4Q7LA

Structure of nbd288 of tm287/288
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
SGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKEAALEVLFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Transporter Motor Taken Apart: Flexibility in the Nucleotide Binding Domains of a Heterodimeric ABC Exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal binding protein
molecule keywords Uncharacterized ABC transporter ATP-binding protein TM_0288
total genus 88
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q7lA00
4NONA 5EXSA 2OM2A 2EFDB 3PUZA 2ZYTX 4NU0A 5FR1A 3Q5DA 5FOXA 3WP0A 3OFNA 1U98A 4EFNA 2IW3A 3HU2A 1US8A 3SHWA 4OI0A 2ANCA 4Q4AB 2GESA 1HT2E 2BMDA 4Q48A 1DVRA 2J5XA 4JZKA 3D3QA 1CLUA 4TLEA 3QIAA 4EPTA 1LS6A 3W6NA 2GXQA 2PH1A 1GITA 1QHIA 1G64A 2QN6A 1NVWQ 1R2QA 2O8CB 4KSBA 5KSYA 1JAHA 1EWRA 1W7AA 5JSZB 3PEYA 3KKPA 1TQ6A 2V7QA 1U2RA 1EFRA 2G83A 3N2IA 4B43A 3HYTA 1IXRC 2LKCA 1E1QD 1G3MA 2C9CA 3TSOA 3R9XA 1M34E 3WRXC 3QXHA 1CR1A 3SJBA 4Q1AA 4BECA 4RZ3A 1KO4A 2BEKA 3T61A 4B74A 3R7WB 3BJIC 2D74A 2HDNB 4TL7A 3A36A 2QRNA 5EZ5A 4GDFA 5HTKA 2VH5R 4JBYA 5E7MA 2WAYA 2O8BB 1OYYA 4D81A 4QJ3A 1SXJE 2PLRA 3TH5A 4PANA 1UBGA 1X1RA 4LBYA 2A5FA 2IX3A 4ZI2A 2WWGA 3T1OA 2SHKA 4HEJA 4I81A 1Z0DA 2A2ZA 1I4LD 2VEDA 4K81B 4NE2A 5AJYA 5EE3A 3WXMA 4OJQA 4L9SA 2HYDA 1DPFA 1C9KA 5J4VA 1GZSA 2WJJA 3LQQA 1J8YF 3KL4A 1KSGA 4HUQA 4I1SA 1W48A 2JDID 2G1KA 4M22A 3ZS9A 4DIEA 5G40A 2ZSDA 2AXNA 1G3IA 2W6JA 4E07A 3ECCA 4R7ZA 5H70A 4AG5A 2VHUA 3U61B 1V43A 1P2SA 4POAA 2KJQA 1ZUNB 2VQSA 2ZE5A 3GJXC 3OEEA 1E1QA 1YKSA 2OV2A 5KYKA 4DIDA 1CR2A 2O8CA 1EGAA 5KPJA 1NVVQ 3I8SA 4QRHA 4PHTA 3KKMA 4TYWA 1OF1A 1GRNA 4LSGA 5HZKA 3CBQA 5FPTA 1N5JA 5IT5A 2CL0X 1S3GA 3A1VA 2DWQA 1ELOA 1P60A 1YZNA 4KLNA 4AI6A 1G3RA 1FW6A 1QVAA 4JLVA 3QF7A 1LVGA 3KXIA 4HAUA 2B8WA 4UXIA 4KFTA 3IDQA 1XXHA 1FTSA 3DMDA 2HEIA 3B6EA 3GFOA 2ZRJA 1LS1A 2ZROA 1XCMA 2IYYA 1D2MA 1NN3A 4W9MC 2F55A 4B32A 1VG9B 2TMKA 3EZFA 3ZD6A 4M1WA 1KY3A 5ANRB 4Z1MA 2ZVQX 1XMSA 1XJQA 3BB4A 1HEIA 3KDSE 2XITA 3AP1A 1G5PA 4QM6A 3C7KA 3FYHA 3L43A 1KI8A 2RGEA 2B6HA 3CUEF 2AD5A 4U7DA 2GJSA 1L2TA 4IOKA 4OQNA 2DY1A 4QHTA 3WHKA 1JR6A 4OL0A 1DAGA 5JZVA 3DZDA 3W9YA 4YMTA 5BN5A 3WYGA 1F2TA 2QAJA 4BLSA 1ZD1A 4M1YA 1NF3A 2W2VA 2ZJ5A 4Q1CA 2RGCA 1QVRA 3LH5A 2NO1A 4DZZA 2VP4A 1R4AA 2P3SA 2JLZA 3LX8A 2ASEA 2XJ4A 1NG1A 4MRSA 5JS8A 4D0NA 1OFUX 1J90A 1RRPA 2YKGA 3V4FA 5A0FA 4ZIRB 2AXPA 4PFSA 4L9WA 1N6NA 4E5UA 4WZAE 1GNPA 1CIPA 2AL7A 4IKEA 4B34A 3F3YA 3V9PA 1W4RA 3PUVA 1W0KD 4CEIA 3ZH9B 2A5JA 2EQBA 2ERXA 1VG1A 2CXXA 3QKRA 3TK1A 3UPUA 2EU8A 4B3CA 4AIIA 1XTJA 4TQAA 1YR6A 1JBKA 4YDHB 3BWDD 4ARZB 4V0MA 1KSJA 2N46A 1H8HA 1NG9A 2IUTA 4FXPA 5A5GA 3WY9A 2B21A 4RD6A 3R7WA 4HSEA 1L4UA 1U8ZA 2QPTA 3ZIAA 2ATVA 3UIEA 4NYIQ 2FH5B 4MH0R 4LPKA 1PLKA 5TARA 1CR0A 3TNFA 5KO2A 1XB2A 3TR0A 2V8OA 3QF4B 5B64A 2QI9C 5JEEA 1R0WA 2GJKA 4KI0A 4B48A 4FWTA 4D26A 1GKUB 4D0LB 2FFAA 2H8KA 3W3AA 1YZTA 5KTYA 2WHXA 3LBIA 3H84A 4JLBA 2BBWA 5EZ6B 4D82A 1XD9A 3TQCA 2PMKA 1TQ4A 3EZ2A 1G5RA 2PEZA 4U5XA 1CBUA 4LK2A 1HT1E 1DAKA 1P9RA 3MWJA 3U3KA 3FE2A 1MV5A 2CMKA 2P5SA 2OFXA 2YC2C 4NYMR 1R0XA 2C9OA 1Q0UA 2J0QA 2Z4SA 3T34A 4Q9HA 3O8CA 3MJHA 4Z54A 1ZM4A 2ZYVX 3CNNA 4Y0VA 4K46A 3NC1C 3I5XA 2QORA 4JLKA 1XTIA 3KKNA 3MSXA 4P33A 2XZOA 3ZLJA 5BN4A 3OEHD 4ZV4A 3R20A 1ESMA 3AF3A 1HQCA 4LY6A 1W5SA 3MRSA 3N70A 4KITB 4PSKA 4QNMA 3KJIA 2J7PD 3A8TA 3PENA 4C0QC 4LX0A 1IN8A 5DH9A 1XCGB 4ESHA 1XBTA 1VYVA 3A1SA 1W4AA 3A1TA 1KI1A 4MGZR 3W5IA 3NKVA 2W6ID 5H8WA 3X1DA 1XFAA 1NMZA 3B1ZA 4TLDA 4A0FA 2FV8A 2Q0HA 5KDLA 2NOAA 3JVVA 3FTQA 4N0EA 5FPYA 3TBKA 2HV8A 3AQ4A 1YRBA 2GTPA 4TMZA 1NVUQ 3SDZA 2HXSA 3VR5A 1CF4A 1TQDA 3U60B 4PSAA 5FFMA 4PPFA 2VPPA 4B33A 3PEWA 3Q7PA 2ERYA 4DB2A 4OK3A 3CPHA 1ZP6A 4PC2A 3BE4A 1Q21A 4URZR 1GL6A 3RWOA 4TL9A 4KVAA 3IIJA 4A92A 4AK9A 2C95A 2PEYA 4FN5A 2V6JA 2R9VA 2XOKD 2DBYA 2GNOA 3DDCA 4DLUA 2AR7A 4HLQB 3AKEA 4R9UC 1R0YA 2AFHE 4C4PA 4QFMA 1HTWA 3EPJA 2YWEA 5KSPA 3BFKA 2AFIE 4G5GA 3MLEA 1W0JD 3VR6A 4UXJA 1U8YA 4O25A 2H92A 4C2TA 1M7HA 4M9XA 1OLOA 2GAOA 2FDCA 3BD9A 1P61B 4PHGA 4PQFA 3FWYA 1Q12A 3GLIA 2R6FA 2DFTA 5TB5A 1I2DA 4GBMA 2WOOA 4LUCA 1T4GA 3IUYA 3PCRB 3KQKA 2CJWA 4PC6A 3IBYA 2YOGA 4QJ4A 1U0LA 2QE7D 4QKQA 4DLWA 3AKYA 4HDOB 1D5CA 3VHXA 4D6PA 4M53A 3KB1A 2JJ1A 1VCIA 4B44A 4LV6A 3VKHA 1BH2A 2O8DA 2OXCA 4QHSA 5GVRA 2IS6A 2NO6A 3O8BA 2BIFA 4JT2A 2I4IA 2ZRHA 2BDTA 1T5LA 1YR7A 2QMOA 2QSYA 2WJVA 3CLVA 1X8JA 4MRRA 3AKDA 1ZM2A 2PBRA 2ZRIA 2WKQA 1E2EA 1ONBA 2ODBA 3EIHA 3CM0A 3RABA 1Z0KA 6Q21A 4A9AA 1DADA 2XOKA 2XAUA 1YU9A 3NBFA 1NP6A 1DAMA 3T15A 1RZ3A 2QRZA 2GCNA 4XSGA 3L0OA 2WM9B 5A4JA 3K0CC 1QHXA 2IXEA 3GLHB 3R8CA 3MFYA 4US0R 3JZAA 4PPQA 4CGZA 3EIQA 1A2BA 3L82B 3EC1A 2GJ9A 3MWYW 5AUPB 2C9YA 3W3ZB 2D2EA 1DAFA 4P32A 3RHFA 2CHVA 1JQJC 2E87A 2JAQA 4A82A 5FPHA 3OAAA 4EIWA 1E2DA 3NG1A 1T3LA 3B9PA 3M4YA 4HAZA 4XIGS 3QPVA 3AB3A 2GCPA 2JJ1D 4A0HA 4JL6A 2D7CA 4BQSA 1MABB 2DFNA 3CKLA 5G53C 4V0LA 1WP9A 2P2LA 2MMCA 2O0KA 5FH9A 2ZUDA 4DDWA 4NCKA 2AWNA 5EXXA 4IVPA 4AKEA 2CLSA 2JLYA 1FQJA 3CNLA 4A0GA 1OPXA 5M04A 4BEBA 1Z6XA 2YZ2A 1FNMA 1WMSA 4EPWA 1AQUA 4QBFA 3LAWA 1XF9A 3TVDA 4JLOA 3EXAA 4LJ5A 3UG6A 3AM1A 4IOJA 1JJ7A 3M0EA 3IO3A 3SFZA 1W44A 3P32A 1KSHA 3TIFA 3PJRA 3ASZA 4YQFA 1Q1EA 5B30A 2F1RA 5C4MA 2O8EA 1OE0A 1Q20A 3EWAA 1DELA 4FMDB 2RGDA 5H1YA 2IS1A 2A30A 1EX6A 4BFVA 2ORIA 4YXWD 3I32A 3ASYA 2QP4A 1K5DA 1E79A 2QTVB 3AV0B 2QMEA 4M1MA 4A8JA 1MKYA 2YWHA 2ZE8A 3DKVA 1SKYB 4CRWB 3BH0A 4LJYA 1ZM7A 1KIMA 4FWIB 2OO7A 2G0TA 3QPUA 3THXB 4F38A 3NH9A 4H1UA 1E4YA 1H8ED 2MSDB 4NDZA 4RD4A 4P4TA 4Q9LA 4D4MA 5AJVB 4DBLC 2R6AA 4UNNA 3CPEA 1IOZA 2PMDA 3RANA 4GOXA 1I4DD 2GXUA 1Z22A 1Z6YA 1XMJA 2OEPA 3D31A 4TSFA 1JR3E 3QG1A 3JZMA 3B82A 4H1VA 1TF5A 1JQLB 2AK3A 2OZEA 3OF5A 2KSQA 1AZTA 1G5TA 2OCYC 4GFDA 2PT7A 2FNAA 2VBCA 1VG0B 1KKLA 2ZRAA 1YZLA 3AUXA 1N6IA 3C41J 4EFMA 3QSYA 3CIOA 5CB6A 3GFTA 2B7BA 2OILA 4UNSA 4QHYA 4UQOA 1RPZA 1E1RD 1XWIA 4M21A 3ADKA 3VX4A 2GETA 4B3BA 2WWFA 2ZRMA 3GJ0A 2O8DB 4QGHA 1XTSA 1YRAA 1S96A 2P5TB 1A2KC 1MO5A 3U7GA 3AVVA 1H65A 1ESNA 1R5OA 1XEWX 1YHNA 1JXOA 3VHLB 4PX9A 3CRVA 3QXXA 2GEVA 4Q19A 3GLGE 2ZUBA 2DHRA 1QHYA 4ZCLA 2QG6A 4H9GA 2ZAMA 1AJEA 3THYA 5LDDC 5JCPA 2CVFA 4JMPA 1C1YA 4Q9KA 3V4RA 3I3SR 4JL5A 4U02A 4GSYA 2IXGA 3K70B 4Q1BA 3R8FA 2NMVA 2QGZA 4OK6A 4QG7A 2WV9A 3SQXA 4DUGD 1ZM9A 2RKOA 2C98A 4YONB 2Q9CA 2VLIA 3THXA 1S1MA 1KI6A 1SGWA 2W58A 1PUJA 4P3YA 3I61A 3I72A 5C2JB 3U7FB 1ZW6A 1OFHA 4F4CA 4KV9A 3LLMA 4M2LA 1KDPA 1P72A 2OLJA 1RYFA 2EFCB 3ND9A 4QNRA 3CF0A 3TLXA 3FKSD 1P5ZB 3K9GA 3NC0C 4DSNA 1G17A 5K8UA 2R2AA 1KI3A 1KNXA 4KFUA 1MOZA 4RY2A 4EJSB 2XTMA 3H2YA 2XZLA 3B5JA 3CZPA 3PITA 4LYAA 5FL3A 2GZDA 2HYIC 1NMYA 1II8A 1F2TB 1BKDR 2CLDX 3RC3A 5FTMA 4M0LA 3MGCA 2RGBA 4Q21A 3NDPA 3KQHA 4Q47A 1EX7A 4FIDA 2J3EA 3X1ZA 4NP6A 821PA 1Z6AA 3K9HA 3B9QA 1O3YA 3U4QA 3JVUA 3G5UA 4V0NA 1WA5A 1Z6GA 1E6CA 2Q9BA 1OHHD 3F5FA 3NXSA 4IW3B 3K0FB 1XTQA 4IXNA 4HB0A 3Q5EA 1M7BA 1KK1A 4V03A 4LBVA 4DCUA 1J2JA 4F4JA 5L3QA 3VU9B 1IBRA 1KO7A 5EE0A 5AUOB 1NBMD 2L0XA 5ELXA 3ZVRA 1D6JA 1XMVA 2GKSA 2NZJA 1KSFX 1E0JA 1GIAA 2KE5A 1US8B 2KBFA 3AF4A 5KSZA 2ZYUX 2O8EB 2PLFA 4LBZA 3WNDA 2ZE6A 1UFQA 3U44A 1UDXA 1W1WA 4DUGA 4QC2A 4GRAA 1CU1A 1SVMA 2OUKA 4HI0E 2BHRA 4AC9A 1AA9A 4I1UA 2IA5A 3ICEA 2ODWA 1JNYA 2WKPA 5TMPA 5CK4A 3FKSA 5J4LA 1NKTA 1Z83A 2XJ9A 3NHAA 1LV7A 1MT0A 5EJEA 1DBSA 3G82C 5DSZA 1JEEA 1KY2A 2FSGA 1CTQA 2XX3A 2QT1A 2IEYA 4C30A 1QG2A 1EG7A 5DI9A 4DCVA 1ZYUA 4A2PA 5JS7A 1WBDA 5L8VA 3NIBA 3B1YA 4WXRA 4DSUA 3PUXA 3AF2A 3HWSA 1KYIA 1XTRA 3FMIA 3F8TA 3MCAA 1KZGB 2GK7A 5HKKA 2ZJZA 5CYPA 3B85A 1HYQA 1E9SA 5DLQC 1XNJA 4NTZA 5TDHA 3QEJA 3T35A 2PX0A 1ZCAA 2VF8A 3P1JA 3TUIC 1S0UA 4Q4JB 1E98A 3ZZUA 1E99A 1P2UA 5CDFE 1CP2A 2JATA 4HZIA 5DO9A 3CRMA 2QL6A 4ZCIA 4G0NA 5SZHB 1PJRA 5KNCA 2BKUA 2ZAOA 3X1XA 1OXTA 1Q3TA 4NYMQ 1ETUA 2I3BA 2AK2A 3DPUA 3NVAA 3HPRA 5CIQA 4EJSC 2WJYA 2Z43A 4PZYA 4WZ6A 1RIFA 4JKIA 3K70D 1XCPA 4XWOA 2IK8A 3DHWC 4EPXA 2R8RA 3LXXA 2C5LA 4JKYA 4RZUA 1M74A 2CK3A 3BOSA 1UBFA 1DO0A 3E5HA 1PUIA 1S1CA 2LCFA 1XEWY 3CRQA 4KO8A 1NNEA 4JVNA 2VHJA 4BFZA 1E2LA 3A1WA 3ZQ6A 5F98A 2GEDA 1COWA 2IWHA 3SS8A 2CNWA 2ZJOA 3PIRA 1VECA 4JVSB 2VRWA 2DCUA 3FHCB 1RC8A 1NN0A 3LQRA 3OIUA 3P4XA 2IEZA 2JLRA 4PZLA 1S9HA 2CCGA 1JXMA 1GWNA 1ODFA 4BWYA 4YC7A 1KI6B 5E4FA 5L3SB 3UANA 2YC4C 1YZGA 4RZXA 1T3SA 3GJ3A 3BORA 4O3MA 4PPGA 3AKCA 3G0HA 1N5LA 1JB1A 1DOAA 4LJ7A 2G0NA 5CM8B 3KTAA 5DISB 5JEDA 1WQ1R 4UNQA 5HCNA 3DVLA 1V5WA 1RW4A 3VMFA 1DE0A 4GMDA 3SNHA 1XPOA 3VR1A 4Q4JA 2WAXA 4S35A 4B35A 1R0ZA 1IN4A 3SYKA 3PUWA 3TR5A 3CWQA 4I1OA 1AS0A 4PPNA 4CW7A 1E2KA 2ZUCA 5KOYA 2PCLA 3WP1B 4IJMA 3EPKA 4C0HA 1IHUA 1X8LA 2QQEA 1W36B 3W5JA 1MO4A 1MR3F 3GPLA 4CEHB 1P75A 2WSSA 4KBFA 2W6JD 5CIWA 3CR7A 3EZ9A 5JECA 4Q66C 3KB2A 5HCIA 1ZINA 5BYJA 1KI4A 2A9KA 4ILEA 4HB2A 1G7TA 2VP2A 2ONKA 3LBNA 1F2UB 3Q9LA 2FA9A 4GL2A 3LLUA 4Q02A 4AG6A 2P67A 4WAUA 1E3MA 4TT3D 4IHQA 4Q7KA 3HU1A 3LX5A 1NKSA 2RGGA 4DSOA 1SVOA 1VCMA 1W5TA 3W8RA 2C77A 1E9FA 3SOPA 1NIJA 3B78A 2I1QA 3TE6A 4JYCA 4A6XA 3B1XA 2G3YA 5E7IA 2QMHA 1Z28A 3FGNA 4V0OA 1JJVA 1N5IA 4YMSA 5DN6D 3P20A 1CRQA 3QKRB 1RKBA 2ZI3A 1AM4D 4TTQA 4BLOA 1R8QA 3LVQE 1HE1C 2GRJA 3WNCA 5KHOC 1OXVA 4HLCA 4QJ5A 1XEXB 2QP3A 4LC1A 5D3MB 4QOSA 2A5YB 3ICQB 2YOHA 2JLXA 4M9ZA 2BM1A 1HUQA 3AP3A 4L5BA 4A8JC 4ZPXA 3K0SA 2QM8A 2JIZA 2WMOB 3QVVA 3MD0A 4D4JA 3RRNA 4E03A 4KODA 2XTNA 1YJ5A 2IUUA 2HT6A 3RS4A 5EQTA 4D4LA 3ZVMA 4LYHA 1N6PA 4OI2A 5JJLA 5J4YA 2ATXA 2WICA 1TQ2A 4QL3A 1L8QA 2CBZA 2ZRDA 4IVQA 2IT1A 2CVHA 4URUR 1E2FA 4IEIA 5E95A 4J0QA 3W34A 3HR8A 1B0UA 2RCNA 3A4LA 3LXRA 2BMFA 1SVLA 1Z5ZA 2FU5C 3PQCA 1NL3A 1IAQA 5CLLA 1P9NA 1Z63A 3MG9A 4OQXA 2CHQA 3SZRA 5EP4A 1AN0A 4XVRA 1U0HC 5EXPA 4PC7A 2WJGA 4B75A 2WWYA 1EFTA 3J81k 2Z83A 2F1JA 1FMLA 4TL8A 4JVLA 2IHYA 2QZ4A 4DXAA 3KUDA 4EPYA 1CXZA 1EXMA 5P21A 1N6LA 2IYVA 4DLSA 3GQBA 2ZS9A 3KFVA 3ZGXA 3BH6A 2ORWA 2X2FA 1U90A 2J0UA 2IL1A 4W7SA 4BLPA 3K09A 1FMJA 4KFRA 4BLRA 1E0AA 4WA7A 4P4SB 2QNRA 5FTKA 1HY3A 2DYKA 1Z3IX 4LV5B 4NYJR 3CX6A 2DR3A 2OSBA 4IDNA 3DM9B 4M1SA 4TYPA 3DMNA 5FOSA 3TSZA 1ZM3A 3DM5A 3ZVLA 1NRJB 4B3GA 1KO8A 3KXKA 1FP6A 3RC8A 3P4YA 4NCJA 1X86B 2O8FA 3D7MA 4C0SA 1GILA 4BFUA 4M8NE 4NBSA 4OI1A 4IDQA 1Z0IA 3CR8A 3QNUA 4Q9IA 3NBZC 1CULC 4YMUA 2WSMA 1YVDA 1F60A 3K0FA 1SVSA 3ZYCA 2G1JA 4GI7A 1KO1A 1RJ9A 3GJ6A 4IDPA 1FOEB 2LKDA 1GL9B 3A4NA 3O8RA 3C5CA 2REBA 4R2IA 3UMRA 1TEXA 3AVWA 3PV0A 1P6XA 3LV8A 3NHBA 2PZFA 2WIAA 5FBLB 5LBIA 4B6FA 4CDGA 2ODNA 5AUNB 4LJ4A 2FFHA 2RGNA 4QBIA 4XWAA 5J4KA 1E0KA 1R10A 1KDTA 2V4ZA 3AEZA 3H4MA 3FHTA 1E2JA 1D9XA 3SJAA 1YE8A 4JSTA 4ABYA 2R6DA 5E7JA 2WPDD 4NKRA 4KFSA 2X1VA 1N0WA 2P6NA 2ANBA 3RDPA 1W36D 5CITA 1QHHA 1NY6A 1E9BA 1OV4A 3EARA 2QAGA 3IHLA 5JLJA 3ZZ0A 2VF7A 1NLZA 1F48A 4ZO4A 2CJWB 2Z6VA 4XVUA 2NO0A 3I73A 1TADA 4DCSA 4GNKA 2RAPA 5FUWA 4IOLA 2OXRA 3GEEA 2BBOA 3S1AB 1W2GA 3VR3A 2W0MA 2XGJA 4FCTA 3C5HA 3PFIA 1BS1A 2KWIA 1P2TA 2BWJA 1MRSA 3ADBA 2QQ0A 5JWOA 3K0AB 5E3HA 3NH6A 3ONWA 1TEVA 3PUYA 3R9IA 1D2NA 4JLDA 4ERNA 1DAEA 4ZDWA 4DSTA 4EDHA 4ASUD 4P0TA 3ZVNA 3IIKA 1QHNA 4OK5A 2EFHB 2PZEA 3GJ7A 3OIVA 3K9LA 3RSOA 2FPMA 4URYR 1PVOA 1UKZA 3EX7C 1NMXA 1EFCA 1N25A 3FDIA 3QUSA 2AKAB 4WOPA 2BMEA 2NZ8A 2GDJA 4Q5IA 1OH8A 2HXYA 2REXB 3DOFA 4XOIA 3RYTC 1FL9A 4Q1EA 4FCVA 1HURA 2MSEB 4TLAA 2JLQA 3BRWD 1Z47A 1A5TA 3U2QA 4HLDA 4Q01A 1DEKA 4CEIB 4LJ6A 2UZIR 1Q1BA 3BB3A 1UKYA 5FL7D 2XNDD 1ZUHA 3ZZTA 2GVZC 1G21E 4AYWA 4UXHA 4EUNA 3RRZA 4AD8A 5JJKA 5TXGA 1SQ5A 3X1YA 1AKEA 5FR2A 4DB4A 4Q7LA 3IEUA 4EPVA 3PVSA 3UWKA 3GLFA 4MKHA 1Z0AA 1ZIOA 1UF9A 4K8OA 1KDRA 4KYIB 5FBRB 2CK3D 3TW4A 3Q3JB 4PSVA 4ACBA 3LFUA 5JJIA 3RVBA 4Q4HB 4YMWA 1XEFA 1NSTA 1J70A 2C8VA 4A4DA 3TVTA 4F93B 1A7JA 1G7RA 2ZVPX 4RD0A 1WBBA 4GMXA 4OYHA 1XDBA 1WE2A 3QPWA 3Q72A 3VNVA 2GZAA 4UKDA 2K5UA 1NVVR 1FUKA 1AGPA 2Q6TA 2Z0MA 3NEYA 4ASUA 4IDOA 2IYQA 4RFSB 2CDNA 2NPIA 2EFEB 1KMHA 1M2OB 3P26A 4IEEA 3SE0A 2F7SA 1OH6A 4N0DA 2GXAA 1OXXK 1Z07A 1KNQA 4ZKDA 1DS6A 2FSIA 5K8LA 4OKSA 3K0AA 2OFWA 2V1XA 3AVQA 4HAXA 4Z51A 3O8DA 2WJIA 2ODEA 3U6KA 4BLTA 3QBVA 2R44A 1X8KA 3QXCA 2RH5A 1J99A 1Y63A 3V00A 1RFLA 1UPTA 3CB4A 5EXTA 4MDEA 1XD2A 3ND8A 4EQ6B 3U3RA 2GZHA 1TX4B 3A4MA 4LDJA 4C0LA 2NG1A 1E2HA 4ESVA 2IUSA 2HF9A 1G4AE 4CT5A 2O0HA 3LA6A 5HPYB 2G6BA 2MSCB 4KYUA 5DGXA 2FMXA 2VSFA 1P73A 1AS2A 2QAGC 4N1AA 5DI3B 3HJNA 1NIPA 3TRFA 1TTTA 3OFND 2VP6A 4MRNA 5KSOA 5DE3A 3UWOA 3ADCA 1XZPA 2ZRKA 2FE4A 4FMCF 2GXSA 2IXFA 1Q22A 2ZI6A 4PQYA 5C1BA 1GTVA 5DYIA 3IQWA 3KKQA 4RJLA 4AKHA 1SKQA 1R5BA 3WYAA 1OH7A 4RKFA 4OQMA 2VA8A 2V7QD 1II9A 1G41A 2BJVA 3QKSA 4M1OA 3UMSA 3AVTA 3VNUA 3SR0A 3DZ8A 1CEEA 1Z08A 2XNSA 2ZRNA 1G7CA 4LHXA 1PZNA 121PA 3KZ1E 3EASA 5GVSA 4EKDA 2DFKB 2QBYB 4MDFA 3R9WA 2QTHA 1N0VC 1ZC3A 1SXJA 3UATA 1VKJA 4Q4HA 2YWGA 3ADDA 1GVNB 1UBEA 3GD7A 1E9DA 221PA 1NJFA 1E0SA 4R2HA 4TMVA 1R5NA 2ZRFA 4EPRA 2Q21A 3H1TA 3THWA 1T5IA 1Q44A 1GKIA 1Y3AA 1ZNXA 2BCGY 2QPOA 1VYTA 2J41A 2J0UB 2ZM5A 1AZSC 4Q9JA 4XVQA 4TL6A 1VDZA 3L0IB 1AQYA 3EC2A 4II7A 2A5GA 3TSWA 1ZU4A 2JLUA 5CYOA 5KNDA 4G3XA 4KSCA 1X3SA 4LJ8A 1G3QA 2NGRA 4HATA 3RS3A 2E1RA 1IXZA 2GJ8A 4LZZA 4A8JB 5FI1B 1XD2B 3IBGA 2JIZD 3HP1A 2QENA 4O0MA 2W83A 2H57A 2YWFA 3AVPA 3OESA 1G6OA 1W4BA 1R6BX 1E9RA 4URXR 2FPKA 4RFSA 4XSHA 2J1LA 5FUYA 4FD2A 4UNRA 2XSZA 4HB3A 4GT1A 4I4LA 4KXFB 4RD2A 2J59A 1D9ZA 4CVNA 5JBQA 1HA3A 3QF4A 2ZU6A 1PLJA 1M8PA 2FSHA 4L8GA 5L3SA 2HLDA 2NO9A 2NO7A 5J40A 2H5EA 3SU8A 1N6KA 2PJZA 5KDDA 3W8NA 2F6RA 2JJ2A 3M1IA 3EPHA 2KBEA 3GLGB 5JRJA 1XXHE 2C2HA 2IYLD 4TWZA 3KQUA 4RKEA 3OE7A 3IILA 1WDTA 4OQLA 4MRVA 3K53A 4JL8A 2JLSA 3T06B 1W2HA 3IPYA 1LB1B 3E2IA 5BWMA 5C4GB 2ZJ2A 3U6BA 1DARA 1UEJA 4PC3A 4B6EA 1OIVA 3L2OB 2MMGA 3QQ5A 1UJ2A 1KZ7B 4MQBA 2FJUA 4IFBA 2P6RA 3I8XA 2VYFA 2RMKA 2ZS7A 3B1WA 4TLCA 4XWKA 1OYWA 4LHYA 5LB2A 1XPRA 1W47A 2RHMA 2O8FB 4A1FA 4Q1DA 3AUYA 4BPBA 1W49A 5F3WB 4TYQA 4MYUA 5SZKB 4KVGA 3IGFA 3K09C 2VL7A 4BRWA 1DO2A 3B7GA 4ZI3A 1I4TD 1QF9A 2IYTA 1NJGA 3DKPA 1P9WA 4FW9A 3U4QB 3Q7QA 2XSZD 2X2EA 5H68A 2J7PA 1E2GA 4AKGA 2GVDC 4MA4A 3W6OA 3OIWA 5FTJA 1SVWA 3QY0A 4BFTA 3THYB 4D25A 2GF9A 3BGWA 2H7VA 2V54A 1O87A 2C78A 5BN3A 3VR2A 2PZGA 3A1UA 4DLZA 3GEIA 1S3SA 2JASA 2BEJA 2ZS8A 4JBWA 1GAJA 1HE8B 1MABA 5FOWA 3SFVA 4B73A 4AKIA 2F3RA 2YJTD 3NDBB 2JJ2D 1VPLA 3SHFA 1E32A 2RB4A 2VO1A 5JRZA 1E96A 4PO1A 4IDHA 5JI3E 4C3ZA 5C46F 1EWQA 1OFTA 2BC9A 4I1VA 4JIMA 2IF0A 4G5SA 3PR1A 4OHWA 1E2QA 1Q3HA 3TJZA 4TMTA 1CJTC 3LNCA 3AGPA 5DI3A 5GJVC 1DG3A 2QTFA 1QHHB 3PEVA 1KJWA 1P2VA 1E2NA 2IYSA 2XZPA 2WPDA 3CNOA 1NLYA 1WF3A 2GK6A 1BIFA 3EAQA 4JSYA 4YLGA 1KDOA 4V0ME 3T5DA 4Z8XA 1XRJA 1M6NA 2KB0A 3WBKA 4BGDA 5AJWA 1SVIA 1HV8A 4QBHA 2OBMA 1W4CA 3K70C 2IWRA 2OFOA 4Q7JB 4QGFA 4BFXA 2YVUA 1IN7A 2G77B 3MUFA 4URVR 1DG1G 2ZI4A 3CRW1 4NCNA 3UK6A 3X2SA 5FBVB 2D7DA 1XXHB 1T9HA 4MYTA 3QBTA 1Z2AA 2GWHA 1IJEA 5L3QB 4HZUB 4B3XA 3RS2A 3IKJA 3FMFA 2W00A 2CCKA 1DTSA 2ZRBA 1Z8FA 3U7EB 5B57C 4HUQB 4LGMA 3AGQA 2ZIAA 4NPHA 2CL6X 3IHWA 4GOKA 2CLCX 4XD7A 2ZR9A 3BFVA 2N1BA 1KAOA 1OHHA 2WZQA 1A1VA 2D62A 1NBME 3KFXA 4TTPA 4M9SA 1VHTA 2WWHA 3VKWA 4EQ6A 3I1FA 4DEXA 3RS5A 4P4SA 2ZEJA 2CCJA 2GCOB 3BERA 1YZQA 3C14C 5FPKA 3QXJA 3FMPB 4NYJQ 1SVKA 1OJLA 4KBGA 4TTRA 4DT1B 1WCV1 5EP1A 3U5ZB 4GP7A 2J45A 4DJTA 2IYRA 3F0TA 5LPNA 5FL7A 2HT1A 4F4IA 3W90A 2FN4A 4PR0A 2ZJ8A 4PO9A 2JCSA 4ZDJA 3QKTA 1G8PA 2IC5A 2ZR0A 3T5GA 3A37A 4RD3A 2WOJA 3GMTA 1LTQA 5CLQA 1PV4A 5DNYB 4D4KA 5CJPA 5J4HA 3TUZC 4ZIRA 2FWRA 4HAWA 1AS3A 1RRFA 2FZ4A 2J87A 5AR1A 3DEFA 1CKEA 3QG5A 1CJUC 2WMNB 1JAIA 3CX7A 1S9DA 1AIPA 2Z5FA 2VHCA 1IQPA 1A4RA 1VCOA 2XEXA 2AD1A 2HJVA 5LD2C 1KI2A 4FCWA 1N3BA 1IY0A 5KPDA 3A6PC 1F6BA 2RGNC 1FNNA 4JS0A 4G1UC 3E1SA 2F1HA 4Q4AA 1P62B 2J0VA 3LBHA 3OAAD 4G01B 4RZ2A 4TN1A 2WIBA 4JLNA 2AKYA 2CEAA 1T8TA 2ZI9A 4DLTA 2B7CA 1JI0A 4DDUA 5F9HA 3TQFA 4HZUA 1KHTA 3IO5A 2QM7A 1U0JA 3AVYA 8OHMA 3EZ6A 1K8RA 1D2EA 2JGNA 4P4UA 1N6HA 3T1TA 3GLFB 2D4HA 2KI5A 5L3VA 3AVUA 4TZ0A 4PZZA 4FMDF 1TL7C 2QMUA 1P3JA 5EUQB 5IK2A 2DWPA 1Q1QA 3I92A 4DT1A 3SC3A 1T3HA 3L8YA 1IM2A 1BYUA 5G41A 1ANKA 4PC1A 1N6OA 2F3TA 2IYWA 1U94A 5TV2A 1G9XA 5EE9A 4IRUB 2DWOA 5K8TA 4LJ9A 4YDSA 2CE7A 1QG4A 2D06A 3GP8A 2GBLA 1LFDB 4LYFA 2C04A 3GLFE 2WJHA 5DYGA 3RWMB 1TNDA 2X19A 4LHZA 1P4SA 4F7WA 2OCAA 3IEVA 2OE2A 3KJGA 2A7QA 4FINA 2O52A 2ZI7A 3OEED 3BBPA 4JT4A 2QE7A 3VQTA 1GP2A 4ACAA 4X8LA 1C4OA 1T91A 3GCGA 4OHVA 1ZAKA 5SZIA 5BQ5A 3O47A 5FOUA 2ZRCA 1CRPA 2ZITA 3MMPA 1QRAA 4B2LA 4RD1A 4TYYA 4XTRA 1GNRA 1T8UA 2ZJYA 5EE1A 2FZLA 1W36C 2H17A 4W5WA 3EA0A 3AF1A 4CYMA 2QAGB 3U3MA 5DIFA 3QE0A 4R71A 2OESA 2Q3FA 2YHSA 5FPSA 1I2MA 1UAAA 3UXMA 5TY0A 2Q9AA 2BOVA 2AN9A 4KAXA 3B8HA 3SEAA 4CEJB 1E2PA 1BO6A 2YINC 1ZD9A 2J9RA 1G291 4B47A 1OIXA 3CF6R 2B8TA 1LF5A 2QA5A 1JR3A 5JHHB 1GDDA 2EYUA 1GL7A 3EWSA 3WHLA 3TGPA 1TMKA 3AF0A 2HLDD 3RAPR 1UBCA 2W2TA 2GCOA 4DLXA 1W46A 3GJ4A 4MYCA 2R6GA 3UKDA 1IJFA 2I1VB 3LW7A 3P27A 4RVCA 1OB2A 1N2CE 1BOFA 4TLBA 4KU4A 5F9FA 1BYIA 2VHTA 1U99A 2OG2A 1TF2A 2F43A 4X8HA 3MJRA 3SJZA 4A6PA 1NN5A 4BZPA 5HR5A 1VCNA 2NQ2C 1SZPA 1TU4A 2BCJQ 4NCHA 2ZPTX 3EA5A 3KTAB 3KXLA 2FSFA 2FFBA 3EIEA 4PXAA 3ZQJA 3FKQA 4DLYA 3L0PA 3IIMA 3C16C 2VP0A 4AYXA 3GJ5A 1GRQA 3BIFA 4Q03A 1HQYE 1MO6A 1E2MA 2GHIA 1JALA 2BVNA 1KKMA 2HCJB 4PAQA 3SN6A 1FX0B 4BFYA 4DHEA 1E94E 4OI4A 4Q18A 5LB4A 1IXSB 2OAP1 3QVUA 3SBDA 2WKRA 3TUJC 2IYXA 3SYLA 1T6NA 2WWIA 1OIWA 4M9QA 3TKLA 2BJWA 2FEMA 3D8BA 4LOAA 2Q3HA 2EYQA 3W6PA 3D6TB 4GP6A 2VHQA 4KCGA 2XXAA 4TZ6A 3QKSB 3VX3A 3OZXA 4PO8A 1JEDA 5FTLA 5AJXA 4O2LA 1NY5A 2GBLC 2JEOA 2QP9X 1JR3D 2EWWA 3DL0A 4GPTA 1ZVQA 3B2EA 4YXWA 3LDAA 4IOMA 4X8MA 2FF7A 2DFLA 2JLWA 1VIYA 1E79D 2F1IA 3ZIAD 3QJYA 4U00A 2V55B 1Z29A 3NBXX 4LYJA 4B2PA 4GZLA 4C7OB 5KNBA 2OHFA 4F91B 1KJYA 2FEOA 1ZJ6A 2QU8A 1H8EA 1G18A 1RE0A 3RRMA 1U9IC 1G8HA 2DB3A 4XH9B 1J8MF 2F9LA 2X8AA 1DAHA 1G20E 1XX6A 1LF0A 3QEOA 3I4LA 3I5YA 3QKUA 4BE7B 1P7CA 1II0A 1MH1A 1N0UA 2GILA 2N42A 4BEJA 3NEJA 4LV8B 3BXZA 4PHFA 4PTLA 3GLIE 1EFHA 5AJZA 2FX3A 2WWXA 3EZ7A 2OCBA 2W0SA 4JLAA 3C8UA 4OHYA 1R7RA 4MRPA 1E4VA 2FGJA 2WWWA 5G3ZA 2YYZA 3VFDA 1FX0A 3LVRE 4A36A 1OH5A 4HAVA 4QGAA 3GLGA 2R62A 2XB4A 4A15A 2QBYA 2BBSA 2WBLC 3LW8A 3TAUA 1Q57A 1YR9A 1KO5A 3EPLA 2W6IA 3GLHE 1AKYA 2XTZA 3MWLA 4LI0A 1L4YA 1X1SA 3C4JA 4LPSA 4ARZA 2B92A 3CPJB 1OXUA 3FPAA 1CJKC 3LO5A 4IFEA 4XD7D 4FI3C 2OBLA 2VSOA 4GZMA 1KGDA 2OBNA 4TQ9A 4WBSA 5HE9A 3T1QA 4B3FX 5GJBA 2FPLA 2REOA 4NZYA 4US1R 1NVXQ 1XZQA 3CWZA 4QXAA 1GKYA 4PQRA 4MUAA 5D3MA 2O0JA 4CEJA 2QY9A 1E2IA 1TAGA 4I99A 4LJAA 3TAHA 4C0BA 5IRCD 2V1UA 1KJZA 1AK2A 4CF7A 4MYHA 4CEHA 5FUVA 2ZXUA 1GNQA 1ZIPA 2G9NA 1U81A 1FP7A 1WRBA 521PA 5BW8A 4DCTA 2QROA 1J7KA 4GOJA 4FMBB 4TQUS 1L7VC 4D80A 2ZSBA 1VIAA 1KK3A 2ZREA 3VTKA 1IY1A 1G7SA 1N5KA 1K6MA 5J5CA 3UMFA 4AWXA 3OIYA 3T1VA 1FQKA 2QSZA 4NCIA 4DLRA 5IF9A 1W0JA 1T0HB 4CT4B 1OT3A 3QENA 5JWRA 4A2QA 2ONJA 2NPFA 4TYNA 3FFAA 4WW0A 4DRZA 1YQTA 3CH5A 1FZQA 1VG8A 5FI0B 2IS2A 3CX8A 3KUCA 2ZU0C 2IHBA 2ZI5A 5JFGA 4NL4H 1II8B 2RGAA 4KHZA 1WXQA 2A78A 4G5QA 1OSNA 1TU3A 1IN6A 3AP2A 5JCZA 1OW3B 1XJCA 1OKKA 4NYIR 5C18A 3GLIB 5FOTA 3Q8XB 3VR4A 4XJXA 5J47A 1NBMA 1U9IA 2YV5A 4HDQB 3KKOA 2F9MA 4JJZA 5K8IA 4B3DA 4AY2A 4A0RA 5UKDA 4Z8YA 1KOFA 5IK2D 1R8SA 1RYHA 4EAQA 4UJ5A 2LWIA 1BMFD 1G16A 4MUBA 5KUTA 1WB9A 4HB4A 2A5DA 3RNLA 2R65A 3AVOA 2AWOA 2XB2A 3K8YA 1ZCBA 1KTVA 4Q7MB 1T0JB 1X6VA 3KX2A 1FFHA 3ZJYA 4DKXA 4C0KA 2OCPA 3C15C 4DVGA 1ZNYA 1LNZA 2VP9A 1ZNZA 1YZUA 2VP5A 3DOEA 1Z06A 2QGNA 3WBJA 1RRGA 3E70C 2GJAA 3ZS8A 1CJMA 4MKGA 3T12A 1MRNA 1E9AA 1E69A 1JPJA 2IS4A 2R6CA 3UG7A 1G3UA 3FHOA 1EFRD 4ZDIA 4PAOA 1DAIA 4RCZA 3WMGA 2EFGA 4C0JA 1GSIA 2V9PA 5EE5B 3K0CA 3SBEA 2P0EA 4R98A 4ZCMA 5HZHA 4UNPA 3FOZA 1VYUA 3WRYC 2CHGA 1QHGA 3REGA 5HKKD 1IY2A 1TUEA 5FTNA 2W2XA 4BUJA 4F92B 2GEUA 5B2ZA 1OFIA 1A82A 2BM0A 4JLMA 1GRRA 1OKKD 4G5OA 1HH4A 4PHHA 1GFIA 1FPMA 3LWNA 4N3NA 2G88A 1G4UR 3BFXA 2GAAA 1F5NA 2C03A 1XEXA 4S2EA 4HLUA 5F2EA 4B76A 3VKGA 2ZRPA 3SYNA 3CRRA 3MAAC 2H16A 3H0KA 3TMKA 3AVXA 3REFA 1AGRA 1UADA 3A58B 5DHFA 1BMFA 1SHZA 1SULA 4Q00A 2J7KA 5GADl 1ZU5A 1UKEA 4D0GA 3HDTA 1XTKA 1FTNA 2VIIA 2O8BA 3K9NA 1ZRHA 3GEHA 1RJ9B 3OHMA 4EFLA 3EG5A 1M1YE 1NLFA 4E09A 4ZDKA 1IN5A 2RHDA 1UKVY 3FB4A 4UJ3A 5IHPA 4DLVA 4DDTA 3KQLA 3U44B 2ZRLA 4AYTA 4DWJA 2JDIA 4JJKA 4LHWA 2ZJBA 2EWVA 5BYKA 4HDCA 5B58C 4XTCS 3U7HB 2FGKA 2ZQ5A 2CE2X 2F43B 4OJKA 3GJ8A 1COWD 2WVJA 2CNWD 4BLQA 3N5CA 2D2FA 3WNBA 1JECA 4M1TA 1CJVC 4WXPA 1KAGA 3IQXA 4LWZA 4HAYA 1NI3A 1SXJD 2J46A 2X77A 1XP8A 2DPXA 1YR8A 2C99A 3GFPA 1ZBDA 4BZXA 1ZC4A 5CB8A 3KJHA 4BASA 2P6UA 5GJWC 4JYBA 4M4SA 1EFUA 3CF2A 5AUQA 3FVQA 4OHXA 5CM9C 1LY1A 2GA8A 2FFQA 4C0AC 5EP3A 5JWHA 4BRUA 2QPAA 2IYZA 4MGIR 2PJRA 3EW9A 4RFVA 3ZD7A 1CR4A 3BS4A 4OBEA 5SZJA 1KK2A 3KJEA 421PA 4TSFD 4DC9A 1QBKC 2ZJAA 3N2EA 3QI2A 2OT3B 1Z2CA 4WZBE 1KI9A 4NH0A 2QUZA 1GOTA 3LY5A 4V0KA 3FMOB 5FOVA 2NTYC 3SQWA 2JJ8A 3CONA 1Z0JA 1MO3A 2VSXA 4Z1MD 2O5VA 5IDVA 2YNMA 3QOFA 3WYFA 3BK7A 3HU3A 4C9BA 1G8YA 4YMVA 1RRCA 721PA 2FG5A 1XU4A 1E1RA 2ECKA 1Z0FA 5FUXA 3RS0A 1TUIA 1G1MA 1EK0A 4DEYA 2PL3A 4ZKEA 1GUAA 4O2RA 4W5HA 4MKFA 2WSSD 4P31A 4LBWA 4C7OA 2ZTSA 5D3QA 1S4QA 1S8FA 3ETLA 4Q1FA 1D8TA 4HLUC 1E9CA 4W5JA 3HPQA 4LHVA 4C2UA 4URWR 1B23P 2AX4A 2BV3A 2OLKA 1TPZA 3PEUA 1FUUA 2FOLA 2HUPA 1SKYE 4TMKA 5JMTA 4LCBA 2WTUA 2Z4RA 2UVQA 2ZRGA 3CZQA 1JPNA 4TT3A 4DDVA 2PCJA 3OE7D 1KMQA 1M7GA 3RRYA 1F2UA 1UEIA 2C96A 1VTKA 3SI7A 1VHLA 3MWKA 3RLFA 5HE8A 2D3WA 2EW1A 2Y8EA 4RCYA 2BMJA 1VMAA 4NHOA 5DN6A 3U3JA 2XXAB 3WMFA 4NMMA 2QT0A 4WVFA 2ORVA 3PXGA 4LRWA 5JHGB 3TW8B 3BB1A 4DCNA 1PLLA 2ZR7A 1LW7A 4TMXA 3K1JA 4JLPA 1GM5A 4BFSA 2E9SA 2EVWX 4BFWA 1F3OA 5AK0A 5JI2E 4QM7A 1W0KA 4CIDA 1UDWA 3IPXA 1IONA 4RSGA 621PA 2CL7X 1NN1A 5CK5A 3H86A 4TMWA 3AH8A 1KMHB 4KJZA 2BBTA 5KDOA 2A3RA 1G19A 4L16A 3B13B 5TVKA 1SHKA 1U8AA 2ZSEA 1H8HD 2RGXA 2GF0A 2UKDA 2ZSAA 1K5GA 4G5RA 1E9EA 5EP2A 2HF8A 4V02A 5EUMA 5FBQB 2V3CC 5CDFA 1XJ0A 3RSLA 4E22A 3B1VA 3KQNA 3CW2A 1S2MA 3NTUA 4IXMA 1XD8A 4OQFA 4WIAA 5G3YA 3Q85A 4ITRC 1CS4C 2IYUA 4EJSA 5JSZA 2J0SA 4PAMA 4LC0A 3BH7A 2BKEA 3NWJA 4JLJA 3HYRA 2Q3MA 3L0SA 5L3RA 4MGKR 2PT5A 3HR7A 3VAAA 5AWFC 2ZSFA 1OB5A 4X8OA 5LD2B 1KI7A 3BC1A 4MITA 2OAQ1 2XNDA 3M6AA 3BAFA 5FBWB 2IBMA 4MGYR 4QBGB 5BXQC 4A2WA 2PX3A 1TF7A 3PG5A 3L8ZA 1NSFA 3DO6A 3VU9A 3OEHA 5KU1A 3THOA 2JA1A 4L15A 3ZDQA 3CH4B 4CZ2A 1UM8A 3RS7A 5GJCA 3B60A 3LRPA 1ZMXA 1SXJB 2V6IA 1GG2A 2YOFA 4JVMA 1YZKA 2ZYWX 3K0EA 1G8GA 4KLZA 2HJGA 3QXSA 1N6RA 5DHAA 4MKIA 4OHZA 3THWB 3NBYC 4QGGA 4HYYA 5CJ2A 2QEQA 3X1WA 1ZUIA 2JLVA 3U3OA 3S1AA 4IVRA 1QHSA 4B71A 1OXSC 4HUTA 4FMCB 4Q4LA 3GLHA 1QZXA 1QDEA 3LD9A 1XMIA 2IF2A 2UZ3A 2ZETA 4M1KA 4B2IA 2P65A 3SJCA 2NIPA 2ZANA 2VTKA 1KK0A 1RVDA 2AHOA 4AURA 2ZE7A 4Y0AA 1G8FA 3WMEA 1Z6TA 1XPUA 3CO5A 4D2IA 1Q1ZA 4US2R 4L4UA 4BZQA 2HCBA 2H1LA 4ON9A 1ZD8A 1SXJC 4JBXA 3FFBA 2H18A 1G6HA 1ZNWA 3I62A 1EESA
chains in the Genus database with same CATH superfamily
2RGUA 4NONA 5EXSA 4HMPA 1GUFA 2EFDB 3WP0A 5FR1A 3Q5DA 4Y6PA 5FOXA 5TSDA 1C0LA 1KVSA 2V7BA 3E61A 1DKOA 1O97D 3MN1A 4EYEA 1S2GA 3SHWA 1RXIA 5K0SA 4Q4AB 4Q48A 3C7DB 1SB8A 3AJRA 5B7GA 5EMMA 4TLEA 2ASVA 4CKEA 1GITA 4LJSA 5JJLA 2P9GA 3I1IA 4KSBA 1KH3A 1NUTA 1RWKA 1IEWA 2BE7A 1TQ6A 1BEEA 5DXJA 2G83A 1DV2A 2WP0A 3KHSA 4R7GA 4BV8A 3ZCTA 1NU6A 2J09A 2UYOA 4GYJA 4ND5A 4II2A 4PVCA 4R2LA 2VNJA 4D9IA 4JJEA 5F1KA 1U28C 5IDWA 2R1VB 4RACA 3W4KA 2NSDA 4WN9B 2LKCA 3OLQA 4KMRA 2C9CA 1BWQA 4GKAA 4H59A 1Q15A 2NZWA 3H8VA 2P5YA 1NQWA 4ZT7A 3SR3A 4MEAA 3FHJA 1JWBB 4LXIA 2A0WA 4FOOA 4H77A 2VNKA 1W96A 2ECFA 3BJIC 3A1EA 4KUGA 2FK7A 3D3EA 4TL7A 4NK4A 3AFHA 1T43A 1ZK2A 3ABZA 1QIEA 2VDWA 3A05A 3IKLA 3KZVA 3K9BA 3A36A 3JCZA 4P4LA 5EZ5A 1SQGA 2FN9A 2CYCA 3FGOA 3AO0B 1KYVA 3FJYA 4JBYA 1PL8A 1W5AA 4U4AA 5E7MA 2O8BB 4D81A 5J1TB 1R9MA 4J2OA 4IUDS 3TH5A 2P9FA 1UBGA 3FTCA 2A5FA 3O8NA 3KWFA 4CKZA 3LT0A 1L3CA 3GCWA 1USVA 3JRWA 4LXHA 5E4JA 5BMVF 3T1OA 2SHKA 3FF4A 4HEJA 1RI4A 3CZRA 2A2ZA 2VEDA 5EE3A 5AJYA 4F3RA 4KDRA 1TLTA 5ALXA 4NATA 1GZSA 4ETNA 1IZ9A 3LQQA 1J8YF 3NI2A 4W8OA 3UAXA 1BEUB 4F9GA 2A3NA 4KREA 1KSGA 2H51A 1W48A 2OAGA 4IIFA 4M22A 3SYMA 3F7TA 1H0HA 1CZRA 3LZDA 4GPZA 2AZ4A 2FX2A 3ONDA 4W1RA 4YIKA 3EXG1 2VJDA 1YBMA 3DLPX 3AL0C 1J1IA 4O2AF 1A8UA 2QZJA 4POAA 1GPH1 4WX2B 2KJQA 2CUKA 2Z95A 3KS9A 2IP1A 5E6RA 3OEEA 3GJXC 1LRKA 3R24A 1CF2O 3HKBA 4LOHA 2H11A 4RMJA 3WK9A 2QJWA 2IXTA 4PZUA 4N76A 3EXFA 4OHBA 2OV2A 4PSCA 1QX4A 2I99A 4TV8A 5KYKA 4JOBA 3EDCA 3PA8A 1NYRA 4YRCA 4AY4A 2FZVA 2IP2A 4WRRA 4PHTA 4WFQA 1OF1A 1A3CA 3HV0A 3CBQA 1GUDA 2CL0X 2IFTA 4UEOA 1PNRA 4HNUA 3TW8A 3AOGA 5AQEA 4DGQA 1U4OA 3TS1A 2B4YA 3IA2A 1KYYA 1QVAA 1OBVA 3Q3VA 4LKOA 4JLVA 1SUBA 1LVGA 5JNWA 3KXIA 5H80A 2ZBQA 1FTSA 3OWXA 1P0FA 2AFRA 2GSDA 1OAOA 3B6EA 3HGTA 2IE0A 2ZRJA 1LS1A 3P96A 2OYSA 4W9MC 5A9SA 1JFRA 2FKAA 2ZBPA 3COPA 3GRPA 2WIFA 1VG9B 4BMPB 1KVRA 2R00A 4KQEA 1CUZA 2X76A 4D1YA 2PU5A 3HDVA 3BK1A 4UUQA 2E21A 2H7XA 2ZQZA 5ELMA 1EP2B 1F8UA 1U3UA 4YI3A 3Q2IA 2FWBA 1VIMA 3AP1A 1KYXA 4ZV7A 1G5PA 4EO9A 3L1UA 4QM6A 3C7KA 3FYHA 5FP0A 5C52B 2PLNA 3WLIA 3B5IA 3PWKA 2FQXA 5AO9A 2YN0A 4WOKA 5ARCA 3CUEF 2MDTA 3JXEA 3K5HA 4FX5A 2GJSA 4U7DA 1L2TA 4QHTA 3PXUA 2C7BA 2P9JA 1E7YA 4OL0A 1DAGA 5JZVA 3DZDA 3MINB 4OYYA 5TS2A 2DQ4A 4Z4CA 5FNVF 1U7ZA 4HYTA 3DLCA 3JYQA 1OROA 2QAJA 3OTQA 1CUFA 4LC9A 1J2RA 4TZKA 3ESCA 4CF4A 4M1YA 4G86A 2EZ8A 3P2EA 2RGCA 2NO1A 4ZT6A 1V11B 5FPQA 4GKBA 5H0IA 3NUQA 3NKLA 3PGJA 3RASA 3VAZA 1BGWA 1E5VA 1DWUA 3PQEA 3NT2A 4JUAA 1TKBA 4MRSA 4PXYA 1TPYA 4Q3CA 1SFRA 2DXIA 4G0UA 1AXRA 1DIOB 3L7YA 5EMJA 2YKGA 4ZTZB 5GVSA 4TYMA 4RZIA 5A0FA 2ZBDA 1WZEA 4PFSA 3G1WA 4L9WA 3RC9A 1N6NA 4I36A 5JAPA 1ZGGA 1FEZA 1LLCA 4E5UA 2V59A 4CBVA 4RETA 2P1RA 2PZKA 3B12A 3RVMA 4DLBA 4B34A 1S8OA 4BX3A 2JEZA 2A0KA 3F3YA 1EJ0A 4ZMBA 1WNTA 1W0KD 3E6AA 3O8OB 1F8XA 3DAHA 3LLSA 1T4MA 2ERXA 1L3BA 5C8YB 4NSNA 1ATIA 3JS5A 2EU8A 1WXFA 1DQZA 3RYIB 2JGMA 4TQAA 2GYWA 4YDHB 1XR3A 5BR8B 4BIIA 4LXGA 5EWLB 4PG8A 4V0MA 1AB5A 2N46A 3UTDA 1H8HA 4N49A 3C24A 3MB5A 4E5YA 5K05A 1XVLA 1ATZA 13PKA 4EATA 2L18A 4EYGA 2PL1A 2Q2OA 3R3ZA 4NULA 1PR9A 1EFKA 4P2BA 4XEHA 3TFWA 2FH5B 5TARA 1PS8A 5KIAA 2AFHB 3G9ZA 2PN1A 2PYZA 3ET5A 4EUEA 1HQKA 3KAKA 1H1DA 4DSOA 2QI9C 5EZQA 1PJLA 1RKUA 4B48A 4Y2RA 1GKUB 1Y4SA 4IKPA 4OREX 2FFAA 3WGHA 3FWZA 4D0LB 4XYGA 2WJWA 2AMLA 5KTYA 5KQGA 1U8FO 1VGRA 4BEVA 1PNOA 1JU3A 4GC5A 2IU3A 4HDKB 1CUEA 1K9VF 4PYIA 1RKXA 1PR5A 4QUKA 4RL4A 3V4SA 1TQ4A 3UJAA 3WLTA 1YV9A 3EZ2A 1G5RA 4A3SA 3CUKA 4I9GA 3IVGA 2Z08A 1E8DA 3B6ZA 4R41A 1Z25A 1R5JA 1GFSA 1EUCB 2FTKE 2AZDA 3WJAA 3QH4A 2P9CA 4K9OA 4OGWA 2PUFA 2P5SA 3EMVA 3GF4A 3IJRA 4J0EA 2A1UA 4AZTA 4JJIA 5JXWA 3VGPA 5REQA 2LDBA 1YAHA 2ZYVX 4Y0VA 4OJTA 2IQ5A 3DPSA 3F47A 2VNAA 4PBTA 2OHJA 4IMJB 3K6SA 4EFKA 2QORA 2QRHA 3L7JA 3MSXA 1SBQA 1L7XA 3OQ6A 3QE2A 4P33A 5IN5A 3U7IA 3OEHD 4ZV4A 3R20A 5BN4A 5DEOA 4I9NA 3ZLJA 5H82A 2BHNA 1A8QA 3FOCA 4JH0A 4G0QA 4EARA 5K8VA 2JVJA 3UJNA 5FPPA 1SELA 4NV1A 2IZ6A 1HDEA 2YVAA 4KITB 3TBFA 5KB3A 1NR5A 3KJIA 8ABPA 4JLSA 2ZIXA 2JD2A 4KL8S 4O4JF 2EW2A 4C0QC 4LX0A 2P0YA 1IN8A 5DH9A 4AX8A 1GARA 2RCYA 3ET4A 3A1SA 1W4AA 4YV0A 1ZJJA 5JO9A 4D9GA 3JR7A 3NKVA 1QUEA 2QGFA 2W6ID 4QDUA 2M6LA 3B1ZA 1F14A 3IP3A 3KTDA 4LZLA 1OWPA 2B30A 3EVTA 5T3UA 1SVNA 2PFGA 5KDLA 1W88A 4A91A 3JVVA 4GUAA 5FPYA 3S70A 3HJBA 4JITA 3IVAA 1YRBA 4TMZA 4MWSA 3RVKA 5JD6A 2QVGA 1NVUQ 3RUHA 1EQAA 4G26A 3VR5A 4F2HA 1FS4A 3GUHA 4OBWA 5BSWA 1AGNA 1N2XA 4QREA 4X63A 2FOIA 2VPPA 1VBKA 4KXNA 2X9QA 4DB2A 1U65A 3U4CA 2HU5A 1XPJA 2X9LA 3IURA 2G63A 3O1IC 2HA6A 2WZBA 4PC2A 4E3ZA 1CUSA 2DRIA 1RRMA 2VPIA 2W2LA 3RWOA 1Q16A 1ISGA 2F1KA 2VHXA 2FP4A 4OGLA 1TO2E 2X4LA 4ZRDA 4AK9A 1PEDA 4FN5A 1T2UA 2R9VA 4J0HA 4DLUA 2GNOA 4OH7A 3DDCA 3KBOA 1PJAA 4J0DA 1R0YA 4BO5A 1XDWA 2XCLA 3GT0A 3BFKA 3MLEA 5L51A 1U8YA 3NATA 3H11A 4MUJA 4QYSA 4A2CA 4M9XA 1OLOA 1OLSA 3BD9A 4HDNA 4PHGA 3R9XB 2XMPA 5C8VA 1Q12A 4KK4A 1X1EA 2NQ8A 3KETA 2XUAA 3BCUA 1QGUB 2ADMA 5J2TF 3IUYA 4ZP1A 3KR1A 1C7ZA 1ZIXA 5CDGA 3PPVA 2YOGA 1T2DA 2QE7D 3WRYA 4E5DA 1D5CA 5BQ3A 1U8TA 1FNSA 2FUKA 4M53A 4R1UA 1Y8ZA 1TT7A 4IWXA 3P2IA 3UMCA 3ST7A 5HQ3B 3HNPA 3KB1A 4BVFA 2ZPAA 3KEOA 1S7CA 1EWYA 2XE8A 2YMPA 3HY6A 2GN9A 3S5JA 4IS2A 5HIAA 3DHEA 1R15A 5GVRA 1UEXC 2IS6A 2NO6A 2G9ZA 4OB7A 4OLFA 5CX1B 2BIFA 3V1MA 4KHPB 4FYVA 4JT2A 2I4IA 1WKBA 2LGJA 2WSYB 2ZRHA 4LOLA 4W6ZA 2O1SA 5KAMA 2BI8A 2G67A 1DMRA 4CDRA 1ZM2A 2NYUA 2UXDB 4V3CA 2C1ZA 2HJHA 2YNMC 1T13A 1ONBA 1O6GA 2ODBA 3H4TA 4XB2A 3SZUA 1KRWA 1RD4A 3BXPA 5TQVA 1XWWA 1MZPA 6Q21A 4XVCA 1QYRA 3A4VA 3RSGA 2BGMA 4LY9A 3TJMA 2V4UA 5HBGA 3FW1A 2O3TA 4C01A 2FKNA 4G07A 3OCZA 1JUDA 3L0YA 4V2IA 4X60A 3VR6D 2XKKA 3KYCB 2WJZB 4XSGA 1T1EA 3GYGA 1N8KA 3JASB 1X9GA 1FLAA 4B2YA 1KMIY 1NOIA 1C7JA 3MFYA 4UREA 3R8CA 2RE8A 3EIQA 4HDRA 4UCFA 2GJ9A 3MWYW 1H2WA 1WXHA 4YAOA 1DWOA 1NNI1 5FORA 3UM9A 3ZNPA 4F5WA 5EJ6A 3HDHA 2C9YA 4INZA 1EWKA 4N39A 4U2KA 3ZWAA 4B5KA 3SHQA 2YXLA 2D2EA 2JI8A 3FOFC 5A9TA 2BFAA 1DAFA 2NUTB 3EISA 3ZBTA 2HTFA 2FPXA 2VN8A 3ZHXA 4YR7A 2ZBGA 1A71A 2H2WA 1E2DA 2CF5A 2ZUUA 2CFCA 4XIGS 1FVOA 2YFQA 3ADPA 1H93A 3ORRA 3U19A 3IP7A 1DMSA 2GCPA 2JJ1D 3IOYA 3VC7A 3SGLA 4EO4A 4BQSA 1NW8A 4QQRA 5FH9A 5FJJA 5H7XA 4JB0A 2YS6A 1WCIB 5EXXA 4WKNA 2NTEA 4X6XA 1NASA 2JLYA 5CLHA 1FQJA 4FBLA 2YYSA 4X3CA 2H48A 4X64B 1W30A 3DMFA 4D9JA 5HFAA 4RMNA 4MS3B 4BC1A 5K0BA 2WLTA 4EABA 1QGAA 2FR8A 4ZAWA 3M5WA 4LJ5A 3W5AA 3AM1A 1DIBA 3RKSA 3PDIB 3AF5A 3EFHA 4GR5A 4R40A 1DCKA 2R8ZA 3T1HB 5LOVA 2BGGA 3TIFA 4N8SA 1G38A 3E5MA 2QLLA 3K3PA 1ZH8A 4EDFA 1FSGA 5C4MA 2O8EA 5JYBA 2ZRQA 1DELA 2RGDA 2FMFA 2XR1A 2A30A 4KACA 1EX6A 3JQ7B 4TS9A 3LS2A 3C8HA 2ORIA 4YXWD 3I32A 4F71A 3REQB 3ASYA 1PBNA 1YMVA 1K5DA 3EJWA 4IS3A 4FDVA 2WHEA 4DREA 4M1MA 2WYWA 5H5JA 3DAPA 3A6GA 3O26A 4BQQA 1RHMA 4X84A 3RJ9A 5T4FA 4TXMA 3G1UA 2V45A 4LF4B 2YWRA 2EEZA 1WR8A 1KMCA 5A1JA 4DNOA 3EGXA 5JSFA 1BHSA 4FWIB 5I7FA 4BNUA 2VRBA 1JEYB 2AEFA 2CDBA 3DMYA 3R3JA 3ANLA 4F38A 3NH9A 4H1UA 3THXB 1GGHA 2FW6A 4P22A 2IIQA 3AMVA 5BSTA 2GN8A 5DU2A 5MF6A 2W4MA 3C3DA 5LZ8A 2MYPA 3MJSA 3W8DA 3RVOA 2MWMA 3TLZA 4F4FA 5H83A 4R8VA 2PGDA 4GOXA 2HU2A 3HL0A 1JQBA 2Z8ZA 3WK6A 2GFHA 1Q77A 4M8IA 5MN6A 1WHTB 5HP4A 2O7RA 1TF5A 3EDRA 1JQLB 3RSQA 4EA7A 1AZTA 2C4UA 1G5TA 2Y1EA 3HA5A 2DBZA 3ANSA 4HGOA 1ENPA 2FNAA 3KZCA 2HW8A 4Y7CA 4REOA 2E4ZA 2VBCA 1VG0B 1KKLA 1YZLA 2W2OA 4TX1A 1WEHA 3CIOA 4ZFNA 4OXRA 2XMGA 1YFJA 1H3NA 1VKOA 5KTOA 4QHYA 3F67A 1RPZA 1GQFA 1C9YA 2Q9UA 3EODA 2I8LA 3ADKA 3VX4A 4CV1A 2JFVA 3M34A 4K0RA 4B3BA 4UHHA 3GJSA 4HWOA 3DJFA 2OMKA 5DZSA 5HMLA 1C9EA 1XTSA 1M2VA 2QD5A 4L9AA 4NOJA 4INAA 3VR2D 2P5TB 5I8PA 2A7XA 3DCNA 4C20A 1K88A 3TQIA 3JQDA 3JWIA 1H65A 1X9HA 4M3NA 1YHNA 4DY4A 4YVFA 3AVVA 4NJEA 5E3IA 1HWYA 1IVYA 5GM1A 3VJRA 4TTSA 3W3AD 2IZ1A 1NPYA 2GEVA 3QXXA 4Q19A 4DYHA 3GLGE 1QDLB 1ZEMA 2DHRA 1Y3DE 2D2VA 1AHHA 5LDDC 5JCPA 2I6TA 1K7YA 3I05A 4JMPA 4JK3A 4BMZA 1JH9A 1NF8A 2P9QA 3JQEA 3KHUA 3N2GB 2M6SA 4U02A 3LBYA 4WNCA 5ADWA 2F48A 3NAMA 4L4ZA 5SYMA 4AO8A 2H2IA 1SOMA 3R8FA 2G17A 3B7WA 1Y4ZA 4HQNA 2QJRA 5FWNA 5JASA 2PKWA 2WV9A 1SPBS 2R00C 2DUUA 4YONB 1GCUA 2Q9CA 3MCTA 2VYQA 3HSKA 4NENA 3THXA 5LC1A 2JCBA 1YRHA 1PUJA 1WMDA 1YC2A 3QUTA 5C32A 1H2FA 5EIWA 3NLLA 3SHOA 2E4XA 3D4OA 4M2LA 1CERA 3ITDA 4IJVA 1UDBA 3LM8A 3ZDDA 4Q3AA 2AI1A 2EFCB 3LBFA 3CF0A 4I50F 4M0FA 3PFBA 4MQEA 2AJDA 2QTBA 1LDEA 4GEKA 1BVUA 1MOZA 3HBNA 2OZLA 4TQGA 4IINA 3IEXA 4IWNA 5E6RB 2XZLA 2J9ZB 3PITA 2EX0A 4LYAA 2GZDA 2QXTA 2XA9A 2IYNA 3Q0EA 3RAEC 4QA9A 3KELA 2J3HA 4LZPA 1EUDB 2RGBA 5FTMA 4KPYA 4MPDA 3OQVA 3NBAA 4QDXA 4C7XA 4Q47A 4FIDA 1U3FA 4NP6A 5LYJF 3AHEA 1LVUA 1O3YA 2YYAA 3AILA 3CVVA 3U4QA 4YMHA 1QQ7A 1H3EA 1HETA 3VKVA 2IOYA 1Y80A 2Q9BA 1M9NA 3CZAA 4NZOA 4ZOLF 2RK3A 2Y1DA 4IW3B 4M89A 3LK7A 5AW0A 4DMMA 3ZJTA 1YQDA 5JARA 5KYXA 4WTOA 1KO7A 3LUKA 1Z4QA 2XTJA 5EE0A 4YRPA 1P1JA 2BE9A 3WKAA 1NBMD 2L0XA 2PKRA 3IAS1 4KIFA 2F62A 3MELA 2RH8A 5KTRA 1DEXA 3ASVA 3VC3A 5ADUS 1LDMA 4J3JA 4CG0A 1CUWA 4E32A 2GYVA 5KSZA 3EF3A 4CLRA 4NIMA 4LBZA 4XDZA 3WNDA 4ALLA 3L93A 4DQDA 5IANA 1OLXA 1NM5C 1W1WA 1Y34E 3IEPA 1SNYA 2ZYSA 2GAFA 3T6KA 4CKXA 1EVJA 1M54A 5IVPA 4K1XA 4GRAA 1CU1A 2BKLA 3J81A 4JUIA 3ZY3A 3O93A 4PIMA 2XNHA 5SY6A 1SVMA 2JFHA 2KW5A 3E9NA 3ONNA 3ROKA 5ICMA 1SURA 6PFKA 2BHRA 1HDOA 1AA9A 1JNXX 2DAPA 4AC9A 5AM2A 2JA2A 3NT5A 1PQPA 1JNYA 1NUUA 3ICEA 1M5UA 3FKSA 2VHZA 1Z35A 2ROQA 3WO0A 1M1YB 4HN2A 4QOEA 2GEBA 1KR2A 1VL1A 2QJTA 2W6PA 4KAFA 2OFPA 4ZAVA 1X77A 4G89A 4OV6B 5A05A 4DQKA 4G5YA 3KT6A 5EJEA 1YKFA 3LJKA 3TO5A 4HAIA 2Q7OE 4BL5A 4CODB 4GD3Q 4IG4A 1YTLA 1XV5A 3RFXA 3WYEA 1CZUA 1ORDA 4RHUA 1KY2A 2FSGA 4PY2A 2XX3A 4HWRA 1ICIA 1LXCA 1WCXA 1Z8NA 2QT1A 3NNDA 1L5GB 3TLEA 1RYZA 4AMUA 2Z1NA 1ZYUA 4A2PA 4Y2QA 4WJZA 1Q7TA 2H9YA 4DN6A 1L5SA 3ZTYA 4DEVA 1JN0A 3T7TA 1IBSA 3WGLA 5I9LA 5A9RA 4BN5A 1VRCA 1W59A 3P5BA 1H5UA 1LPBB 3HHEA 4E13A 4BGIA 1X92A 5TDHA 2CLFB 4B8YA 2PZBA 3E1GA 4UD2A 2J3LA 4OJYA 1PT6A 1Y1RA 2GD1O 1NJ8A 2ZTMA 4GLBA 3HCFA 1E98A 4AN0A 1JDUA 1P2UA 4O4LB 1CP2A 1U1FA 4RGQA 2JATA 3FG9A 4WUVA 4X7RA 1FYFA 3BHJA 3CRMA 4XX0A 2QL6A 4A1OA 1H69A 2OGWA 1AQ6A 1RQNA 2L19A 1WMBA 3E4CA 4G5HA 1Q3TA 1CQJA 8AT1A 5ED4A 1Z4NA 2GHRA 4U9UA 2I3BA 2NUBA 1I7NA 5H3LA 3S2IA 3COVA 1I94B 2AK2A 2I34A 3O9VA 4EJSC 2WJYA 1KJJA 4YT4A 1BWRA 2ONCA 3LQ4A 1O97C 5HFNA 2BFFB 1XCPA 4YP1A 3C6MA 3DHWC 1IB6A 5AM4A 2HMAA 4WASA 3M9XA 2C5LA 2XTAA 4REQB 1BA3A 3Q6MA 1M74A 2CV0A 1FVHA 1FCJA 1UBFA 1MAVA 1DO0A 2MHCA 3BQ9A 3E5HA 1S1CA 4M8LA 4UDOA 1BG6A 4KO8A 3CRQA 3F9CA 4V0SA 4WZZA 1QFJA 1ORVA 1IWPB 2HLNA 2OMEA 4F06A 2NUPA 3AUJB 2TYSB 4CGYA 1VGVA 2GN4A 1QAOA 1COWA 2A9VA 3M70A 2CNWA 2OL4A 4IJ5A 4P35A 4AUEA 2VRWA 2GSWA 4UBOA 2DCUA 5U9CA 2ZT6A 4B3SB 1EHYA 2EDAA 3EVBA 2HNBA 1SBNE 2VUSA 3LQRA 3P4XA 1ISSA 1IWBB 2P2DA 2CCGA 3U4DA 4OPMA 1VJ5A 1I7LA 2XUOA 1KI6B 3TRKA 2H0QA 2YC4C 2HFKA 4QXRA 4H7EA 5BUZA 3ULKA 3DHVA 3GJ3A 3KALA 3BORA 4DILA 1X80A 3D0OA 2RJNA 5A1TA 1JB1A 2HNAA 1DOAA 4I4TB 2G0NA 3AYXB 3INYA 4FFLA 2WJ6A 4DWVA 5KNCD 4UNQA 4F46A 2QUHA 4MVJD 5IC4A 3ELUA 5J3JA 4AULA 2J3KA 1V5GA 2JVKA 4HAOA 4NEQA 5EIFA 2FK8A 3C3AA 3C3CA 4M8SA 4B35A 2QRPA 1R0ZA 3O7MA 1P81A 1RZVA 5I48A 3PDJA 3V42A 4TXJA 1T10A 3PUWA 3TR5A 5AT1A 3FSRA 1YQGA 4TWAA 4FHZA 1XE3A 2J6BA 4W5OA 2ZUCA 1FXUA 4J94A 2D2XA 2LVBA 1X8LA 2QQEA 1E8MA 3O84A 1X7WB 4B3RB 4F9EA 1F2VA 5EINA 4RY8A 3BIOA 1TYBE 4CEHB 4HXGA 1GG5A 1KP9A 1UDCA 2PLWA 2RK6A 4IQ4A 2B61A 4E3WA 3EZ9A 1KQOA 1WF6A 3MMSA 1K8XB 4K05A 3LCJA 3KTOA 5BVGB 2ISSD 4FGUA 2H06A 1SBIA 3H9EO 3EEBA 1L7PA 2AOUA 3SMQA 4Q02A 1RPJA 1EP1B 2Z8YA 5K09A 1OTHA 3KSZO 2P67A 4WAUA 3AWDA 1D09A 4TT3D 2IPMA 1Q11A 4IHQA 3WGMA 3SS9X 1QCYA 1NKSA 2RGGA 2C61A 1SVOA 3LX5A 4XE5A 3T7KA 1W5TA 3LHIA 4GMFA 4PYJA 3W8RA 1DKNA 1RPAA 1E9FA 1RJGA 5BSVA 2XCQA 4HWKA 2I1QA 3MAJA 3TE6A 1J8QA 4PEVA 2G3YA 4YO7A 4MUKA 3CEJA 4V0OA 3V2UA 4IH4A 4YMSA 3P20A 5GGXA 4CM7A 5C1OA 4ESEA 1R8QA 3LRTA 2P77A 4QJ5A 3PEEA 3TI9A 3C5WP 3RSSA 5C8XA 5C37A 1ISFA 2NVUA 5D3MB 3GDWA 2WT4A 1F1BA 4PX5A 1FJGB 1XZGA 3IE2A 3ICQB 2I2BA 1KPIA 3GRRA 1LPAB 2H4JA 2OK8A 1LUAA 1KOJA 2QM8A 3AY0A 4QWWA 4TS4A 4WOBA 1ZI6A 3TXYA 2QSUA 3E05A 4I5GA 4X41A 4KODA 3ZHRA 2XTNA 1YJ5A 4E03A 1LDGA 4JASB 3GFVA 1P33A 3RS4A 4RTQA 5EQTA 4D4LA 5LMNB 5BV8A 4RIFA 5LNK6 1BJKA 2ORED 5J4YA 1ZS9A 2ATXA 4N5HX 3T0GA 3HG7A 2ZRDA 1E7SA 3DB1A 3GRZA 3P2YA 5BOSB 1B8PA 4MRMA 2UXBB 1BWSA 2Q3JA 4FFNA 1E2FA 3PUIA 2Q3DA 1KAHA 2WHYA 3O4IA 3CMCO 4HPWA 1YF3A 4J43A 4Q0MA 1CUIA 4P6VF 1Z5ZA 1CQIB 3AUTA 3PQCA 1OX6A 1U8EA 1P9NA 5JPCA 3PFNA 4QPCA 1H4TA 4Q1VA 2CHQA 5EP4A 5A7HA 2V5VA 1K27A 2NU8A 4XVRA 2WWYA 5CYFA 2F1JA 1A5SB 4OP1A 2QZ4A 4TL8A 4MS4A 4EPYA 5ALJA 2XDQA 1EXMA 3GP5A 5P21A 1N6LA 3COJA 3PTZA 4DLSA 4K9LA 4HTFB 4ZCQA 4FD3A 5C1PA 2J4DA 2Y9PB 2YXDA 2A4MA 2OHIA 2YTZA 3ED5A 4I5EA 2YV4A 4R05A 3CZ4A 4FFPA 4W7SA 5ICFA 4BLPA 1N9KA 3DBRB 3TOSA 2VJCA 8LDHA 2JFXA 1FMJA 1XMQB 4COOA 4L5AA 3RV4A 3H5OA 2J9XB 5AK5A 1WB4A 2B1JA 3A7EA 3NONA 1BS9A 3CX6A 2DR3A 2OSBA 5DBIA 1ID8A 4QT4A 3PQ8A 4M0CA 4R01A 2W2QA 4BQPA 1UCFA 4X0EA 2VSQA 3FTPA 4NCJA 3GB9A 3MXTA 5IJAA 2C9MA 5I9BA 3PQDA 4BFUA 2PK3A 4M8NE 4QDJA 3AEXA 3KCQA 4QWMA 4RENA 5JW6A 3R4CA 1FZTA 3CR8A 3VSDA 3RE1A 1TQ8A 2Z6QA 4WNIA 2HU8A 2WSMA 1YVDA 1G8MA 1SVSA 3KDPA 1BE8A 5JJ5A 3KDAA 2YW9A 1M5TA 2G1JA 2LKDA 4R0MA 1U63A 5TMBA 3C5CA 2IE8A 1DTWB 1MV8A 5A4FS 5BV2P 3CVYA 3V4LA 3ZXUB 1EI9A 1TEXA 3MXOA 1QVZA 3PV0A 3AVWA 1P6XA 3ZNQA 2F4VB 4B81A 3LDGA 1NLUA 3ROGA 1K9SA 1PR1A 1RACA 3OA2A 1E7MA 4P36A 1MLDA 1C1DA 1YS7A 2QRVB 5G0SA 3S2YA 2RGNA 1T5HX 4QBIA 4AJJA 4C1NA 4TKVB 4CKBA 1WMAA 1PP4A 1C29B 3SJAA 3TZQA 1WHTA 1YE8A 3BXFA 5KVVA 1CZNA 1WEKA 1J2EA 1EH5A 4RLHA 4JOQA 5E8RA 2X1VA 3O03A 2P6NA 2ANBA 2XVZA 3B48A 1ZN8A 5D85A 4ENUA 2HLHA 3IYLW 4K86A 1K1EA 4GMKA 3EARA 4GWGA 1WSBA 2QAGA 3DYVA 4KB5A 4MOWA 5JLJA 2DWCA 5LQNA 4S12A 3SX4A 2ADFA 4QPJC 1NLZA 3OFSA 5C3UA 4B80A 3NJ4A 4Q9AA 4AW9A 4JSRA 2ZWPA 3SP1A 4ZO4A 2EBHX 2A92A 4OXKA 2C2YA 4O8CA 1WP4A 5BNWA 4J0CA 4A6DA 3BEOA 3DAYA 3EXFB 4HO1X 2O8VA 3IXLA 4Q3KA 4IOLA 3S1AB 1FP4A 3JARB 5ICSA 3GT3A 1GQYA 2W0MA 2ZYHA 4O2AB 1BS1A 1FE8A 4XQ0A 3SVTA 1MRSA 4RXTA 3GPIA 1TD1A 1XQVA 4FIZA 4JBHA 1TJ4A 1J7JA 5BO5A 4UE6A 3UY4A 1M5RA 3ZJVA 1A8HA 1DGQA 2XB8A 1D2NA 5TF0A 3S2ZA 3MIZA 4ERNA 1DAEA 2H3HA 3E9DA 1EMDA 1N4DA 2COEA 1ZK4A 2EFHB 1GGFA 1NNLA 2JCXA 1YB6A 3NTOA 3OIVA 1AUOA 1DQPA 3FPLA 1NM5A 3VPXA 5K8CA 1EFCA 1NAHA 4C6TB 1EG2A 3FDIA 1C7EA 3QUSA 2BMEA 1XYGA 3PUKA 4Q5IA 4EKEA 1U0BB 1R00A 3SCZA 1OC2A 1JW9B 4UEWA 3LGSA 1FL9A 1JWAB 3TCKA 2PM8A 5C9ZA 1K66A 3Q15C 4MROA 4X66B 2FHPA 5ESRA 4PXSA 5BRJA 5LWHA 2C59A 1SEPA 1AO3A 2JJYA 2BD0A 2VDMB 4L2IB 3O6VA 4D6YA 2YX1A 2NZXA 4PNPA 1AUVA 1UKYA 1XCBA 3CE6A 4BJ3A 1B73A 2XNDD 4BTEA 2GVZC 3OPNA 4DBVO 1V1RB 1G21E 1SKBA 1IPFA 1YOBA 4I6GA 2OO5C 3ETDA 1OV6A 4UTZA 4LISA 1PYOA 1V9LA 4PAWA 1JB9A 4N0MA 1OX4B 1WUYA 2O2EA 3A28A 3L07A 4E2XA 4EPVA 3GUYA 5D86A 2XUQA 3IJPA 3PVSA 2MINB 3SXUB 2WYHA 4Y2SA 1Z0AA 1ZIOA 3K15A 4K8OA 5ALHA 4MVJH 2QG9A 3P9PA 3QLUA 1PWXA 3L1KA 4ARBA 4KPEC 4I8XA 3R6LA 2GDZA 4PO3X 1RSZA 2C8VA 4O4HF 1BU5A 3TVTA 1R4NB 2ZVPX 4YREA 1VLVA 3C8ZA 1WBBA 3SHVA 3FJ1A 4OYHA 3BXOA 4PVDA 1WE2A 3DUFA 5CX1A 1GGEA 2A14A 4UKDA 5HNKA 3D7SA 3NEYA 1AGPA 2Z0MA 2R8OA 1IOWA 4KO3S 1NDUA 5EXEA 3YASA 5FWXA 4ASUA 4FFRA 2EFEB 1JYSA 1E6MA 4IEEA 1V8ZA 2F7SA 4LF6B 4N0DA 3TCNA 4CQMB 2AG6A 5KMGA 2NSHA 1Z2PX 1DRKA 2MSNA 5GV7A 3O90A 5FLKA 3FHLA 1HDIA 2XUDA 4MA0A 1P6QA 2Q1WA 2QHXA 3RVDA 1CFJA 4XLLA 1JLMA 3C1TA 3CEPB 3O8OA 2R44A 3QBVA 4NENB 2ZJ6A 4S2UA 1GGJA 1Y63A 1YIOA 2QX6A 3CB4A 5EXTA 3V00A 3ZJ5A 4MDEA 2ST1A 1JFFA 1XD2A 5ADHA 1G66A 1NGSA 4EQ6B 1CYDA 2GZHA 1LDBA 3A4MA 2ERCA 4C0LA 1E2HA 3ILXA 1P4RA 3WKEA 3GBVA 2IUSA 5KYNA 2POQX 2HF9A 1G4AE 3EMKA 3SSOA 3LA6A 4BJHB 1O95C 4MQEB 5HPYB 5CTJA 4JQCA 1KY4A 5FULA 2MSCB 4D3SA 1FXWA 2FMXA 3CT6A 2H65A 5DK6A 1P73A 3TRFA 1R9JA 4ENVA 3OFND 2VP6A 5KSOA 5DE3A 3M1YA 1ZBQA 1QQ6A 3ADCA 2FE4A 4FMCF 2IXFA 3G2JA 1Z62A 4MQUA 1IFXA 3OJLA 5IDQA 4DIKA 3JQ9C 5FQNA 2Y3IA 5C1BA 1QHFA 1GTVA 2JAHA 1XN4A 1IMJA 3S7TA 3KKQA 3HU5A 4RJLA 3GH3A 1SKQA 4AKHA 4AY3A 3WL8A 5F35A 2DFDA 4F2PA 2FPGB 1QYVA 1YZHA 4RKFA 2PA3A 2O9JA 2V7QD 2B4QA 4M1OA 4R8RA 3WRVA 4ZHQA 3UMSA 4CKWA 5EFZA 3VNUA 3DZ8A 2VQ3A 3IDSA 3RTGA 3L41A 4MP6A 2XNSA 1UODA 4LHXA 4OYRA 1YSCA 2X5JO 2AUNA 5JCOA 3QLVA 4NEGA 1QB8A 3R6TA 5CA0A 4MDFA 3P2JA 2P41A 3R0JA 3UATA 1VKJA 3WLPA 4RL6A 2PL9A 5I8ZA 3ADDA 4UU8A 4P9NA 3IE1A 4JIGA 2Y0EA 1Y82A 1NJFA 5DGCA 4DMFA 3FOAA 1T2EA 1ZX1A 4TMVA 1L5HB 2ZRFA 1Y81A 4EPRA 1WXXA 1MIHA 1DAOA 3QU9A 1OA0A 1Q44A 2PMWB 4RKWA 1VYTA 2J41A 2IUFA 4RSHA 4XVQA 1W25A 3GGSA 1EVLA 3PFGA 4RFLA 5D01A 5HFJA 2B1IA 1JXAA 1PYDA 2FPPB 3DQQA 3TSWA 1XVIA 1ENZA 3BMOA 4HN9A 3FM9A 1Z4IA 2GB4A 4H27A 4GU5A 5KNDA 3KBBA 4KSCA 3GLRA 5BW6B 1G3QA 2HPZA 2NGRA 4BCCA 3TDKA 2E1RA 2YQ4A 2P6OA 2GJ8A 1MDFA 1C8BA 3KVRA 4KN6A 5FDFA 1JFFB 1XD2B 2HADA 3HP1A 2QENA 1BFKA 1Z5UA 3ZKWA 4GOND 5AVOA 4YP7A 2YWFA 2AT1A 1ILEA 2P68A 2PRSA 4FFSA 3OECA 1GEEA 3HJUA 1AKVA 4KEAA 4TMYA 2GPNA 1RZUA 3CF4G 4XSHA 5K3AA 1RU3A 4UNRA 1DEAA 2D0IA 2YFKA 4WZAA 5DBFA 5FHQA 3UKJA 4CVNA 1CUJA 1HA3A 3QF4A 1UAGA 2Q5HA 5DGDA 5L3SA 2FSHA 4IO0A 4L8GA 1QG6A 4XUDA 1EJ2A 5FKJA 3U4IA 5MGBA 1QZTA 1QC5A 3LUJA 4LTMA 4RF4A 3HVUA 4Y1RA 2IKQA 3A25A 3DOIA 5J40A 3R3VA 4F8JA 3HUDA 1YO6A 5ADVA 4ZYYA 1TUGA 5F1OA 1EE1A 3ANYB 3W8NA 2F6RA 2JC3A 2O3SA 3AR3A 3T0FA 3GLGB 2HX1A 4OLJA 5BWCA 2O6LA 1O94A 3RF7A 5DBOA 5EMHA 3VSCA 1FYDA 3IILA 4BO7A 2BHLA 2VQDA 1WDTA 3OOEA 5TQ0B 4RVHA 1J42A 4EG1A 1PV1A 4JL8A 3IHTA 5BWMA 2I76A 3E2IA 4M9UA 4MLPA 3AFNA 3JYHA 3K1YA 4XGRA 4U7WA 2AN3A 1OIVA 2Q6IA 5DK4A 5EJGA 1VJCA 2I7VA 3N8GA 5ALKA 1QP0A 3BXEA 3I8XA 1OGYA 2FMKA 4XM1A 1HBJA 2WD8A 3ENZA 4UNIA 2QPLA 5LKAA 2BUBA 2GT1A 2UVDA 1D0VA 3BWXA 4LHYA 3SBXA 1XJWA 1PU2A 2RHMA 2O8FB 3W7VA 2EEPA 1VHQA 3KZOA 4MVJM 1XTZA 4N4AA 4RNDB 5LYJA 3FFTA 4MYUA 4PYNA 3OE4A 3EXG2 3AEKA 2AJTA 3KAQA 3MJEA 4DRXA 2VL7A 1JG7A 5A3SA 1DO2A