4Q7LA

Structure of nbd288 of tm287/288
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
b'SGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKEAALEVLFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized ABC transporter ATP-binding protein TM_0288
publication title A Transporter Motor Taken Apart: Flexibility in the Nucleotide Binding Domains of a Heterodimeric ABC Exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal binding protein
total genus 88
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q7lA00
4M1MA 3F3YA 1FNMA 1L2TA 2GK6A 4Q5IA 2ZR9A 4B6FA 5EUMA 4TZ0A 3EA5A 4IRUB 4LX0A 1W44A 3DO6A 2GBLA 1S96A 2ZE7A 3GLHA 1BMFA 4ASUA 3AV0B 4DDTA 1SVOA 1GKIA 2V1XA 2WJVA 5LPNA 4GL2A 2BMEA 4BRWA 1GFIA 3U60B 1RKBA 3T1QA 1OKKA 2KWIA 4A2WA 1E96A 1FQKA 4M21A 1P2SA 3VR1A 1XU4A 2RGAA 3K70C 2CK3A 4OQNA 4XWOA 5HZKA 1MABB 4DEXA 3C8UA 1SVSA 3ECCA 1F6BA 4E09A 4AD8A 4IXMA 4OK6A 2AFHE 1OIXA 4TL8A 2XZLA 2G1KA 2E9SA 3CPJB 1VCIA 2BBTA 4P31A 4TYPA 1NL3A 1UEJA 4NCIA 2OAP1 4ZCIA 1DARA 2RHDA 4FMDF 4B3CA 4WVFA 2I3BA 4LC0A 4TSFD 5H8WA 2OG2A 4QFMA 1J2JA 3WYAA 4CEIB 4PAQA 3CWQA 3KJHA 1US8A 1DAIA 4JVMA 2V54A 3V9PA 3K70B 1HYQA 3CNNA 1CLUA 1RRFA 4MGKR 2YOGA 4HB4A 3NC1C 4UXHA 3GLIE 1OXXK 3FMPB 3ZZUA 5B2ZA 4FWIB 3B82A 4XOIA 3EPKA 4XD7A 4BRUA 3BJIC 5B57C 1EFCA 4JYBA 3A1UA 3KKOA 1N6LA 4JT4A 3DDCA 2VTKA 4TLDA 3UMSA 2C98A 3KJIA 3CLVA 4P33A 2ZAOA 3AVUA 2WKQA 1ZCAA 4HZUB 1QHSA 1OXTA 3AP2A 4HUQB 2J7KA 2ZYVX 3S1AA 4DZZA 1Q1QA 1KAOA 2ORVA 3IGFA 5FPYA 3QKRA 3VKGA 3O8BA 5DE3A 3RS0A 1CTQA 4MRRA 2ZE5A 4PPQA 2GVDC 4RZXA 2BJVA 3LH5A 3BS4A 4LHWA 2PEYA 4KI0A 5GJCA 4OQXA 3H4MA 1NNEA 2AXPA 4PR0A 4LSGA 3MSXA 2BBOA 1OIWA 2XXAB 1ZC3A 4RY2A 1NBME 2WVJA 4H1VA 1EX7A 2W6IA 1E98A 1QRAA 4OKSA 1KK1A 3PEUA 4YC7A 1IXRC 2GXAA 2OE2A 2CNWD 3RS2A 1FNNA 1KKLA 2F1HA 3ZZTA 2VH5R 3HJNA 3JVUA 3TLXA 4TL6A 3AKDA 4CW7A 2FPLA 4XIGS 2OCPA 2OSBA 5DIFA 3U3RA 2HV8A 2VL7A 1IXSB 5DH9A 1J8YF 1EX6A 1RYHA 3L2OB 1KSGA 3PEYA 1UAAA 1G9XA 2JLUA 1E9EA 1U9IA 4NDZA 3VR5A 2WJGA 3GJ3A 4K46A 4HEJA 1PLLA 4B74A 1CS4C 2PX0A 3K9HA 1KDOA 3LLUA 3VR2A 4A1FA 4OI2A 4QGHA 3AVXA 2O8FA 4PSKA 1O3YA 2H17A 3IUYA 3V4FA 2GK7A 1SHZA 2FDCA 1HV8A 4JL6A 4U7DA 4FWTA 4G5GA 3SBEA 1U8YA 3WXMA 4DUGD 1FFHA 2WKPA 2ONJA 3UK6A 5TXGA 4M1KA 4PQFA 5K8UA 2J0VA 1G4AE 4C0SA 4WZAE 1K8RA 3U4QA 4D26A 1XRJA 3HU1A 3KQKA 1P9NA 3K0FA 4R98A 5CIQA 2C04A 1E9FA 1ZNYA 2QTVB 2ZREA 3GCGA 4M9XA 3EC2A 2QSZA 1Z0IA 3SYNA 3ZLJA 1KNQA 1NVXQ 2V6JA 1NBMD 4KFSA 4HAYA 4B3GA 1ZVQA 4V0OA 1KAGA 4Q9IA 1EFHA 2QEQA 1QHGA 4GDFA 1MOZA 1SVLA 3VX3A 2VP4A 4IDOA 4M9ZA 1WF3A 4M1TA 5JCPA 3U3OA 3PV0A 4TMWA 1WE2A 2FPKA 4FD2A 4MYTA 2V4ZA 3WRXC 2JDIA 2FWRA 1E6CA 2IXFA 4PSAA 2OT3B 2ANBA 3LV8A 1ETUA 3DM5A 2Z0MA 4JLBA 5GVRA 5EP3A 1G291 1F60A 5AK0A 1E2QA 1Z6TA 1A82A 2OFWA 4DB4A 4LPSA 1BH2A 2IL1A 2VIIA 4QBFA 4N0DA 3DM9B 1WBDA 4TQUS 2FZ4A 1H8HA 3X1DA 2X2FA 4Q47A 2GESA 3LQRA 3OZXA 3O47A 2F1RA 2NO7A 1GILA 2XB4A 4JIMA 2BKEA 5CK5A 1DELA 3RAPR 3KZ1E 2D62A 4FINA 3KX2A 4NZYA 1Z6YA 2JIZD 3LAWA 4KODA 2X77A 3TMKA 2WWGA 3WMEA 4I81A 4ZV4A 1IY2A 3CX7A 1BIFA 3A8TA 3B60A 3CRVA 4LYFA 2YWGA 2VF7A 4G01B 4LJ4A 1PV4A 3FWYA 2QZ4A 4OQLA 3HYRA 2IC5A 2ZJBA 1OIVA 1X3SA 4AKEA 1GRRA 1ZUIA 3C16C 1UBGA 3OF5A 4NYJQ 2BEJA 1FW6A 1NN1A 4P4UA 1E9AA 4TLEA 1GNPA 3ND9A 3QKTA 2OFOA 4QBHA 2GA8A 4LPKA 1MO6A 2FU5C 2YYZA 3K1JA 1XP8A 2RGGA 3QI2A 4JYCA 4BFWA 1NJGA 2O0HA 2X2EA 4I1VA 2V55B 2ONKA 1GG2A 1YZQA 121PA 1W48A 5EQTA 2IYRA 2GJ8A 3LLMA 4DCSA 1KDRA 1XEWX 2FEMA 3D7MA 2GEDA 4M9SA 2F1IA 4OI1A 4BLPA 1I2DA 3T5GA 1ZU5A 4HB2A 3PCRB 1YR7A 4L9SA 3K0CC 5DNYB 2BBWA 4YXWD 4Q4LA 2G1JA 4Q66C 2XJ9A 1MABA 2QORA 2D2EA 2IEZA 1SQ5A 4M1SA 4E07A 1WBBA 4Q7MB 4Y0AA 3AF2A 3FKSD 5G40A 3ZQ6A 1S2MA 1W36C 4Z8YA 3ZIAA 4RD3A 1L8QA 3FPAA 1E2GA 3TAUA 3LA6A 2JLSA 4NHOA 3OEHA 2WPDD 2QE7D 3H86A 1G4UR 4CEIA 1DTSA 1F2UB 3VHLB 2IWHA 1XPOA 1W2GA 5E7IA 5KYKA 3MGCA 3OFND 1KGDA 1G7SA 2BVNA 4YDHB 1FX0B 1ESNA 1R0YA 2IYZA 3BFVA 4IVRA 3QF4A 3KUCA 1DS6A 3SOPA 3ZJYA 4PFSA 1M7GA 4RKFA 4A8JA 3X1ZA 1XXHA 1E94E 1KSFX 4M1OA 3LW8A 1Z6GA 3N70A 1W36B 2AKYA 2IF2A 5CM8B 5DO9A 3RNLA 1MH1A 4HLUC 4RVCA 1M8PA 5JEDA 3AF1A 2GJ9A 5L3QB 1ZYUA 5KPDA 2CLCX 3EW9A 4Z1MA 1G8PA 3LWNA 3B1YA 4GOJA 2L0XA 4O25A 4GNKA 1KHTA 3AF4A 1W46A 4KHZA 2IHYA 2P0EA 5GADl 4EPWA 3AEZA 5J4VA 1PLJA 1OW3B 1VHLA 5CJ2A 3I3SR 2O5VA 2HT6A 1DPFA 2HJVA 1XDBA 4MKIA 4OL0A 3I92A 2AN9A 4MRNA 4OBEA 4Q7JB 2WWYA 3PJRA 1KMQA 5ANRB 4HLCA 5FBWB 3KDSE 4LY6A 2OEPA 2G6BA 3L0PA 2QI9C 4DCNA 4E03A 2ZJYA 3PENA 5FOUA 4XWKA 3TNFA 1NSFA 1KO7A 3QY0A 1NP6A 2GEUA 2MMCA 3W5JA 4MUAA 3RVBA 4FCTA 1VG8A 1JPNA 1ZRHA 4C9BA 4JL8A 2XEXA 4L8GA 2Z4RA 3SYKA 2XGJA 2ZROA 1TUEA 1J8MF 1UBCA 3QVVA 5KO2A 1TUIA 3K0SA 4Q18A 4ZCMA 2QA5A 2KI5A 2Q21A 1F2TB 4MGZR 3R9IA 5FUVA 3TKLA 1ZNWA 5BWMA 1YKSA 1E1RA 1Z0AA 2GCOB 1SXJD 4NYMQ 1CEEA 2B7BA 1G20E 3AVYA 4IOKA 2GXSA 1P2TA 1XX6A 3B85A 2CCGA 4EPYA 1XJQA 3L0SA 3EARA 4CEJA 2NMVA 4QG7A 4QNRA 2ZRDA 1DG3A 4IJMA 3UMRA 2GCPA 4Q9HA 4EFMA 2NPFA 3TVTA 1IN8A 3HP1A 4LJ8A 3AVOA 1YJ5A 2VHCA 3C14C 2OCAA 4OQMA 4PHTA 1GM5A 1OF1A 2QPTA 1S3GA 1VKJA 2A5GA 4DBLC 1E0KA 2IUUA 3U61B 1OHHA 3BIFA 2ANCA 2ORIA 3RSLA 2O8BB 5AR1A 1KI8A 3SFZA 621PA 1AKEA 2NZJA 3F8TA 4LJ5A 2IXGA 4CZ2A 221PA 4IDNA 1FPMA 3AB3A 3PUWA 4KXFB 3TR0A 2BMJA 1DADA 4V0KA 5A5GA 1ONBA 4MYUA 2ZSDA 2ZS7A 4US1R 4C0KA 2IEYA 4MA4A 5B58C 1NLZA 3B5JA 3FHCB 4UXJA 5DGXA 4HSEA 3U44A 3NH9A 3FFBA 2WSSA 1G3QA 4K8OA 1VYTA 2V7QD 3F5FA 2BMDA 1FQJA 1TEVA 3OAAD 5KHOC 5KDDA 1E99A 4RD1A 3W34A 2V3CC 1U0JA 2P65A 3ADBA 4MKFA 2OCBA 1Q22A 1S1CA 1UEIA 1N5LA 2W6JD 1OH5A 1NVWQ 1TX4B 1KJWA 1ZIOA 3NKVA 1ZNZA 5C1BA 4MH0R 1N6HA 1NMXA 1FP7A 4B73A 2F7SA 1Q20A 3IHWA 4TTPA 2YZ2A 5TARA 1JR3A 1KOFA 3ONWA 3PUYA 1AZSC 1N25A 2KE5A 1XPRA 1CR4A 2IYUA 3IIJA 5JWHA 1U90A 2Z5FA 1UKVY 2DBYA 4GOKA 5TB5A 4C0QC 5FBQB 2Z43A 5CITA 2RGNC 2OBMA 4D25A 5JCZA 4Z8XA 3DMNA 4XTRA 5F98A 2F55A 2QPOA 4OQFA 4BGDA 1UFQA 3CZPA 3ZDQA 2F6RA 3LVRE 4KFUA 3LQQA 1MO5A 1E2DA 2RMKA 2XAUA 5EP2A 2RGCA 3QPWA 4KLZA 4RFSB 5BW8A 1N5IA 4ZDJA 4JBXA 4LJ6A 1CKEA 1HT2E 1S1MA 2CVFA 3BGWA 5LB4A 3RC3A 4C4PA 1OT3A 4ZDIA 1I2MA 1TADA 1C4OA 3NIBA 4EJSC 4IEIA 4D4LA 3WP0A 2PX3A 4RD6A 2QY9A 1JQLB 4LBZA 4W5HA 4BFTA 3AKEA 2ORWA 5F2EA 2ZRGA 2ZVPX 2ZANA 2DFNA 1E2FA 2R9VA 3GJ5A 2DWPA 5AUPB 1XZQA 4GZMA 2FFHA 1Z08A 1G7RA 1NVUQ 1OV4A 4EJSB 1N6NA 6Q21A 3GQBA 4DCVA 4OK5A 4F93B 2FSFA 1SHKA 3AGQA 3FFAA 3O8DA 3TAHA 1G16A 1H8EA 2VSFA 4NMMA 3CF2A 4ASUD 4TLBA 1E2LA 2AKAB 3I73A 4URUR 5FUYA 1KDPA 1F2UA 3A1TA 4C2UA 3GPLA 4BQSA 3KB1A 1RRGA 5JS8A 1Z0FA 2O52A 2W58A 1HA3A 1OKKD 3T61A 2A78A 4AY2A 1WCV1 1XZPA 3QNUA 4AYTA 2OCYC 2CK3D 1ZM7A 1M74A 1Y3AA 2FPMA 2J5XA 4BLQA 4M8NE 4AIIA 1MO3A 1W4RA 3AUYA 1KK0A 2HLDD 1X1RA 3NG1A 1M2OB 3QXSA 1BYUA 4Q1DA 2H8KA 1EWRA 5L3QA 4M4SA 2P3SA 4B76A 3SBDA 3ZD6A 4JLPA 2AX4A 1N6PA 4PQRA 1EWQA 5DI3B 3TQCA 1Z8FA 3TSWA 4C0AC 3CH4B 2UVQA 4RFVA 1H65A 1KYIA 1VYUA 2XNDA 4KYIB 1AS3A 3CIOA 3UKDA 1KK3A 2QM7A 1MV5A 3GP8A 2A3RA 3VMFA 1MR3F 4NP6A 1KI9A 4GP7A 1R5BA 1T91A 1V43A 1OB5A 5EJEA 3W6OA 1N6OA 4FCVA 4AYXA 2OM2A 4JT2A 5JI2E 3UG6A 4A4DA 1UPTA 2QL6A 3LBHA 4PC2A 4LZZA 1CXZA 1OLOA 4IVQA 1NY6A 5CDFA 4DLVA 1JEEA 1WXQA 3P1JA 3R9XA 4MQBA 1W2HA 2ZYTX 2ODEA 3HDTA 3VU9A 1KI6B 3O8RA 1T6NA 1F2TA 2GJSA 1T3LA 3L0OA 3MRSA 4QL3A 1I4LD 3NC0C 3BB3A 4YMSA 3K0EA 3VR3A 4N1AA 1EK0A 1AKYA 1P5ZB 4YMTA 2FG5A 5DI9A 4E22A 4TTQA 3MUFA 1RPZA 4K81B 4F4IA 4LYHA 2GETA 2F3TA 1XTIA 2J46A 2AWOA 2IYXA 1GKUB 1G8FA 1XFAA 5LD2B 1G5PA 1M6NA 2G0NA 4L15A 2CL6X 2KBFA 1LY1A 1N0VC 2YWHA 3PR1A 4WXRA 1NIJA 4ZIRB 4B2IA 1S3SA 3IIMA 4JLDA 4QBGB 3OIUA 3LBIA 2W6ID 2MSCB 3DZ8A 3SHFA 5GJWC 5BYKA 1D2MA 4PPGA 3VKWA 1R5NA 2VP0A 4HB0A 1NY5A 5JFGA 1AZTA 1I4DD 1XF9A 1YZTA 4OYHA 3EAQA 5JI3E 2F3RA 4URZR 2ZJZA 4Q01A 1E9BA 1MRSA 2JLVA 1GVNB 1G7CA 3LX8A 1OB2A 4W7SA 5CM9C 1B23P 3PUVA 3KFVA 2ZI9A 4V0MA 5K8TA 2RKOA 2ZAMA 2HF8A 4DT1B 3KJEA 4LJYA 4P3YA 2FJUA 1CF4A 2ZRLA 2B8TA 4AWXA 3U2QA 2WKRA 3CONA 4GMDA 1Z2AA 4WZBE 1XJCA 3NBFA 4ON9A 3RWOA 2VHUA 3NBXX 1LF0A 2CVHA 1G41A 2QMEA 5EE9A 4BUJA 2X8AA 2PMKA 5HE9A 3EZFA 3C15C 1E9CA 4Q4AA 1ZP6A 3TSZA 4BFSA 3AVTA 1Q21A 3NTUA 1Z0DA 4PX9A 2BHRA 1GRQA 4JL5A 2WWFA 3SJCA 4JJKA 4EDHA 2DPXA 2BOVA 4PQYA 3AF0A 4XWAA 5E95A 1D5CA 1K6MA 4TYYA 2NO1A 1CJUC 1D2NA 3BXZA 4D0LB 1W5TA 1Q0UA 1T0JB 2BKUA 4FI3C 3NXSA 1Q44A 2QPAA 2A5FA 4UNPA 1R8QA 1Z0JA 2QAJA 1E79D 1YZUA 1P73A 2WMNB 3ZYCA 3TK1A 1KI3A 4M9QA 4M53A 4B3DA 4C7OA 2J7PA 3UWKA 4DCUA 2VHJA 4IOJA 5TDHA 4V03A 2CEAA 2QAGC 3E2IA 3REFA 3AKYA 5KNDA 2OESA 2XOKA 4KLNA 2ZVQX 4DDWA 2RCNA 1X8LA 1IJFA 5IRCD 2JDID 3KFXA 3QG1A 2REOA 4MRSA 4P4SA 1ZINA 5EZ5A 1W49A 4CT5A 4D0GA 2IYSA 3WMFA 2O8CB 1Z5ZA 3GLGE 1CBUA 2ECKA 5BQ5A 3GFOA 2W83A 2ZE6A 3TE6A 3THWB 3EPJA 2WJYA 3HU2A 4PANA 1TQ4A 4IDQA 3SHWA 3HPRA 2J0QA 1VMAA 3NVAA 2SHKA 4HAXA 1L4UA 2QAGB 1KO4A 2FNAA 5DN6D 2IF0A 2YV5A 1G5TA 3GLIB 2BDTA 3CF6R 4JVNA 3HU3A 2OLJA 2ZRCA 3A1SA 4AK9A 1CR1A 1K5GA 2ZRPA 3RRZA 2C77A 4XSHA 1DO0A 2KBEA 4G5OA 5E7JA 2CE2X 5AJVB 4DWJA 5KTYA 1LW7A 1CJVC 2XX3A 4EJSA 3BH7A 4FN5A 3MWLA 4OI4A 1G7TA 2OLKA 4RZUA 4DDUA 4UXIA 1KNXA 2C78A 3DKVA 2IUSA 4BASA 5EE0A 5L3SB 1OFHA 4M22A 5AJWA 5ELXA 1IONA 3RRMA 1P7CA 4WIAA 4PO8A 1JJ7A 1N0UA 3GJ7A 4G5QA 2B7CA 4XH9B 1D8TA 1ZM4A 2OO7A 4TL9A 3UATA 3VX4A 1YQTA 3A1VA 3M4YA 3TSOA 3E1SA 3MWKA 2EW1A 5BN5A 3GD7A 1GL6A 3MAAC 5LDDC 1Q3TA 1XD2B 1JJVA 1U0HC 1G3IA 2D2FA 5JWOA 4C2TA 2WHXA 1X6VA 3WNDA 1IN5A 3KQLA 3I8SA 5FBRB 4B33A 1AGRA 4D80A 1CRPA 5JJLA 1HQCA 2FGJA 2ZI5A 3CF0A 1EESA 4D4MA 1AJEA 3AUXA 2XB2A 5H70A 2WWIA 3ZIAD 5BN3A 4Q4HA 2C9YA 3F0TA 2PJZA 2QN6A 1LTQA 3BB4A 3VKHA 1TU4A 3OEHD 4OHVA 1KO8A 1Q57A 4Q1BA 3K70D 2CHVA 4DLSA 3GJ0A 2CJWA 2R65A 4C0LA 4DDVA 3ZVRA 4DSOA 3R20A 3G5UA 1T5IA 5JJKA 3KXIA 5JSZB 1GNQA 1ZM3A 2NZ8A 2R44A 4D0NA 4DIDA 1X8KA 4FMBB 3CO5A 3SJAA 3UPUA 4B32A 4QHSA 2ZTSA 2ZRFA 2CCJA 1CJKC 4OHZA 2G3YA 2WOOA 2REBA 3TRFA 3U3JA 1P72A 4OK3A 4TWZA 4JBWA 4U5XA 4EFLA 3NH6A 4Z1MD 3D3QA 3VQTA 2O8DB 2A5YB 2F1JA 1G8GA 3BERA 4A0FA 3TH5A 4AKGA 3H0KA 2XZOA 1TF2A 4QGFA 4DEYA 1JPJA 3SEAA 2NO9A 2E1RA 4A0HA 5EXPA 3EZ7A 1G6OA 1NSTA 5EE3A 2UKDA 3RS3A 1R6BX 3X2SA 2QG6A 4RD4A 4LHZA 3RLFA 3DOFA 4DJTA 4B48A 1YE8A 3T1OA 4U02A 5C46F 1YU9A 2GTPA 5FPKA 4IVPA 3QOFA 3UIEA 2R6FA 4ERNA 4GI7A 3EX7C 3ND8A 5HE8A 4LHXA 4QRHA 3LO5A 4O2LA 4NCJA 4LWZA 4C0JA 2J0UA 3GLFE 2Q3MA 4PXAA 1MRNA 5FI1B 1G1MA 5IDVA 4HAVA 5KPJA 4S35A 1KTVA 2IT1A 4ZIRA 2ZJ2A 4NYIQ 1E2MA 2DWOA 1GP2A 4TL7A 3IHLA 3SN6A 5JECA 2A2ZA 3WBKA 4OI0A 4HI0E 2XZPA 4XJXA 1NMZA 3TR5A 4ARZB 4GP6A 4HLQB 1BS1A 3QJYA 4KITB 1E1RD 1CU1A 1II9A 3X1YA 4MKHA 3KJGA 5CIWA 3R7WB 2G77B 4IW3B 3EPLA 2RGEA 1OSNA 4JVLA 3RANA 2G0TA 1YR8A 2WJJA 3C4JA 4QOSA 4DT1A 3RHFA 3FE2A 5FBVB 4URWR 2J41A 1VCMA 5EZ6B 1QBKC 4ZO4A 5KSZA 3Q72A 1M7HA 4P0TA 3CZQA 5FR2A 2VLIA 3QEJA 1XMVA 1DAMA 3C41J 1L7VC 2GEVA 2V1UA 5G41A 3CW2A 1NRJB 5JZVA 5FOTA 3EZ6A 4L4UA 4KSBA 5HCNA 4ZI2A 2R6CA 1OHHD 1UM8A 4MRVA 1NKSA 5HZHA 1GNRA 5SZIA 1QHHB 1JR6A 3K53A 3I32A 2GKSA 3Q8XB 2R62A 3EWSA 4PC7A 5EXSA 2R2AA 1SULA 4IDPA 4HAZA 3W6NA 2IYTA 3VFDA 3CH5A 3MWYW 4A6PA 1IN6A 2FFAA 2QUZA 1Z63A 2QSYA 2D7DA 3MJRA 1RRPA 5FPHA 5TV2A 1XTSA 2VO1A 5FL7A 2H92A 2B8WA 3AP3A 2NO0A 1ZBDA 1UKZA 1X8JA 3TUIC 2B6HA 2V8OA 4OHXA 1GKYA 2VP6A 2C95A 2DCUA 3A4MA 3BE4A 2MSDB 1EFTA 2VP2A 1GSIA 5EXXA 4IOMA 2WSSD 4PHGA 2ZJAA 1OPXA 2ODBA 4IEEA 1SXJC 1Z6XA 1P3JA 4PPNA 1XTQA 1IQPA 4CEHB 2ZI3A 1T5LA 2F9MA 4JKIA 4B3FX 5CB8A 3IEVA 3QSYA 2PL3A 3C7KA 3AKCA 5CJPA 2O8CA 2VEDA 1I4TD 2NO6A 4PC1A 4RD0A 1JAHA 4ITRC 4Z51A 1DO2A 4POAA 1JR3D 4LJ9A 3CNLA 3K09C 1SXJE 3BD9A 2DFKB 1D9ZA 4HLDA 3KQHA 1WRBA 1IHUA 1SXJB 2QAGA 2O0KA 3MCAA 3GLIA 3PFIA 1R4AA 4DC9A 4IOLA 2GXUA 3ZS8A 2ZI6A 1NLYA 4D81A 2VYFA 1IM2A 3IO5A 4G1UC 1JNYA 1S9DA 1RW4A 2I4IA 2TMKA 3EIEA 3FVQA 1WDTA 3OESA 4L9WA 4M1WA 4XSGA 5L8VA 3LDAA 1GTVA 2W0MA 1SGWA 3A36A 4M0LA 1Z0KA 4AURA 4R71A 5SZHB 4LDJA 3QIAA 4X8MA 4G5RA 4HDCA 2QROA 4HZUA 4HUQA 4V0LA 2KSQA 3QEOA 1F3OA 5J40A 1AK2A 3SQWA 3FMOB 1XTJA 5SZKB 1TQ2A 1T8UA 4B43A 3QUSA 2FE4A 4PAOA 1YZLA 4Q1EA 2AL7A 4A0GA 5L3SA 2ZXUA 3KXLA 3IEUA 1E2HA 2IYQA 3K9LA 2GF0A 2K5UA 1R5OA 3TUZC 1G5RA 1D6JA 1JQJC 3TUJC 4TLAA 2LCFA 4EPVA 2BWJA 4PZLA 3SS8A 4LV6A 5AUNB 4J0QA 1OH6A 2IA5A 2C5LA 4MDEA 4MRPA 4LBVA 2XXAA 3FDIA 1XEFA 4LV5B 1XD2A 4GMXA 2EFGA 3MD0A 1NBMA 2QT1A 3TBKA 4EQ6B 1KO5A 2YHSA 3ZVLA 2Q9CA 2EWVA 1N0WA 1QZXA 2F43B 1Y63A 2Q0HA 4YMWA 1MT0A 2AFIE 1R7RA 1RYFA 1DOAA 1TNDA 4I1OA 4L5BA 3ADKA 2VBCA 3EC1A 1Z29A 2Z6VA 1ZC4A 4EKDA 3U5ZB 4NCHA 4RD2A 3J81k 2JJ8A 1E69A 2ZRAA 2HXSA 4B44A 1NJFA 2D06A 1XTRA 2GZHA 2ZUDA 3N2IA 4CIDA 3AH8A 4UNNA 4MUBA 5DISB 2FX3A 3TW8B 2GZAA 3PITA 2CBZA 2OAQ1 3PUXA 5HPYB 3WHKA 1KMHB 4FIDA 1IBRA 2H5EA 1TQDA 2GWHA 2NIPA 4QJ3A 5H1YA 2ZJ8A 2AXNA 3A1WA 4DSNA 3VAAA 1E9SA 4OJKA 3W9YA 5E3HA 3CX6A 1UKEA 4NL4H 1NF3A 2WSMA 2DHRA 4YMUA 4LRWA 2RH5A 3VTKA 2F9LA 3KUDA 1AIPA 2RGXA 1RC8A 1PLKA 2H1LA 4NYJR 2R6AA 3ZZ0A 5HCIA 1KDTA 3BH6A 1WP9A 2GXQA 2YKGA 3ZH9B 1XCMA 2ZRIA 3IILA 1RVDA 1RIFA 2VPPA 5J4KA 1PJRA 1ZNXA 5FOVA 2GBLC 4GFDA 4R2HA 2Q6TA 5JHHB 3CX8A 4B35A 1DAKA 1II0A 2VA8A 5E4FA 3OEEA 4BPBA 4ILEA 3B8HA 3GEEA 2C96A 1UKYA 2DFTA 1ZCBA 3CB4A 1FTSA 2BIFA 2CHGA 1XCGB 3MLEA 1QHXA 1W0JA 2PLRA 4XVUA 2AK3A 4YXWA 1YRBA 5DYIA 1AA9A 4JLVA 1QHIA 1RE0A 1W4AA 2YNMA 5TVKA 4ZKDA 2WV9A 5EE5B 4TT3D 1OE0A 3GLHE 4P4TA 1X1SA 2Q3FA 3FKSA 1HY3A 4Q9JA 4ARZA 4KO8A 1JEDA 1ODFA 1SVKA 2J59A 4D6PA 3B9QA 3A58B 2ZEJA 2ZRJA 1GDDA 5HKKA 4CYMA 4Q1AA 2HYIC 2HT1A 3I1FA 2V6IA 5DHFA 4C30A 4HDQB 3OFNA 1HH4A 1CP2A 3SYLA 5DYGA 1N6IA 2XSZA 5FTNA 2VSXA 1E9DA 3EA0A 1Z3IX 1OJLA 1KI2A 1IOZA 3P27A 2HUPA 4GPTA 3ZQJA 1WMSA 2BCGY 5KSOA 1YZNA 3X1XA 1FUUA 2N42A 3C5HA 3TJZA 1Z22A 1WQ1R 3AF3A 4OHYA 1CR0A 3Q85A 4C3ZA 2W2XA 3NHBA 4PC6A 2FOLA 2JA1A 2YC4C 1QG2A 5JHGB 2ERXA 2ZU6A 1E32A 1DBSA 1P9RA 1CR2A 1QHHA 1U94A 1JXMA 3IIKA 3W8RA 3BFKA 1U0LA 1DEKA 4M2LA 5FPSA 3UWOA 2PCLA 2NOAA 1G3MA 4CGZA 1J7KA 1US8B 1E1QD 1Q1EA 5K8LA 2C03A 3BC1A 4Q21A 1PZNA 3RC8A 1YR9A 1DVRA 3CRMA 1T3HA 3QPUA 4URVR 4TTRA 5JRZA 2GVZC 5KU1A 5JJIA 5FH9A 3Q5EA 3B2EA 3CWZA 3THYB 1MO4A 2BJWA 1KY3A 4AKHA 4HYYA 4TYQA 2AD5A 1BMFD 1D2EA 3OIWA 3CPEA 1XEXB 2QP3A 1GITA 3AGPA 3RDPA 3ETLA 4JMPA 4I1SA 1HEIA 2EU8A 2QTHA 4JLAA 4QXAA 3VHXA 2JATA 1NG9A 1HT1E 3D6TB 5F9HA 4B2LA 1JECA 3T35A 3VR6A 4FMCF 4NKRA 4B71A 4KFTA 3JZAA 3K0CA 4MYHA 2ZRMA 1R0WA 3LFUA 3U6KA 4KYUA 3SE0A 1FX0A 2REXB 3S1AB 4DSTA 3QPVA 2PZGA 2AHOA 4EAQA 2IXEA 3BRWD 3WY9A 3EPHA 4O3MA 1VHTA 4NYMR 4QHYA 3HYTA 4NBSA 2N1BA 4A2PA 1U99A 4FCWA 3PG5A 4KVAA 3T34A 3NHAA 1FMLA 1TF5A 3LRPA 5KNCA 2IW3A 3DHWC 4A2QA 1CIPA 4NU0A 2D3WA 2WWXA 2Y8EA 1O87A 2Z4SA 3GJ8A 2XOKD 3LXRA 1BYIA 2EFHB 4TLCA 2EYQA 3A4LA 3RRYA 3EIQA 4LUCA 4URYR 2NGRA 2P6RA 2EFCB 4YQFA 3FTQA 4DHEA 2OFXA 3ICEA 3B7GA 3GEHA 3PVSA 3U3MA 4GBMA 4HLUA 2VHQA 2NQ2C 4I99A 3ADDA 3TW4A 3G0HA 3WMGA 1BOFA 1KIMA 3GFPA 2AWNA 2WBLC 4B2PA 4XD7D 4B3BA 4BLRA 2P6UA 3VR4A 1G64A 4QGAA 5KSYA 5G3YA 2A9KA 2LWIA 4D4KA 1IN4A 2RGBA 4W5WA 1OXUA 4KFRA 2QP4A 3M1IA 4JZKA 1Z06A 5IHPA 4ZCLA 3CUEF 4F4JA 3KL4A 4EQ6A 2CHQA 2D7CA 3CR7A 1KI4A 2BEKA 4RCYA 4ACBA 2JLXA 1XBTA 3KTAB 1AM4D 5FTLA 2QBYB 2IS6A 4Q7KA 1D9XA 2WJHA 3K0AB 3NWJA 1GL9B 2GCOA 1VG1A 3LVQE 1GIAA 4BFVA 3OHMA 4LI0A 3BOSA 4I1UA 4OHWA 4QGGA 4AG5A 5FTJA 2MMGA 2QQ0A 3B1XA 1W0KA 3GJXC 4B34A 5KUTA 1QHNA 2PEZA 4TN1A 1W4BA 3QE0A 3P4XA 4TZ6A 1LS1A 1KJZA 3IPYA 2C2HA 1IN7A 4LYAA 3BB1A 3W90A 2FSGA 2RAPA 1JBKA 2IBMA 3K8YA 2OBNA 2E87A 3SDZA 2P6NA 2CLDX 3A4NA 3Q3JB 1NG1A 4X8LA 2W00A 2O8BA 2WTUA 3LW7A 4L16A 3T5DA 5BYJA 2NTYC 2YWFA 3QKSB 5KDOA 1U8ZA 5JS7A 2IWRA 5D3MB 5TMPA 3CKLA 1TPZA 1VPLA 3SJZA 1T8TA 521PA 2CMKA 2OXRA 4RZ2A 5KOYA 3Q7PA 1N6KA 1N2CE 4GT1A 2D4HA 2C9OA 3I5XA 2B92A 4FXPA 1G17A 3GFTA 4N3NA 1SKQA 1HTWA 4BECA 1Z47A 1LFDB 1CJTC 1XEWY 3KKQA 4PO9A 2DFLA 4LCBA 5AJYA 1UF9A 4KSCA 3VNVA 2O8EB 2CDNA 2UZIR 1RZ3A 3W5IA 4F92B 3A37A 2YVUA 1JI0A 1S9HA 3PEWA 2EVWX 5SZJA 3R8CA 4BWYA 4RCZA 1A1VA 3JZMA 4FMCB 5GJVC 2ZYUX 4I4LA 2VP9A 4W5JA 1XMSA 5K8IA 5FOWA 1TMKA 1OFIA 3NEJA 3RS4A 2IS2A 1HE1C 2J87A 1HUQA 2UZ3A 2VSOA 3L8YA 5JRJA 1GZSA 4ESVA 2CCKA 3PEVA 4US0R 1WA5A 5UKDA 2LKDA 5KNBA 1UDWA 4RFSA 1OXSC 1P4SA 1QF9A 2JJ2A 3FB4A 1DE0A 1EFRA 1NI3A 2HLDA 1OXVA 2IYWA 3AVQA 3AVPA 4JLNA 3WHLA 2RGNA 1UADA 3GLGB 2IS4A 2IK8A 2ATVA 1ZAKA 3CRW1 4A8JC 3UG7A 1H8HD 1KSHA 2BCJQ 4NONA 1AS0A 2QENA 1FOEB 2QT0A 1P75A 2XTMA 4A92A 3FOZA 1P62B 4TYWA 1XJ0A 3AQ4A 3MJHA 3KQUA 5KSPA 4DXAA 4GOXA 4TQAA 5LB2A 3P26A 3UXMA 2HEIA 4HUTA 3OE7A 4DLTA 3DPUA 2XNSA 2DYKA 2QNRA 3SI7A 3FHOA 3QF4B 2Q3HA 4UJ3A 1U81A 1XXHE 4H1UA 5JEEA 4A8JB 3N2EA 4B47A 1XXHB 3THYA 3IO3A 1LB1B 4M1YA 4Q1FA 3PXGA 3U6BA 2PMDA 4Q1CA 3SU8A 4TYNA 1QG4A 4W9MC 4CF7A 2XTNA 3TQFA 4DLUA 2WICA 2P67A 3W6PA 1XEXA 3UANA 1ZIPA 1UBEA 5DHAA 1RJ9B 1W1WA 1WB9A 2GILA 1G3RA 2HCJB 2BV3A 3EIHA 3QXJA 4EFNA 3WP1B 5TY0A 1SKYE 4V0NA 3RRNA 3R9WA 3DL0A 5AJXA 5D3QA 1FZQA 1SKYB 1YHNA 3SC3A 4DLYA 1QDEA 3UMFA 3HPQA 3JVVA 1OH7A 2XTZA 5FL7D 3M6AA 3T15A 2J3EA 4D82A 4A15A 1COWA 4B75A 4HATA 2H7VA 4KJZA 3LBNA 4PHHA 4Q7LA 4UQOA 5FOXA 3BAFA 4ZDWA 3NDBB 1N3BA 3HWSA 2QGNA 4X8OA 3SZRA 4CVNA 1XPUA 4YONB 2WMOB 5DI3A 2ZRHA 5IK2A 1ZM9A 4QNMA 4DCTA 3EWAA 2Q9BA 4BFYA 2VP5A 4C0BA 1NVVQ 1S8FA 1X86B 4YLGA 2NG1A 2N46A 4KBFA 4IFBA 4A6XA 4EIWA 1OYWA 5AWFC 2ZE8A 1M1YE 4NCKA 1C1YA 1EXMA 4JJZA 1YR6A 3L8ZA 4QC2A 3EXAA 1MKYA 4DSUA 4BLTA 3PQCA 1G6HA 3RABA 4MGIR 4Q03A 2FV8A 4LJ7A 5C4GB 4NPHA 4QKQA 2JJ1A 2PZFA 2Q9AA 1VCNA 4YMVA 2CL7X 2WIBA 1M7BA 1SVWA 4QM6A 4LK2A 4DLXA 1P6XA 4Q4JB 4R9UC 3I8XA 4DIEA 4CEJB 3EZ9A 3DOEA 3Q7QA 4QBIA 5BN4A 3CRRA 3PUZA 1KI6A 1E4VA 2ZI4A 4LHVA 4DVGA 4UKDA 1HURA 3CBQA 3I4LA 3KTAA 1SZPA 2WAXA 4N0EA 2OBLA 2JAQA 2FGKA 2QBYA 4A36A 4URXR 3K0AA 2YC2C 1P2UA 2WIAA 5AJZA 2DR3A 5FR1A 1XD9A 3QENA 2G88A 3GJ6A 4PO1A 4KCGA 3U7HB 2P2LA 3GLFB 1AN0A 4D2IA 2ZU0C 3IBGA 1E79A 1K5DA 5G53C 2ZM5A 1TU3A 5JMTA 1S0UA 2AR7A 1FUKA 3HR8A 5FTKA 3U44B 1AQUA 2W2VA 1P60A 2GJKA 2OILA 1E2NA 2QU8A 4F91B 3SQXA 3LX5A 4TSFA 1E4YA 1JAIA 5FL3A 1GOTA 1KJYA 4JLJA 4S2EA 3U3KA 4RKEA 3QG5A 3KKMA 2DB3A 4EPXA 2OZEA 3QKSA 4FMDB 1UJ2A 2C8VA 4P32A 4MITA 2VF8A 4JLMA 5CYPA 4YDSA 5D3MA 3GEIA 1N5JA 1JR3E 2JLQA 2ZUBA 4GRAA 4LGMA 5FBLB 5FUXA 3U7FB 4G0NA 2FZLA 3QXXA 1R8SA 1IAQA 4PHFA 3TIFA 4PSVA 2VRWA 3BFXA 4R7ZA 1G8YA 4F38A 5FFMA 3IQXA 2A30A 5DN6A 4Q02A 1A4RA 2X1VA 1IXZA 4O0MA 2FSIA 3KKPA 4JSTA 421PA 4MGYR 1XWIA 2IYVA 3CNOA 5C4MA 5EP4A 1VECA 1OFUX 1G21E 2FA9A 2G83A 5DSZA 3B78A 3T12A 1VG0B 4DLZA 1IY0A 2IUTA 2V9PA 2O8EA 3I61A 3MWJA 3B1WA 2RB4A 3NEYA 4R2IA 1II8B 2FFBA 1LV7A 1ZUNB 2GNOA 1JXOA 1VG9B 5JLJA 1EG7A 1KK2A 1A7JA 1ZW6A 1W4CA 4Z54A 4XTCS 3T06B 3DMDA 3U7GA 4CT4B 2R8RA 4BFUA 1YVDA 2QP9X 3SFVA 4NTZA 2IYLD 2ZETA 1KI1A 3L43A 4Q00A 2LKCA 2WOJA 2C9CA 1ELOA 5P21A 4WAUA 4U00A 2PBRA 3M0EA 2PLFA 3OEED 1ZMXA 2ZI7A 3Q5DA 2PJRA 3X1WA 1T9HA 2JASA 4AKIA 3IKJA 1AQYA 1W0JD 3U7EB 4RZ3A 4G5SA 2PH1A 1T4GA 1TAGA 2CNWA 2QRZA 4HZIA 2GF9A 1CULC 2A5JA 3THWA 3GLGA 1J99A 1FP6A 1Z07A 1T3SA 1VDZA 1AS2A 4ESHA 1S4QA 4RSGA 5H68A 3EG5A 4HDOB 4UJ5A 4LOAA 1NVVR 4ZI3A 3DKPA 2XJ4A 1E2KA 5HKKD 2BMFA 4TMZA 5AUQA 3FKQA 2QGZA 3FYHA 2EWWA 4ABYA 2ZRNA 4Q9KA 3DVLA 3WNBA 3BORA 1LNZA 2ZYWX 3P32A 2XSZD 3IQWA 5J5CA 2DY1A 4TMKA 3GJ4A 1DAGA 1E9RA 2QQEA 2CL0X 1XD8A 3LXXA 2WWWA 2CLSA 2MSEB 4JLKA 821PA 2GAOA 2HYDA 2R6GA 3K9NA 4DUGA 4AI6A 1YRAA 2A5DA 3H1TA 1L4YA 2X19A 3KB2A 2FN4A 1QHYA 3OIVA 1RJ9A 2VHTA 2ERYA 4WXPA 4MYCA 2NPIA 2O0JA 4BE7B 1TEXA 2OXCA 1NN5A 1OH8A 3B1ZA 1SVMA 2J45A 4IHQA 3ZD7A 1TL7C 3IPXA 2CXXA 3T1TA 1YZGA 1E2PA 2PT5A 5HR5A 4LBYA 1E0AA 2QMOA 3QF7A 1JALA 1E0SA 1N6RA 2ZPTX 3FHTA 3CM0A 3WYGA 2H18A 2H16A 3FMIA 2ODNA 2W2TA 1H8ED 1AGPA 4JBYA 4BZXA 3WYFA 2CE7A 2WWHA 5CDFE 1HQYE 1UBFA 3NBZC 5C18A 3AVVA 4NYIR 4WBSA 4A0RA 1G8HA 2ZS8A 4RJLA 1NLFA 1DAHA 1RFLA 1LF5A 2ZS9A 5AUOB 3WRYC 5FTMA 1V5WA 3VU9B 1A2KC 4WOPA 5A4JA 3HR7A 2ZJOA 4JSYA 3R8FA 2ZSBA 3LNCA 4Q48A 5JSZA 2D74A 2BM0A 2FMXA 1M34E 1W36D 3Q9LA 3B1VA 2ZRBA 5EE1A 1PUIA 2ASEA 3MG9A 4KU4A 4G3XA 3BH0A 5CK4A 4IDHA 2JIZA 5A0FA 3ASZA 2ZJ5A 4Q4JA 4KAXA 1DAFA 1KZ7B 2O8DA 3SR0A 1NKTA 2ODWA 4FW9A 4LYJA 2KJQA 1ZM2A 2XNDD 5KDLA 4IXNA 1FTNA 2IYYA 3WNCA 2WAYA 2GHIA 2Z83A 3W8NA 2AD1A 4NCNA 5C2JB 3IDQA 3D8BA 1KSJA 1W5SA 2HCBA 4LC1A 3N5CA 1RRCA 2JLYA 4MKGA 4JVSB 1U2RA 4PTLA 5FOSA 3H2YA 4V0ME 4Y0VA 1R2QA 1VTKA 2GRJA 4WZ6A 2GZDA 5L3RA 5FUWA 2EFDB 3MMPA 2G9NA 2WJIA 4B3XA 5BXQC 1XB2A 1ZUHA 3KKNA 3THXB 1TQ6A 4JKYA 4BEJA 1E0JA 2W0SA 3QBVA 1E2EA 2FEOA 4HAUA 3GLFA 3RS5A 1VIAA 1Q12A 2GJAA 3C5CA 4KV9A 1DAEA 1Z83A 1ZJ6A 2ZUCA 2RHMA 1U98A 2HXYA 4UNRA 3CPHA 3ICQB 4QJ5A 3GLHB 5EXTA 3DEFA 4US2R 1A5TA 2KB0A 2VQSA 2PT7A 5GJBA 4Q4AB 3W3AA 1NMYA 2WPDA 2QE7A 3R7WA 2RGDA 3RS7A 3EZ2A 3FMFA 4A9AA 2A7QA 1GL7A 3AP1A 1R0XA 3P20A 4PPFA 1PVOA 3QXHA 5IT5A 5EP1A 4QM7A 2JLWA 5CYOA 4A82A 2I1VB 1W0KD 5M04A 2JLZA 2FFQA 1EGAA 3THOA 1XMIA 1W47A 4DB2A 1SVIA 4LV8B 4AC9A 3LY5A 2GCNA 3KXKA 1KY2A 2C99A 3L82B 1ESMA 3E5HA 2IX3A 1YZKA 4B6EA 4C7OB 4KVGA 4DLRA 1TF7A 2WM9B 3G82C 3QKUA 1G18A 4LHYA 3BK7A 1HE8B 1W7AA 721PA 1IY1A 3B6EA 2ZITA 2EYUA 3PIRA 4PZZA 1KKMA 5JWRA 1B0UA 1CRQA 4P4SB 1JB1A 1P9WA 5FI0B 1QVRA 4AG6A 4F4CA 1II8A 1BKDR 1CJMA 1E3MA 4GZLA 2J9RA 5EUQB 4UNSA 2QM8A 1F48A 3TGPA 1P2VA 1E2IA 4HAWA 2EQBA 3DZDA 4TQ9A 2I1QA 2ZIAA 2BBSA 2BM1A 2FSHA 2YINC 2IS1A 4CEHA 5L3VA 1ZU4A 2YWEA 4JLOA 3EASA 3GMTA 2YJTD 4D4JA 3NBYC 3T1VA 4BLOA 3OIYA 2HJGA 4CDGA 8OHMA 2FH5B 3B13B 2ATXA 1IJEA 3B9PA 1VYVA 4BEBA 3QKRB 4ZDKA 1T0HB 2OHFA 1E2JA 2FF7A 4XVRA 1SXJA 3CRQA 1KZGB 4Q19A 2HDNB 4WA7A 1XCPA 3L0IB 5CLLA 2J7PD 2ZR7A 3QQ5A 4PAMA 4NE2A 2B21A 1QVAA 1GUAA 4HB3A 2ZRKA 3SJBA 1ANKA 2YOFA 3RWMB 2J0SA 1ZD8A 2ZSEA 4DKXA 1U9IC 2JGNA 3TVDA 5F9FA 4PC3A 2GAAA 1F5NA 1R10A 2ZSFA 1DG1G 3K9GA 5J4HA 3AM1A 1N5KA 2IHBA 2AK2A 3K09A 4WW0A 2JJ2D 1J70A 2OUKA 1R0ZA 4Q9LA 1EFRD 5LBIA 2BC9A 2DWQA 4QJ4A 5J4LA 3VNUA 3W3ZB 3A6PC 3I5YA 1BO6A 5F3WB 1XMJA 1C9KA 1XTKA 3ZGXA 1J90A 5FPTA 4IFEA 4ZPXA 1Q1ZA 4Q4HB 2XITA 4BZQA 2R6DA 2PCJA 3ASYA 1LVGA 1XNJA 1NN0A 3WBJA 3I72A 1VIYA 2QMHA 1OYYA 3OE7D 3BWDD 1Z6AA 2CJWB 3NDPA 5J4YA 4EUNA 3QXCA 5GVSA 4QHTA 2O8FB 1OFTA 2JCSA 2ZR0A 2F43A 4DRZA 2V7QA 1KO1A 4KBGA 5CB6A 2H57A 3OAAA 3I62A 1UDXA 4E5UA 2GDJA 5IF9A 4LJAA 4AYWA 4NH0A 1Q1BA 2J1LA 3ZVMA 1Q3HA 3QBTA 2W6JA 5G3ZA 2QTFA 1GWNA 2QRNA 4BFXA 3U4QB 3RYTC 4BZPA 1A2BA 5B30A 1LS6A 3CR8A 3K0FB 5LD2C 5B64A 3SNHA 3E70C 2EFEB 4O2RA 4TT3A 3AVWA 2ZSAA 1Z2CA 5HTKA 1FL9A 3KQNA 4BLSA 2YOHA 5DLQC 1FMJA 5E7MA 1KMHA 3RSOA 2PZEA 3V00A 1COWD 3FGNA 4CRWB 3V4RA 1G19A 3H84A 4EPTA 1ZD9A 1P61B 5J47A 4V02A 2P5TB 3P4YA 3LD9A 4F7WA 3ADCA 4DLWA 3O8CA 3QVUA 2J0UB 5IK2D 2JEOA 1GAJA 2JLRA 4ACAA 4IKEA 1NIPA 4PZYA 1TTTA 3BBPA 5CLQA 2P5SA 5JBQA 1VCOA 1PUJA 4TMXA 2QMUA 2OV2A 4C0HA 4MDFA 1GRNA 1EFUA 1NN3A 1Z28A 2ZQ5A 4LBWA 1ZD1A 3MFYA 4GSYA 4OJQA 3ZS9A 4BFZA 2WZQA 3IBYA 4TMTA 4JS0A 2JJ1D 4II7A 1G3UA 4UNQA 4XVQA 4H9GA 4TMVA 1E1QA 4EPRA 3REGA 2HF9A 3THXA 3D31A 3ZVNA 1KI7A 1U8AA 4X8HA 4ZKEA
chains in the Genus database with same CATH superfamily
3VO2A 3JAKA 3QTLA 4M1MA 4W63A 2W6OA 1QIKA 3NM5A 3TXXA 3H13A 3LC7O 4Q5IA 3U7IA 3OJLA 4B6FA 4C4ZA 4HYQA 5A04A 1H0SA 1CD5A 1W44A 1YB5A 4IQ0A 1S96A 4CBVA 3FM9A 4J3JA 2Z3VA 2ZE7A 1J2UA 1Q15A 4QXMA 2GRAA 3AV0B 1UFKA 4I4IA 4DDTA 2FMKA 1X7GA 5AYVA 2V1XA 1Y7TA 5TGTA 4WINA 2PX5A 4D96A 5ENZA 4ZYUA 1J8DA 2BMEA 4ZREA 2ZCJA 1P4RA 1T0IA 2PUWA 3EMKA 4IHJF 5CDSA 5HIJA 1VXRA 1T5SA 1OKKA 1S01A 5DCLA 1E96A 3VR1A 1LDGA 2VDKB 1Q84A 1W52X 4CL2A 1SOMA 1ZWKA 3EVDA 3EBPA 4OQNA 4XWOA 5HZKA 2WF9A 2D1FA 2YY5A 3NP7A 1LLQA 1F6BA 1RCFA 5EHGA 3ND5A 4JNKA 4AD8A 4E09A 2AFHE 4QFDA 1IRIA 3QELA 1VE3A 2WG1A 4PRZA 1ONOA 4TYPA 3DEAA 5BSFA 3U5TA 1O95A 1DARA 4AAYA 3K32A 3U09A 5IWCA 2W70A 1F1JA 2I3BA 2WHPB 3D7SA 4LC0A 5HS4A 1TTPB 2I1WA 4WUVA 4MWDA 2VPTA 3E9CA 3WYAA 1M9NA 1OAOC 3KJHA 1US8A 1DAIA 4C7XA 1LK7A 1OZGA 2A0FA 2X14A 4JX9A 4U4AA 2IEIA 1Z18A 5E6UA 4XIYA 4ZMBA 3K70B 2BDUA 4CTNA 2OAGA 5LQAA 3UW1A 1C8LA 2YOGA 4YGXB 4UBMA 3TF5A 1XZFA 2R60A 1RE1A 3DR3A 2F4NA 2XF2A 4RHYA 3RIMA 3S81A 2AS0A 5HBRA 3PZBA 4FWIB 4ZCRA 3CZMA 3T99A 4XOIA 2VS1A 4CKWA 1NSYA 3ESBA 3FSRA 4PG4A 4BNXA 1EFCA 5AVSA 2AOTA 2FAXA 5TR9A 1N6LA 1V25A 3DDWA 4QARA 4W6QA 1XDZA 2VHYA 3UMSA 4FR5A 4G1EB 2Q07A 2ZAOA 4QDXA 5HQ3B 5C80A 3ND6A 2XNJA 3PJFA 1ZCAA 1OXTA 1T34A 1YV9A 3S1AA 5J58A 5A03A 5JYEA 1EA5A 1E1KA 4KAAA 1J21A 5HA5A 5FPYA 5L7YA 4DARA 2GYWA 10MHA 3FCEA 3K15A 3QI7A 3QKRA 2WRZA 3DQZA 1CTQA 2AMJA 5EZQA 4GZ6A 3RARA 3A3PA 1LK0A 4WASA 1OILA 1QHEA 3U3DA 3NT2A 3ZOKA 1PZHA 1O57A 1X38A 2HQRA 1JF8A 2PEYA 4KI0A 5AICA 5BNIA 4ZEVA 4JVOA 4HNUA 4L7QA 2C7BA 2NWQA 3H4MA 1NNEA 4CMBA 1WXIA 4W8OA 2Z2ZA 4LSGA 3OU2A 2FXIA 2BBOA 3OLYA 5L4SA 3KSAC 3FTCA 1U8CB 2WVJA 2ES4A 1YKFA 2ZCVA 3VC7A 2E4AA 1KYYA 4OKSA 5MGNA 2D2VA 2M1ZA 4DNFA 2GXAA 2WDZA 3AEKB 3RS2A 1FNNA 1KKLA 4NH4A 3PCTA 1GYQA 3PRKE 5FXMA 3BFJA 3CA8A 4JB0A 4QTZA 4BO9A 2ZUUA 4PN3A 3FSEA 3V3KA 1EH5A 3L7YA 1YUBA 2C3OA 4GD3Q 1K6XA 3QJGA 5DH9A 3QGMA 1J8YF 1K06A 1OX4B 5ADWA 2LW7A 2WMDA 1G9XA 2JLUA 1E9EA 3UJ9A 3ET4A 3AL0C 5F1YA 3C6QA 1PLLA 3HVUA 3RYCA 3MN1A 2I7XA 3VR2A 3LLUA 4A1FA 3IP6A 4NDAA 1RJEA 2ZDQA 5EG5A 1KRWA 3RQIA 4MVXA 3RREA 4JJ4A 3AVXA 1J97A 4II3A 1VL5A 3H42B 1AUQA 4KK4A 3UJBA 5HZMA 3OTQA 2PGIA 1SHZA 2X0KA 3R6DA 1XRPA 2ZSIA 2VXBA 5ESWA 5BWLA 4U7DA 4HY3A 5IVDA 3SBEA 2OV1A 1WVGA 3C5WP 1A8QA 3C6ZA 3PA6A 3WXMA 4F9FA 1FFHA 2ONJA 1POXA 3D0RA 1WZUA 4KVFA 2FUCA 5H5JA 1X7ZB 2J0VA 1H1DA 4J43A 4TV9F 5K8UA 1G4AE 4MQFA 5CH8A 3WQBA 5ADHA 3I05A 1DXYA 2IPXA 4QREA 1Y8QB 3OQIB 3U4QA 3FIUA 4QLOA 4D26A 1TYZA 1YL7A 4J49A 5IAAA 1AUXA 3K0FA 4R98A 1I7NA 1ZNYA 2C04A 2QTVB 2ZREA 4WKNA 5FQOA 4CN8A 5BOSB 2W6NA 2YN2A 2QSZA 3UPTA 4LFBB 1TIBA 3SYNA 2CJFA 2UUCB 2GRUA 3OLXA 1KNQA 1NVXQ 2V6JA 3C5VA 2FRDA 3CCCA 4B3GA 1WV1A 1ZVQA 3C3WA 4V0OA 2DGDA 2PANA 3N8NA 4C87A 5BPHA 2XMBA 4NAHA 4ZQFA 2Q62A 4HWTA 1SVLA 1CUFA 3TOCA 5KYWA 5AW4A 4IDOA 4Y6GB 1WF3A 1S2DA 2GHRA 4ND3A 5JMOA 3U3OA 1N75A 1X7YA 3ZJ5A 1ZAYA 3FA2A 5DW0A 4BNFA 2JDIA 3CLRD 4YJFA 1O6CA 1PJZA 4TMYA 4PSAA 2DBVO 2ANBA 4K9RA 3LV8A 5JCOC 2PT6A 4OX9Y 2HKIA 1MNQA 4HNHA 3IQFA 4O4IF 1F60A 5AK0A 1E2QA 1Z6TA 3G5LA 1A82A 4A1OA 2OQRA 3DV0A 3AR7A 3WK9A 2IL1A 3DM9B 1RQGA 2NQ8A 3G88A 2FZ4A 2XRMA 1XF1A 2PY6A 4OFBA 5K8VA 3N6RA 3AWDA 1B0AA 1UK7A 1ZH0A 1AKVA 2OENG 2C5FA 3LKBA 3OZXA 4GUDA 4I50A 3STVA 4KH1A 1E1CB 1GILA 1N2GA 2BKEA 2XB4A 5MN6A 4FINA 5AT1A 5IS2A 4KR6A 5KCMA 1MB2A 2YJ6A 3JARA 1Z6YA 2JIZD 2VZ9A 3A6FA 4KODA 4KREA 1DPGA 1Y4ZA 1CY1A 3WMEA 4WPGA 3GT3A 4ZV4A 1E6EA 3V8EA 2P69A 3A8TA 2C4TA 1KHHA 3B60A 4D3SA 3O4JA 2VF7A 4LJ4A 1VKNA 3DCJA 5JNRA 3W9UA 1T36B 1T8PA 4FEAA 4QATA 5JR3A 3TSYA 1OIVA 1SBHA 4AKEA 4WZZA 1GRRA 1XNGA 1KFEB 1UZMA 4V24A 5TPWB 3RT1A 2AUNA 3EPPA 2BEJA 4TLEA 1ODTC 2CJXA 2OFOA 5CCDA 1UBJS 2GA8A 1EB8A 1FNBA 1W8DA 2VQ6A 2PGOA 2X5OA 2ZWPA 3JWIA 1XP8A 3K1JA 1TYEB 3M9XA 3GUYA 2CLMB 3OURA 3QI2A 3HO8A 5C5IA 2I9PA 3RT9A 1F1BA 2FZGA 3QWHA 2FE1A 4I1VA 2RHTA 2V55B 5TQJA 1PJSA 1UFRA 1VJ5A 1YTLA 2GT1A 3M1YA 2NVWA 1BDBA 2DX7A 4Y6OA 1KOJA 2IYRA 3WADA 3OC0A 3QFRA 4KLRA 2QQGA 4PRKA 3LLMA 4B9AA 4YRBA 4OI1A 3D7MA 1U2ZA 3A14A 4F4UA 3ZE0B 1I2DA 1UAGA 2VTDA 4HUJA 2G28A 2P1DA 4UDNA 4L07A 4BNLA 3S2FA 4G5FA 4NK4A 1M33A 3K0CC 4XUEA 2BBWA 4KOEC 4Q66C 1KRXA 2I71A 5AKIA 2OCDA 2D2EA 1GZ5A 4E07A 4E5SA 4Q7MB 2AZXA 3HYCA 2XMQA 3AF2A 3RJZA 3FKSD 1CW2B 3ZQ6A 1PSZA 1HFJA 3AHFA 3ZIAA 1K68A 1H3EA 1K2VN 1L8QA 1YAJA 2QLLA 4G0PA 1E2GA 1QNLA 4BY9E 2JLSA 1DBPA 1V39A 4IUYA 3VHXB 2QE7D 2W93A 1E3WB 3A11A 3ID6C 3ZDFA 1G4UR 2WDPA 4CEIA 3VHLB 1PEAA 4TUYF 4IH9A 2ISQA 1P8JA 4GMFA 3MZ0A 3WK8A 4IQ4A 2BE9A 4EYQA 4ZVSA 1VIVA 2A57A 1FBTA 4KKVA 3SOPA 3ZJYA 3LTEA 2RC6A 3PUJA 3LLSA 4PFSA 4EG1A 1GUYA 1PK9A 2X7JA 3DTVB 3OCUA 2NV6A 4TS3A 4A8JA 1W36B 3EFEA 3ZCXA 4RV5A 4AZ3B 2AKYA 2FETA 2IF2A 1PEDA 1ZLYA 4J9UE 4JC8A 4LWQA 5AKEA 5KQLA 3LFTA 3U1TA 2GJ9A 5L3QB 1MTOA 2EGGA 3VAYA 5T4EA 1B42A 1GZ4A 3TIGA 3EW9A 2JFYA 4JJGA 4YT8A 4EELA 3RFFA 1ODJA 1G0NA 4DA8A 4O25A 3WB0A 3TLJA 4HFRA 7GPBA 4KHZA 1YIAA 3O8LA 4EPWA 2KYRA 3D7RA 4B87A 3LCJA 3GXBA 5C35A 1MJHA 2O5VA 3BD8A 4UAJA 5C1DA 2PX2A 1XDBA 1Q50A 1EZ1A 3I92A 2AN9A 4UUNA 2CLKB 4MRNA 1M1UA 1O0BA 3FI0A 1PWXA 5FBWB 1D07A 2VXOA 1UFOA 3KDSE 4LY6A 4N0PA 5K3FB 3B12A 3PDHA 1RPNA 4YA6A 3RU7A 3UXEA 3TNFA 1V2HE 5MF6A 4B3MB 3PK0A 2HREA 5DMHA 2XPCA 4FYVA 2GEUA 1Z4QA 3DZBA 3L8MA 2OA0A 1RXSA 2QN7A 3VJRA 1ZRHA 3IH5A 2FPPA 5HFAA 4P4NA 2XEXA 1YOVA 1E1DA 4L8GA 4EFDA 2HZ7A 3ZE6A 1UJ5A 3TN7A 1DJLA 2YXPX 1R8YA 3VR6D 1ORDA 4HNVA 2JFHA 3ORYA 3D4LA 2XWSA 4HO1X 2OQ2A 1X9IA 2QX8A 5KO2A 1TUIA 3RYFB 2D1RA 1CCWA 2RH8A 2QA5A 2Z98A 3NOOA 1CHNA 1SC1A 3CUKA 3H3FA 2VBGA 2PRSA 2XUQA 5F52A 5LBUA 2PVPA 4UD6A 3GCXA 2P78A 4DCCA 5C7OO 1XYVA 1Z0AA 2R97A 3AFMA 3JATB 1SXJD 3DUWA 3KR2A 3ZDAA 3FTFA 1G20E 3OEYA 3AVYA 2GXSA 2PUVA 1XX6A 2Q6OA 1K7EB 1B6RA 3HEBA 2LGJA 3EXFA 1G20B 4BMVA 5F1OA 1A7UA 3AT1A 3NB0A 5AI8A 5KYVA 5CVEA 4YCNA 1RCTE 4CEJA 1IL0A 1DG3A 4LXYA 3GRPA 3MS4A 4XGNA 5HRUA 3K0HA 3WL8A 2VYVD 4H2DA 3WV4A 1LWOA 2B1IA 1QVVA 5K4AA 5IU6A 2NPFA 2PLNA 3LKVA 4MNTA 2F1OA 3W8FA 1CQIA 3PFHA 2ZT8A 4YCMA 3AERB 2OCAA 3LLCA 1OF1A 2Q5EA 1ST3A 4J94A 4FE4A 3ZYZA 4ENQA 2YN0A 3K1AA 4AIRA 1OA1A 2QYTA 4EYGA 1F8XA 1G2OA 1R6DA 2XNKA 3COYA 2JANA 3NW9A 3S2YA 3F6RA 2ZVDA 3JVIA 2DCMA 3RSLA 2XLBA 4EY5A 2QSJA 1TCAA 3FF4A 3IC5A 1WWKA 4I4CA 1BU8A 1DRVA 4OP2A 4IDNA 3HA7A 2O2ZA 3NHYA 1H5QA 3KOUA 5JADA 4KXFB 1Q1AA 1NUSA 2BMJA 4HTFA 4IGKA 1XMXA 2BTQB 3ZHXA 1WCYA 4MYUA 1VKOA 1UQTA 4MQLA 2BGGA 1GPKA 1JLHA 1RJFA 1QE3A 4QPNA 5AJHA 1EVKA 3JU3A 1JE0A 2IEYA 4IHJA 3TG2A 4PU0A 1I1OA 2WTEA 5KAPA 5L95A 1ETHA 5DGXA 3L5OA 2PH5A 1PQWA 3RBVA 1L5WA 1PNQA 2WSSA 1VYTA 2JAOA 1I4OA 4QQ8A 3TQSA 2BMDA 2GD6A 3W04A 4C3VA 2OD7A 5AOCA 5KDDA 1DTWA 1FS6A 1E99A 2CZCA 2RHWA 3NDIA 2IPMA 4RF4A 2YHUA 4CV2A 4A27A 2V3CC 3WDLA 3WK5A 2X2OA 3HRIA 2C4KA 5EJ5A 2VVTA 2OFPA 3O74A 5IJZA 1S1CA 1UEIA 2W6JD 1N5LA 3IA2A 1TX4B 4ZO6A 4Y98A 1NXVA 1EUDA 4MH0R 4BZZA 1NZJA 1WB6A 2R8OA 4QA9A 5G0WA 3W5HA 5CEFA 5B5SA 3OUUA 2HU5A 1TVEA 3DLCA 1N25A 5DHPA 2H2HA 4H31A 2BUAA 5JWHA 4ARAA 1V1JA 4DG5A 1UKVY 2HMAA 1P2GA 4F2PA 4C0QC 2Z43A 4V2IA 1A5ZA 5CITA 3KTDA 4HVCA 5EIHA 2VT3A 1SCNE 3DMNA 1A1SA 3LSTA 2ZWAA 4WL0A 4Y6SA 3R3YA 3DLIA 4Y9RA 3DE2X 5AJTA 3DE6X 3CZPA 4BMSA 4MB2A 5E1DA 4ZAXA 3A0UA 4GI3A 4N8EA 1Q0ZA 2GMWA 1MC4A 1GNVA 1E2DA 1T2EA 2RMKA 3CGGA 5EP2A 3QE3A 4XQEA 1DMSA 4RFSB 1PW5A 1N5IA 4ZDJA 4X3PA 1FJGB 1HT2E 4BRSA 1OT3A 1I2MA 5TT1A 5ALUA 3NIBA 5D8DA 1XA0A 1XU9A 1U6KA 3CXUA 3H2GA 3LHKA 3OZWA 4D4LA 2C7RA 1DC5A 1K0UA 3MOSA 3WP0A 4WDQA 4WNIA 4GQBA 4WFKA 1GAEO 4GZ3A 2X42A 2O0LA 3KJXA 3ROQA 1HEYA 3PA8A 4KPGA 4TT8A 5IAGA 4H7KA 3VPSA 5F2EA 2ZVPX 3HGMA 2B5WA 2YXBA 1SD1A 3NASA 2P41A 4F4HA 4NFYA 1DBIA 4QDZA 1ZSVA 3UJ8A 3CBGA 1FYVA 1WHSB 1TUBB 2VUTA 4MYSA 4R2WA 2WQ7A 4RPHA 1BHQ1 2JKVA 3ILSA 1SCQA 5F3DA 1N6NA 4F5DA 6Q21A 3I9JA 4ZAZA 1LLCA 4HKTA 2LDBA 3O8DA 1MDBA 4LRYA 2B36A 4RPCA 3LC2O 4RXMA 4NMMA 3VNRA 1BVYF 2Y0DA 1QJ4A 3I52A 3SSOA 1YQUA 2CW5A 4GKAA 8LDHA 1JG1A 1PS0A 4URUR 2XCQA 4RSRA 1T26A 2X5NA 1LK5A 3B7WA 1U3CA 4WKOA 2NSLA 4J3NA 5B1HA 3GPLA 1IC6A 3T9FA 2HIAA 3ZTTA 5JS8A 4MICA 2G5CA 2O52A 2QUJA 1OKKD 4AY2A 4U6NA 5EHIA 4ZVTA 1XLUA 4PONA 4TKLA 5JD6A 3E27A 1L5GB 3QNUA 5KTTA 2OCYC 3E58A 1ZM7A 1M74A 2EWMA 4GR9A 4X95A 2ZUEA 1GU0A 1Z8HA 2DH6A 4M8NE 4AIIA 4CF5A 1BWRA 3EHDA 4Y3UA 1MO3A 1W4RA 2W43A 1M6VB 1CVLA 1QP0A 1V8DA 2J5KA 2H8KA 4XEUA 1EWRA 2G06A 2QW1A 3L6RA 3MGGA 1R8JA 1O95D 3D0OA 2QW8A 4JGIA 3S55A 1VKRA 1YQ9A 1J42A 2J33A 4EI2A 4U2KA 4XIFA 3U4IA 1TXGA 2IOFK 4QAJA 5DEOA 2XGGA 3L8EA 3STYA 3C45A 3SICE 3UT5A 4JLWA 4NSNA 3W3AH 2O3RA 2VOEA 3CIOA 3IUPA 3UKDA 5EIEA 1U31A 2C2WA 3JV7A 2EFYA 4TV9A 4LCJA 3V8BA 1RM5A 2A3RA 3NJRA 1XXLA 3OECA 1KEEA 4GUAA 3P2JA 3N7TA 2B4TO 2BEUB 4GP7A 1R5BA 4DA6A 1CRLA 1T91A 3OF2A 4X7MA 4UVEA 2ZSJA 2O5CA 2PSEA 1FTGA 3T7CA 1IM5A 3LYAA 4W8GA 4FCVA 3ZBPA 2B6NA 1SQFA 1GNTA 3G9UA 3EVEA 1KE1A 2A8YA 3GPCA 3UG6A 3DVSX 1UPTA 2OOKA 4FS3A 4GQAA 1RJGA 3TDKA 3UANA 2PPLA 4F6CA 2B37A 4IVQA 1LSOA 1NY6A 3IAXA 3QLEA 1NVDA 2GEFA 2IXTA 1RI2A 3NHFA 5CDFA 1U28A 3B6MA 3VPCA 4W5TA 3VTAA 1GZDA 5BN4B 5JH7F 2I2BA 3QFTA 2E85A 3I6MA 4FTWA 4JA2A 4FFOA 4L0QA 4MQUA 3RVPA 4B7UA 2B82A 1C7IA 1C3OB 5GMOA 2GJSA 3ZK8A 1B6TA 1OGJA 1YJXA 3MRSA 5H02A 3Q2KA 3NC0C 5KYUB 4DIDA 3VR3A 3KLOA 4MUEA 4O4IA 1EK0A 4BO3A 2RK4A 5I9LA 4F72A 2HRQA 3BHNA 1M0SA 4M46A 1QX4A 3WV5A 4C4YA 5CLFA 2BCEA 4TTQA 4DJFC 3S7ZA 1SBIA 3ER8A 1XTIA 1X7HA 2SBTA 4AMYA 5TNXA 1XG5A 2DXIA 1GKUB 1QB7A 2B0JA 1G5PA 1M6NA 4HGPA 2BI4A 4C03A 3UFXB 3EXIA 1Z2OX 2H9AA 2ZT5A 3A10A 3ESQA 5EN4A 5A62A 3DBRA 5ECDA 4B2IA 4P4LA 3LBIA 3DZ8A 5L4LA 2NP6A 1B26A 1TFRA 1D2MA 3OZUA 4FHEA 1YZTA 1XF9A 3RROA 1ISRA 3EAQA 3IUSA 2F3RA 5BP7A 1A04A 1FUIA 4Q01A 3P8ZA 2XWPA 3FW1A 3BTUA 3PP8A 3HEMA 1DWOA 1WMEA 3LX8A 4W7SA 1MEEA 1ZMBA 3ABIA 3U9SA 1BCRA 1NT4A 3LPCA 3RC2A 4MWSA 1PCXA 2JI7A 4L51A 5FP0A 5EZYA 4ZI7F 3NJ8A 4DLAA 1HC7A 1ZN9A 4EJFA 1R3UA 4Q3LA 4WT7A 1TOAA 2B8TA 3L6BA 3BHJA 1Z6ZA 1T5BA 2WKRA 5G1OA 2X0DA 3SS9X 3CONA 3VR2D 1Z15A 1Z2AA 2Q6IA 3L5KA 3R1IA 4IS2A 2J9YB 1XU7A 2XYHA 1BCSB 1YNOA 4OMDA 3RWOA 1FFCA 2CBXA 2NU7B 1WSBA 2CVHA 3NBXX 1OWOA 2RD2A 4JYMA 4ZPJA 3ZWPA 2P5UA 5DULA 4LNHA 4NOJA 2R47A 3W2HA 3DFKA 2VDQB 5DNEA 4MWEA 8GPBA 2GEBA 1E9CA 1ISHA 1ZP6A 3C15C 4HWPA 3RUCA 1SUSA 3AMVA 4HGYA 4GSLA 3A05A 5D00A 1IIRA 3QV1A 4HVAA 4UU1A 4YHBA 3UA3A 3O4GA 4D1YA 1GLNA 4Y2SA 4TYYA 5DT2A 2J3MA 1MFPA 1WTCA 4J0HA 4CLOB 1D2NA 3EFOA 4WX2B 1MAAA 2P1ZA 4FI3C 1DIBA 4LWOA 1MX3A 4IS3A 3V4VB 4A0SA 4C1BA 1H4QA 4TUYA 3DONA 1YZUA 1N92A 2PRYA 2VJMA 1HOTA 1P73A 1KAHA 2VPXA 4RK6A 4BJ5A 1RC1A 4N6OA 1KI3A 5EESA 4GF5A 2R48A 4FFBB 4FE7A 2Z2XA 4M53A 2FMTA 1D8AA 2HSGA 4C7OA 1VSUA 3D6UA 4P53A 4DCGA 1NLUA 2UUOA 4UUBA 5TDHA 1KU0A 1M10A 3AIIA 4G86A 3O2QB 1IHPA 1NDQA 1ZXLA 2CLIB 3QPCA 3E2IA 4JEHA 3AKYA 4UVGA 4IILA 9GPBA 4CTJA 3P0IA 3BTSA 1JJBA 3KOWA 5IRCD 2FXVA 2JDID 3KFXA 1OZ0A 2REOA 3HYSA 4K9MA 4MPPA 4NBVA 5FKJA 3TM5A 4IQFA 1C0IA 3TLMA 4JC0A 5EZ5A 3ZCPA 3DXFA 5BUCA 5K0TA 1PWEA 4WFIA 1Z38A 3DEJA 3WMFA 2O8CB 4OU5A 1G9SA 4ZWNA 4HXFB 3E3NA 1LV8A 5BQ5A 5JNVA 1SQGA 4E3ZA 2PQ0A 5L7TA 5AKLA 2ZE6A 3TE6A 1MNAA 3F49S 3QUTA 2J0QA 3AWIA 3HPRA 4CF4A 3I2HA 3JZIA 2P9YA 3VVLA 2VCEA 3FOEC 1KO4A 3HSSA 2CNDA 2IF0A 3PXAA 3P2IA 4TROA 1JYEA 2QL5A 2YWDA 3CF6R 4XQ9A 4JR0A 2OLJA 4LE0A 1C7ZA 4Z86A 1BEUB 1YA8A 3FVWA 3CJQA 5B36A 5JAHA 3HB1A 2JVKA 3DTNA 4O0LA 1FYEA 1N7JA 3GRCA 2CE2X 4CCYA 1S4MA 4XCQA 4NY1A 1Q19A 4WCVA 1CJVC 1YJ8A 3RJ5A 3GROA 3F6SA 1J0CA 4XCXA 1MVLA 1V16B 2NTJA 1BXKA 1XAJA 3DKVA 1T1EA 3VYSB 1ZHFA 5L3SB 2JGJA 1IONA 4NV3A 3NCHA 5LLSA 1P7CA 2H85A 3RRMA 1KDYA 1QQAA 3ERCA 1P0FA 2Q8PA 3T5CA 3DG9A 3HRHA 2COEA 2RI0A 1ECFA 3D8SA 3FVTA 3JAWA 3MLAA 4G5QA 3QY9A 2B7CA 1FXSA 2CBGA 4A23A 1YF3A 1VLMA 3KEMA 3RVJA 3PJEA 3TSOA 5CH5A 3TCKA 5BN5A 1WOYA 5LVAA 1GL6A 3HGTA 4K9NA 1QWOA 2ATIA 3KOMA 4KNVA 3ZU4A 4RZHA 4D9FA 3UJHA 4EYOA 1Q6ZA 1S2OA 4DV4B 4NOMA 3E22B 1WV0A 2BKLA 3N2KB 3FPSA 1P1CA 2FG6C 1X6VA 1A4IA 3WB2A 1IN5A 2O5RA 3I8SA 1XQ6A 2VJCA 4D80A 1O9GA 2QUIA 2FGJA 3V1MA 2EZ8A 4YUYA 1AJEA 5HOQA 2Z1DA 2XB2A 4MIEA 2R1UA 2WWIA 3ZIAD 3CLUC 4O4HB 1X8XA 2RHCA 1J49A 2WZDA 4MMXB 4Q4HA 3TQTA 4E6EA 1XEAA 3F0TA 3OLQA 3GAFA 4XRRA 2QN6A 1MZPA 3QPAA 5JS2A 5JSFA 2WTAA 3PUIA 4BNNA 4OQEA 2NT4A 3OQJA 1TZBA 3LUFA 3P5BA 3KOZA 3BJRA 4FOPA 2VDPB 3KLPX 1DOZA 2CJWA 3ZU6A 4C0LA 2GBCA 2PRZA 4MOWA 4FFSA 4JBHA 4CLRB 5FWXA 2ZB4A 1CZRA 4DSOA 4EW6A 1YFJA 2HNAA 1QBGA 1GNQA 3BEOA 4B6QA 3IT1A 1QWSA 2O6HA 1B7GO 1IVNA 3N0TA 4G84A 1ZVKA 3CEMA 4L78A 4YFVA 5DK4A 3CO5A 1I24A 3SJAA 3DBVO 2PRIA 4QHSA 1FUEA 5CPBA 2B35A 2IW1A 1T8WA 1EK6A 3TZKA 2G3YA 2JGDA 2WOOA 4OOEA 3TRFA 1P72A 2VJPA 4OK3A 5BT9A 4D3ZA 4U5XA 4BQIA 3NH6A 4CFYA 4IYJA 2F1JA 1G8GA 2RE8A 1PBTA 1Q91A 2VDMB 4C2BA 4AL4A 2R25B 5BXYA 3H0KA 1PJBA 4L4RA 4TVSA 3A3NA 3K31A 3GWZA 3L8DA 1MRZA 1NUHA 2WYHA 3A2MA 4K0KB 1NSTA 4HPXB 4DRXA 3ZHOA 1YHZA 3X2SA 1G38A 3UJAA 5KVSA 1X80A 4RD4A 1EGVB 2VJOA 2VK1A 4MUFA 4NG4A 3T1OA 5C46F 1YU9A 4IVPA 4RQUA 3RRJA 1MAWA 3PCXA 3I9V6 5JY1A 1N9ZA 2ICAA 4R1LA 1K4MA 4QRHA 3LO5A 3PD0A 3TL3A 4QAQA 5COQA 3TD6A 3WA6A 3IE2A 2QI9F 1GCAA 2WD9A 4QSHA 3S6JA 4IZ6A 2NZVG 4Y2QA 1N8SA 2P9FA 1YHYA 1KTVA 4H7EA 4S35A 1NFQA 2ZJ2A 1L1RA 5KPJA 4PYIA 1FBNA 3PHHA 4ZYLA 1Q7BA 4TL7A 3RUIA 2ZJ3A 3IIEA 5H9VA 4NENA 1NYLA 3OZSA 3WWEA 2A2ZA 3PHCA 4RTPA 5IXYA 4OI0A 1RM0A 2XZPA 4XJXA 3ENWA 1T4CA 1M6HA 5K45A 3PYXA 4I8IA 4W4TA 3U3XA 1P17A 2VF5X 3LY9A 4GP6A 2E18A 3JYQA 1KYTA 1BS1A 2NU6A 1N2CA 3G68A 1YS6A 4MKHA 3SFTA 2A1UB 2HMVA 1FDRA 4I5IA 3ODGA 4L3WA 3T4UA 2RGEA 4MUJA 4JK3A 3T3DA 1EIWA 2ODTX 5THQA 4QOSA 5HKAA 3L0YA 3JASB 5ESXA 2BR5A 4UVHA 1VCMA 4ZXFA 3KZOA 1IY8A 1FU7A 1VXOA 4ZO4A 3G89A 3Q72A 1UIMA 2IEBA 3F74A 2JIPA 2Z5LA 5D1HA 1PWHA 1DAMA 1PSDA 4PM4A 3BXGA 3FR7A 3D1VA 5F78A 4NE9A 4JENA 2HXGA 4R16A 5JZVA 2FEWB 3RJMA 1NXQA 4L4UA 5HCNA 3KSUA 4IUBS 5C1PA 4YUVA 4RENA 1D0SA 1H2HA 2GX6A 2R6CA 1UM8A 2X8WA 4MRVA 4EZIA 3WIEA 2YY6A 4R2KA 1EGHA 3WO1A 1JR6A 2GKSA 2Q49A 2IHKA 4ZYXA 3C48A 1PZMA 2Z56A 1SULA 4IDPA 1PW7A 2XCUA 5I8ZA 1YE3A 2OO3A 1SBCA 1O1YA 1QUEA 3VFDA 5FEUA 1AMUA 1CZNA 4K3VA 2FFAA 2QUZA 2SKEA 4UCWA 3P45A 4DQLA 4FBGA 4XM1A 1KJNA 2B8WA 3AP3A 2Q3JA 3B9RA 4WBXC 3O2JA 5IVPA 4J0FA 1ZZGA 4X94A 3BGIA 5L6LB 1U3WA 2JJYA 2V8OA 4OV6B 1GKYA 1GQYA 2C95A 2VP6A 2YQ4A 3BE4A 4RACA 5EXEA 2JIDA 2VP2A 1I36A 4AX8A 4ES6A 2WIKA 2AFHA 2WSSD 4X90A 3R74A 5IKEA 2ZJAA 3TTTA 3F2IA 3MJFA 1PS9A 3QU4A 1RLTA 4YJ2B 5GAJA 4WSOA 1C30B 1U0RA 2ZI3A 1TC2A 1NQTA 4D9HA 4GR4A 5MGBA 3BZUA 1MF7A 4U0JA 1H3FA 2IGTA 4HWRA 5DLDA 3UJ7A 3M5CA 2W6PA 3U9TA 2E48A 3AKCA 2QS9A 2VEDA 2E4UA 1ESCA 1UBTS 5BV1A 2JLBA 4MWOA 4X1IB 5ENDA 1TI7A 3LS2A 1F20A 2PUGA 1NJ8A 1QP7A 4POAA 3WS7A 2WWTA 3CNLA 4JC4A 2DFKB 2I3DA 1RWKA 4PCUA 3IPLA 4IJWA 5H82A 1TO1E 2Y9MB 2NU8A 4OD0A 4RZQA 4ML3A 2WNHA 2BFFA 2NQTA 3PHLA 1R4AA 1D2GA 4MW1A 2WWRA 2UVPB 3IO5A 4GIBA 4WDRA 2CWDA 2DQ4A 2I4IA 3R6LA 4L9WA 3EIEA 1UPUA 3LKDA 2CXHA 1KEWA 1WDTA 3DA8A 1W34A 3OU6A 3PQ5A 1E7QA 1ZS9A 3AL3A 3N8DA 4XSGA 5CHYA 2PYZA 4RL4A 1EDEA 5CMLA 1E9VA 4ZZIA 1Z0KA 3DOCA 4Q3BA 3H5RA 4G5RA 4OY3A 5J23A 3D6JA 3STHA 3D7NA 1QIFA 3I09A 1FLVA 5J40A 1AK2A 1MQ9A 5SZKB 1TQ2A 4B43A 2IDKA 3TLCA 1MIHA 5JH7A 3Q8LA 2FE4A 3U7RA 1YZLA 2Y1KA 4YACA 5E9AA 1E2HA 1QMPA 2IYQA 3I5MA 2Q4DA 3KSMA 4ZI5A 2K5UA 1R5OA 1VP3A 1G5RA 4Y2RA 1IMOA 1JQJC 1NM5A 1XTVA 3O9VA 3O8OB 1DOHA 2BWJA 4TLAA 2SKDA 4HQRA 5KSWB 4I8DA 4J0QA 1JA0A 3KIPA 1OH6A 1YU6A 3WBBA 1GLVA 1NW3A 4MRPA 2PUTA 4KXVA 4BB6A 3VSDA 4MLDA 5C7LO 5MN4A 3QMMA 4LV5B 4PZ0A 1XD2A 4AXXA 3IAUA 4Q4DA 3VDRA 2QMYA 2YWJA 4QYTA 3TBKA 5HQTA 5L9AA 1VSBA 3U81A 1KO5A 1NJSA 3ZVLA 2Q9CA 3MBOA 1I32A 3QVMA 1CF2O 4G1CA 4OUKX 1Y63A 2UAGA 4OLFA 4WY8A 3RWBA 2WKWA 3FX2A 1QPBA 2AFIE 5KEIA 1R7RA 2HQBA 1EBBA 4O4JB 4MDHA 4TKZA 1CB0A 3DDSA 3T7SA 2CYCA 1U0OC 4L5BA 7ABPA 4XYBA 1VCHA 3DKIA 3K2QA 2O7SA 2Z6VA 3S7TA 5CCEA 2HIGA 1LUAA 4LJSA 1OX4A 1JJAA 4NCHA 3ZCQA 4EKDA 4NCBA 1WNFA 1XQ1A 1YNSA 4I6JA 4RELA 1XZJA 4NF2A 1XAIA 1U0BB 3AC0A 4GECA 5ETJA 1U02A 5DISB 3TW8B 3FYCA 1BVRA 3NYIA 3WKDA 3H17A 5ICGA 1T1JA 4DMFA 4ZI7A 1IZZA 5HPYB 1ZPDA 2Y1LA 5AKYA 1L5NA 3CUUA 2OCKA 1IBRA 4YP1A 5C8XA 3W5DA 4S24A 1HNNA 1T6YA 1A8SA 2GWHA 2NIPA 4QJ3A 2WYVA 2VH2A 4DJ5X 3W7AA 3ZWDA 2J9FB 3D2LA 3T52A 3W9YA 4DBZA 3HCBA 3A04A 2DHRA 4Z9YA 3PZRA 2RH5A 4DY4A 5CTAA 4EHFA 4LHEA 1Z4OA 3KUDA 1E6WA 3KHSA 1J22A 3OQIA 2QYSA 1PEKE 1HZJA 1VL2A 3RRFA 4BP8A 5HCIA 3BH6A 3LECA 1KP2A 2QTVA 5BOSA 2GXQA 4R4JA 4KQIA 4LOIA 2IHTA 3GDWA 3WWCA 3K6SB 1P0PA 1UXIA 2BGMA 3ETNA 2RHBA 3AI2A 2I6SA 2ZDGA 4WNAB 4DAOA 2D4AA 2J6IA 2GBLC 2QRPA 3GRKA 4DGSA 3MSCA 2Q6TA 3JW8A 2X0JA 4N01A 1SUWA 2V0CA 1II0A 2VA8A 5K4HA 1R4ZA 3PQ4A 3O8QB 2RJOA 5JDCC 2YV3A 4BPBA 1SR8A 2EQAA 2GHTA 1SURA 3FZGA 2WSYB 2O8NA 1FYXA 1XCGB 5CA0F 2GZ1A 2B98A 3ZDRA 3IESA 2P90A 4JROA 3GFSA 1MEJA 3FYDA 4PG5A 5TS2A 3AI1A 5DNDA 1CY7A 1QHIA 4JLVA 2IYPA 2O05A 3C85A 4TPKA 4BGEA 1GU1A 4OM8A 4CM8B 1JXQA 2YJ4A 4CQLA 5ALZA 2Q3FA 5DTMA 3H05A 3PPXA 3FOWA 4ARZA 4KO8A 1ISFA 4PBRA 1JEDA 3OVMA 1Z75A 4XM2A 1ODFA 5GV7A 5A1TA 2X7HA 4MV5A 1KJIA 4UTZA 3EIXA 3HYNA 1P3Y1 1TECE 3F6PA 2C8KA 4O2BB 2ZEJA 3IVRA 4Q1AA 2ZYDA 3SLRA 2HYIC 4TRNA 2XUZA 2V6IA 1ISPA 4IKOA 2PKYX 3RK4A 2AUTA 4GYYA 3WIDA 3KELA 3VPAA 3ZDDA 3D2CA 5DYGA 4KI7A 1O5TA 1VYHA 2VSXA 4M7PA 5AMXA 1LD3A 4INJA 1OJLA 1IOZA 1BD4A 1C8VB 4BX9A 1T36A 2BCGY 3SZGA 3NEAA 4GHWA 1V1RB 3EZNA 2F8LA 1EWVA 1FUUA 5TPWA 4HNTA 3TOSA 1YACA 1Z22A 2AW5A 2X4GA 3AF3A 3Q85A 1VMEA 4J1TA 1T29A 4PAWA 4UM8B 3AM3A 4UMVA 2W2XA 2BR4A 4QPZA 1ODIA 1BX1A 2HQOA 2FOLA 3HCWA 5C7IO 1E3EA 2NUTA 3RSCA 1UJCA 3UAWA 2Q5CA 1JIQA 3I42A 3NAGA 4G4IA 2FP4A 4CU2A 1DBSA 1U94A 3E5RA 3IIKA 1XIVA 4V3CA 1E89A 1UOEA 2QD1A 3MTDA 4DQDA 2QRHA 1GL3A 3UWOA 4CKBB 2FMUA 1J7KA 2VAVA 3MUNA 4INOA 1E1QD 1N9GA 1Q1EA 3V7WA 2H7CA 3I8OA 3BC1A 5K8LA 2QVXX 1QCCA 3RC8A 4FVTA 4YAIA 4URVR 4TTRA 4GXQA 1SBTA 2GVZC 4N7RA 4EY7A 3VDXA 5JJIA 2X6TA 2COKA 2X9LA 3H4IA 3IV6A 5AVUA 2VZ0A 4GXTA 3FCAA 2W4MA 5IP5A 2BZ1A