2VMV A;  2BYL A;  2DOU A;  1AHF A;  4ZDP A;  1W7L A;  3BB8 A;  1ASM A;  4WYC A;  3MC6 A;  1AY4 A;  4RKD A;  5HDM A;  4ZSW A;  2VMT A;  1X29 A;  2GB3 A;  2WK9 A;  2OGA A;  3HLM A;  2PB0 A;  4F5J A;  2VMZ A;  1RVU A;  1ORD A;  3AV7 A;  3N75 A;  5F8V A;  2E7U A;  1KKJ A;  1BJO A;  4AZJ A;  1V72 A;  4KAM A;  1ECX A;  2BYJ A;  3DC1 A;  4F5M A;  1E5F A;  2V0Y A;  3HL2 A;  2Q7W A;  3BWN A;  4WYG A;  2C0R A;  1LC5 A;  3RQ1 A;  2VMS A;  2Z1Y A;  3AEM C;  1PFF A;  1KL2 A;  2ZY4 A;  2OAT A;  1D2F A;  1X2A A;  1AHG A;  3GZC A;  1AIA A;  1N2T A;  1MAP A;  4RAE A;  4A0H A;  5M4B A;  1AHY A;  1BS0 A;  1YJZ A;  3WGC A;  3H14 A;  3TFU A;  4CVQ A;  5D5S A;  2WB6 A;  2GMU A;  4MQP A;  2AY7 A;  1EQB A;  3AEM A;  4ITX A;  2WK7 A;  1UU2 A;  5EUN A;  1AY8 A;  1IX6 A;  1YNU A;  2W8J A;  4P7Y A;  1OHV A;  2D63 A;  2D64 A;  3RBF A;  1BJW A;  1ASG A;  4XJM A;  4AOA A;  2C44 A;  5J8Q A;  3ISL A;  4OBU A;  1YAA A;  2W8U A;  2E7J A;  1C4K A;  4GDY A;  5KTB A;  3PAA A;  3HQT A;  2AY1 A;  4MGR A;  1S0A A;  2O0R A;  3QPG A;  1SPA A;  5DJ9 A;  2JJG A;  4XEW A;  1D7R A;  1ARG A;  3N4R A;  3A9Z A;  1TPL A;  1ARS A;  1SVV A;  3GWP A;  3LG0 A;  2F8J A;  4B9B A;  4UQV A;  3QN6 A; 
#chains in the Genus database with same CATH homology
 3RCH A;  4LW4 A;  3I5T A;  4JEV A;  4N0W A;  1VP4 A;  3B1E A;  1C7O A;  4WLH A;  4RJ0 A;  2BIG A;  2HP2 A;  4F5F A;  4AO9 A;  4UHN A;  3R4T A;  1AY5 A;  3N4S A;  4M2K A;  1FG7 A;  1BQA A;  1GC0 A;  1KMJ A;  2BI9 A;  4UHM A;  5LH9 A;  2EZ1 A;  3WCO A;  1M32 A;  1AIC A;  1BJ4 A;  1CL1 A;  4W91 A;  2YKU A;  4R5F A;  5DX5 A;  2VMQ A;  2GMS A;  4F5H A;  3VK2 A;  2DGK A;  1U08 A;  1ASA A;  1GEW A;  2EO5 A;  2W7L A;  4JEW A;  2CH1 A;  4E77 A;  1CS1 A;  2EGY A;  3COG A;  4AZK A;  1G4X A;  2QBT A;  4J5U A;  2BI5 A;  3AEO A;  1D7S A;  3DRD A;  3FVU A;  3AEN B;  1SFF A;  3NYU A;  2D7Y A;  3N7N A;  1AAW A;  1M7Y A;  3E2F A;  4PVF A;  4E1O A;  4W1X A;  4GE4 A;  2O1B A;  4WYF A;  2EPJ A;  5EAV A;  2PO3 A;  4J8L A;  3JZL A;  3UE8 A;  3EI9 A;  4RKC A;  4GEB A;  5C6U A;  1RV3 A;  8AAT A;  1ASN A;  5IWQ A;  4GE9 A;  2CB1 A;  2ZSM A;  3OP7 A;  5M49 A;  3FZ7 A;  1ASE A;  2D66 A;  1LW4 A;  4K05 A;  3ACZ A;  3BCA A;  1OAT A;  2VIA A;  1TAT A;  3W1H A;  3FQ8 A;  7AAT A;  2JIS A;  2W8W A;  1YIY A;  3CBF A;  4ADC A;  3LWS A;  4IYO B;  2AAT A;  1UU0 A;  2QB3 A;  4IXO A;  2QSR A;  3F9T A;  3UWC A;  1KMK A;  3NUI A;  1W3U A;  1JS6 A;  2CY8 A;  3FQ7 A;  3JWB A;  4MKK A;  2Z9V A;  3DYD A;  3MEB A;  4OYT A;  1QIR A;  3QGU A;  1MAQ A;  2RFV A;  2YCN A;  1MLZ A;  3PDB B;  3NU7 A;  2XBN A;  1ASD A;  4ZSY A;  1B8G A;  4E3R A;  2DGL A;  5HXX A;  3ZRR A;  4FFC A;  3BV0 A;  5G4J A;  1WKG A;  3QBO A;  3QM2 A;  4TV7 A;  3GJU A;  5TF5 A;  1G7W A;  1MDZ A;  5BJ4 A;  5LHA A;  4WXB A;  3VOM A;  1WYU B;  1GBN A;  1GC4 A;  5FT5 A;  3FCR A;  2W7H A;  2CIN A;  2VMW A;  2CST A;  2W8T A;  4WBT A;  3DXV A;  2W7J A;  1S07 A;  3GBX A;  4OT8 A;  3E9K A;  4ZAH A;  4A72 A;  3BS8 A;  1CZE A;  3OKS A;  2VMR A;  3GET A;  3ATH A;  2HUU A;  4WLJ A;  3FKD A;  2VGV A;  2D65 A;  4GE7 A;  1AKC A;  3F6T A;  3FVS A;  3HT4 A;  5FT8 A;  1MGV A;  1IJI A;  1MLY A;  2CTZ A;  3L44 A;  4M2J A;  5M46 A;  1SZK A;  1ELQ A;  3TCM A;  3VAX A;  1QIT A;  4ISY A;  4ITG A;  4RJY A;  2VGT A;  4JEZ A;  3K40 A;  2FKI A;  3H9X A;  1O4S A;  2PB2 A;  3PJ0 A;  3AEL A;  4OC9 A;  2HOY A;  3E6G A;  5G09 A;  1W7M A;  4Q76 A;  4E3Q A;  2ZY3 A;  1I43 A;  3KGX A;  3FFR A;  3ZRQ A;  3AAT A;  1QJ3 A;  2GQN A;  2VMP A;  1AKA A;  1OXO A;  3LV2 A;  5JAY A;  1ASB A;  1M0Q A;  3FFH A;  4RM1 A;  3EI8 A;  2R5C B;  1CQ6 A;  4Q75 A;  3QHX A;  2VMU A;  4K2B A;  3E2Z B;  3Q8N A;  4ADB A;  1B9H A;  2EH6 A;  3CQ4 A;  3GZD C;  4WB0 B;  1D7V A;  1M0P A;  2YCP A;  3PGY A;  3FZ6 A;  1CQ8 A;  1RV4 A;  4EFF A;  2Z67 A;  1B5O A;  4GSA A;  3IF2 A;  4ADD A;  4L0O A;  3AOW A;  4W5K A;  1M0O A;  1LW5 A;  5AX8 A;  3NYS A;  3GZD A;  2CFB A;  3KE3 A;  3W1J A;  4HVK A;  1OHY A;  3N4X A;  1V2D A;  4IXZ A;  4Y0H A;  2W7D A;  3LY1 A;  4UHO A;  2HUF A;  4F4E A;  1SF2 A;  4A0R A;  4AO4 A;  2ZY5 A;  1LS3 A;  2BWP A;  3HVY A;  2V1P A;  1AIB A;  5G2Q A;  1TAR A;  3FTB A;  3NU8 A;  3LVK A;  4LNJ A;  1V2F A;  1C7N A;  1WYT B;  2AEU A;  4I8A A;  5F9S A;  1FG3 A;  4GRX A;  3JU7 A;  4OCA A;  4RIZ A;  3PDB A;  1CZC A;  4JF0 A;  2JG2 A;  1BKG A;  3TAT A;  4U1T A;  1Z3Z A;  1ZC9 A;  4ZAS A;  3L8A A;  4IW7 A;  1IAY A;  1QZ9 A;  2W7E A;  2QA3 A;  1J32 A;  3EIA A;  4MQR A;  1TOE A;  4HF8 A;  4OTL A;  3NDN A;  4ADE A;  1AHE A;  4ZLV A;  1WYU A;  2VIB A;  4A0G A;  3LVJ A;  3RI6 A;  2BHX A;  3KKI A;  4ATP A;  1I29 A;  5EAA A;  1TAS A;  3KGW A;  1C0N A;  2VMO A;  1O69 A;  3P1T A;  1H0C A;  1AKB A;  2X5F A;  3AEJ C;  3VP6 A;  2YKY A;  4MSO A;  4LNL A;  2HOX A;  3R9A A;  1TOG A;  3WLX A;  4XQ2 A;  4RIT A;  1S09 A;  4WXG A;  4M2M A;  2R2N A;  1WKH A;  2XH1 A;  1JF9 A;  4CBS A;  3LVM A;  1GCK A;  4R8D A;  2BI3 A;  4P3M A;  4TN4 A;  3AEJ A;  3K7Y A;  3I16 A;  4JEX A;  2JJE A;  4JF1 A;  2Z9U A;  1YIZ A;  4A0F A;  1AAM A;  1B4X A;  2O7C A;  5E5I A;  1VJO A;  4N0B A;  1MDX A;  2HOR A;  3DZZ A;  3HBX A;  2HUI A;  4W8I A;  1OHW A;  3WCN A;  1Z7D A;  1XEY A;  5K8B A;  2ZC0 A;  3A9X A;  1IBJ A;  1W7N A;  4Y0I A;  1GC2 A;  1AJS B;  1JG8 A;  3FRK A;  5G2P A;  1LKC A;  2X5D A;  1DFO A;  2JGT A;  2VMY A;  3CQ6 A;  3T32 A;  4CXQ A;  2ZY2 A;  2AEV A;  4MY5 A;  1VEF A;  3MKJ A;  1IX7 A;  3DOD A;  4WYA A;  2AY3 A;  4A6T A;  2BWO A;  2ZP7 A;  3W1I A;  2Z20 A;  3MBB A;  1O61 A;  2Z9X A;  2C81 A;  4WB0 A;  2ORD A;  2D61 A;  4TMR A;  3ASA A;  2YRR A;  4IXS A;  3EI5 A;  5HHY A;  2CJH A;  3F0H A;  5E4Z A;  3USF A;  1AJR A;  1ASF A;  4H63 Q;  2AY4 A;  3ZZK A;  1S06 A;  2CJD A;  3DR7 A;  4A6R A;  1WYV B;  1FC4 A;  1MDO A;  3NYT A;  2VI8 A;  1DKA A;  1BT4 A;  3G0T A;  1M6S A;  3G8M A;  4FL0 A;  1GD9 A;  2KFP A;  2ZYJ A;  3GR9 A;  2EZ2 A;  1AMQ A;  5EFS A;  1N31 A;  2G6W A;  3WKR A;  2W7F A;  2E7I A;  4MQQ A;  3WKS A;  3BCB A;  1D7U A;  2BI1 A;  3N0L A;  1BW0 A;  2E54 A;  2DR1 A;  3WY7 A;  5FT4 A;  1CL2 A;  2Z9W A;  4LC3 A;  1DJ9 A;  1WYT A;  3D6K A;  4CXR A;  1TOK A;  1V2E A;  4KYO A;  3B8X A;  4JE5 A;  1TOI A;  3ELP A;  2YKV A;  4BA5 A;  4BHD A;  1ART A;  5FT6 A;  5EUD A;  5D95 A;  2CJG A;  2QB2 A;  1YOO A;  4MKJ A;  2JJF A;  2OQX A;  1OXP A;  4Y0D A;  4EB7 A;  1LC8 A;  2R5E A;  3FDB A;  2VGS A;  3FD0 A;  3LVL B;  2X3L A;  4XJL A;  3MAU A;  5DJ1 A;  1P3W A;  1DJU A;  2BWN A;  1G7X A;  4F5G A;  2WK8 A;  3B46 A;  4ZDO A;  1SZS A;  2Z1Z A;  3NNK A;  4NOG A;  2DKB A;  3EZS A;  4KXK A;  2R0T A;  3N5M A;  1G4V A;  1ARH A;  2X8U A;  3BWN C;  4F5K A;  3EI7 A;  5EUE A;  1TOJ A;  4H51 A;  3FQA A;  2FNI A;  5EIG B;  4F5L A;  2OKK A;  2W7K A;  1DGD A;  3FSL A;  3AEN A;  3HDO A;  3PD6 B;  4LNM A;  3B1D A;  1H1C A;  3TFT A;  3ECD A;  3E2Y A;  3HMU A;  2AY9 A;  3MAD A;  3CQ5 A;  4F5I A;  4K2I A;  3VK3 A;  3ZRP A;  2FQ6 A;  1DTY A;  2YKX A;  4CBR A;  3A8U X;  2VMN A;  2TPL A;  3FDD A;  2VGZ A;  1IX8 A;  2W8V A;  4R5Z A;  5I92 A;  1SZU A;  1XI9 A;  5DB5 A;  1X28 A;  1IVR A;  4LW2 A;  4OBV A;  3EUC A;  1AJS A;  1I48 A;  2HZP A;  3BWO A;  4IYO A;  2NMP A;  1AMR A;  1ASC A;  3I4J A;  4DBC A;  3A2B A;  2GSA A;  4WYE A;  5BJ3 A;  1PG8 A;  3EI6 A;  5M4D A;  4DGT A;  3CAI A;  1GC3 A;  1S08 A;  2VMX A;  3NRA A;  4EMY A;  2C7T A;  2FYF A;  4WXF A;  3TQX A;  3UAK A;  4R2N A;  4AH3 A;  1ELU A;  4BA4 A;  1UU1 A;  2JJH A;  1N8P A;  2HP1 A;  3B1C A;  3II0 A;  2CAN A;  1KKP A;  3G7Q A;  1WYV A;  3PDX A;  4ZWV A;  3FVX A;  3M5U A;  1QGN A;  1PMM A;  3PIU A;  3MAF B;  4JE5 D;  2ZSL A;  1EG5 A;  1BQD A;  4OMA A;  2QMA A;  3EIB A;  2Z61 A;  3QI6 A;  1J04 A;  3BN1 A;  4JEY A;  4RLG A;  1EJI A;  2YCT A;  2W7G A;  4WYD A;  1UKJ A;  3H7F A;  1ZOB A;  2D5Y A;  4Q31 A;  4WD2 A;  3RUY A;  3PA9 A;  1BJO B;  2VLF A;  4A00 A;  4BQ0 A;  4ZDL A;  1KL1 A;  3NX3 A;  4WP0 A;  2BIA A;  3DU4 A;  1CJ0 A;  9AAT A;  4IX8 A;  2WKA A;  4EU1 A;  3A9Y A;  1GEX A;  2AY8 A;  2DKJ A;  4XAU A;  4BMK A;  2VYC A;  1DGE A;  4QGR A;  1W23 A;  4O6Z A;  4W1V A;  1I41 A;  2BKW A;  1M4N A;  3AEP A;  1AMS A;  2YOB A;  1AX4 A;  3DXW A;  3PPL A;  2VI9 A;  3ELE A;  3BC8 A;  2AY2 A;  1GDE A;  2ZJG A;  1WST A;  4UOY A;  3WGB A;  4EB5 A;  1IUG A;  5EIG A;  3JW9 A;  2R5C A;  3EZ1 A;  2BI2 A;  3PD6 A;  1YJY A;  3E2Z A;  4XJP A;  4XJO A;  2VLH A;  4PIW A;  1YJS A;  2OGE A;  3P6K A;  2AY5 A;  4PFF A;  4PFN A;  4XK1 A;  1ZOD A;  3WX9 A;  1C9C A;  3JWA A;  3ZZJ A;  4DQ6 A;  5G4I A;  1B9I A;  1IAX A;  1BJN A;  3RBL A;  1X0M A;  4ATQ A;  2EYQ A;  4W1W A;  5E3K A;  1QIS A;  1CQ7 A;  4Q6R A;  3IHJ A;  1ASL A;  4ZM4 A;  2FN6 A;  1Y4I A;  3K28 A;  1LK9 A;  3BCX A;  1E5E A;  4B98 A;  3RCH B;  2HOZ A;  2ZUK A;  4A6U A;  2W7M A;  3WZF A;  1DJE A;  2FNU A;  3NTJ A;  4IY7 A;  5G0A A;  2W7I A;  1ARI A;  1O62 A;  1AMA A;  1GEY A;  2VGW A;  3GSB A;  4K2M A;  4ZWM A;  3VK4 A;  1AHX A;  3AOV A;  2QLR A;  2A1V A;  2YHK A;  3FZ8 A;  1RVY A;  2G7J A;  1PMO A;  4ZM3 A;  2OKJ A;  1M0N A;  2D7Z A;  1C7G A;  4U2H A;  2BIE A;  2VGU A;  3MC6 C;  1QJ5 A;  1T3I A;  2CH2 A;  2AY6 A;  2DGM A;  3E77 A;  5EQC A;  3JTX A;  2FM1 A;  3NUB A;  2YRI A;  1B5P A;  3DR4 A;  1LC7 A;  1JS3 A;  3ASB A;  3MAF A;  2VMV A;  2BYL A;  2DOU A;  1AHF A;  4ZDP A;  1W7L A;  3BB8 A;  1ASM A;  4WYC A;  3MC6 A;  1AY4 A;  4RKD A;  5HDM A;  4ZSW A;  2VMT A;  1X29 A;  2GB3 A;  2WK9 A;  2OGA A;  3HLM A;  2PB0 A;  4F5J A;  2VMZ A;  1RVU A;  1ORD A;  3AV7 A;  3N75 A;  5F8V A;  2E7U A;  1KKJ A;  1BJO A;  4AZJ A;  1V72 A;  4KAM A;  1ECX A;  2BYJ A;  3DC1 A;  4F5M A;  1E5F A;  2V0Y A;  3HL2 A;  2Q7W A;  3BWN A;  4WYG A;  2C0R A;  1LC5 A;  3RQ1 A;  2VMS A;  2Z1Y A;  3AEM C;  1PFF A;  1KL2 A;  2ZY4 A;  2OAT A;  1D2F A;  1X2A A;  1AHG A;  3GZC A;  1AIA A;  1N2T A;  1MAP A;  4RAE A;  4A0H A;  5M4B A;  1AHY A;  1BS0 A;  1YJZ A;  3WGC A;  3H14 A;  3TFU A;  4CVQ A;  5D5S A;  2WB6 A;  2GMU A;  4MQP A;  2AY7 A;  1EQB A;  3AEM A;  4ITX A;  2WK7 A;  1UU2 A;  5EUN A;  1AY8 A;  1IX6 A;  1YNU A;  2W8J A;  4P7Y A;  1OHV A;  2D63 A;  2D64 A;  3RBF A;  1BJW A;  1ASG A;  4XJM A;  4AOA A;  2C44 A;  5J8Q A;  3ISL A;  4OBU A;  1YAA A;  2W8U A;  2E7J A;  1C4K A;  4GDY A;  5KTB A;  3PAA A;  3HQT A;  2AY1 A;  4MGR A;  1S0A A;  2O0R A;  3QPG A;  1SPA A;  5DJ9 A;  2JJG A;  4XEW A;  1D7R A;  1ARG A;  3N4R A;  3A9Z A;  1TPL A;  1ARS A;  1SVV A;  3GWP A;  3LG0 A;  2F8J A;  4B9B A;  4UQV A;  3QN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...