4Q7LA

Structure of nbd288 of tm287/288
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
SGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKEAALEVLFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Transporter Motor Taken Apart: Flexibility in the Nucleotide Binding Domains of a Heterodimeric ABC Exporter.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal binding protein
molecule keywords Uncharacterized ABC transporter ATP-binding protein TM_0288
total genus 88
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q7lA00
2PCJA 2WKQA 2G9NA 3NG1A 1J8MF 1DPFA 1AN0A 4OK6A 1II8A 4Q1DA 1AJEA 4R71A 2F55A 4A8JC 1CS4C 4C3ZA 4HEJA 2CVFA 5E4FA 1R8SA 4PC1A 1CJKC 4KVGA 4OHVA 4ARZA 4M2LA 4KODA 5JCZA 2G88A 4ZKEA 3RSOA 1Z6TA 1ZVQA 3P27A 4B6EA 2F43B 3BIFA 1V5WA 2G0TA 2G77B 2XSZA 2ZE5A 3BOSA 4M1YA 2V7QD 2FOLA 2EVWX 2HYDA 3TMKA 3PJRA 4LJ8A 4AD8A 4N1AA 1G3RA 2ANBA 4GNKA 4ABYA 5JEDA 3HR8A 4IXMA 1QHXA 1VCMA 2C04A 4OBEA 1DARA 4AYWA 1HH4A 4WZBE 5ANRB 4MGIR 3U3MA 4QRHA 4W9MC 3T5DA 1ZW6A 2P0EA 1ZP6A 2WM9B 3IPXA 2ZQ5A 3T34A 5J4HA 1TQ6A 4EDHA 1M74A 1AZTA 3MWJA 1T8UA 4B3XA 4OHXA 1Z0FA 3B5JA 1JR3A 1OKKA 2JDIA 4QGAA 4ZCMA 3L0SA 2DYKA 3IKJA 1M7BA 2NO7A 2PMKA 2FSHA 4JT2A 5IK2A 4RSGA 5D3MB 3WYGA 3AKCA 5F2EA 1T9HA 3N5CA 1QHSA 1KSJA 3KUDA 5TB5A 1E94E 3I4LA 4ZPXA 2RGAA 3CR7A 1DAIA 2F9MA 4JL6A 1G7RA 3TSWA 4WBSA 5FTNA 2XNSA 2CMKA 3WYAA 4U5XA 4OI4A 3C41J 4Q66C 3C15C 4R7ZA 3CRVA 3EZFA 1XWIA 5DLQC 4BFYA 3HJNA 5KO2A 1XXHB 1ZYUA 2YINC 1NMYA 3VNUA 2V9PA 3CW2A 3TSZA 3K09A 1E1QD 1UDWA 2W83A 1XFAA 3EG5A 2IA5A 4CVNA 1W7AA 2I4IA 1K5DA 3W6OA 1KNQA 3NKVA 1AS2A 2WOJA 5FPTA 2CEAA 1CJUC 1LNZA 1W5SA 3W8RA 1NVWQ 3X1DA 2A78A 1TQDA 5IT5A 2CL6X 1N25A 2GRJA 3H0KA 2WAXA 5FTLA 3B9QA 2WKRA 4WA7A 1AZSC 3GFTA 4FMBB 1FZQA 4OQXA 1XX6A 3I8XA 1IN8A 2REBA 1YZGA 4B76A 4YDSA 4A6XA 4NCIA 5J4KA 4NYJR 4L4UA 3RVBA 1KZ7B 1YU9A 4JLNA 4EJSB 1GG2A 4DHEA 2WPDD 1I2MA 1PUJA 2HT1A 3R9WA 4DLWA 2H17A 4FCTA 2AN9A 2OHFA 4C2UA 2H57A 4PO1A 3MJHA 5TARA 1G19A 1RPZA 2C96A 2CBZA 2R8RA 2VHTA 4RKEA 2ONJA 5JHGB 3AF0A 5FPYA 3KQHA 3MFYA 3LY5A 1H8HA 3K0CC 4DCTA 1GUAA 1RYFA 2RGEA 3GLHE 5SZJA 4A4DA 4A0RA 1AKEA 1OF1A 3FVQA 4JL5A 2IYLD 1HTWA 4BGDA 2ZUCA 1SXJC 1OFIA 2BEJA 3K0SA 3SQWA 2CCKA 4D4JA 5AUNB 1AK2A 3GJ3A 4EPXA 2CJWB 3EWAA 1YKSA 2YKGA 4FXPA 5KDDA 4ZIRA 4BEBA 1QHYA 2AKAB 1WMSA 3SYKA 1XEWY 4HSEA 1OXSC 3B2EA 4RFSB 4LDJA 2ZITA 4YMVA 121PA 1ZM2A 3H1TA 2FN4A 4P31A 3IEUA 3HYTA 4B71A 4V0OA 1CR0A 2X8AA 3U5ZB 4G01B 1JPNA 1MR3F 4Q19A 1G3IA 4UNNA 3OEEA 5FOWA 4O25A 1VHTA 2QT0A 2PL3A 2QP9X 2HV8A 2W0SA 2X1VA 1W1WA 2IWHA 5JCPA 2AK2A 2OXRA 4URUR 3F3YA 4ASUD 2GEDA 4DIDA 1IXSB 4H1UA 4F38A 3NBYC 2VP9A 2TMKA 4PPQA 4Q9HA 2F1IA 1EESA 2CK3A 4NMMA 3B13B 2MMGA 2VP6A 3IDQA 2P5TB 2QGZA 3IGFA 3X2SA 2F9LA 3D31A 5EP3A 4OHYA 3WNCA 1F60A 3A1TA 3ASZA 3MG9A 5CB8A 1XPOA 2HJVA 4N3NA 2JJ1D 4C0LA 2IS6A 1NMZA 4Q21A 2XZOA 3QKRB 4YONB 1HUQA 2IEYA 2OFWA 2WPDA 3X1ZA 1S3SA 1OYYA 4BRUA 3W6PA 2XZLA 4JSTA 3THWA 3VQTA 1YR7A 1SKYB 3PQCA 3THXA 1R0XA 2F7SA 2GKSA 4PQYA 2JLVA 1TUEA 4NYMR 2RB4A 1IJEA 3D7MA 3H2YA 2KE5A 4HAUA 3L0PA 3A4MA 4EJSA 2J46A 1YZTA 2E87A 4KJZA 1TF5A 3QKUA 4MYCA 3AEZA 4LC1A 2ZI5A 4BWYA 2GILA 4D6PA 4CIDA 5DNYB 4RJLA 2AXNA 4HAYA 3FGNA 4YXWA 4A8JA 2UVQA 3CO5A 3SHWA 3X1XA 1W4AA 3Q5EA 2ZYUX 4X8MA 1IN6A 1XDBA 3KQKA 1XMJA 3VU9A 1OFUX 5CM8B 4TLBA 4RY2A 2ZRLA 1T5IA 4URXR 3KJHA 3I61A 3OEHA 2VSFA 3GMTA 1MABB 3SJAA 1E9AA 2NZ8A 4TN1A 3QVUA 1KO5A 1U8AA 3CX7A 1N0UA 1XMIA 2ZS9A 4NP6A 5FOSA 4NE2A 3RSLA 1W49A 2ZJZA 3VKGA 2IEZA 5JJIA 1S4QA 1N6LA 3NH6A 2FEMA 3Q7PA 1L8QA 5J4YA 3UG6A 4R9UC 1NBMA 2OCPA 1MT0A 3DOEA 3EARA 1AGPA 1HQYE 3IBYA 3PIRA 4A9AA 3EPLA 4XTCS 3FHOA 2HT6A 2J9RA 3TH5A 4S35A 1CULC 2AR7A 2FFHA 1FNMA 4K46A 4XVRA 2VLIA 4AC9A 5LD2B 1R0YA 2FFBA 1KK3A 1KJWA 3P20A 5FL7A 1AS0A 3K0CA 2F1JA 3CRQA 5JS8A 2QE7D 3KDSE 1Z63A 1UEIA 3UIEA 4B3CA 3BFKA 1SXJA 1VHLA 5BXQC 5JSZB 2FSFA 3L8ZA 4PX9A 1S8FA 1TX4B 3M4YA 1FX0A 1ZNXA 2A5GA 3VX4A 2JATA 2D2EA 1OFHA 4HAWA 4M1OA 4LYFA 4GOKA 2J0UB 1BS1A 5EUMA 4QNMA 5GJBA 2NTYC 1Q3TA 1X86B 1EFTA 3RRMA 3MJRA 1VTKA 1ZUHA 4HLDA 3T15A 2QEQA 1FQJA 4UXHA 4IDOA 5FOXA 4XTRA 2JLXA 5HE8A 3QXCA 1ZD9A 4BFTA 1LS6A 1N6OA 1E2EA 4A6PA 2B8TA 4MDEA 3Q72A 1KDPA 4IHQA 2PLFA 4ERNA 1SHZA 1MOZA 5JS7A 3FB4A 2CE7A 3MWKA 5DHAA 2I1VB 2IYRA 4RCYA 2GCNA 3LA6A 2YV5A 2BWJA 5DO9A 4BFUA 3GLFA 2J1LA 4B44A 4Z54A 3U3RA 2F1RA 1S3GA 1ZCAA 5DIFA 3VHXA 2G6BA 2ZRCA 3NWJA 4HDQB 4OI2A 3H84A 4LRWA 3HR7A 3FMPB 1MO4A 2Z83A 3EA5A 5FBWB 1E69A 2IXFA 2QI9C 1SVMA 2XITA 3NEJA 4JLKA 4FD2A 3B60A 2GNOA 1TAGA 1Q0UA 4UJ5A 4DC9A 3LLMA 1S1MA 2XEXA 2GK6A 1GTVA 1BMFA 3TRFA 5H70A 1MABA 2F3TA 3EWSA 1KDOA 3TIFA 1CLUA 1W2HA 1HY3A 2ERXA 3D3QA 4TMZA 2P6RA 2ZJOA 2OCAA 2FFAA 1AA9A 3QXHA 2LKDA 1P6XA 2IUSA 3AVOA 3AUYA 1CIPA 3IHLA 3W8NA 4MGKR 4ZKDA 3IUYA 4W5HA 3RS3A 3LLUA 3CUEF 4EJSC 4TZ6A 4GMXA 3P32A 3TW4A 2QN6A 2FFQA 3HWSA 1YZNA 2EFEB 2NMVA 3UWOA 4FMCF 4HLUC 2V6IA 2XTMA 3I72A 3OIYA 3SC3A 5KTYA 5H8WA 1NN0A 2D74A 3LNCA 4FCWA 1XZQA 4JBWA 2OCBA 3LW8A 3CLVA 2JEOA 4CEHB 3KKQA 1G8FA 4W5JA 2RHMA 2GEUA 5FI0B 4C0HA 4C0QC 1NY6A 2AWOA 4HUQA 4KCGA 3C5CA 3TVTA 5IDVA 3ICEA 3DOFA 2VHJA 3O8RA 2W6ID 3W3AA 4XWKA 3OE7D 3E5HA 5FPKA 1MV5A 2IXEA 3B9PA 4M8NE 5JFGA 4KV9A 3KFXA 5FPSA 4A0HA 2QPAA 4JLDA 1XTRA 1A4RA 4GPTA 5A4JA 4UKDA 5DH9A 3VTKA 4LHVA 4LBYA 1F2UB 1Q12A 3LQQA 1YZQA 3NTUA 3QENA 2GVDC 2VF8A 3A1WA 4P32A 5FUYA 4B2LA 2KBFA 3B6EA 3MSXA 3QKSA 3U4QA 3P4XA 1YR8A 3A8TA 5CIQA 5M04A 2CXXA 2PLRA 1XTSA 3UMSA 2FPKA 1CJMA 1G6HA 4Q7JB 1ZM9A 1XCMA 2HYIC 1JJVA 3GLIB 2GZDA 3RHFA 4F4JA 3AF3A 4Q47A 3A36A 5H1YA 4X8LA 4ESVA 2C95A 3K0FA 1ZC3A 2BEKA 4MUBA 2CHGA 5CLQA 3ZD6A 5HE9A 1TUIA 4YMTA 1FX0B 1CXZA 2N42A 4FCVA 3NBFA 1UAAA 2NGRA 3K9LA 3OE7A 1U8ZA 4LJ6A 3I92A 1XXHE 1NSFA 2PT5A 2HLDA 2R6DA 3I5XA 4PHHA 4P33A 2ZRMA 2REOA 3B7GA 1O3YA 2CJWA 1ZUIA 2KBEA 4V0MA 2BMEA 1XMVA 2Q9CA 4PTLA 1A2KC 1IY1A 3EPJA 3ZD7A 1CP2A 1WDTA 4UNPA 2HF9A 1Z6XA 4Q7LA 1IAQA 1Z5ZA 1S9HA 1SGWA 5L3QA 1J2JA 1SVLA 4LBVA 2OILA 2P6NA 3EZ9A 1UKZA 2W6JA 2O8CB 1UADA 2GXAA 3A58B 3RS4A 1D9XA 2VHCA 5B57C 1NJGA 1ZNWA 4IRUB 4RD3A 1KMHA 3AVVA 1ZM4A 3DZDA 1GILA 1KI1A 4MUAA 1HT1E 2ZVPX 4KHZA 4D80A 1KGDA 3PUYA 4BEJA 5JRZA 4QBIA 1ANKA 3PUZA 3ZS8A 5C18A 2ZI6A 1SKYE 2DCUA 2R44A 2OV2A 4FN5A 4HAZA 4PZLA 4MYUA 2B8WA 3QKSB 4E5UA 2QM7A 1E9SA 1XEFA 1F5NA 1WQ1R 3LBNA 4M1TA 1ZAKA 3ND9A 2IT1A 3NXSA 5HTKA 5JBQA 5KNDA 1G5TA 3KX2A 1P73A 4QKQA 3KFVA 3WP0A 3FYHA 3SS8A 3EPHA 4KYUA 1VIYA 2OXCA 1S0UA 1KO4A 2WWGA 3TGPA 1IBRA 3IHWA 3BD9A 1R8QA 3VMFA 5HZKA 1DAGA 1QG2A 2IF0A 3AP3A 1HE8B 1JQLB 2PEYA 2GETA 4R2HA 1DAEA 1CBUA 1JB1A 2EWVA 3QKRA 4M22A 2ZYWX 4YMSA 1M8PA 1V43A 4CT4B 5K8TA 1PLLA 4MKGA 1KI4A 3O8CA 1IXRC 1EGAA 2VIIA 1A5TA 4IVPA 3I32A 1E9BA 1LF5A 3EZ6A 1AS3A 4OKSA 1JALA 3N2IA 3JVUA 2W2VA 3QQ5A 1CEEA 1U9IA 1TF2A 3LWNA 2G0NA 4M1SA 4NDZA 4ZDWA 1VCNA 2C99A 3PFIA 2NPFA 4D25A 3PEUA 3C4JA 1Q22A 1SZPA 1FUKA 4EIWA 5EXSA 1U81A 3R20A 1KY3A 1NBMD 2GEVA 2QTVB 3VR5A 1N6PA 4L8GA 1IN7A 2RGDA 4HYYA 4IVQA 1Z0IA 3CONA 5F9HA 2WWFA 5K8LA 3AF1A 3GLHB 5L3VA 1QHHA 4R2IA 1S2MA 2OT3B 3KJEA 3I5YA 1W36B 2H92A 3KKNA 1C4OA 2ZRJA 1U99A 2V7QA 1YZKA 1A1VA 3SYLA 2RAPA 3ZDQA 1B23P 2ZRNA 5L3RA 2AX4A 5J5CA 4Z1MD 5G3YA 4B6FA 2ZI7A 1DOAA 5DI9A 1CR4A 4JVLA 4UXIA 2J87A 2UZIR 4MGZR 5TDHA 4ACAA 3C5HA 2NO6A 5KHOC 2ODNA 3FKSD 2FZLA 3V00A 2ZU6A 1KSFX 4JVSB 1JEEA 2PX0A 4B3BA 5FH9A 1WE2A 1E4VA 2IC5A 3BB3A 3A1UA 2B7BA 3CZQA 1JR3D 2FH5B 5HCIA 3HU2A 1ZNZA 2BCGY 3UKDA 4F4IA 3LO5A 3RWMB 3SZRA 3U7HB 1R7RA 3OEED 1NLZA 3UATA 1HURA 1UM8A 2CNWD 4B3DA 4KITB 3ZIAD 2BM1A 4QC2A 3B1VA 4BZPA 2C5LA 1EG7A 1OFTA 3L0IB 2XB2A 4Q7KA 1KOFA 2FMXA 1EFUA 4LJAA 5C1BA 3UANA 5JSZA 1W4CA 5DI3A 1DO0A 1XTIA 4A2QA 1JJ7A 1XB2A 1G3UA 1YRBA 3AGQA 5JWRA 4ZI2A 1U94A 5C46F 4C0JA 4X8HA 1KI8A 1UBEA 3Q5DA 5AJWA 4E03A 3SU8A 2RHDA 4D81A 4LY6A 2BKUA 3LBIA 4RZUA 1Z8FA 2PJZA 1P9NA 5TMPA 4JLAA 4JS0A 2GWHA 2D2FA 4JT4A 3TQFA 3CM0A 4ZDKA 3VNVA 3EZ7A 1NVUQ 3NEYA 1G64A 1BO6A 1EFRA 3ZVMA 1GOTA 2IXGA 1SVKA 4M9QA 4IDQA 2ANCA 3BXZA 1Y3AA 1BYIA 3ZQJA 4GI7A 1ZNYA 3EPKA 1RJ9A 2NZJA 2BMDA 1LY1A 3PUXA 3GJ7A 3TSOA 1NLFA 3QE0A 4DBLC 1TU4A 1XEXB 3TAHA 4DLVA 1Q57A 1RC8A 2O8BA 1SKQA 3LW7A 3OAAA 1DELA 2WAYA 4MDFA 3NC0C 1R2QA 5DE3A 2LKCA 1OHHA 4Q9JA 2ZM5A 2AD1A 4YQFA 2IS2A 3K0AB 2D7DA 3CKLA 2GCOA 1C1YA 2GK7A 3C14C 3BH6A 1B0UA 3TAUA 3BK7A 3MWLA 5FR2A 4E22A 2ZAMA 2PBRA 1F3OA 1NVVR 1JAIA 2YC4C 1SHKA 3RDPA 3AVTA 2ZREA 1E9RA 5EE9A 4CDGA 1DS6A 2DHRA 1Q1EA 5AJXA 3WYFA 3ETLA 1U98A 1OE0A 4LYJA 1BYUA 3B1XA 1KMQA 5BQ5A 1SULA 4TYNA 1UEJA 3GJ4A 5EXPA 3U4QB 1D2NA 2IUTA 5JWHA 3W9YA 3DM5A 1FTNA 2VP2A 1Z0JA 1TPZA 1ZU5A 2R2AA 4MITA 3KJIA 1Q1QA 1P9WA 2ZSEA 2QBYB 3WMEA 1XPUA 1W0KA 2RCNA 4M1WA 4OQNA 1KO1A 4LYAA 5DYGA 2NG1A 2HEIA 1E98A 4LBWA 1E9EA 3BAFA 3MRSA 4OHWA 1Q20A 2VSXA 2W00A 2GBLA 4HZUB 3KQUA 3TW8B 4C9BA 1HQCA 1JEDA 5TVKA 1H65A 2QTHA 2ZSAA 2YJTD 3W90A 4IEIA 3BH7A 3NBXX 4L9WA 3DL0A 1R10A 2AFIE 2DFNA 1Z2AA 2FGJA 2BV3A 3HU1A 3VKHA 2AXPA 1P2SA 2GA8A 3PUWA 4KU4A 4NBSA 1TADA 1IM2A 2X2FA 3UG7A 4PPGA 3MCAA 1Z83A 2VTKA 4FIDA 4M1MA 4RZXA 3QY0A 3K9HA 3Q8XB 2VPPA 2RGCA 4IOKA 3LAWA 2XB4A 3U3KA 4PC7A 3SBDA 4ON9A 2Z4RA 4RZ2A 1KSGA 1XEXA 4HZIA 2G1KA 1MRSA 1XD2B 2O8BB 3VAAA 1R4AA 1NP6A 1T0HB 2WHXA 1WXQA 4TLAA 2FDCA 1CF4A 2V1XA 4GMDA 4AURA 1UKYA 1XTKA 2BMJA 1X1RA 4I4LA 3RS7A 2FWRA 4MRVA 4Q1CA 4Q4JA 3GJXC 3RC3A 2DWOA 3RS2A 2ORVA 2YWEA 3GJ5A 4EAQA 4EPWA 1U8YA 4Q1AA 2CDNA 4V03A 1QBKC 2O8DA 1ZIOA 1X6VA 3RLFA 3MWYW 3QVVA 1OB5A 1OV4A 5GJWC 3U3JA 4BFXA 4MGYR 3K8YA 3QG5A 4OK3A 3SHFA 3TLXA 4ZCIA 3OEHD 2K5UA 4TLDA 2BDTA 3QPUA 1F2TB 4LV6A 2ZRFA 3CRMA 4KVAA 1WCV1 2WMNB 3L43A 4AYTA 4D0NA 5TY0A 3T06B 4DDVA 5HZHA 4HDCA 3ONWA 3PCRB 4HB3A 5EP1A 1G5RA 2QQ0A 5IHPA 4BRWA 2MSCB 1AKYA 3EIHA 4XSHA 1W4RA 1QVRA 2EYQA 4EQ6A 2XTZA 4NZYA 3NHAA 4PAQA 1SVOA 4XSGA 4AKGA 2IF2A 4BLOA 1ZCBA 1FOEB 2HCJB 2QE7A 4OJKA 3ADCA 4AG6A 4Q48A 2GCOB 4A82A 3SEAA 2DWQA 3NBZC 3R7WA 3NH9A 2VHQA 2H7VA 3FMFA 4CGZA 3I62A 2L0XA 3RABA 1NIPA 3T1QA 3AUXA 4CRWB 2B92A 1PZNA 2P65A 1RRFA 3K70B 4KFTA 4NYIR 5GJVC 2V6JA 1ZRHA 2G1JA 2NOAA 2PCLA 1L2TA 2YOGA 4XIGS 2C8VA 4MKIA 3ADDA 1LV7A 3CF2A 5EZ5A 2OE2A 4DSTA 1HV8A 4C7OB 4PO8A 1VCIA 5IK2D 3KB1A 3WBJA 2O8EB 2YYZA 1G4AE 3PEYA 2PZGA 3VHLB 2W2XA 4M1KA 2XTNA 1SXJD 4QBHA 3U44B 1DG1G 5EJEA 4HZUA 2FZ4A 1GNQA 5G40A 2WJYA 4FMDF 2V54A 4EFMA 1VG8A 1KO8A 3QEJA 4JL8A 4YLGA 2W6JD 1VECA 3BC1A 3CF6R 3GEHA 3K53A 3SDZA 3O8BA 5C2JB 3TBKA 1TU3A 1RRCA 4BLRA 3KL4A 4LJ7A 4LHWA 4A92A 3KUCA 3B78A 5BN3A 1GRRA 2JCSA 2EWWA 2JIZD 4I1OA 3SN6A 2WIBA 3U2QA 1P61B 1G8YA 3ZJYA 2O0HA 4NCKA 2ZR7A 4M9ZA 1N5LA 1NN3A 5G3ZA 4RFVA 5UKDA 4BLSA 1JQJC 3GQBA 1LF0A 1XJCA 1GP2A 4B47A 2RGGA 3EC1A 4PSKA 2FGKA 3GPLA 3M6AA 3SJCA 4GL2A 1TQ4A 4IOMA 2AHOA 4QXAA 5LB2A 1QHGA 3BB4A 2GVZC 4TWZA 1BH2A 1CRQA 4PC2A 3FOZA 4MKHA 1RE0A 2A5JA 2C9CA 4HI0E 2DBYA 4A36A 4TYYA 4TMXA 4ASUA 5EE1A 2OAQ1 1M1YE 1XCPA 4YC7A 3W3ZB 4PC6A 1JAHA 4LZZA 1G5PA 4A8JB 3DM9B 4LJ5A 1FW6A 2ZEJA 3ICQB 3GFPA 2ZVQX 4ARZB 2PZEA 1EX7A 2J0QA 3FDIA 3SR0A 4DEXA 1DBSA 4O0MA 3CF0A 3PG5A 4G5OA 3TVDA 2QAJA 3X1YA 1G8GA 3BWDD 2ZE7A 4OYHA 4D0LB 5JMTA 1XBTA 4TTQA 1G4UR 4IDPA 1R0ZA 2H5EA 4RCZA 4H9GA 4BZQA 3O47A 4PZYA 5E7JA 4EPRA 2ZUDA 5D3QA 1XU4A 4B33A 3EA0A 3I73A 3A1VA 1ZM7A 4LJYA 4GP7A 4TLEA 5KPDA 2JLZA 1G18A 3FPAA 2V8OA 3KQLA 5K8IA 4KYIB 5CK5A 4Q1BA 2WTUA 3BFXA 1P2UA 3AVYA 1WBDA 4IXNA 2AK3A 2ZYTX 4PANA 5C4GB 821PA 3THWB 4JLBA 1YR9A 1KDRA 2QZ4A 5G41A 2JIZA 2V1UA 4EFLA 2CNWA 2QT1A 2IX3A 2RGNC 4US1R 4LWZA 4HLQB 4JJKA 2BKEA 4TYQA 2ZU0C 4B3GA 4O2LA 4TL9A 2ZR9A 2QTFA 4KXFB 4XD7A 1JNYA 4LYHA 2JDID 3G82C 5JJLA 2MSEB 1SQ5A 1OT3A 5CJ2A 4HUTA 1PJRA 4Q4HA 1KTVA 1NIJA 1CRPA 3PUVA 1CR1A 4L9SA 4NYJQ 4CEJA 2EFGA 2F3RA 4AY2A 2WWXA 4LSGA 4DSOA 4KAXA 3AF4A 3QPVA 4QHTA 3CZPA 5GADl 3GJ6A 2HF8A 1US8A 3RS5A 2ZSDA 4GZLA 1F48A 3EAQA 4S2EA 4DUGA 4P0TA 4K81B 2WICA 4PR0A 3C8UA 1XNJA 4CZ2A 3EIQA 4XOIA 2IHYA 1P3JA 2XXAA 1Q21A 2ZS8A 3RWOA 4RD4A 1G7CA 4NU0A 5AWFC 2J7KA 2OFOA 3THYB 4N0EA 2R6AA 5JZVA 4QJ3A 5LBIA 2P67A 2FX3A 1J99A 2XJ4A 4PHGA 1TTTA 4WAUA 1GL9B 1Z28A 2JGNA 2WV9A 3S1AB 1T4GA 2XAUA 3M0EA 3QUSA 2CCGA 5A0FA 4B48A 2HDNB 2XJ9A 3KXIA 4PHTA 5GVSA 3T1VA 1ZM3A 4DLXA 1N3BA 2W2TA 4PPFA 3DHWC 4LCBA 1KZGB 4R98A 1ZIPA 2CL0X 5KSOA 2Q9BA 1J8YF 1K8RA 1UBGA 1OXUA 2BVNA 2ZE6A 3V4FA 4CEJB 1OJLA 4CF7A 2I1QA 3LVRE 3WNBA 4JYBA 1LVGA 3OHMA 4I81A 2FJUA 2WBLC 4KBFA 1NJFA 4W5WA 2OZEA 3GJ0A 1KI2A 4CYMA 2C78A 4RZ3A 1ZINA 5FUXA 1OW3B 5J4LA 4D2IA 1VMAA 4IW3B 4LOAA 1R0WA 2JJ2A 4V0LA 3UK6A 1DAHA 4ZDIA 3EASA 4TQAA 1E0KA 4G5GA 1ZMXA 2OO7A 5EUQB 1SVSA 1YE8A 5BW8A 3AV0B 1X1SA 1QDEA 2HUPA 4KSBA 4QGHA 1FFHA 1LS1A 2BBWA 3PEVA 5JHHB 2REXB 1SXJE 1DVRA 2CK3D 4XJXA 5DN6D 3ADBA 3CPJB 5HPYB 2QUZA 4LI0A 2O8DB 3GLIA 1N5KA 3HU3A 4BZXA 2ZI4A 3E1SA 2ZE8A 2C2HA 3HYRA 1G3MA 3SJBA 4UNQA 1Z29A 4JMPA 1II8B 2Q0HA 2Q3MA 1FMJA 4LHYA 3QIAA 4A2PA 3PEWA 3RRYA 3G5UA 1G7TA 1XJ0A 2GAAA 2VP5A 3U6KA 1KIMA 3KZ1E 2ZJBA 4TYPA 1KAOA 1VG1A 2OG2A 1KAGA 3VFDA 4TL8A 1WRBA 3CR8A 3GFOA 4DLTA 2WKPA 4ZV4A 1GL7A 2XSZD 4UNSA 2GXQA 2OLKA 4P3YA 1O87A 1U2RA 2LCFA 2QMHA 4ZDJA 1WF3A 2VBCA 1EWRA 2VP0A 4Q4AA 2IYQA 2O0KA 3FFAA 4ZI3A 5DISB 3SQXA 1QHNA 2GXSA 2WIAA 1G8PA 3DMDA 4BFSA 2GESA 2J7PD 2J3EA 3FMOB 5F9FA 1CTQA 4H1VA 3K70D 1YR6A 2NO1A 2XNDA 4G3XA 1NVVQ 4U00A 4D82A 1OH8A 2ZIAA 3C16C 1S9DA 4DVGA 1UBFA 3ZZTA 2GF9A 4BFVA 3IIKA 4PC3A 1EX6A 4EKDA 2R6GA 2IBMA 3GLFE 1VYTA 3CH4B 2WSMA 2BJVA 3AQ4A 1VCOA 4Q00A 5EE3A 2ZI9A 4OI1A 4MQBA 4DCNA 2ZUBA 5FTMA 3IIMA 4MA4A 2WWWA 4RKFA 3QI2A 1U0HC 1UJ2A 2C9YA 1E9DA 1NMXA 1P5ZB 3A1SA 1U0JA 3CH5A 4KI0A 1MO5A 3DZ8A 3TK1A 2HXSA 4GRAA 5KSYA 4JVNA 1E0JA 1G1MA 1QZXA 3TUJC 1W46A 2O52A 4JYCA 2QP3A 3QXJA 4TT3A 1P62B 2JAQA 2A2ZA 4AKEA 4AWXA 3AVXA 3AP2A 3PR1A 4JIMA 2FE4A 1YJ5A 2FNAA 2QAGC 1DTSA 1EK0A 1WA5A 2R9VA 3B1YA 2J7PA 5IRCD 2C03A 3FKSA 3WNDA 2NPIA 5A5GA 4NCJA 2IS1A 1OB2A 1E1QA 3QJYA 4I1UA 4UJ3A 4DB2A 3RRZA 3OIVA 3REGA 4HAXA 1NSTA 2OBLA 3RC8A 1LW7A 5AJYA 2B7CA 1NNEA 2GDJA 2Q3FA 3GLGA 4Z1MA 1E2LA 5KPJA 5KNCA 3U61B 5F3WB 3THOA 4JKYA 3WHKA 3MUFA 3IIJA 3OIUA 3NDPA 4EPYA 3IQXA 1WB9A 1KJZA 4C0BA 5JJKA 1QHIA 1DG3A 1XTQA 1Z6GA 3KKOA 1KI9A 2OEPA 4HB0A 4MRRA 4B43A 1D9ZA 5CITA 1MRNA 8OHMA 4GFDA 3KJGA 1XF9A 3BJIC 3ZGXA 2QBYA 3DDCA 1OXXK 3A37A 1L4UA 1K5GA 4A1FA 1X8LA 1KHTA 3ZIAA 1FPMA 3QBVA 2YWHA 3T5GA 2Q6TA 3W34A 1P7CA 4LHZA 2I3BA 2PX3A 4Q02A 5IF9A 1F6BA 1EFRD 2QL6A 3QG1A 1YZUA 2OBNA 4OL0A 1CKEA 4HUQB 4LV5B 2W6IA 2OESA 1M2OB 1OH7A 1D6JA 4YDHB 1CU1A 3TQCA 4D4KA 4QFMA 4RD6A 1NN5A 1UPTA 2JASA 2MSDB 3PENA 3ZZUA 2WSSA 2D62A 3B1WA 1D2EA 5K8UA 1VKJA 1E9FA 3DKVA 4DZZA 3TR0A 4XVUA 3MLEA 3GJ8A 4Q4AB 3PVSA 3BERA 1Y63A 5B2ZA 2DWPA 4XWAA 4QBGB 1PLJA 2PJRA 4G5QA 5HKKD 4M0LA 4PPNA 2H18A 3WHLA 2ZI3A 2Q21A 3B85A 3FWYA 1E6CA 2BBSA 1W44A 4WIAA 1Q1ZA 3DPUA 4NYMQ 2D7CA 1HYQA 3LVQE 1Q1BA 1CJVC 1ETUA 1GFIA 4PSAA 5G53C 5L3SA 1G17A 3TUIC 4IOJA 1RRPA 2W0MA 3K0FB 3DEFA 3LFUA 4I99A 3E70C 2GJAA 3QEOA 4O2RA 3WXMA 1GWNA 1YZLA 4GOJA 4DRZA 2ZANA 4OHZA 1RFLA 1YQTA 4ITRC 4QNRA 3W5JA 5J47A 2DR3A 2JLRA 3CX8A 1UF9A 3N70A 1GKUB 2ZRDA 1JECA 2WJVA 1KNXA 4NHOA 3QSYA 1ZJ6A 2XX3A 4IFBA 1KKMA 1MH1A 4U7DA 2OFXA 1NL3A 1KSHA 1OYWA 2ZRKA 2CLSA 1IQPA 2WVJA 2P2LA 4KO8A 4C0SA 1W48A 3UWKA 1E2GA 1KKLA 4B3FX 2CLCX 4Q4HB 4TSFA 4F4CA 5EXTA 2WSSD 2ONKA 5JLJA 1TEXA 4QJ5A 1S1CA 4HAVA 2BOVA 3TR5A 2QGNA 1FP7A 2CHQA 3P26A 3K1JA 2GBLC 2EU8A 3QPWA 1VG9B 2EW1A 4RD2A 2KI5A 3W5IA 1XXHA 721PA 3ZYCA 2J59A 1GSIA 1GL6A 2GF0A 1E2HA 1RJ9B 2BHRA 3FTQA 4Q9KA 3R7WB 1H8ED 1HE1C 1PLKA 4WW0A 5HR5A 4YXWD 4L5BA 3GEIA 1XEWX 2BBTA 4NCHA 5B58C 1JR3E 5AUPB 4X8OA 2RGXA 2GJKA 1QRAA 3BBPA 1W47A 5AUQA 2H1LA 3SYNA 1XRJA 2AD5A 2E9SA 1BKDR 1FL9A 3TUZC 2CL7X 4GSYA 5JWOA 4AKIA 3OIWA 1T3LA 2YZ2A 3LXXA 3REFA 1JXMA 1D2MA 4P4SB 4GP6A 3DO6A 5FL7D 3DKPA 3K70C 3NDBB 4HLUA 1II9A 3OFNA 4MRPA 1QG4A 5H68A 4E07A 1DEKA 2JLSA 2C9OA 3SJZA 4BFZA 5LPNA 1N5JA 5DGXA 2P3SA 1OLOA 4JVMA 3IO3A 4LBZA 5DI3B 2QNRA 3ADKA 3IILA 2IK8A 4K8OA 3SFVA 2R6FA 3AVUA 2YWFA 2R65A 1G8HA 5L3QB 4JLMA 5CK4A 2JLUA 521PA 4U02A 1ZBDA 4PQFA 4DUGD 4DCVA 3QOFA 3B1ZA 2ATXA 1E96A 4G1UC 1ZUNB 4JBXA 4LHXA 1XD9A 4NKRA 4A0GA 1XMSA 1OH5A 4LV8B 4V0KA 5E3HA 4DEYA 3GLFB 4TLCA 4UQOA 4IJMA 4JLPA 3WBKA 1DADA 2Z0MA 3EIEA 3B8HA 4URWR 4BLPA 3J81k 1D8TA 3SOPA 1GM5A 2BJWA 3A4LA 2QQEA 2O5VA 4EPTA 3AKDA 4M53A 5E7MA 4PXAA 3IPYA 2MMCA 2QRZA 3CB4A 4Q1FA 4OJQA 3A6PC 2A30A 3CNNA 1N6NA 1TEVA 2IYUA 1E2DA 4P4SA 1T5LA 3P1JA 2WMOB 2WJJA 4B2PA 1KK1A 1JR6A 2OCYC 3ZS9A 1A82A 3AKEA 4OI0A 2QAGA 5DYIA 2VYFA 1RRGA 2EQBA 1E79A 2WWIA 3B82A 1M34E 1CJTC 4QM7A 1W0KD 2WZQA 2PMDA 3JVVA 2ZPTX 3D6TB 3MAAC 4QJ4A 4EUNA 4DSUA 3HPRA 4FI3C 3KKMA 1ONBA 2LWIA 5DN6A 1N0VC 1G7SA 2ECKA 2N46A 2IUUA 3FFBA 4NYIQ 2O8FB 1TNDA 2IYXA 1Z6AA 4KFUA 1GAJA 1I4LD 2BMFA 4C0AC 2OBMA 3GP8A 4CEIB 3OESA 3VR6A 3GLGE 3GLGB 1ODFA 3SE0A 1N2CE 3AP1A 1FUUA 5DHFA 4DKXA 4Q03A 1E2NA 1GRQA 2BC9A 5P21A 3RS0A 1N6KA 1XD2A 4M9XA 4TT3D 1GNPA 1A2BA 2O0JA 2ZAOA 3Q3JB 1II0A 4DB4A 3M1IA 1KI3A 5B64A 4XH9B 4EFNA 1ELOA 2NO9A 4IFEA 1JXOA 3LX5A 5JEEA 5KU1A 3CRW1 3QXXA 2DFLA 4D4LA 2CLDX 5AUOB 1TMKA 2F1HA 1COWD 2ZYVX 4PZZA 4BE7B 2JJ8A 3T61A 4ZIRB 4PSVA 2IS4A 4DCSA 5AJVB 2GJ8A 4JLVA 4QG7A 2WWHA 2Z6VA 2HJGA 1E2JA 1P2VA 3EC2A 5FBRB 1BMFD 3CRRA 1VPLA 2CE2X 1GITA 3AVWA 2H8KA 2XXAB 1F2UA 2FPLA 3I1FA 3KB2A 1E0SA 3QF4B 3CX6A 3THYA 4AI6A 4FMCB 2Y8EA 4AIIA 1S96A 2XOKD 4E09A 4NL4H 4PFSA 5ELXA 2V4ZA 2SHKA 1XCGB 5CIWA 2QU8A 1J70A 4C4PA 4TTRA 2FSIA 2IYWA 3A4NA 2A5FA 1D5CA 5AK0A 2YNMA 1GIAA 3KTAB 4DDWA 2GAOA 2A9KA 1T0JB 2XOKA 5FI1B 3VR1A 2ZROA 4D0GA 4GOXA 4TSFD 1FQKA 1QVAA 4Q01A 1US8B 4AG5A 4MH0R 1U9IC 2QM8A 2QSZA 3HPQA 4AYXA 5L8VA 3NC1C 4MRSA 1EFCA 4WXPA 4Y0AA 3TKLA 2OAP1 1P72A 4CEIA 1IHUA 4N0DA 5FPHA 3L8YA 4L16A 1M7GA 2RMKA 4M4SA 1UDXA 4NH0A 2ZSFA 1T91A 3IQWA 2NO0A 4WVFA 4KSCA 3WRXC 4II7A 1OKKD 4Q18A 1KO7A 4QGFA 5LB4A 1R5NA 5EE5B 5CDFA 2DFTA 5HKKA 4POAA 2RGBA 1RYHA 4KFSA 1CR2A 1X3SA 4KLNA 1R6BX 4URZR 4DLZA 4DJTA 4LPSA 4MYHA 1U90A 5CB6A 2ATVA 4JZKA 5GVRA 2GZHA 1LTQA 1IONA 2VF7A 4G5RA 3VU9B 4KLZA 1KMHB 4MRNA 2ZRAA 1HEIA 2JA1A 2AKYA 3P4YA 5JI3E 4DCUA 3FHTA 3OF5A 1M7HA 5GJCA 1Z0AA 5FOVA 2F6RA 1AQYA 421PA 3X1WA 2J41A 3ZVRA 1KJYA 2FU5C 1E1RA 3AGPA 4US0R 2UKDA 3L82B 1PV4A 2BBOA 3NIBA 4BASA 3AKYA 4TTPA 1NVXQ 4DSNA 2XGJA 1ZD8A 3HP1A 4F92B 1ZD1A 2QG6A 4F93B 4OK5A 2ZS7A 4PHFA 3WMGA 4Q9IA 5EXXA 1XTJA 5B30A 4LX0A 2ZRPA 2QMUA 1E9CA 4UNRA 3K0AA 3E2IA 3BGWA 5L3SB 2GJ9A 3CNOA 2V3CC 2VEDA 5EP2A 4TMTA 1NLYA 1NG9A 2QPOA 3KTAA 1SXJB 4I1VA 5FOUA 4HB2A 2VHUA 4FWIB 2ORWA 2ZSBA 2WJHA 4DT1A 4Z8XA 4LGMA 5KUTA 1E2MA 1G16A 4TZ0A 2YHSA 2VSOA 3FE2A 4Q4JB 2X19A 4QM6A 5EZ6B 4BQSA 1T6NA 2V55B 1IY2A 1J90A 3UXMA 3U7GA 1DAFA 1Q44A 1IN5A 5E7IA 2NQ2C 4D4MA 4JSYA 3K9GA 3LBHA 1MO6A 2QMEA 4Z51A 4IDHA 3H86A 1OPXA 2XZPA 4IEEA 4HATA 3SI7A 1PVOA 1N6RA 2D4HA 3CPEA 2E1RA 3SFZA 2P5SA 5FL3A 4RVCA 2WOOA 1E99A 3ZQ6A 1ZC4A 4Q5IA 4A15A 3FMIA 5SZIA 2OM2A 2HXYA 2ORIA 1VG0B 2R62A 2KSQA 4MKFA 4URVR 3G0HA 2AWNA 4EQ6B 2WWYA 1XPRA 3U3OA 1NG1A 3QBTA 4WXRA 5FR1A 4JLOA 4NPHA 1NKTA 1VYUA 2DFKB 1W0JD 2WJGA 4TL6A 3VR4A 4DDTA 1XD8A 3EW9A 5BYKA 1RZ3A 2ZJ8A 3EX7C 3BE4A 4OQFA 3LH5A 4IOLA 3WP1B 4ZO4A 5FBVB 3EXAA 1SVWA 3KXLA 1JBKA 4JLJA 1PUIA 2ODBA 1FNNA 2BM0A 2Q9AA 3ASYA 1E2IA 4RFSA 1G41A 1DO2A 1GKYA 3IO5A 3WMFA 2FF7A 5KDLA 2YOHA 3MD0A 4LUCA 5FBLB 4C30A 4UXJA 2RH5A 2VQSA 2D06A 4KFRA 1AQUA 1Z22A 4CEHA 1R5BA 1SVIA 5TXGA 3BRWD 3ZVLA 2QSYA 3I3SR 3RNLA 4DT1B 5CLLA 5TV2A 3GLIE 2QAGB 4Q9LA 3T1TA 4JBYA 3RAPR 2ZJYA 4LPKA 4DWJA 2ZR0A 1N5IA 1VYVA 5FOTA 3TNFA 3D8BA 1W0JA 3CPHA 1XJQA 2GCPA 4ILEA 1N6IA 2FA9A 5JRJA 2ZJAA 4GZMA 1RVDA 1OHHD 2KB0A 3VR3A 4FMDB 5AR1A 2FPMA 1IJFA 1I4DD 3F8TA 3DMNA 3H4MA 4YMWA 3LRPA 2A5YB 3FKQA 1UBCA 3O8DA 1YHNA 2ZRBA 5CM9C 4J0QA 1DE0A 5CDFE 4ZCLA 4M21A 5E95A 2ZTSA 4QOSA 4V0ME 6Q21A 3GCGA 5FUVA 1L4YA 1EWQA 2P6UA 4RD0A 3KXKA 4YMUA 2JJ2D 3MGCA 2IW3A 1Z0DA 1P60A 5EQTA 1X8KA 2G3YA 3NVAA 4B73A 3U7FB 4GDFA 1E2PA 3L2OB 3T35A 3W6NA 4JJZA 1UKVY 4B74A 1E3MA 4LK2A 1BOFA 5KOYA 4AKHA 1W36D 1E2QA 3JZMA 4DIEA 2FSGA 2N1BA 4PAOA 1AGRA 1OIWA 1A7JA 2VO1A 3BB1A 2FEOA 3LXRA 1Z08A 1IY0A 4O3MA 4OQLA 3I8SA 4DDUA 1E4YA 2OUKA 4URYR 1Z07A 1YRAA 4DLUA 4DXAA 2ERYA 1KK2A 4Y0VA 4Q1EA 1GNRA 1Z47A 1IN4A 3C7KA 2D3WA 4MYTA 2JLQA 3OZXA 1NKSA 1OIXA 5FTKA 1QF9A 1TF7A 3AM1A 1E2KA 4EPVA 4Q7MB 3CWZA 1GDDA 4LJ9A 3VR2A 4XWOA 3CWQA 3ZLJA 5LDDC 2QRNA 1VIAA 1K6MA 4GT1A 1ZU4A 3ND8A 2IL1A 4HLCA 2PT7A 3AB3A 3U60B 1COWA 4NCNA 2IYTA 5D3MA 2JLYA 4RD1A 3GD7A 1W36C 1Z06A 2C98A 1KI6A 1NRJB 3F0TA 1W4BA 1RIFA 1EXMA 1JI0A 4A2WA 4KBGA 4IVRA 3SNHA 5BN5A 1NI3A 3R9IA 3IEVA 3AVPA 1AM4D 4WZAE 1GZSA 1QHHB 2EFHB 5AJZA 4G0NA 4L15A 4TMKA 4IKEA 1P9RA 3PV0A 4PAMA 2RKOA 4BLQA 1FP6A 3QXSA 4US2R 4NONA 2BCJQ 1HT2E 1FTSA 4NTZA 5FTJA 2DPXA 2QORA 1W5TA 2GZAA 2Z43A 4Q4LA 2CHVA 2B6HA 5BN4A 1Q3HA 3LDAA 3T12A 1OSNA 2ZETA 3CIOA 3SBEA 2PH1A 2GHIA 4A0FA 2ZJ2A 4WZ6A 2KWIA 3QNUA 4BUJA 4BFWA 2WJIA 2DY1A 2FG5A 3CBQA 5EP4A 5HCNA 4XD7D 3QF7A 1KI7A 2EYUA 2QPTA 2VRWA 3EZ2A 3LQRA 4OQMA 4AK9A 1BIFA 2VP4A 2PEZA 3K09C 3LX8A 1E79D 2ZXUA 4TYWA 5KSPA 4GBMA 2YWGA 4TMWA 2YOFA 2DB3A 1JPJA 1WBBA 5KDOA 2OSBA 1KY2A 5BWMA 3K0EA 3VKWA 2IYVA 3L0OA 3GEEA 1GVNB 1MO3A 2J5XA 2A3RA 2Z5FA 3OAAD 2QY9A 4QHYA 4TQ9A 1Z2CA 2R6CA 3MMPA 1E0AA 2A5DA 1T3SA 2QROA 5DSZA 1F2TA 2UZ3A 2NIPA 2QMOA 3ECCA 4V02A 1G291 3Q9LA 5CYPA 4C2TA 2JJ1A 621PA 3BH0A 4PO9A 3ZVNA 5J4VA 1AIPA 2YVUA 3NHBA 4WOPA 4P4TA 1TQ2A 2JLWA 1LFDB 2OLJA 5CJPA 5SZKB 2HCBA 2ODWA 1DAMA 4IDNA 1J7KA 1H8HD 1IXZA 4QHSA 1OIVA 2ODEA 1ESNA 4LJ4A 2EFCB 2IHBA 3GLHA 1GKIA 2KJQA 1RW4A 2GTPA 3TJZA 2ZJ5A 2QENA 3IBGA 3K9NA 4BECA 1G6OA 1E32A 2H16A 4QBFA 4DLYA 3WRYC 4TL7A 4XVQA 1I2DA 1Z3IX 1Z6YA 3RRNA 2BIFA 1OXTA 4FW9A 4QL3A 4B75A 1KI6B 3KQNA 3WY9A 1LB1B 4D26A 4QGGA 2YC2C 1EFHA 1OXVA 1NN1A 2FV8A 2PZFA 3KKPA 1Z0KA 3UPUA 1G9XA 1E2FA 2IYSA 4DLSA 5C4MA 3OFND 1RKBA 1T8TA 5KNBA 2IYYA 1NBME 2F43A 3ZZ0A 1UKEA 3THXB 1KK0A 1M6NA 2J45A 1G20E 4PQRA 2ASEA 4CT5A 1UFQA 4F91B 2XNDD 1VDZA 3R8FA 4BLTA 1XP8A 3F5FA 1GRNA 4F7WA 1U0LA 2W58A 1L7VC 4ACBA 2Q3HA 4G5SA 1C9KA 3RYTC 2J0SA 3PXGA 1G3QA 2AL7A 3U7EB 2IWRA 1E1RD 4CW7A 2VH5R 4HB4A 4HDOB 5LD2C 2AFHE 1HA3A 3Q85A 4JKIA 1KYIA 5J40A 1X8JA 3V9PA 2HLDD 4TMVA 2X2EA 2QP4A 1FMLA 3S1AA 2EFDB 1N6HA 5KSZA 3BORA 3VX3A 4ESHA 3JZAA 2C77A 1NY5A 5CYOA 3DVLA 1G21E 3BS4A 5FFMA 2VL7A 2RGNA 5JECA 3LV8A 4Z8YA 2VA8A 3CNLA 4LC0A 3T1OA 1OH6A 2CCJA 3V4RA 2O8FA 3QKTA 1N0WA 4BPBA 3BFVA 4B34A 4B32A 5EE0A 5F98A 4C7OA 1NF3A 4I1SA 4P4UA 5FBQB 1WP9A 2O8EA 1XZPA 2J0UA 2ZRIA 5FUWA 3HDTA 1P2TA 1IOZA 1ESMA 1I4TD 5BYJA 2GJSA 3FHCB 3LD9A 3R9XA 1T3HA 2CVHA 3QF4A 4B2IA 4C0KA 1P4SA 2IYZA 3ZH9B 2ZRGA 4FWTA 3U44A 4W7SA 5KYKA 2A7QA 3AH8A 3PITA 4B35A 1R5OA 1YVDA 4FINA 4M9SA 3TE6A 1TL7C 2J0VA 3AF2A 5SZHB 4TQUS 2B21A 2GXUA 1DAKA 1W2GA 2G83A 1H8EA 2X77A 3AVQA 221PA 5JI2E 3U6BA 2O8CA 3N2EA 3UMFA 2Z4SA 3UMRA 1P75A 2QA5A 3Q7QA 3R8CA 2ZRHA 4V0NA 3RANA 1MKYA 1KDTA 4DLRA
chains in the Genus database with same CATH superfamily
3FNHA 1JBEA 3ZZ1A 5BNIA 4F4FA 2PLNA 3PXCX 4M6WB 4Q1DA 5DNCA 2CJPA 3ICWA 4MTCA 4BX9A 3UUWA 2Q07A 2QJOA 3PNQA 1FPQA 1K7SN 4UDYX 3VV3A 4O02B 1CJKC 4OJTA 4PG4A 4QPNA 4ARZA 5KINB 1U7OA 2HWXA 4OHUA 4ZKEA 4JC5A 1UIRA 1Z6TA 1ZVQA 2RH4A 3BIFA 3I9V6 4H3SA 2G0TA 2ZE5A 3BOSA 3IT3A 3JD0A 4A5OA 5IVKA 3IH5A 4BTVA 3PGXA 1N32B 1SIWA 4HPWA 3M9WA 3QYFA 4N1AA 2BZ1A 5FJIA 2ANBA 1TO2E 2H4ZA 5AIAA 4BXOA 3DUFA 4I66A 1DARA 2CWWA 1Y7PA 1HH4A 4QGBA 5ANRB 4MGIR 5H9VA 3VR5D 5JY1A 5K0ZA 1PHRA 2W90A 2X6QA 1P8JA 4KDRA 1ECFA 1ZP6A 3T34A 5J4HA 2PZJA 2ZQ5A 4GKJB 1U2GC 4YP1A 3O83A 1DJOA 4RZQA 1TIBA 3ZW8A 5AVWA 3MWJA 1OAOC 4CLHA 1CEQA 4B3XA 1OKKA 1TK9A 1U3WA 2QR3A 4CMBA 1HDEA 2DYKA 3LIPA 3GNSA 3LDUA 3T3DA 1Y6QA 2XOXA 1V8FA 3UYLA 1ZIYA 5IK2A 4RSGA 2OV6A 3V4LA 4KOAA 3ZCQA 2ZWOA 1T9HA 1WZIA 5TC4A 1RI3A 2YN4A 3AHJA 4IUCS 3KUDA 4IJKA 5TB5A 1IZ7A 2AFVA 1JDUA 4WCFC 4HX9A 4MUYA 3O7WA 4IF6A 5K0GA 4DC1A 3ER9A 1KWKA 2UUAB 3HYCA 5REQB 4AU1A 2PBLA 2ZUTA 1U9JA 3IR6A 4QUDA 1G5FA 3WISA 5K6AC 3MINB 2XCSB 4FILA 3O2JA 4IDBA 1IPFA 4Q66C 3HY6A 3O8QB 5CH8A 2CDAA 4XFKA 3FOFC 2JC3A 1VRCA 2MR5A 3NASA 4LWPA 1XWIA 4V24A 4D9CA 2XNHA 1NU8A 1A0OA 4TTJA 3BMCB 4OM7A 4ZVSA 4GYWA 3A6FA 3EZYA 3IV6A 1Y5RA 4P2GA 2QRLA 4FBGA 4OLHA 1SMKA 4ENTA 5FADA 1NJSA 5IKMA 1N2JA 4FHGA 2HRDA 3O95A 3NYQA 4HV4A 5FF9A 5H0IA 4G5FA 4C0WA 4CVNA 1W7AA 2IP4A 3W6OA 4WJKB 3NKVA 1PTJC 1G9TA 3OWHA 4RHYA 4G9BA 1JVBA 4O4LB 2Q41A 2PMBA 3SMVA 5AVRA 5HKBA 1CJUC 1L8OA 3ZE7A 2DHCA 2RHRA 3W8RA 3NDRA 2A78A 3HI4A 3M5CA 1TQDA 3MK31 2PFSA 2BEUB 3BKXA 3EA4A 1N1DA 2OAEA 5FTLA 2BY4A 4MAMA 3B9QA 3PK0A 3ZWQA 4WA7A 1N2EA 1YS6A 3PJGA 2DUNA 3H5VA 5IS2A 5BVGA 4IG9A 1Y7IA 3LI2A 4OQXA 4DDHA 3I8XA 3KVRA 5LXTF 3I1JA 1Y8AA 1X1BA 4WUTA 2QJTA 3R5KA 4R7GA 5BSFA 1UMKA 3KZCA 3F98A 4Z9FA 3TMYA 2YZKA 3WRWA 4A6XA 2C59A 4QLBA 2B4AA 1DHRA 1T5HX 1TO6A 1PD1A 3KVNA 4M0FA 1GYRA 4NCIA 3GRFA 4Y9TA 5HIMA 3QA3E 1E7RA 4HH1A 5E4YA 1IVYA 2GBIA 2I87A 4Y1EA 4JB2A 4YO7A 3EG9A 3N74A 1J2EA 2A0UA 4FCTA 1ST3A 4MLCA 1NUSA 2DPGA 2ZQYA 1CUVA 5B4TA 4C2UA 3DH0A 2N75A 3PRJA 3OFSA 4RK1A 2C96A 2CBZA 2R8RA 3C3BA 4N49A 4KGVA 2ONJA 4WMLA 1WWKA 3OQVA 1T13A 3LY5A 4MV1A 5LP6F 1WUYA 3EZXA 3NHJA 4DTCA 3L0YA 3GLHE 1PG5A 4JDUA 1NRXA 5B37A 5C35A 4YQEA 2TYSB 4AQDA 2BEJA 4GQAA 5WRFA 3UCFA 2BTEA 3PI7A 2B34A 4RWZA 4D4JA 1E6MA 2EXXA 3EWAA 2IDZA 5J2TB 1FS6A 3VI4B 1QHYA 1BU8A 3SYKA 1XEWY 1JX6A 4HSEA 5U9CA 2QZPA 1A9OA 3DW1X 1OXSC 2V6GA 3N07A 4OREX 4RS3A 2M6LA 1T34A 3OURA 4LDJA 1P4RA 3OJFA 4WRRA 4Y1GA 3FR8A 4HNAA 4YMVA 4ZOBA 1OCEA 4P31A 4YRDA 4JXZA 4NBKA 1OC2A 4ZEXA 4CM4B 2C31A 4QG3A 5ES4B 4B71A 1N2SA 5HGXA 1CR0A 2FW7A 2PUCA 4LQLA 5IT0A 4JQCA 4CHGA 4IDFA 5COQA 3OEEA 3STWA 3QELB 1VHTA 1G42A 2FB9A 1VBNA 3ISVA 4QDZA 5CD9A 5DRTA 2W0SA 1O89A 1YQ9A 1YRWA 3F3YA 2PIDA 3LLCA 4BX0A 4AJLA 5A2QA 3DNFA 3DD5A 2VP9A 2IYPA 1TYAE 2TMKA 2PZLA 4X92A 3ASVA 3LK7A 1ZESA 4Q9HA 2QIOA 2F1IA 2VNHA 4FDLA 2CK3A 5HG0A 9GPBA 3B13B 2PANA 5KYNA 1EESA 1ISGA 3IDQA 3NM5A 3HB1A 4UOQA 5F2OA 4CKBA 5MF6A 4F2GA 4BKOA 2F9LA 2HRCA 1Z16A 1BDBA 1QXSA 4OHYA 1DGQA 3WNCA 3A1TA 2UZ1A 4FFBB 3MG9A 2OMKA 1XPOA 1C3VA 3IAFA 1AXGA 1E8MA 4YONB 2G17A 1DUIA 1SWVA 4IDCA 2VJLA 2H0QA 5JSUA 5A4IS 4PBTA 5KTRA 3TOZA 1OYYA 4EVSA 1NHGA 2O0LA 3DZJA 3FNQA 4GSKA 1GG8A 3AI1A 1K66A 3GLTA 3I83A 3C87A 5BSUA 2I6FA 1ZGGA 3EBOA 1ZEJA 4NYMR 3ROMA 4HAUA 1IJEA 1Q0TA 3CZMA 3B6ZA 3QU9A 1K9VF 2C4MA 2H1WA 2Y0BA 1SQFA 2YWRA 1YJCA 2VOEA 1YZTA 1W8IA 3H1AA 3I5UA 3WDLA 2FPIA 3I01A 4KJZA 3E7DA 3F7OA 5KREA 2HKIA 3I2YX 4ZCSA 3R9XB 1D4FA 3CGWA 4LC1A 2ZI5A 5K0BA 3F4BA 1E2BA 1K88A 1KGSA 1Y7LA 1N2GA 2FQQA 3H5RA 1G4HA 5ADWA 2B6NA 2ETVA 3PFWO 2C8KA 2YZMA 4LA4A 4UD2A 3SHWA 4MB0A 1YFJA 3G2HA 3EVAA 2ZYUX 3R5XA 4FHZA 1XDBA 4X8MA 1DTWA 4DY4A 1CVRA 1OFUX 4TLBA 4R1LA 1K8YB 4H1TA 2ZRLA 1T5IA 3JYOA 1I5OA 2B3TA 1DOZA 3CZRA 1XA0A 4DQLA 1I3LA 4A6EA 4ZZ1A 2NZ8A 4PYLA 5EQJB 1KO5A 3GD5A 3O9ZA 1XMIA 2YV3A 4R0NA 3DW3X 4NE2A 1IIRA 1W49A 2ZJZA 4GXRA 5K45A 5BSVA 3AIKA 4EW1A 4HDRB 5H16A 2FEMA 3JD4A 3OTOB 3IUBA 5J4YA 3K2IA 2FZEA 2F8SA 3L1KA 1NBMA 1ZJ4A 2Q27A 3OOHA 3HMQA 5TQJA 4OJNA 1AGPA 3H8SA 4XTCS 4QUIA 4N18A 5EFOA 1UJ5A 1R9MA 1PWXA 4PXSA 4TYMA 2GZSA 2WIKA 3ANLA 1CULC 2AR7A 2BISA 3OECA 2QN1A 2X3FA 3OJXA 4K46A 1QK3A 4IIHA 4NNJA 1BX3A 3ROXA 4B6RA 1ESEA 1XO1A 3L8EA 1PJAA 3MAJA 5JVDA 3H3FA 3I6BA 3LCVB 2FFBA 4BJ6A 1GNVA 5FL7A 1JU4A 1AS0A 3K0CA 1MB9A 4LG1A 1XQ6A 2D3TA 2WUGA 4ZEOA 2QE7D 3ETJA 3SWWA 3CVOA 3UIEA 1C0LA 4FQ8A 4B3CA 2JFPA 4QTZA 3SKYA 4DR2B 2WM2A 2FR8C 2EX4A 1BE0A 3CLSC 4PX9A 1UOOA 4XM1A 2A5GA 2OYCA 1E3WA 1M2VB 1SC4A 2JATA 4LYFA 3VKUA 3NIGB 4RAOA 4UBMA 2QRQA 4FX5A 4BNIA 1Q3TA 5B55A 1PEAA 4B4UA 4L0DA 1DRUA 3EF1A 4QPZA 1Y7TA 3ANMA 4RVGA 4TM8A 4YY3B 1HPLA 4PSCA 3T15A 1LJ8A 1FQJA 5FOXA 1MD9A 5HE8A 2FOXA 2NT3A 3GA5A 4BO7A 1XU9A 3W8EA 1N6OA 3N76A 4BNWA 4A6PA 4MWZA 4IHQA 1YDEA 3SC2B 2AIRA 1FDTA 1SQ6A 1U0FA 4D97A 5I7FA 1JDPA 2F2TA 3BMNA 3FB4A 2QN7A 3KVVA 1VI5A 3QVKA 2PQMA 3U49A 2BGMA 5CFMA 3GLFA 4B44A 4Z54A 1ZLYA 3U3DA 1GQFA 2HIAA 5T7BA 3A9SA 3D1JA 1THZA 2XCUA 2G6BA 4JP1A 4QASA 4ZEMA 4IDAA 3ZX5A 1WCXA 3H84A 1DTWB 2O1SA 2X40A 4FB4A 3L8DA 4EVRA 1NM5C 1PFGA 1UK7A 1FE8A 2P1DA 3FMPB 2Z83A 1CIJA 3QYJA 2WAAA 5F4BA 1E69A 2IXFA 2O07A 1T9KA 1SVMA 2VQEB 1SK9A 1Y6FA 2VKQA 1T6YA 2FRDC 1VJDA 1HRKA 2VZ0A 2A86A 3EMDA 1S1MA 3LLMA 2PSJA 5BWCA 3D7KA 1BMFA 3EY4A 1LX7A 3EWSA 2YWDA 3WGHA 1CLUA 4NRDA 4RSHA 3S2GA 3QUCA 1KMMA 3N8IA 1N5OX 1I10A 1TW2A 1AA9A 3LG2A 3UN1A 2ETXA 1SRQA 5A06A 1ARZA 2HH9A 3GOQA 3QXHA 4WCVA 4XKJA 3ZXYA 2IUSA 4B7UA 2I7DA 3NTOA 3E22A 4IUDS 4LVNA 1R6TA 3IP7A 2FX5A 3IUYA 4W5HA 1X0XA 1ND5A 4JT8A 4TZ6A 2REQA 1VL0A 2FFQA 3W5BA 2EFEB 2ZT5A 4O4JA 1L8XA 4INOA 4JUBA 4PG7A 4IV0A 5EJ9A 4FMCF 4HLUC 3EB9A 2X86A 2XTMA 3I72A 1ZMRA 1E5LA 2XY4A 4NARA 1LBIA 3H9BA 4KIJA 1P0CA 4R8RA 2D74A 2XUFA 4FCWA 5GONF 2OXIA 1QYWA 3B48A 3PPIA 4ATNA 3F4LA 4P38A 3A3PA 1FDSA 2WE7A 3KKQA 1G8FA 3NKLA 4FFRA 2EDAA 1DWOA 4W5JA 5CMLA 3R7BA 3VKFA 1JHVA 4I8DA 2XLCA 1XTTA 1Y3CE 3ICEA 3BSFA 4DSAA 4LTDA 4C7KA 3DOFA 4GO1A 1GD1O 4BDSA 1Z75A 3W3AA 1JHXA 1LSOA 1E5VA 4HGOA 4FOLA 4M8NE 4CCSA 5JFGA 2PUEA 1K9SA 2X6TA 4KWTA 2Y0PA 1UQRA 3KFXA 3L4BA 3OPVA 4KV9A 4LDNA 3RIHA 5BR4A 1NVEA 1ZD4A 4JLDA 4D9HA 2DC1A 5A4JA 1H4SA 5HWSA 4LHVA 2JS7A 1XZHA 1Q12A 3OQJA 1T4CB 2VF8A 5AW3A 2GBPA 3EQ6A 2VJOA 1YZ3A 5K0JA 3B6EA 4RA6A 3U4QA 1U5CA 3O3MB 4KACA 3FBWA 2VDWB 1A7KA 3A8TA 4X3CA 1EGHA 5CIQA 5EN4A 2BAGA 3SXUA 1GCOA 3TGWA 5A3JA 1XTSA 4ZA2A 1CJMA 1DJNA 3PEFA 3JATB 1XCMA 3O2SB 4DQXA 1JJVA 1K98A 2VSNA 4F4JA 1KZ9A 4Q47A 1WDKA 1KKUA 3A36A 4XGNA 3PS9A 5C51B 4ESVA 1PT7A 4C07A 1ISSA 3K0FA 4F2WA 4E2WA 5AW6A 1H2ZA 3HZHA 3I12A 3GJYA 4HS4A 1TUIA 2D59A 2R79A 2CB9A 4D9EA 3G5LA 3I2FA 1FX0B 4YMTA 3OHPA 5CEEA 1P0QA 4XB2A 2N42A 3D3EA 2BKXA 1OGJA 2XXJA 3I92A 4DKJA 2M2IA 3R6TA 1NSFA 3BRCA 4A73A 3UGJA 3QX8A 3UJ7A 4L6AA 2WAOA 3COYA 2AZ4A 1JE0A 4P33A 1W87A 2REOA 3H83A 4X00A 2CJWA 1CUYA 3GX1A 2J85A 1WDMA 3P5BA 2XUAA 3O7MA 4MKZA 3D8NA 3RVRA 4AZVA 4CDMA 4DA6A 4HGNA 1XMVA 4PTLA 1A2KC 1QC5A 4MW5A 1CP2A 4UNPA 4N47A 4EHKA 1AT1A 3ZHQA 3IIEA 1AE1A 1Z5ZA 5THQA 3BD8A 2B36A 3G13A 3ZHTA 1GLNA 2X4IA 1K68A 1PYDA 1QB8A 3IV9A 2CFCA 4DWVA 3PSHA 3Q88A 1ISMA 4H31A 5CX1B 1M67A 1UKZA 3BUSA 3OUZA 3BCSA 1Y8RB 3GRKA 2GXAA 5DM1A 2VZ8A 3RS4A 4NG5A 4UHDA 4XRRA 2DQSA 4F8EA 4NFYA 5B57C 3A05A 3KOUA 1NJGA 8AT1A 2C2BA 3ONDA 4IRUB 2V9ZA 4YGXB 1ZHHA 1QGED 2CN1A 5TPWB 5KTPA 3EH2A 3JXEA 2HK7A 1GILA 3HA7A 4QYXA 4MUAA 4ZT5A 1KGDA 3C43A 4RTKA 4YP9A 2IXTA 4HPJB 2RGWA 4FYKA 3ZS8A 1JKIA 3SCZA 4YUWA 1SKYE 4GLLA 4D6XA 1BMQA 3Q9UA 4H4CA 4KQ2A 3EYAA 4RA9B 3TI9A 4LFBB 2UDPA 4RJTA 3RVDA 2BMWA 1WXIA 2HW8A 2B8WA 1HNNA 4MYSA 2TSYB 3NATA 1JEQB 2QM7A 3CNQS 1U31A 4FLMA 5HTKA 2Y71A 1ZAKA 2E5WA 2IT1A 3HBFA 5DNUA 4PE5B 4PBSA 3AM5A 3KX2A 4EHHA 5KQGA 1V1MA 5KNDA 1TOAA 5LYJF 4QA9A 1M8JA 3T7AA 4YAGA 1LFAA 4B4WA 4CCAA 4G1FA 1USGA 3GT3A 3IAM1 4Y8VA 2VPXA 2DXIA 1ADGA 1D0SA 1JG7A 1Z74A 2Q5EA 3PWSA 4BMZA 2WWGA 1X80B 5T6BA 5GWXA 2RD2A 1UAGA 5EMHA 1EQUA 1U5BA 2TMYA 3S5UA 5HZKA 2IF0A 1U5AA 4U2BA 2YJGA 1RYMA 4PRZA 3TJRA 3WZ2A 3OFVA 4R2HA 1JB1A 4M22A 1JJAA 2ZYWX 2DCMA 3DT6A 3MS4A 5K8TA 1KMNA 1LPAB 5GV8A 3SDBA 1TM4E 2QQFA 2VIIA 1SZDA 4TVSA 3I32A 1ONPA 2R8BA 4WY2A 4TOIA 1EYZA 1LF5A 4EY4A 1HQDA 5DGCA 1V96A 1PQ4A 3N2IA 3NTXA 1D07A 3ZWBA 2G0NA 3AERB 1BMTA 2O2SA 4RTJA 2NPFA 3PEUA 4JOCA 3JPWA 4O29A 3V7NA 1EWTA 1EP1B 1EUCB 1FUKA 1WZ2A 1POXA 5EXSA 5IVDA 5CX1A 3H7IA 3PIIA 4J0JA 3DNMA 2GEVA 3IMFA 3U31A 4YYEA 2VJYA 2ZUVA 4UDOA 1NUTA 1T4BA 2RG7A 1BN7A 2RGDA 3EGDA 3PC3A 1DC6A 2ISSD 4WPGA 2GPAA 2O6HA 5F9HA 5ALEA 4ZOLB 3SOZA 1W36B 4KXMA 2GRUA 4Y2QA 3KKNA 2NUTB 4U6NA 1Y1QA 2WJPA 4GOLD 3DAOA 1A9ZA 3H8JA 1YZKA 4LCJA 4A10A 1NW9B 1DP4A 1GEGA 2RAPA 2WA2A 3SYLA 1UJ6A 5AVJA 4DR6B 2AX4A 1K5HA 4EG3A 1U3UA 4DPLA 1GPNA 2CLFB 1SU6A 5JVDF 5DM60 3IOMA 4HRXA 4QTXA 2XBUA 4LVOA 2WW8A 4LZLA 4DZRA 2J87A 3BZUA 5FTWA 3G0OA 3BULA 2C42A 3ZWYA 2X4DA 4RHEA 2VJQA 4ND3A 1N9KA 5HDQA 3FVTA 2W22A 1B2LA 1JEEA 2B30A 2PX0A 4K6KA 3BB3A 5KVCA 4RKRA 3LZDA 4CDNA 1XR3A 3UKDA 3U7HB 1N7IA 2RARA 4ISBA 5JC8A 2QYOA 2XRYA 3OPNA 3GVIA 2WUDA 2AZTA 1OWOA 3GEBA 3FI0A 2IODA 3ABRB 1W6UA 3B1VA 2C5LA 4FNGA 2I8CA 1YONA 1JEJA 3GP5A 1QKKA 3ZYZA 2XB2A 1KOFA 1P1JA 5E2BA 1RI1A 4AP6A 5C1BA 5JSZA 1GJRA 1W4CA 1IK6A 1Y9DA 1OI2A 2UUPA 2V59A 1XTIA 2VTEA 1MF7A 3DXFA 5TS3A 3P2MA 1KDVA 3WS7A 1G3UA 5KNCD 2W48A 4IMJB 3RNOA 5DCYA 2IPOA 1W29A 3HB9A 3VYRB 4C0JA 4X8HA 4F3CA 4FVTA 1D0VA 2QR2A 3N58A 3IP3A 2WQZA 1MC4A 1WCIB 1ZN2A 1L5OA 2H5JA 4RHXA 5ICFA 3TZEA 5K9ZA 2ZCJA 2QWXA 3GLQA 1IUOA 4Q0MA 5K3AA 3RRJA 3WGMA 3ZZNA 2BKUA 4I9UA 3LBIA 1B8UA 3BD7A 3SHOA 1P9NA 4L75A 4YXFA 1QP0A 1Q77A 2GWHA 4HNSA 3VNVA 1C0EA 4BIIA 3H75A 1KYZA 1M3SA 3NEYA 1BO6A 4ZAYA 5EC8A 5LL6P 3OZAA 5IJAA 3SLKA 2F90A 4M9QA 4N12A 1ZAYA 2BFDB 3DHYA 3ZWPA 4EUKA 3R5TA 4UVGA 1EE1A 1WXXA 3EDMA 1RJ9A 1LY1A 3I5AA 3PUXA 3QGMA 4P5EA 2VYQA 3AC0A 3TSOA 1TTQB 4DLVA 1RC8A 4NCBA 1Q57A 1Y4SA 1LRKA 4FYMA 4ZHSA 1IQ0A 4DTIA 2XF8A 3NX4A 2WAYA 3TB6A 2LKCA 1OHHA 4I9HA 5CW2A 4M99A 4HNQA 2ZM5A 2HDHA 5IXJA 2CLKB 2IS2A 1TK2A 1V3QE 2D7DA 3NB0A 3CKLA 3TZKA 3BQMB 1BEZA 3N0WA 4WGGA 5BV7A 3HQ4O 4IXDA 3BH6A 2HBRA 2CFIA 4E22A 3DBOB 5ALRA 3GJQA 4C4ZA 3IAHA 4F6LA 3PQ6A 2V74B 5JZOA 1SHKA 4TZTA 1WXFA 1AK1A 3WK9A 1C7JA 5BUZA 4G6ZA 2G06A 3WGOA 5DLEA 1K63A 1Q1EA 3AJ8A 3DBLB 1EM6A 4NV3A 1NMQA 2NAFA 3BDVA 1UMCB 4AMVA 1SCJA 3TM4A 1DBRA 4J0HA 5DWVA 1BYUA 2C5BA 4OXKA 2FG7C 2R85A 4WOBA 4TYNA 1DBVO 1UEJA 4AJ4A 1P7YA 1ILWA 1K1EA 1U7DA 4DMHA 5JWHA 4EQZA 3W9YA 2ZSHA 2JLBA 2BL4A 2R2AA 3ND7A 1OAKA 1X7YA 1RXIA 2ET6A 2XWPA 3OVMA 2DOKA 5DXAA 2HZ7A 2IU0A 1RYYA 4M1WA 1V3TA 3IKLA 4P93A 2OCXA 3NP9A 4LYAA 3WL3A 3WQSB 2O0MA 5DYGA 3R3JA 1IBKB 4UZEA 2HEIA 1RHQA 3P2JA 4PICA 3UJDA 1XLTC 2PUAA 3KL2A 3PVZA 2VSXA 3G7SA 2PJUA 2GBLA 1EA7A 5LKAA 3OPXA 4P58A 3TW8B 3AETB 3U4CA 2PZMA 4C9BA 5TVKA 1IIBA 1EDEA 1H65A 2OL4A 2X3UA 1BVYF 4MPPA 2YJTD 2XHEA 2VAXA 1I2CA 3W90A 1EVIA 2AMYA 2EZ4A 4IGAA 4B09A 1HKHA 4NEGA 1R10A 2AFIE 2HRZA 2XECA 3KHTA 1Z2AA 4IZHA 1VQ1A 2BV3A 2FLVA 3TW6A 3HU1A 3JQFC 2GA8A 3IPCA 4HLNA 4KWIA 4KU4A 3LUCA 4LIPD 1TADA 4O8CA 4K26A 4BAUA 3T3MB 5E8JA 1P18A 3WIBA 1N5DA 2GFHA 2WIDA 3MCAA 4BKPA 3SHTA 3OQMA 1F0YA 2VDQB 3IJEB 1PFKA 5EJ2A 4AUMA 2N9UA 1P17A 3WV5A 3ETCA 3Q8XB 4P3KA 1PYOA 3EVEA 5F1OA 2O9JA 4U63A 2O2DA 2XB4A 1V6SA 4H7EA 1GZDA 1I1OA 2BP7B 2YHIB 2Z1NA 3DDSA 2HIMA 4O0LA 1BRTA 1NP6A 1VFPA 2WHXA 4MUIA 4TLAA 3OCCA 1XZ8A 4F3YA 1CF4A 2V1XA 3HL4A 5JVDB 4AURA 5TLSA 1MAWA 3RS7A 3K9CA 4Q4JA 1OX5A 1XHLA 2X42A 4IGKA 1FXWF 4HDNB 3CH7A 5KI6A 1GTSA 2GNPA 2CZCA 1JLSA 1V26A 4E7PA 2QZJA 4PS0A 3EBLA 2XV1A 1QO7A 2DPMA 2ZCVA 4ROSA 2GI4A 3FXAA 3C48A 3I9JA 4K28A 3RLFA 3BTUA 3OH8A 1OB5A 1M2WA 3IAM6 3DTYA 5E9JA 4WA8A 1NW7A 4DADA 4BFXA 4KQKA 1RPAA 1AHIA 1V7PC 3L8MA 4OK3A 3N5KA 2CXPA 1T15A 4CMEC 2K5UA 2ABWA 1V11B 2I67A 2AW5A 5E8RA 2EX0A 4YRZA 4M8LA 2HMAA 5IJ0A 1VMKA 2DR2A 1MVNA 3VC7A 2WFZA 4D0NA 3HJTA 4KR6A 3Q87B 4OBXA 4Y2GA 2UVPB 4CKWA 5HZHA 3S2ZA 4WADA 4FU0A 1HE5A 4MW1A 4P92A 2MSCB 4BRWA 2HO4A 1JDBC 5KJ6A 3LU1A 3PDUA 2D5IA 1LI4A 1IJBA 4EQ6A 4GVPA 4KH0A 3WLIA 1VZ2A 3K0HA 1XELA 2E2WA 4IGFA 4BLOA 2CC2A 1FCJA 1DEHA 3VZDA 4DG8A 3HMKA 3ADCA 1FYDA 4AG6A 5JU6A 4K0KB 4Q48A 2GCOB 2AQIA 3PHGA 4O59O 5AM4A 2G1AA 1M6VB 4K40A 4B0OA 5BVHA 2QTMA 4ZJYA 3LRXA 2VHQA 4HGZA 3FMFA 4PPYA 5B30A 4KR7A 3NWPA 3I62A 1RHKA 4KAJA 1VYHA 4BNKA 3BF7A 3K7EA 5FNVA 4H6WA 3JQ7B 5EIWA 4I7EA 3VPSA 3M33A 8ADHA 3LXMA 1W52X 2ZTVA 1QMGA 1HL7A 3KHSA 2DKNA 2JIRA 2R8PA 3SJ7A 3GI1A 1JHAA 4HR7A 1VGRA 1IEVA 4E14A 5AXCA 2OE2A 4R41A 5CHYA 4AUKA 4BQNA 4QIHA 1YZYA 3D6MA 2I1LA 2Y67A 3AUFA 5EIEA 1IBLB 4KR3A 2XOEA 3IOYA 5IK2D 3KB1A 1JWBB 4MI1A 1U7ZA 3PEYA 1S8AA 3CZ9A 3VH2A 4CUZA 2WQ7A 5K4HA 4UHJA 5LZ4A 2P0YA 1SXJD 2VPYA 2XRMA 5B6IA 4QBHA 4WXEA 3U44B 1BXRA 1N33B 5EJEA 3FOWA 2I7CA 1GNQA 4IIEA 5DNAA 1O0CA 1NUUA 2F62A 1X39A 3N8GA 1ZVKA 1BEUB 4EFMA 1P3DA 5C53B 4QU8A 1TVCA 5DGTA 1W2WB 1CZHA 4BMOB 2CY0A 1JLLA 4MQ5A 3O8BA 3O8OB 4UEWA 1GGNA 1TU3A 2G08A 1YA4A 4B9EA 4F6CA 1SBYA 3KSMA 3N7TA 4LJ7A 4DBZA 4DUZB 1CZOA 3V8PA 4UOEA 3X44A 3L7YA 3RE1A 1L7DA 4K8RB 2FDXA 1WUJS 3L8GA 4K03A 2VPQA 4L4RA 1T3GA 3MJCA 1G8YA 3R9KA 2Q4DA 1SD5A 4C0XA 2RH9B 2AOXA 1C1XA 2D1YA 1Y9AA 2JIBA 3AR4A 5ALGA 3OX1A 5KOJB 4M9ZA 3T95A 5G3ZA 1Y89A 1GAQA 5UKDA 4R6XA 3WRYA 4YALA 5GM2A 1SB8A 1LVHA 3EYWA 3EXFB 5CP8A 2G9UA 1HG0A 3EC1A 3PQEA 3S8EA 2FGKA 1U4OA 2G4LA 1A9YA 4JT9A 4B2YA 4GL2A 1TQ4A 2FSVC 1IY8A 1UODA 3LHDA 3W2IA 4B3TB 3FWZA 4TWZA 1BH2A 1CRQA 3E7FA 4G0YA 4PC2A 5K0NA 4DMFA 2A5JA 4YPOA 1LUAA 1GCIA 1ENPA 4P80A 1KQFA 1DLIA 3H7AA 2HBYA 4I4NA 2YNMC 4A36A 1FMCA 4PGAA 2O8NA 4KKXB 4ASUA 3T3NA 5EE1A 2XYRA 1RXVA 1FU7A 4YC7A 3G2PA 3HO6A 1JAHA 2ZBFA 3NHMA 3QPDA 1AXRA 3QWBA 3DS8A 2BDUA 3DM9B 5AQEA 4PG8A 3TE7A 4YV7A 1NW8A 3KXDA 4ZYWA 2ZYIA 2J0QA 1PKEA 3V3KA 3FSEA 2YUIA 3UJCA 4D9FA 1PR2A 1EI9A 4BO6A 3SX0A 3PG5A 2QAJA 1TLTA 4QUBA 4OYHA 1EM8A 2GCIA 2ZE7A 4RIHA 4D0LB 1MU0A 1IHDA 1RQNA 4TVKA 1YAJA 1DXOA 2L2QA 2J07A 1FFGA 1XVIA 3BM5A 4HXYA 3BJZA 4RCZA 1PDWA 4XFJA 4KMMA 3IVRA 4K0RA 1N77A 5E7JA 3DAYA 1XU4A 4F5DA 4P3PA 3K2QA 4TLEA 4ZU6X 2FFRA 4H4DA 2I8AA 2Z5LA 3FPAA 3IESA 3M70A 5CFQA 3KQLA 1Z9BA 1GN8A 3KG2A 2ZP1A 3AB8A 3AHFA 1KZ1A 3EAFA 4JA0A 3UAYA 4AP9A 3NNDA 4XDYA 5HFJA 1CHDA 5C32A 3E3OA 3RSZA 4HK4A 4RXMA 2YDYA 5TPWA 1TVEA 2CFSA 1QU2A 2Y1GA 1NBOA 2ZYTX 3VH3A 2Z2JA 1RJFA 2P2CA 4JC8A 4DR7B 3FOCA 5KS2A 3KD3A 3GGGA 4C6HA 1YR9A 4CM9D 1UJCA 4DRYA 3MW8A 1KDRA 1LDGA 2BKVA 1JGTA 2HQSA 3EW7A 3ON5A 4LRXA 4XPIB 3IBSA 2QT1A 3ENZA 3ZU6A 5KOJA 4TSKA 3UJ3X 1LSSA 4LWZA 1D2GA 3WO0A 4JJKA 1QKIA 2XZTA 2XKJE 3G2QA 3LE8A 4TS4A 2ZU0C 3THSA 1SC3A 1X7XA 1JU3A 4O2LA 4X9XA 1EFVB 4CMAA 4G0ZA 1RCUA 4QQNA 2JEYA 3UMBA 4V2UA 4ZVLA 3C3CA 2QYHA 3A6DA 3OFJA 2AYXA 1TGYA 3P2IA 2D0PB 2E7ZA 3R3SA 5CJ2A 3C2QA 1YDMA 1M6HA 2C2KA 2ONYA 2QTCA 4I6GA 1DQZA 4P9NA 5CLIA 4HDAA 2VG8A 3IAEA 4L9SA 4UE3S 1NQXA 2R1VB 3WO1A 2EFGA 1UKAA 3S0JA 4WGFA 4DSOA 2XMZA 3SX4A 2QJFA 1U6KA 2WD7A 3OTHA 2AYZA 5CDYA 2R6JA 3TZHA 3IP8A 2HF8A 4D9JA 1US8A 4WZBA 2A1TR 2V65A 4J16C 2P0AA 4GZLA 1BAPA 4YT2A 4S2EA 3NBKA 4K81B 2F17A 1OGYA 2NZ2A 1H5QA 2NXJA 3G8DA 3B6JA 2GN2A 2L17A 1TYEB 2VOJA 2WDPA 2Y1KA 3WB9A 2IHYA 2XXAA 5DBEX 4QPPA 4F9TA 1Q21A 1X14A 7MDHA 1N36B 5JRDS 4A16A 4RD4A 4UEOA 1NWCA 1G7CA 4UPVA 2HMSA 3JQAD 1P80A 2J7KA 4DQ0A 1JYEA 1QDLB 2JGEA 2HSEA 3KQSA 5LBIA 1BCRA 2P67A 4BJHB 4QFCA 4AS1A 1CZKA 5G4KB 2IGTA 4PHGA 3T5MA 4WAUA 1ZR2A 2EZ9A 2JGNA 1A9PA 4E33A 3CZ5A 1T4GA 3QBEA 4YCBA 5HGJA 5A0FA 2YV2A 4PG6A 1E1MA 4ME6A 3AB7A 3BGIA 4MUXA 1GSAA 1LH0A 3KXPA 3HJRA 3HADA 2NQTA 3KXIA 4PLGA 1LBQA 1K2WA 2Q7XA 4X1OA 2AOTA 5JH7B 5HK9A 4UW9A 1ZM3A 3NU1A 1U2GA 4BP3A 3NHZA 1VA4A 2W2TA 4EI8A 1H2RS 1VE9A 3DHWC 4HWGA 4IP0A 1KZGB 4LCBA 4MCIA 4Y2HA 1AHHA 2IYFA 2OO5C 5KSOA 1XPJA 1J8YF 5M04A 1K8RA 4YCDA 4AIRA 1UBGA 2FHPA 1OXUA 3GOHA 4FSHA 4L3VA 3V4FA 4B3MB 1R74A 3B1FA 1KY5A 4F9GA 3OETA 4CF7A 3LVRE 4LZWA 2ZG6A 2CHEA 3KLOA 1LU9A 3G1TA 1JMKC 2IOFK 4DUYB 1SUFA 4OGWA 2ODTX 2JGDB 2WBLC 2YRFA 2DZDA 3GJ0A 2E0IA 1TTHA 2Z3ZA 3HGMA 2QUIA 1H42A 3BTOA 2JFOA 5K1ZA 4C29A 3D3KA 5FUXA 2JIMA 4D3XA 2EW8A 1B42A 1G8JA 2DBZA 4WK0B 1YJQA 4V0LA 3O1JC 1XZJA 1DAHA 4AJNA 2PUVA 1O54A 2OO7A 2X2PA 4D57A 1SVSA 3ORSA 3VOBA 1Z2EA 2IOYA 4P7FA 3LYAA 1M34B 1X1SA 5F33A 4ZTUB 4KSBA 1FFHA 1LS1A 1SXJE 4XSVA 2DUWA 4QE3A 3TTWA 4BVLA 2GEBA 2QUZA 1XMOB 3HU3A 4AMUA 2ZI4A 3HYRA 1G3MA 2I2BA 2GEFA 2C7VA 2G1UA 5TQ2A 4O4IA 3U0VA 3NAZA 4CN8A 2V45A 1JE1A 4YRGA 1JH9A 3FPCA 1UBJS 2Q0HA 4M6WA 4JGGA 4XWWA 3FGPA 1FMJA 1XCOA 3QIAA 3PEWA 1FYXA 4R54A 1NMEA 2O3RA 3JARB 4S1TA 1XJ0A 2GAAA 1OTYA 1ZMTA 2GD2A 3GFVA 3IAAA 1H1LB 4Y2PA 1FXUA 3KV3O 5E3IA 1KIMA 3U6KA 3KZ1E 1O95D 1AK9A 1NYTA 2NVUB 3ZIDA 4NJEA 2J3HA 3SKVA 1ZVVA 2ZIFA 4HQOA 2H2IA 3GUYA 1E77A 1JIXA 3Q1KA 2Z9DA 3VFDA 1X7HA 2IHKA 5IC5A 5AVUA 1OROA 4RHFA 4V0RA 4O4JB 5L95A 1I1HA 1N9ZA 4ZV4A 1XQ9A 1EGQA 4MGEA 4YRCA 2HB6A 2LCFA 3L77A 1W5FA 4GWKA 2FPWA 3MGAA 4KYVA 1WF3A 5B7NA 4NLLA 1KFCB 1F8YA 3W06A 5KNDD 1GQYA 3WLHA 2HTFA 4ZI3A 1MG0A 1JP7A 1KAHA 2WIAA 3UCEA 4E70A 1H1TA 2J08A 5D6NA 4MJ3A 4JYMA 1UJMA 3FMOB 1XDGA 3M5DA 4JI8B 3MGGA 1CTQA 3BWBA 1YR6A 1PT9A 3UJ8A 4G3XA 4D82A 2WP8J 5LQJA 2WHPA 2WFLB 3C16C 3QJ5A 3RD5A 2Q5IA 4J16A 1UBFA 4EEKA 2OB2A 1U2DA 2C20A 2AQKA 3LDHA 2CXHA 5BSEA 3S1SA 3D0OA 1JLHA 3PUHA 1NQWA 1T4CA 4P22A 1QANA 5DZSA 3AQ4A 4B7CA 4BYMA 3GLFE 1ZRNA 1MX3A 1D6MA 1MZPA 2G04A 2VDWA 1OWNA 5FTMA 2BTOA 4O4LA 4KMSA 1EUYA 5REQA 5KC9A 3ZWAA 1A9QA 4QC2A 2NSDA 1E9DA 4C7XA 1JSZA 3KVYA 1MJGM 4L9AA 3DZ8A 4MV7A 4S0ZA 5FNZA 1SKAA 3TK1A 1CUEA 3G8BA 3UZUA 1O08A 2ZB7A 4CM1A 2Q3DA 1E0JA 1TM5E 1ODSA 1TU0A 2WZBA 3AHEA 3F4KA 3L41A 1G1MA 1B6SA 1Y1KE 3QK7A 4A27A 1RQGA 4C5BA 1DX9A 1W46A 3CJRA 1B0AA 4QFBA 1TCBA 2QP3A 3JYNA 3E3NA 4TT3A 2KMLA 3KLBA 3H3JA 4X6YA 5BSKA 4IIJA 2PS1A 3K9FC 2B4QA 1AHNA 1ZFNA 2Q4OA 3AP2A 5AK5A 5AXBA 3VU0A 1ZG3A 3AZPA 1GPJA 1PJCA 3MYRA 2R9VA 3MCVA 4HNGA 2OHOA 3TFOA 2J7PA 4JQYA 5IRCD 5KHLB