4Q7LA

Structure of nbd288 of tm287/288
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
b'SGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKEAALEVLFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized ABC transporter ATP-binding protein TM_0288
molecule tags Metal binding protein
source organism Thermotoga maritima
publication title A Transporter Motor Taken Apart: Flexibility in the Nucleotide Binding Domains of a Heterodimeric ABC Exporter.
pubmed doi rcsb
total genus 88
structure length 255
sequence length 255
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q7lA00
2C9OA 4QHTA 2QGNA 3RWOA 2UZIR 2DCUA 2NGRA 3KQHA 5GVRA 2PMDA 4A6XA 5HCIA 2WICA 5C4GB 3Q5EA 2WJHA 1E2FA 3CLVA 1ZUIA 2IYWA 2HEIA 2VQSA 2HUPA 1FUUA 1CR0A 1OHHD 2H17A 3B8HA 4P33A 2ODNA 1GNRA 3LLUA 3U3RA 3C4JA 1SVOA 1S0UA 4KSCA 4NYIR 3LLMA 3B9PA 3RS4A 2ZYTX 1IAQA 1YZTA 1G3RA 4Q21A 3D7MA 2ONJA 2J0VA 1Z2AA 2Q6TA 4X8MA 3BGWA 4BASA 2WKRA 1G7TA 2ANBA 5LD2C 4NYIQ 2HT6A 1ZD9A 3JZAA 5EXSA 4OQFA 1KK2A 4EAQA 1NVUQ 5E7MA 5FUVA 1WBDA 4TLDA 4CEIA 1TTTA 2P0EA 5IHPA 4N0DA 5AUNB 1XFAA 4FMCF 521PA 3SI7A 1FUKA 1YJ5A 2IUTA 5CITA 3U6KA 2FNAA 2F9MA 2ZSBA 3IEVA 4URZR 1XTKA 1G16A 1TUIA 2Q9CA 5TARA 3L8ZA 3CIOA 2J41A 4G1UC 4OQNA 1X8KA 1KZ7B 1B0UA 4L16A 1MO4A 1Q3HA 1TAGA 4FI3C 4XWKA 3R8CA 2G0NA 4HATA 2GXUA 2RB4A 4JBWA 4NHOA 4BLOA 2O52A 5HPYB 3UPUA 1KSHA 1BYIA 2G1JA 2VL7A 2YC2C 3NC1C 2G9NA 4YC7A 3VQTA 2ZI4A 1Y3AA 2PT7A 1U8YA 2GAOA 3LQQA 3NHAA 4JSTA 3BIFA 4URUR 3AVYA 2XZPA 1MRSA 4MKHA 1E2PA 4RZUA 821PA 5FBVB 4CDGA 1KNXA 3EW9A 3IO5A 4QGGA 5CDFA 3QBTA 4NMMA 3T1OA 4PHFA 1U8AA 1JXOA 1AK2A 1VHTA 2GEVA 5AK0A 1MV5A 2WAYA 4FXPA 4W5WA 5FOVA 1E9CA 1R7RA 2QPTA 1F2TA 4K81B 5FTMA 2C96A 5E4FA 4NH0A 1XEXB 3F0TA 1VG9B 3CRW1 4AG6A 3B1XA 2WKPA 1EK0A 1W4RA 5AWFC 3TVDA 1DAIA 1OV4A 2BEJA 4DLSA 3ADCA 1E1QD 4XIGS 4C0KA 4UNNA 5AJWA 3CNOA 1E9DA 2R44A 1CR4A 2VP9A 2ZS8A 1G17A 2IK8A 3K0AA 4DCTA 4Z1MD 3ZQJA 4QGHA 4UJ3A 3T61A 3U4QA 5P21A 1Q1BA 1HUQA 1CJTC 5EUQB 1Z83A 1IXZA 5J4LA 3RRZA 1G21E 2ODWA 1NLFA 3H0KA 1L7VC 2GCOB 2WPDD 3GLGE 3AGPA 4DT1B 3SQXA 4AKIA 1JPJA 2GRJA 2FE4A 4BFWA 2FV8A 4JZKA 2P65A 1GKYA 1OXTA 4DCVA 1P2VA 2W6JA 4BE7B 2ZRJA 3FMIA 2Q3MA 3GJ5A 3ZZUA 3A8TA 4CEHB 3IILA 1E9FA 1W5TA 1QHIA 3U61B 4B3GA 2VPPA 4LJYA 5HCNA 4B2LA 3SR0A 5JCZA 4XD7D 4GZLA 4ESVA 3AVVA 5KYKA 3K0FA 4JLDA 1X3SA 1K5GA 5FFMA 3DZDA 4JLBA 4YMWA 1N6NA 2X2EA 1EXMA 4BPBA 5KU1A 4QHYA 2IWRA 3QXHA 4LHZA 1KI2A 2A5JA 3MWJA 3RANA 3MLEA 1WRBA 4R71A 3UMSA 3FMOB 2WAXA 1OIXA 3IQXA 4Q1BA 3REGA 1ZD8A 2QMEA 5CJ2A 1W49A 2WKQA 1Q57A 2QU8A 2PCLA 4PANA 3W6PA 1FX0B 4KSBA 5FUXA 2ATVA 3QG5A 3LBHA 1PJRA 3BERA 3GJ6A 4OI0A 2ZRBA 3UXMA 1H8ED 1LS6A 2LCFA 5AJZA 1X8JA 1XU4A 1P9WA 3A4LA 2W6IA 1W0KA 3AGQA 4P31A 3KJEA 3ADDA 1ZIPA 1UEJA 4DLYA 4CF7A 4GRAA 4MGZR 5FPKA 1H8EA 1NN0A 1LFDB 3X1YA 5LB4A 2QPAA 4Q4HA 5CYOA 1X1RA 4LHWA 2EFGA 2YWFA 4KFRA 4B76A 4M22A 4PTLA 2QI9C 2DBYA 1OW3B 3I32A 5SZJA 3I5YA 3P4YA 1HV8A 2V54A 1E2MA 1G8HA 2ZRLA 1IN7A 2FSIA 1E98A 1F2UA 2FGJA 1E99A 1FMJA 3V4RA 4B3CA 3KZ1E 5HR5A 3GPLA 1BYUA 1G20E 3QJYA 3A6PC 3PIRA 1XDBA 2IXFA 4KVGA 4R2IA 3CNLA 4RZ3A 4TMTA 5FL7A 4A2QA 3AVPA 1DEKA 1J8MF 2F3TA 1NF3A 4LRWA 4OI2A 2F43B 2OO7A 2A78A 5B2ZA 4DDVA 3JVVA 1OE0A 5K8UA 3K9GA 3KXKA 4ITRC 2ZE7A 4OHWA 4B6EA 1TQ6A 3LD9A 3TIFA 3DEFA 4DCUA 3SYKA 4OHVA 3KUDA 1W48A 4AD8A 3O8DA 4LBYA 3EPLA 1W2GA 3VR1A 2IW3A 5JBQA 5CDFE 2REXB 4JBYA 3VU9A 1A82A 3D6TB 2IYTA 4LDJA 3ZJYA 2QE7D 1JALA 3HR7A 3TR0A 3LV8A 2RH5A 1E9EA 1T3HA 2ZREA 3IHLA 4LYFA 4LGMA 1NSTA 3EA0A 4YMUA 4IXNA 4YMSA 1FL9A 2HJGA 3CF0A 721PA 2IYZA 3BK7A 1EWQA 2Q9AA 4PZLA 3P27A 3GQBA 2RAPA 4PQFA 3QKTA 4Q7JB 1BMFA 3LX8A 3VHXA 1KIMA 3DKVA 2NPIA 2IL1A 2PEYA 2QP4A 4MH0R 4W5JA 3SE0A 4DLZA 3KJIA 3OE7D 1PLLA 2NO6A 3FTQA 1RKBA 4Q4LA 3T1QA 4Q1CA 3WRYC 1XMSA 4C0BA 3GEHA 2IYXA 3L0PA 3GJ8A 4QHSA 1S3SA 4OI4A 2LKDA 3AVUA 5FOUA 3SBEA 4BRUA 4D0LB 2RMKA 3P1JA 4PSVA 1KDPA 3QF7A 5KPJA 4XVQA 1NN1A 3AB3A 2CLSA 4ZO4A 4DLWA 3EZFA 5JCPA 3T1TA 3QKRB 2ZYWX 1YZKA 2ERYA 1QHGA 4V02A 1OFTA 3K0EA 1OXXK 2J1LA 4OK3A 4HLUA 3VFDA 1X6VA 1Z28A 4YDSA 4LBWA 1IN6A 1QHXA 4LOAA 2PZGA 1ZYUA 2W2TA 4BLTA 5HE9A 4MRVA 4US2R 4QFMA 2O8CA 2ZR7A 1CEEA 3HWSA 4AYWA 4M53A 4TMXA 3RSOA 1M34E 3PV0A 4MYTA 4HB0A 5DE3A 1RRFA 4TMZA 3I5XA 2CHQA 4Q4JA 3U6BA 1W7AA 4C2TA 2RHDA 1GM5A 4YXWA 3O8BA 3RVBA 4QXAA 1M8PA 3R9IA 2AK2A 4V0NA 1QHSA 4QM6A 5H8WA 2G0TA 3N2EA 1NIJA 1KI8A 1TF7A 2IT1A 4Q66C 4BUJA 1RW4A 3GJ4A 5CJPA 5J4HA 3QSYA 3X1XA 1M7HA 2WWIA 5EXPA 1CJUC 4NYMQ 2Q9BA 1RJ9B 2ZRIA 2O8DB 2OHFA 3MSXA 2JLUA 4D80A 221PA 3HYTA 5EE9A 4LUCA 2DR3A 1UDWA 4HLCA 3FMFA 2J9RA 3U4QB 1KO5A 2WJJA 4DCSA 1ZUNB 5LPNA 1PV4A 4ACAA 1E0SA 5JECA 1WQ1R 2HT1A 3MJRA 4ZIRB 4I1UA 3AVXA 4V0MA 2OCYC 4LV8B 1E1RD 1CXZA 4TLCA 2P3SA 2G83A 3WNDA 4ERNA 4Q5IA 1KO4A 4IOJA 1DARA 4M1KA 4ZDJA 3AP2A 3R7WB 4I4LA 1YZLA 1U98A 2I1VB 2RGGA 1TMKA 4E03A 5EJEA 5JHGB 2C78A 2IS2A 1IQPA 1HEIA 3QIAA 4L8GA 4Q47A 2NTYC 3M4YA 4C0JA 4A8JC 4NCKA 3W8RA 5FOSA 1Z5ZA 4A36A 2QZ4A 2RGXA 3GMTA 1CJMA 5JRZA 4YLGA 2GDJA 3Q7QA 1Z0KA 2WHXA 3AF0A 4JYCA 4Q1AA 2OCBA 4XTRA 2OBMA 3NWJA 2LKCA 3K0FB 2EYQA 3ZYCA 3ZD7A 4M1WA 2Z4SA 3RC3A 5LB2A 1OIVA 3KUCA 2CDNA 4FMBB 2R65A 2JDIA 2WMOB 3CH4B 4RD1A 2IC5A 2YWGA 1FQJA 5KO2A 1ETUA 1MO6A 2WWXA 1R2QA 1O87A 2CJWA 3PUXA 1J99A 3DZ8A 3G0HA 4CEHA 1HTWA 3MWKA 1W4CA 3R7WA 5CLLA 1HT1E 3ZS8A 2ZJOA 2BM0A 4OQXA 2A3RA 2CE7A 3KXLA 1A5TA 5DNYB 1SXJE 1NVWQ 4ZIRA 3QXXA 1KDOA 5SZHB 5JJIA 5JWHA 4W9MC 4P32A 3OHMA 2H1LA 2O8FA 1NMYA 3KB2A 3BB1A 1N6RA 2HCBA 4N0EA 4WAUA 1VYVA 5G40A 4ACBA 3SYLA 3L0OA 1R5NA 4Q01A 2G3YA 2PBRA 4Q9IA 3UMFA 1YU9A 5KNCA 3LXXA 1E2EA 3ZQ6A 4IHQA 1IHUA 2VSOA 2QORA 1KTVA 1UM8A 2PH1A 3B5JA 3TVTA 5CYPA 3ZVRA 1XD2A 1OPXA 3LXRA 2IS6A 3CO5A 4DLXA 4IDNA 3MD0A 5KNBA 4E22A 1SXJC 3BE4A 3THOA 2N1BA 3RRYA 3VR2A 2C99A 5KSYA 1AS0A 4YDHB 5F9HA 1E0JA 3FKSD 1K8RA 2QN6A 1W47A 1S3GA 3LW8A 3QE0A 1HY3A 4TYNA 3X1ZA 1SVSA 3SQWA 4KJZA 4ASUA 4TZ6A 2J7PD 2QENA 4D0NA 3WP1B 1GITA 3TMKA 1I2MA 1IJFA 1CRQA 1M74A 2XNDD 1G8PA 3I1FA 1Z6AA 2R62A 2P5SA 2NIPA 3U60B 2JIZD 3F8TA 2RGNC 4BLRA 5HZKA 3IHWA 1KSFX 1OXUA 4WZAE 2GK7A 3ADBA 4QL3A 5GJWC 3AUYA 1GNQA 3CWZA 4LHYA 4PAMA 1XPUA 3HR8A 1XWIA 1TQDA 3T06B 5KDLA 2BKEA 2QY9A 4F93B 4LYJA 1E2KA 5FBLB 4RD4A 5CIQA 3THYA 5G53C 1FW6A 2J87A 4RCYA 1LY1A 2V55B 3LH5A 3OEHD 2CMKA 4UXJA 1G3IA 3VX4A 2QNRA 2SHKA 2YINC 2P5TB 3NEJA 4WVFA 5B30A 3KX2A 2QQEA 2WBLC 1WE2A 2JJ8A 1E69A 4QC2A 4DCNA 4A0GA 2XXAB 1U90A 5J5CA 2H16A 4O2RA 4E09A 3RS3A 4URWR 4B3BA 3FWYA 4NKRA 1S9HA 5DO9A 1GFIA 2AL7A 4UNPA 4KXFB 3AQ4A 5GJBA 2IYVA 3IIMA 3J81k 3MWYW 2GZAA 4GBMA 4B6FA 2ZRCA 3KJGA 5GJVC 1KO8A 1WXQA 3AV0B 1XXHB 2OUKA 4LJ5A 3U5ZB 4DEXA 3LW7A 4JLAA 4MITA 4NYJR 1UAAA 2V4ZA 3GEIA 1NKTA 1VCOA 4C7OA 2FU5C 2ZETA 2OBLA 1CULC 3WMEA 2X8AA 4HSEA 1V43A 1P72A 4PHTA 4QGFA 3EAQA 2X2FA 3GFPA 5FTKA 4Q7MB 5JZVA 2PT5A 4GP7A 1ZM9A 3H2YA 3HU2A 2QROA 3BS4A 3R8FA 3QKRA 1ZAKA 3CR8A 1GAJA 3REFA 1RRCA 5AUOB 2KB0A 2GJ9A 2ZRPA 3I61A 1OF1A 1M7BA 4DUGD 4Q4AA 2KBEA 3IPYA 6Q21A 1SKQA 3LBNA 1JJVA 2XOKA 3EZ2A 5AJXA 1YR7A 1Q0UA 1UKZA 1F6BA 2BOVA 4MUBA 5SZKB 1J70A 5F98A 2VF8A 4RFSB 2GZHA 4DHEA 4A4DA 1SGWA 8OHMA 1D2NA 1VECA 4NE2A 1EFTA 3K0CC 4U00A 1WF3A 5KUTA 2ZYVX 4AURA 1BO6A 1XF9A 1ANKA 1QG2A 3IBGA 2QAJA 1UFQA 3EPJA 1L2TA 2C98A 4OK5A 4S35A 4Q7LA 3PJRA 3I4LA 1G19A 2RGDA 2AXNA 2V7QA 2B7CA 4A0HA 2HYIC 3BH6A 1VIAA 2I1QA 2WZQA 4LJAA 2X1VA 5JJKA 2KJQA 3CWQA 4EIWA 1YE8A 3TKLA 4IRUB 1PZNA 2IYRA 5HKKD 5EQTA 4EKDA 2NZ8A 5LBIA 4B73A 2XZLA 4D25A 4HB3A 4QNRA 1Z0JA 2D74A 2R6FA 2VLIA 3THWB 1C4OA 2F7SA 3QNUA 1VG1A 1YVDA 2RHMA 3VR3A 1NMZA 5L3VA 2EW1A 1NL3A 3P26A 4KFSA 3U3MA 2RGBA 4V0OA 4EJSC 2GJSA 4G5SA 1YZNA 5C1BA 4X8HA 1XTQA 4EJSB 1KK1A 1Z06A 5DH9A 2D7DA 5FOWA 4HYYA 1E4VA 1LS1A 1XD9A 3LO5A 3K09C 2FDCA 1R4AA 4LJ4A 1UBEA 4K46A 2QG6A 2WM9B 3V00A 2ZUCA 3W3ZB 2IX3A 4YMTA 1NI3A 5CM9C 1TADA 1U99A 4MYHA 4B75A 1XD2B 3EPHA 3QPWA 3ZIAD 5EP2A 2A5DA 3A4NA 3CF2A 3TAHA 1CRPA 4D4KA 4QBHA 2GBLC 1P9RA 1VCMA 1W0JD 4Q48A 3NBFA 2G77B 1ZINA 2YWEA 5FOTA 4CYMA 4YONB 1G3MA 2K5UA 4AY2A 3M6AA 4KV9A 4ZV4A 2FWRA 2WSSA 4FWIB 2TMKA 4UNQA 2L0XA 3UK6A 1FPMA 1OB2A 2V1UA 2Z43A 1NBMD 2BBWA 2FFQA 3QF4B 2O8FB 4LBZA 2AN9A 3EPKA 4D4JA 4DSTA 2GTPA 4LCBA 2WMNB 4QG7A 2JIZA 2FSHA 1T3LA 1HYQA 2XB2A 1P60A 4N1AA 2DFNA 3Q5DA 1Q22A 3ASZA 3PQCA 2GEUA 4TYWA 4EPXA 1FX0A 3EZ6A 4PX9A 1CLUA 2XGJA 5JSZB 2UVQA 4QJ4A 3HJNA 2AX4A 1J2JA 4QRHA 1G3UA 3MJHA 5H70A 4PHHA 4FCVA 2W58A 3H4MA 2YVUA 4IDPA 1T8UA 3QUSA 4OKSA 3EASA 1IOZA 1BOFA 1DAFA 1II8B 5B58C 1XMIA 4OBEA 1SXJA 1IONA 3AKDA 3Q72A 1Z6YA 4RVCA 1YKSA 1KJYA 1UBFA 3GLFE 4C0LA 2PLFA 2Q3FA 2W00A 3UIEA 3ONWA 3K09A 2GJ8A 3W8NA 4PXAA 4AYXA 3BRWD 1MR3F 3CRMA 1NBMA 5JEEA 2FJUA 2ORVA 2RGAA 2JATA 3GLGA 4IOMA 2PX0A 2D06A 4HZIA 3BFKA 2VHTA 1X1SA 3WRXC 1E2NA 1W36B 5TXGA 4UNRA 1W5SA 3ZVNA 5FI0B 4CT4B 2V3CC 1QVAA 3IIJA 5EUMA 1XJCA 4WW0A 5EXXA 4HI0E 1X86B 4WZBE 2JJ2A 2ORWA 5GJCA 2VP6A 1D9ZA 2DFLA 4NCJA 3TRFA 4ABYA 4F7WA 1T5LA 2J0QA 1K6MA 2OT3B 5DLQC 4OJKA 2JJ1D 4FWTA 2OEPA 4RFVA 1Z2CA 3E70C 5G3YA 4FCWA 2J7PA 3FFBA 3T34A 4B71A 1J8YF 4LWZA 4D2IA 3NHBA 1V5WA 2ZI5A 3GD7A 4OJQA 5IT5A 4Y0AA 5EZ6B 2KBFA 5FBRB 4IOLA 4MGYR 1KI9A 2J5XA 5BYJA 3NBYC 3RS0A 2OSBA 1VYUA 1SXJB 3HDTA 4TT3D 4G0NA 5E3HA 2ZTSA 1W0KD 2BJVA 4TQAA 5KSPA 4BFZA 1II8A 4B2IA 4ZKEA 4Q1DA 4QKQA 1RRPA 1KAGA 3FHOA 2NQ2C 3AF2A 4PSKA 5SZIA 2GCPA 3SJZA 4BFYA 2YOGA 5FTLA 3AF4A 4B43A 4AWXA 2QSYA 1W4AA 3PEWA 1ONBA 1DADA 2BIFA 1Z07A 3IGFA 4OQLA 1SQ5A 3LA6A 4TLEA 3PXGA 4IVQA 4ZI2A 3ZH9B 2OILA 2AD1A 1ZM2A 1EFUA 1KMHB 1OKKD 1GL9B 4BEBA 4R9UC 1KHTA 4LJ7A 3L82B 3QG1A 4JVNA 4MRPA 5J4YA 3KQNA 2YV5A 1G1MA 1EFRA 3ZVMA 1A1VA 3BB4A 2AFIE 2D7CA 2F1IA 2HV8A 3QKUA 5J4KA 1TX4B 4TZ0A 3QPVA 1RRGA 4RKFA 4PZZA 3OIUA 1JXMA 3JVUA 1LF5A 3DHWC 3OIYA 2C9CA 1IN5A 1FQKA 1NP6A 4GI7A 5JWOA 3K9HA 3VTKA 2XSZA 4HUQB 4KLNA 1SVKA 3QBVA 3TAUA 1I4LD 3P4XA 3D8BA 1P3JA 4LY6A 1EX7A 4A6PA 1A7JA 1XB2A 3UMRA 3T15A 1RJ9A 1D6JA 3IUYA 1IXRC 1KZGB 4IW3B 3K1JA 2ANCA 1QHHB 1UKVY 4AKEA 4TMVA 1CU1A 4K8OA 1G9XA 3O47A 1O3YA 1YHNA 4IOKA 1ZNYA 3Q3JB 2YHSA 3B1YA 2GBLA 2OLJA 4ZPXA 3EZ9A 1KI6A 4LC0A 1OLOA 2FZLA 1AKEA 2GF0A 2ORIA 1HH4A 1HT2E 2HDNB 1E1QA 4D82A 3SJCA 2ZSFA 3Q9LA 1KKMA 1R0WA 1AA9A 2O5VA 2QTFA 4M0LA 5E95A 2PJRA 1W4BA 2JLQA 1WDTA 2JLXA 1W44A 1HQYE 2OV2A 2EU8A 1U81A 2ZJZA 2ZRMA 1JECA 1IM2A 5BN5A 5E7IA 2WJGA 4WA7A 5E7JA 4BFXA 2IYSA 3QKSB 3CB4A 1KDRA 4V03A 5JFGA 2EFEB 1U0HC 1SVWA 4B33A 1ZCAA 2EYUA 1LB1B 1WCV1 4MRSA 3RLFA 1N6LA 4JVSB 3LDAA 3MCAA 4M4SA 1Z8FA 2H8KA 3L0SA 3PEUA 4JIMA 2CLCX 3T5DA 5FTNA 2BCGY 1NSFA 1XMJA 3EWSA 1CJVC 2QAGB 4Q9HA 2CHGA 1G7CA 1MH1A 2QMHA 1XXHE 3OE7A 4PO1A 2CCJA 2B7BA 3GLFA 4P4TA 2AKYA 2QT1A 3U3KA 1US8B 1WB9A 3KDSE 2IF2A 1K5DA 1XTRA 2F1JA 2RKOA 1FOEB 3C15C 1U0LA 2AFHE 2HCJB 4MDEA 3NH6A 3MMPA 2YOHA 1OFHA 1YRBA 2UKDA 5DI3B 1VYTA 3FKQA 3RABA 3N70A 1CR1A 1S1MA 2C95A 2JGNA 5DN6A 1UDXA 1N6KA 1DELA 2DWOA 3CKLA 4G5OA 4LJ6A 4M1SA 3GLFB 1G5PA 1JR3E 5EE1A 2IHBA 1NN5A 5A4JA 4HLQB 1AS3A 4I99A 3UWOA 1M7GA 1VMAA 2WVJA 1QDEA 2ZVPX 4PZYA 5CK4A 4A9AA 1RVDA 2IEZA 5FL3A 2VEDA 2JCSA 4LC1A 1FTSA 3LVRE 3EXAA 4LV6A 4RKEA 4XJXA 1HURA 3SEAA 3RS2A 4LBVA 4Q9JA 2BBTA 3Q8XB 2WJYA 5JRJA 5F3WB 5DSZA 5L3RA 5IK2D 4G5GA 3CONA 3V9PA 1TEVA 4BLPA 5G41A 4C2UA 4FIDA 3PEYA 2GHIA 3KL4A 2F1HA 2MSDB 1XTIA 2V8OA 3I92A 1NLZA 1UBGA 1TPZA 4PQYA 5HTKA 1OH7A 1EX6A 1E2DA 3W3AA 2CVHA 3VMFA 1Z0DA 1RYFA 3RAPR 1CJKC 1WA5A 3LX5A 4FW9A 4A8JB 3RS7A 3NBXX 4PC3A 3KXIA 1OT3A 2P6UA 3QXSA 1KI6B 3BB3A 4KYIB 3SFZA 1XEWX 3KJHA 4N3NA 4MDFA 4WXPA 2ZIAA 4ASUD 3HYRA 3BJIC 4DIEA 1N5IA 2G1KA 5JI3E 2Z6VA 5JS7A 3TW4A 2IS4A 3MAAC 4DLUA 3BC1A 4Q4HB 3G5UA 5TY0A 2A30A 1EFRD 4JLNA 2PL3A 2W6ID 3LBIA 3ZVLA 3AH8A 1COWD 2ZE6A 4IFEA 3ZDQA 3EIQA 1MRNA 4RJLA 3GLHB 4C0SA 1A4RA 3NH9A 4RFSA 1NG9A 2R8RA 1BIFA 3KKNA 4HDQB 5J4VA 1T0HB 1OIWA 1IY1A 2B6HA 3M0EA 3NIBA 3KQLA 1AZSC 2BBSA 2ZQ5A 2IXGA 1L4UA 4PR0A 4BZQA 3U2QA 5KHOC 3K70C 1NNEA 2VA8A 3GJ3A 2GILA 3WMFA 4UXIA 1R8QA 3T1VA 4XWAA 2G88A 2FPMA 2J7KA 4PAQA 5K8LA 3TGPA 2GWHA 1T5IA 1B23P 2FN4A 4M9QA 3IEUA 3RDPA 3PVSA 3FKSA 4U7DA 2ZITA 4DEYA 1KI4A 2AWNA 4EUNA 2RGNA 2W2VA 1NKSA 1TF5A 2BDTA 4OHYA 3B1VA 4LX0A 2VHJA 4B48A 3QVUA 3A1SA 2EFDB 4TTQA 2JLSA 3C7KA 2R6AA 3FOZA 2EFCB 4IJMA 2O8EA 2CE2X 1C9KA 4IVPA 1E9AA 5EP3A 1TL7C 3K8YA 4IVRA 4F4IA 5BWMA 2QT0A 2XSZD 1ZBDA 4M1OA 3GJXC 2PLRA 1OB5A 3JZMA 1TU4A 4OL0A 4JLJA 4DBLC 2DHRA 1VCNA 1P7CA 3KKPA 1G291 2J46A 4Q9KA 2UZ3A 1QHHA 4BFSA 5HE8A 3BBPA 2ZRDA 4GOKA 2CNWD 2WSSD 4Q03A 2FX3A 4RCZA 3OIVA 4A1FA 3SHFA 3V4FA 1PLJA 4ILEA 3NEYA 4HLUC 3A1TA 2DY1A 1SHKA 3NVAA 4V0KA 2GETA 3CX7A 2EQBA 4URXR 2W83A 4DWJA 1IY2A 1DBSA 1ZNXA 2O0HA 1VG0B 4Q00A 4QOSA 1HE1C 2GNOA 3SJBA 4HAZA 2XNDA 1IN4A 2MSEB 3H86A 4URYR 3HU3A 5D3QA 3U44B 4JVLA 2F3RA 1TF2A 5JEDA 2CJWB 2ZPTX 3CRVA 2Q21A 4Q1EA 2F55A 4CGZA 4UNSA 1KO1A 4Q02A 3B1WA 4HEJA 1E0AA 5AJVB 4NCIA 1GRRA 3VKHA 3K0SA 1E3MA 4P4SA 3UATA 5GADl 3X1DA 2BM1A 3OEEA 4DLVA 3R9XA 4NYJQ 1R6BX 3N5CA 1VKJA 4B35A 4DVGA 4OHXA 5J40A 1FNNA 5IDVA 4EQ6B 3B7GA 2XTNA 1BS1A 2QPOA 4QM7A 1ZIOA 1XEFA 1F2TB 1R8SA 1X8LA 4KU4A 1OSNA 3KKQA 4DB4A 2NMVA 4NCHA 2XEXA 1G41A 4LK2A 4CW7A 4ZI3A 2WWHA 3K53A 4M1YA 2ZI3A 1RPZA 2CEAA 1JPNA 1G18A 2R6CA 4JYBA 4C0QC 4AKGA 4LSGA 4KFTA 1N6IA 4EPTA 1U8ZA 4TLBA 1G4UR 3BFXA 3C8UA 5AUPB 4GZMA 1G6HA 3AF3A 1QBKC 5K8IA 2W0SA 3MGCA 5EP1A 3VNVA 1L8QA 1ZC3A 2R6DA 5JS8A 1P75A 3GCGA 2Z0MA 2FG5A 5CIWA 3CM0A 3TUIC 4PPFA 2ZANA 1AQUA 2O8BB 3ADKA 3QPUA 3OAAA 2QEQA 1TQ4A 3VKGA 1P5ZB 1GUAA 2Q0HA 2BMFA 3IO3A 3QF4A 1S96A 2YWHA 1G64A 4MKFA 3N2IA 4I1OA 4KFUA 3FB4A 1EESA 4LHXA 1SXJD 4X8OA 4GOXA 2ZXUA 1XPRA 2ZJAA 4QBIA 2JLWA 5UKDA 3DDCA 1ELOA 2OAP1 2HLDA 2OFOA 1XD8A 1ZMXA 3D3QA 4M21A 1II0A 4CEJA 3TBKA 3ASYA 2QSZA 4BRWA 4XSHA 3ICQB 1YR6A 1XCMA 4TQ9A 2A5FA 2A9KA 3EC1A 4GMDA 3AVWA 3ETLA 5DI9A 1JEDA 2FSFA 3B9QA 4US1R 4EDHA 1E2IA 1BKDR 1KO7A 1LNZA 2IYUA 2EVWX 3WYAA 4FMCB 2NOAA 1YR8A 2GK6A 5B64A 4KODA 2O8CB 2JAQA 4BLSA 4JT2A 2QRZA 1F60A 5HKKA 4TQUS 2ZI7A 2I4IA 5AJYA 4MRRA 2BC9A 2BV3A 4IDQA 4PO9A 1Z0AA 1DE0A 3L8YA 4GDFA 2X77A 2V7QD 3F3YA 5IRCD 1IN8A 2VP5A 5JSZA 2R2AA 1SULA 2Y8EA 3BD9A 4YMVA 3EX7C 4BFVA 2ZU0C 2PZFA 3SOPA 2C2HA 2PZEA 1SKYB 2OFXA 2LWIA 2BMEA 1R0XA 1CTQA 2ZEJA 3SHWA 4A2WA 3EZ7A 4ZCMA 3E5HA 3FPAA 2XAUA 4DDWA 1NJFA 4NYMR 4HDCA 1W0JA 2VH5R 4M2LA 4Q19A 2GESA 3UG7A 4EFLA 4MQBA 4MGIR 4C9BA 5FI1B 2FFHA 2ZRHA 1WMSA 3QVVA 3O8RA 2IYLD 5JJLA 2FMXA 2H92A 3B82A 4LJ8A 2FGKA 3OF5A 4DUGA 3IKJA 3P20A 3AP3A 3PENA 4G5RA 5DI3A 4Z8XA 1KOFA 1AS2A 2XB4A 2Q3HA 3AKEA 3ND9A 1NBME 4Q18A 1GILA 1ZM7A 1G8GA 2D62A 2FA9A 2VHQA 1U2RA 5FPSA 4Q1FA 4F92B 4GL2A 1JBKA 1EFCA 3HPQA 4JLPA 3QEOA 5HZHA 1XTJA 4GOJA 1NVXQ 5TVKA 1D2MA 4PAOA 5CB8A 2P6RA 4H1UA 1GG2A 3R9WA 4TYPA 4IXMA 2Z4RA 3BH0A 3EWAA 4JBXA 4TTRA 4JLKA 3SJAA 1G6OA 2IEYA 1QHNA 2NG1A 1XTSA 3CX6A 1FFHA 1OXSC 3AF1A 3GLHE 1RYHA 5JWRA 1Z6XA 3I3SR 3KTAB 1Q20A 1WBBA 1GDDA 1ZD1A 4Q7KA 1AIPA 1JQLB 3QKSA 2QQ0A 2NO7A 3GJ7A 3CX8A 5K8TA 4FN5A 2E9SA 2KI5A 1ZC4A 4F4CA 2G6BA 4DXAA 5ELXA 4C7OB 1OJLA 3WYFA 3CPHA 4DDUA 1S9DA 5D3MB 1ZW6A 2QAGC 4D26A 3WYGA 4W7SA 5JMTA 2NZJA 1GWNA 1F2UB 2BJWA 1N5KA 2GJKA 1ZM4A 4HUTA 1XCPA 2YOFA 1R0YA 2ZJ5A 3UG6A 4L9SA 1OYWA 2FPKA 4HDOB 1U94A 1Q21A 4PO8A 4ARZA 3TLXA 1L4YA 3CZQA 1MABA 2FEOA 1Z0FA 5DGXA 3ICEA 5FOXA 2BBOA 1GZSA 2C8VA 1ZVQA 2CVFA 2JLRA 3NKVA 4B3DA 1GSIA 4KITB 3PEVA 5C18A 2ZI9A 2D2FA 3CPJB 3SS8A 3AM1A 1R5OA 3W90A 4QJ3A 3T35A 1ZRHA 1HE8B 1Q1QA 2FH5B 2ZRGA 1NIPA 1DVRA 3HP1A 3DKPA 3OESA 3F5FA 1CKEA 3ZS9A 1MT0A 1FZQA 2WOJA 2WJIA 4DSNA 3IBYA 3GFOA 3EIHA 1AJEA 4G5QA 2IWHA 4AYTA 1RE0A 1ZNWA 3CW2A 1E96A 1HA3A 2DFTA 5KDOA 4IDOA 2WPDA 2QP9X 4JS0A 1CS4C 5D3MA 5C46F 2QM8A 4MKIA 1NVVQ 1M1YE 1WP9A 4IFBA 2BWJA 2IXEA 1KMHA 1QZXA 4RSGA 2GCNA 5BW8A 3SBDA 1XCGB 2J0UA 3K9LA 4GMXA 2XZOA 5L3SB 2CL0X 4C4PA 1OFUX 2OBNA 2CXXA 3SZRA 2AK3A 1Z63A 4B44A 1IJEA 2QA5A 4R7ZA 4Q9LA 1F5NA 4U02A 1XJQA 3QXCA 3RS5A 2VSXA 4RY2A 1D9XA 1T3SA 2WJVA 4GSYA 5H68A 3PR1A 3VHLB 3I62A 2GF9A 3BOSA 1E6CA 3T5GA 3VKWA 3A1VA 4JT4A 3B1ZA 2D4HA 4Z54A 1KAOA 3Q7PA 1E0KA 1H8HA 2BEKA 3LNCA 4L15A 3GP8A 5F2EA 3TQCA 3THXB 1Q3TA 2XXAA 1A2KC 3DO6A 3SYNA 1P4SA 2A7QA 2FSGA 3DPUA 2ZS9A 1PVOA 2VHCA 5DYIA 2GCOA 1VHLA 2OCPA 3E1SA 1N0VC 3T12A 3PUYA 3CBQA 1JJ7A 1KDTA 2ODBA 3FMPB 1T6NA 2YZ2A 2VP2A 3LVQE 421PA 4DT1A 3ZIAA 5CLQA 2ZAMA 4LHVA 3K70B 4A82A 4LJ9A 4AK9A 1AZTA 3KKMA 2OM2A 5L8VA 3QY0A 4ESHA 4BGDA 1Z47A 4HZUA 4NDZA 4X8LA 3W9YA 3HPRA 3K0AB 3GLGB 2CBZA 4BWYA 4EFNA 1D8TA 2AR7A 1SVIA 2BHRA 2MMCA 5KTYA 1VPLA 4CT5A 3RHFA 4XWOA 2OAQ1 1OHHA 3NC0C 4E07A 1NY5A 5KPDA 1FMLA 1KGDA 3WNCA 4KCGA 3KQKA 4C0AC 1XEXA 2IUSA 1DTSA 3U7EB 3TUZC 1JQJC 5EE3A 4EPRA 2VIIA 4QJ5A 1E32A 2J3EA 3WHKA 1CF4A 3MFYA 1T9HA 1XZQA 2W6JD 1AQYA 2ZYUX 5BYKA 5FPHA 3A37A 1GRNA 2FFAA 3ECCA 4URVR 2GXAA 2V6JA 2WTUA 2P6NA 4LYHA 2WWFA 3TH5A 1EG7A 1JI0A 1GL7A 2HXSA 5EE5B 1II9A 1LTQA 4WOPA 3MUFA 1AN0A 3RWMB 1A2BA 5FR1A 2VP4A 3C5CA 1P61B 5AUQA 5CK5A 3AVTA 4OI1A 4HAYA 1GRQA 3CPEA 4V0ME 3EIEA 4TL8A 4JL5A 3FVQA 1KI1A 1P2UA 3B78A 5EP4A 3CR7A 3MWLA 3L43A 4PC7A 5EXTA 5G3ZA 4PC2A 4B32A 1G5RA 2GVDC 1P6XA 2QL6A 1W2HA 1J90A 3BXZA 3CH5A 2O8DA 1E79A 1XEWY 4UKDA 1Q1EA 1U0JA 4FMDB 4KYUA 4AKHA 4KBFA 3QENA 1FP6A 2BCJQ 2ERXA 1N3BA 2EWVA 4Z51A 4WIAA 2KSQA 2ZUDA 1KMQA 2BMDA 4JLOA 4MKGA 4J0QA 4JMPA 4ZCIA 1DS6A 2XJ4A 2WOOA 1VG8A 4DIDA 3AEZA 1BMFD 2WIAA 3OAAD 4E5UA 1NVVR 1TU3A 3OFND 4DLRA 4DLTA 1CP2A 5LD2B 4TMKA 3FDIA 2XTZA 3OEED 2WWYA 3W6NA 1G7SA 4EPWA 1PLKA 4H9GA 2ZJ2A 1SVLA 1ZJ6A 4WBSA 5DN6D 4HB4A 1J7KA 4L9WA 5TDHA 4W5HA 2AKAB 3Q85A 4PC1A 3DM9B 5ANRB 2ZRAA 1DAKA 1E9BA 4TMWA 2JASA 2XNSA 1D5CA 1S1CA 4US0R 3C41J 2IHYA 2QUZA 5CM8B 3RRMA 4A2PA 3L2OB 5JLJA 5KSOA 3AVQA 4PSAA 2DFKB 3W6OA 4P3YA 3BORA 4BFTA 2MMGA 2H5EA 2EFHB 3LY5A 1NY6A 3OEHA 4F91B 4IEIA 1JB1A 1P9NA 2ZS7A 4ZDKA 2XOKD 4PC6A 3SU8A 3MG9A 2V1XA 4O2LA 3EA5A 4LPSA 4P4UA 1TNDA 1ODFA 2CLDX 2NO1A 2AHOA 3GLHA 5FL7D 2JA1A 4DZZA 3B13B 3TR5A 1Z08A 2EWWA 2QTVB 3GLIB 4M9SA 1AGPA 2F1RA 4D6PA 2QTHA 5DYGA 2GKSA 2W2XA 5FBWB 2J45A 1LW7A 1MO5A 4A8JA 4POAA 4ARZB 3X2SA 4CVNA 3U7GA 2GZDA 3B2EA 4O0MA 4D4LA 1N5JA 2QBYA 4XVRA 2B8WA 3LRPA 4UXHA 2XJ9A 3VU9B 1XX6A 4KI0A 2OG2A 3A4MA 3AP1A 2REBA 3RNLA 1P73A 1R5BA 3TUJC 2QE7A 4M8NE 4KLZA 1Z0IA 2GJAA 4DSOA 3H1TA 2ONKA 4OQMA 3W5IA 1JEEA 3A36A 3FE2A 4MUAA 4BZPA 4FCTA 4RD6A 3WMGA 3GLIE 2AWOA 2ZR9A 4QNMA 1FP7A 1GTVA 3TK1A 5DHFA 2YNMA 4O25A 3DMNA 1TUEA 5M04A 2W0MA 3O8CA 1KJZA 3HU1A 1YZGA 4JLMA 4S2EA 4A92A 3DL0A 3THWA 2IS1A 5CB6A 1COWA 2HF8A 1ZP6A 1U9IA 3K70D 2HYDA 4A0FA 5JI2E 1KKLA 4II7A 4TT3A 2A2ZA 3PCRB 1OXVA 4A0RA 3M1IA 1EGAA 2IYYA 2P67A 3GLIA 3CRRA 4PQRA 2CHVA 4JSYA 1Y63A 4ZKDA 4NONA 2QP3A 2O0KA 4C30A 5BN3A 4XH9B 3WBKA 2ZROA 1D2EA 4ZDWA 621PA 3NDBB 1U9IC 4BLQA 4TL7A 3FFAA 3VNUA 2D2EA 2DYKA 3U3OA 2FFBA 1DAHA 1UJ2A 3B6EA 3TSOA 3AUXA 1GKUB 2JDID 5BN4A 2J0SA 3QI2A 2AD5A 2XX3A 2GEDA 2VO1A 1OYYA 4JL8A 4MRNA 3SN6A 1DOAA 2REOA 1RZ3A 1E2JA 3S1AA 1SZPA 2CNWA 1DPFA 3NG1A 1P2SA 4XTCS 2Z5FA 5FR2A 4KO8A 3I8SA 2OE2A 4H1VA 2YJTD 1T0JB 1H8HD 1KJWA 1W46A 1P62B 1NJGA 3NXSA 3NTUA 3DMDA 2IYQA 3SNHA 1LVGA 2F43A 4M1MA 1Q1ZA 2B21A 2OXCA 4EPVA 1XXHA 2JJ1A 2GAAA 1GP2A 1N5LA 1TQ2A 3BWDD 1Q12A 1VTKA 5L3QB 3MRSA 4MYCA 1GOTA 1M6NA 3I72A 4IDHA 4KBGA 2GXSA 3RRNA 2QBYB 1CBUA 1I4TD 4XSGA 1H65A 3LWNA 4HB2A 4DSUA 2FZ4A 1E2QA 3FHTA 5H1YA 4AC9A 1VDZA 1YQTA 1UBCA 3WP0A 4B34A 4RD3A 3SFVA 3ZZTA 2OZEA 4LV5B 4Z1MA 4AI6A 2OXRA 3CUEF 1ZM3A 2NPFA 3IIKA 2Z83A 1EWRA 4LZZA 3L0IB 4DKXA 2F6RA 2IUUA 5FH9A 1PUJA 4HUQA 4BEJA 1F48A 3KB1A 1Z29A 1W36C 4BQSA 1MOZA 1KSGA 2WSMA 3GFTA 1VCIA 4PFSA 5B57C 4FD2A 4JL6A 3C14C 1DAGA 3EC2A 4Y0VA 1QVRA 4U5XA 1S8FA 4AG5A 2PMKA 5TMPA 4DDTA 4UQOA 1KNQA 2ZM5A 1G4AE 3BH7A 1JNYA 4XD7A 4AIIA 1DO0A 4I81A 1JAHA 1I4DD 2VBCA 4NCNA 4Z8YA 4LYAA 2VYFA 2ZJBA 2RGEA 5FPTA 1M2OB 1OH6A 1KSJA 2JLVA 1NG1A 1ESNA 4KAXA 2E87A 3A1WA 5C4MA 3IPXA 1E94E 1UPTA 4TN1A 1ZUHA 4TSFA 4JJZA 2O0JA 2A5YB 1OFIA 2V6IA 1FTNA 4EQ6A 4XVUA 2HLDD 2JLZA 3K9NA 2QRNA 1GIAA 2ECKA 2QMUA 3CRQA 4NL4H 4O3MA 3ZGXA 5BQ5A 4DJTA 3THXA 3ZD6A 1IXSB 4FINA 1GNPA 4BFUA 1BH2A 2ODEA 5EZ5A 2WWWA 4NU0A 1CIPA 3U7FB 1ZU5A 1SVMA 3LFUA 4G01B 1MO3A 2OESA 3NDPA 5IF9A 3GJ0A 5A0FA 3BAFA 5TV2A 1IY0A 3AVOA 4ZDIA 1GVNB 4UJ5A 2O8BA 4G3XA 1I2DA 3CNNA 2R6GA 3QXJA 3UWKA 1T4GA 4ZCLA 4KHZA 1OH8A 1NN3A 1R0ZA 1VIYA 2ZRNA 2VSFA 4TYQA 1OKKA 2ZU6A 5IK2A 2GVZC 2OLKA 2CCKA 2FF7A 4TYYA 1UKEA 3VR4A 2C9YA 1MKYA 2ZRFA 5GVSA 2R9VA 1UADA 1E2HA 2AXPA 2B92A 1XZPA 3X1WA 2MSCB 3UKDA 3TQFA 3DVLA 4TL6A 2ATXA 4HAUA 2N46A 1DO2A 1YRAA 3IQWA 2ZAOA 4JKIA 4C0HA 5F9FA 1P2TA 1QHYA 3R20A 2ZSDA 4TWZA 3A1UA 2ZUBA 4JVMA 4PPGA 4OK6A 5AR1A 1OH5A 2P2LA 1RFLA 4P4SB 1KYIA 4TSFD 4B74A 4CRWB 5DIFA 2XTMA 4PHGA 3W5JA 4L5BA 1AKYA 1XP8A 3OFNA 3G82C 1XBTA 2C5LA 3E2IA 4JJKA 2ASEA 4HZUB 1EFHA 2JJ2D 2DPXA 4IEEA 3U44A 2C03A 1GL6A 1G7RA 4CZ2A 4GPTA 1DAEA 3DM5A 2WIBA 2DWQA 3B60A 3H84A 1N0WA 4QBFA 4F4JA 3VX3A 4DRZA 3PG5A 2XITA 1XPOA 5LDDC 1E79D 2VRWA 4TLAA 4R2HA 1W1WA 1XRJA 2VP0A 1CR2A 1YZQA 5TB5A 1G8FA 4JKYA 5KNDA 3LQRA 2KWIA 4CEIB 2PJZA 4GNKA 3IDQA 5FPYA 1QG4A 2X19A 3QEJA 4DB2A 2FOLA 1YR9A 1SKYE 1KK0A 2YC4C 1UKYA 4QBGB 3WXMA 4M9XA 3OZXA 2ZE8A 2CK3D 3DOFA 4RD2A 3A58B 3I73A 3VR6A 2H18A 5L3QA 2CCGA 2O8EB 1SHZA 4WXRA 5C2JB 1DG1G 3NBZC 1JAIA 2J59A 4TL9A 3QQ5A 1YZUA 1KY3A 2HF9A 1JR6A 4NZYA 3P32A 4D81A 1JR3A 3TSWA 4Q4JB 5EE0A 5L3SA 3ZZ0A 1N6OA 4RD0A 2RGCA 1XJ0A 2ZE5A 4FMDF 5FBQB 1E9RA 3TW8B 2NO0A 2I3BA 4IKEA 4MA4A 4RZ2A 4HLDA 4PPQA 2YKGA 3CF6R 4JLVA 2H57A 1DG3A 3U7HB 4D0GA 1N6HA 2J0UB 4DC9A 121PA 2IF0A 3KQUA 4B3XA 1F3OA 3ND8A 3C5HA 1ZU4A 1RIFA 2ZSAA 1XNJA 3S1AB 3LAWA 4LI0A 2N42A 4C3ZA 3GEEA 3TE6A 2ZJ8A 5DISB 3C16C 4GP6A 4I1VA 2ZSEA 1G5TA 1S2MA 2V9PA 1E2LA 4OYHA 1RC8A 3D31A 3RC8A 1N0UA 3WNBA 1E4YA 2BMJA 2B8TA 1XMVA 2GXQA 5FUWA 1KK3A 4GT1A 2ZJYA 1UEIA 1ZNZA 3KFVA 4MYUA 3PUWA 4LPKA 3DOEA 4YQFA 1FNMA 1C1YA 4F38A 5FUYA 5KOYA 5FTJA 3B85A 4NPHA 2H7VA 4NBSA 3EG5A 1US8A 3TNFA 1S4QA 2ZVQX 2PEZA 2E1RA 3PUVA 3SC3A 4A15A 2QGZA 2IBMA 1Z6GA 4CIDA 4ON9A 3W34A 1MABB 2HJVA 2C77A 2QAGA 4BECA 3WY9A 2QMOA 3PFIA 1GKIA 4Q4AB 5KSZA 2DWPA 3KKOA 4KVAA 2CL6X 2FEMA 2C04A 4WZ6A 2YYZA 4EFMA 3QOFA 1PUIA 1Z6TA 2VHUA 1HQCA 3OIWA 1QRAA 2GA8A 3SDZA 1QF9A 5JHHB 4EJSA 3FYHA 4HAXA 1UF9A 4BZXA 2ZRKA 1NRJB 1N2CE 2PCJA 1E9SA 4EPYA 1KI3A 4I1SA 3KTAA 2QM7A 4HAVA 2VF7A 4M1TA 2WV9A 4V0LA 1E2GA 3WHLA 5DHAA 1Z22A 1W36D 1LV7A 4B47A 1TEXA 1G3QA 4TTPA 2CL7X 1NMXA 1LF0A 2DB3A 3TSZA 1AGRA 1JR3D 1KY2A 1N6PA 1Z3IX 2RCNA 4P0TA 4PPNA 1R10A 3FGNA 4D4MA 5J47A 3I8XA 2FPLA 2ZR0A 3WBJA 4CEJB 2HXYA 2WWGA 4MGKR 4QGAA 4NP6A 4OHZA 1T8TA 4XOIA 3U3JA 2F9LA 3AKYA 4R98A 3PITA 3RSLA 2CK3A 4B3FX 1DAMA 3K0CA 2NO9A 3THYB 3UANA 1T91A 3VR5A 2BVNA 3VAAA 2VTKA 1G8YA 4GFDA 3CZPA 1E1RA 3AKCA 3KFXA 3RYTC 3TJZA 4B2PA 2KE5A 1ZCBA 3PUZA 2BKUA 3BFVA 2ZI6A 5KDDA 1ESMA 4RZXA 4YXWD 1Q44A 4L4UA 2PX3A 1AM4D 1NLYA 2D3WA 2OCAA 3FHCB 1N25A 3EARA 2OFWA 4HAWA 5A5GA 2IA5A 1IBRA 2JLYA 1KI7A 4NTZA 2JEOA 4M9ZA 5BXQC 3ZLJA 2A5GA
chains in the Genus database with same CATH superfamily
2C9OA 3FX2A 1L5HA 3TTUA 3ZV4A 2I4RA 2NGRA 5FX2A 1LBSA 1FZTA 1EQUA 1LDYA 1RWBA 3CSDA 5KYGA 4U6NA 4Y3UA 5K3FA 1UPFA 4FGUA 4DCPA 2BGKA 5I7HA 2P9BA 2VQSA 1EQAA 1FUUA 2H17A 2W6QA 4P33A 3DBIA 3V48A 3K5HA 1GNRA 3DKIA 5BRAA 4R8RA 1SVOA 2BI4A 4QFCA 1ZRSA 4JUCA 1KYXA 4NYIR 4DIMA 1D6SA 1WSAA 2C88A 3B9PA 5AM3A 2Z8XA 1T34A 5EVJA 1YZTA 2B61A 4DAOA 4Q21A 3FGZA 3SDBA 1T0PA 3BGWA 2Y1FA 3KE8A 1VRCA 3ZWQA 1VPWA 5LD2C 3GROA 3OOEA 4NYIQ 2HT6A 3T7AA 4D9EA 3LU1A 5EXSA 3J7TA 4OQFA 4MPDA 1HYEA 3R0IA 4P7KA 1MORA 3LLSA 5KJ6A 2C5SA 2ID7A 1K7XB 1J09A 1WBDA 1CG6A 2W6PA 4CEIA 1YWGO 4D9HA 1XZGA 1K2VN 4RJJA 3U7RA 4FMCF 3SI7A 1WB4A 2IUTA 1BEZA 5LQRA 2CV0A 3BRCA 4GKBA 1KP2A 2ZSBA 3IEVA 1Q92A 1B8PA 1TUIA 4D3ZA 1XDUA 4AF6A 4P0PB 2R7KA 1WUIS 4S2UA 3WQHA 1RAHA 1B0UA 1FYXA 4EJFA 2JKYA 4QDJA 1MO4A 4QPNA 5MGBA 4UBIA 2ZJ1A 2E4XA 3A6HA 1SG6A 2QM3A 1VPVA 3JD3A 1SZJG 3MNFA 2JC3A 1UZNA 2W2MA 4HATA 4N8SA 2GXUA 2RB4A 1DWQA 4O3FA 4XWYA 3WLSA 3ZGOA 4BLOA 3UPUA 3BXPA 4CKCB 1KSHA 1BYIA 1KQOA 3DL7A 3FUXA 1PZXA 4MICA 3VQTA 4OOEA 5TNXA 3FPCA 3ICVA 5LLDA 5LNK6 5JAPA 2O2CA 2ONYA 4JSTA 3BIFA 4O2BA 3JV7A 1BMQA 2FPWA 4PNZA 1JPVA 1CW2B 4RKRA 4RZUA 4UM9D 5F52A 3EQ6A 4CDGA 4LXHA 5EKUA 2C7QA 5CDFA 2DHQA 4CTKA 5I9NA 4K5QA 3U7IA 1JXOA 1WPGA 1WXEA 1NZFA 1KY4A 2FN9A 3M9XA 3RSQA 3N7AA 2CNKA 1NQTA 4JI6B 4FJ1A 3A4IA 3AIMA 1WV1A 5ARDA 2E2WA 2W8BA 3ISTA 1WSBA 3PKIA 3PHCA 1K6XA 2BFDB 2OBFA 4FXPA 4GGPA 3OQJA 4FVTA 4K81B 4KQ2A 4LVUA 2PA0A 1IY9A 2C96A 3H5IA 3IE2A 4TKLA 1O9HA 3G85A 1XEXB 1GG8A 3CRW1 3TQQA 4EZIA 2XDAA 3WGVA 4RXUA 4DVJA 1S2NA 5AWFC 1OV4A 3V4VB 3Q3HA 3WS7A 2GZSA 1E1QD 7REQA 4LJLA 3ZHOA 4L3OA 4Y2YA 1BMDA 4MUJA 2ZS8A 3PSAA 5JW6A 1BXRB 3G2IA 1BQ3A 2CLFB 3Q3IA 3ZQJA 4HVCA 1T6XA 1Q1BA 1F14A 1FSFA 1HYGA 2PMBA 1F20A 3AW8A 3R5JA 4ZEWA 4DM7A 4BUZA 1G21E 1VKHA 1NLFA 3GUHA 3DBHA 1L7VC 2GCOB 2PRSA 3N2ZB 4Z5XA 4DT1B 5JXIA 1JPJA 1I94B 2DERA 3FNQA 4G1FA 1ZI8A 5K0SA 4OMCA 5L7WA 3DT8A 5KX5A 2WT9A 4TROA 5LOVF 5GINE 1J1UA 2W6JA 3ROGA 1MC1A 1V6CA 2ABWA 2Q3MA 3FMIA 1PJ8A 3A8TA 3AR6A 3ZZUA 2PTHA 1FRVA 1KHHA 3W7BA 4HJXA 5IN4A 1GPBA 3T95A 1W5TA 3Q6MA 4CKEB 1TRHA 4DIKA 4FEYA 1WL8A 1CUUA 4C05A 1H93A 4FZ3A 5HCNA 2NU8B 3OU7A 1Q95A 3SR0A 4UTNA 1QG6A 2CJFA 2YR0A 4XD7D 1FMTA 3HY6A 3AVVA 1GDHA 1RCTE 4BMYA 2PAFA 4QUEA 3ZXIA 4JLDA 1X3SA 1K5GA 2QXYA 3A9RA 4E6EA 4ZZ0A 3BCRA 1O94A 2X2EA 4YMWA 4BPBA 3ET5A 1SUAA 2DOKA 5KU1A 4N3GA 2HN9A 4QHYA 1L1FA 4QJBA 2QYTA 1KI2A 2A5JA 2QZ9A 2XADA 4Z86A 5AK6A 3ZJ5A 4MV6A 3UMSA 1QRSA 2R751 1NT4A 1OIXA 4PN3A 2F59A 3REGA 2QMEA 5CVTA 5A1TA 2WKQA 2P9CA 2O06A 2ARKA 2PCLA 3OPNA 4EHDA 5JRDS 4BQEA 2QJOA 4RMNA 1WW2A 3GFVA 4JB3A 1C3EA 4UDOA 3W7AA 1TVKA 1JFVA 3QG5A 4DR4B 3WX0A 3BERA 5JMWA 5KCZA 4IZOA 2ZRBA 3GT7A 4OI0A 1CQIA 2QUBA 2XUOA 1H8ED 1LS6A 3KPUA 3ZJTA 1XU4A 3A4LA 1RD4A 4GG1A 4AM8A 4O2AF 1F38A 5HA5A 3GZJA 4WCFA 4XEUA 5CB4F 3KJEA 1JH9A 1ZIPA 1UEJA 2PMEA 4MB6A 4MGZR 4Y2HA 5K3SA 4MR9B 3UAGA 3AF6A 1NN0A 1QVWA 4CCYB 2BAGA 2X9VA 5LQDA 3P0RA 3U19A 1M2FA 2D0PB 3NIWA 2CVZA 3AESA 5I7SA 3HDHA 3MGAA 5CYOA 2J3IA 2EFGA 2FLKA 4FGSA 4YRPA 4C1NA 4MQ5A 3ZPXA 2HO4A 4EAAA 4A91A 4EG0A 2AIRA 1MU0A 3D0OA 2FWMX 3DE1X 4F46A 5C8DA 3ZDCA 9ATCA 3P4YA 3CJQA 1JW9B 3PJDA 1HV8A 3BXXA 3S3TA 3V4RA 3IS3A 2GSDA 1V41E 4D45A 5IS2A 3M49A 2LNDA 4L4ZA 3QJYA 4LVNA 2PKYX 2VYVD 2JZCA 2IXFA 2NW6A 3PIRA 3M4ZA 4KVGA 3CNLA 3R7DA 5B7PA 3PFCA 1JAYA 1U7OA 3CSSA 1C3XA 4C7KA 2F3TA 2IBSA 3ETJA 7AT1A 1Q50A 1VKOA 2SCUA 4PG4A 4LRWA 1XELA 2OO7A 8ATCA 4N03A 4R31A 4AMUA 5K0ZA 3AHJA 1TLTA 1LTKA 3JVVA 1YC5A 1YI1A 5JCJD 2M2IA 2BGJA 3K9GA 1NE7A 4BKRA 2FVYA 2VDWB 3LD9A 4DCUA 4X66B 1QGUB 4QRDA 3N39C 3O8DA 3PI6A 3DBLB 3UCXA 3IIIA 1GGMA 4CIXA 4RIHA 3EPLA 3DL4A 1VMKA 3SPXA 4FC7A 4JBYA 1DAPA 4GHWA 1RI1A 5D3ZA 3UFXB 4GEGA 1A82A 5DM60 2IYTA 3OI7A 1ZQ1A 4YT4A 1QC5B 2QE7D 3HFGA 3N2KA 3PNQA 3Q7IA 4GECA 4RDHA 1D09A 3U5TA 1YB2A 4LYFA 2K2WA 4ER6A 3MIZA 3EA0A 1VLLA 4IXNA 5IKXA 2P35A 4Q16A 3SM9A 4DGSA 721PA 1O89A 1EWQA 3LWZA 3VR6D 4DMGA 2CZCA 1PSZA 2RAPA 2SKEA 3GQBA 4AY3A 2V7GA 1YQQA 2VBGA 2ZQYA 1CJBA 5ALVA 2NPIA 3CCFA 2PEYA 3PGMA 4MH0R 3SE0A 3V8RA 2G9QA 1PLLA 3LG2A 2VQDA 2W42A 1HKUA 5EOVA 2UYYA 1ZVVA 4HGNA 3DE6X 1SUWA 1PK8A 2PGNA 2C4NA 2Q1YA 2IYXA 2G63A 3GEHA 1PX0A 1JZQA 2N75A 1XZ8A 4U9HS 3AVUA 5KWEA 3I6IA 1N9KA 1PIWA 1YAJA 2CLMB 4BRUA 1ZWKA 3S27A 4ZZIA 1U7PA 1LGYA 1SC4A 2Q1XA 4HQNA 3VUEA 2QXUA 5AVKA 2ZGVA 5LP6B 1F4VA 3OJWA 3UFXA 4G85A 2POCA 2V03A 5HOEA 4RWZA 3K4PA 5DT9A 3TRDA 3A3OA 4XDGA 3AERA 1OLUB 2M6SA 3K0EA 4C6SA 5JAMA 2IJGX 1F0KA 1OXXK 3OZEA 4DPMA 1H2EA 1BE1A 5CD1A 4HLUA 3WWDA 3R0ZA 4DILA 4CMEA 3WLEA 3UJNA 2FY8A 1J2TA 3ESBA 1QHXA 4YRQA 2DY0A 4RQUA 1ADBA 4HWGA 1ZYUA 2W2TA 4BLTA 5ABPA 5M29A 3TG2A 2JLAA 1WY5A 4QFMA 2ZR7A 4NCAA 2AFIA 2A9PA 3HWSA 4P82A 3RSOA 2E6KA 3W3AD 3ZC3A 4F06A 3GLTA 3AEKB 4PU0A 4IXWA 2PRIA 2DKFA 5DE3A 5KTKA 1RRFA 1WTAA 4C2TA 1UH5A 1GM5A 2XE4A 3AY3A 5COQA 1P3Y1 3KVVA 3USZA 4CLHA 2Q5IA 3PX3A 5ALXA 2AK2A 2C2WA 3HI6A 4KWHA 2DX7A 2PSSA 4K9MA 1G5FA 1M72A 3R7AA 2CLEB 3A1NA 1VXOA 4NFSA 4G1MB 1TF7A 3C3MA 5EFZA 1QOZA 2W2NA 2ZYDA 1B3BA 3AFMA 4RUKA 4Y98A 5CJPA 5J4HA 5JAZA 2WWIA 5EXPA 3B9BA 1ULBA 3ZE8A 5KMGA 1RJ9B 4WN9B 2DG2A 2O8DB 2OHFA 1IAVA 4F2DA 4BNFA 4MW6A 4D80A 1PT8A 2JLUA 1Y1LA 3EVCA 1Y9DA 1RKVA 2F8LA 1XF1A 2IHNA 3FMFA 2J9RA 3OIDA 1I3LA 1P80A 2NX2A 1W30A 2P2CA 4ADSG 1L5KA 3SC6A 1NVMB 4ACAA 2CJXA 3D8RA 4LZLA 3F1KA 4U1RA 1IWBB 2JK0A 3FJ1A 1ML3A 4HDSB 2NZVG 1XA3A 1WQ1R 3X1KA 2HT1A 3AVXA 1USIA 2OCYC 1KERA 2FWIA 2AF4C 4LV8B 1F9EA 3EQ2A 1KO4A 2I7TA 5DBOA 4J1SA 1L5GB 1DARA 2CVOA 2WIJA 3HWWA 2CKDA 2QDXA 2JFGA 2HLPA 2H3EA 3G88A 1CQWA 3C6XA 3AR4A 1XAIA 4NY1A 1KS9A 3HKDA 1TMKA 3TCXB 3E61A 4IPTA 4DYDA 4PBSA 3E7PA 5EJEA 4FM9A 2C78A 2K6GA 3IVRA 2IS2A 1HEIA 2BHNA 3UMVA 3EDRA 3CVVA 1RNLA 2CT8A 1USGA 4LDZA 5IWCA 1ECFA 5JMPA 4A8JC 3EH1A 4MR8B 3NPMA 4OA5A 3W8RA 2BLNA 3PC8C 4DARA 4EHLA 4BIMA 1K7CA 2RGXA 3MS4A 4YLGA 2IEBA 4EVIA 5REQA 2PBFA 4JYCA 1YL5A 4AQYB 4CMCA 4MQ6A 2EF1A 4LWQA 5ALYA 5A02A 3CF4A 3HCBA 2FRXA 3RC3A 2B7LA 3KUCA 4Y8VA 3QJ5A 1QCCA 3M3PA 1AV6A 2B9EA 1IHPA 5L40A 3ER9A 2BZGA 5K4HA 2A59A 3TM4A 1PT7A 3L46A 1HWYA 5D6NA 5DGHA 3PUXA 3HXLA 3LUGA 2OVBA 2IVZA 3AJAA 5CLLA 3VM6A 2UXDB 1HT1E 2GYYA 1E18A 5CNKA 3B48A 1KC1A 5DNYB 3EXIA 4GI3A 1PDVA 2P9TA 2ZXFA 1SHUX 1NVWQ 5JJIA 1OFVA 1N2XA 4FFPA 5A6SB 4Z4HA 3BWYA 4NC9A 4AO8A 3BUSA 2C8LA 4L0CA 4JYAB 3HCWA 3OHMA 4B1FA 1GCAA 3KL2A 3MTJA 2VH1A 3BRWA 1OVMA 2A0KA 2OGTA 4J0HA 1ZHFA 1QXSA 2P7IA 1BXRA 2QK4A 2ETXA 2I4MA 4JYMA 2NQTA 5IBCA 4IJKA 1Z4IA 5GPBA 4GYWA 3ZWDA 2LR0A 4CLRA 5EPEA 1LBQA 1KEUA 3EULA 1E2EA 1VLHA 2I0FA 3FPSA 4E30A 1JF8A 4OQYA 2VSOA 2R6HA 4TX1A 1MQ8B 4PLYA 2IYEA 4QIHA 3ZVRA 4X41A 3V6LA 1C5KA 1FLDA 1XD2A 1X87A 2NYUA 3GJQA 3QVOA 3U3XA 3VYVA 4IDNA 4FR2A 4BO1A 4DLXA 2QL5A 2D6FA 4CKZA 4H3VA 4YNBA 1YOVA 2IFTA 2CUNA 3G2MA 2VBFA 5EWJB 4EG6A 1J0EA 5JOQA 5KTNA 2O57A 2WYIA 3UK7A 1EM6A 2PZKA 5C32A 1NXXA 1W47A 1S3GA 3B5IA 3LW8A 1HY3A 3QE0A 4M6WA 4NG5A 4X7PA 4Y2PA 3AF5A 5G0SA 3X2EA 4B6JA 1DGQA 1LPAB 4BS9A 4D0NA 3U56A 2O0MA 2HSGA 1IJFA 4NZ9A 5DNVA 3ORRA 1DX9A 1X1TA 1PBTA 5T8KA 2PX8A 3A10A 1Z6AA 1ZL0A 4KXUA 3GRPA 5P8WA 3G2PA 2BZSA 2Q29A 3VXKA 9LDBA 4G63A 5CURA 1BHO1 3GP5A 3R4CA 3IHWA 1YFKA 4RY9A 1A9RA 4U2EA 4H7HA 4L0QA 4R84A 3ADBA 4HNTA 1B6GA 1OBFO 2QS9A 3DAHA 3N74A 3RG8A 1XK7A 3I2IA 1JDZA 3QX7A 4NXMB 1EWYA 2AW5A 1E5VA 1QYWA 2BKEA 4F93B 1Z2OX 3PHBE 1BRTA 1FVFA 4PWYA 2A9JA 2QV0A 5FBLB 2HDOA 3CR3C 3MBIA 1QF6A 4KK4A 3S5JA 1RHJA 1FUEA 2WKWA 1OZGA 4NRDA 3THYA 1MBZA 1PNOA 2VYCA 2J87A 3BAZA 1LY1A 3RSFA 3HBNA 4OXIA 2CMKA 1G3IA 1J39A 2WTEA 2ZBDA 4WQMA 3RYFA 4AJHA 3CW8X 2IKSA 1UZAA 5EHNA 3VX4A 4B7XA 5FEMA 2Q9UA 5DPMA 4P4LA 1HMPA 4AY4A 5F4ZA 1QFSA 4QC2A 4KW7A 4DCNA 1RKUA 4MPTA 3MTEA 3VNBA 1VDMA 3IAS1 4DCOA 2OV4A 1XU9A 2GLTA 2IP1A 3PQ4A 3VPBA 4ZTZB 1NW7A 1L9KA 1N75A 1Y1PA 2HQOA 1J2UA 1S9HA 2VHXA 4UBJA 4ZQCB 4BP9A 2ZM6B 2AL7A 2IIBA 3CT6A 1XVTA 3VHQA 3J81k 2GZAA 3WGMA 4B6FA 3KJGA 1VOTA 3NAGA 3DH0A 4BOYA 2NUAB 1JLMA 1ORVA 1ETHA 4HEA6 1XXHB 1XRLA 2OUKA 4KXXA 4O4IA 1OX5A 5EJ9A 1VHJA 2ADMA 2XKJE 3LW7A 3U5ZB 4ZEXA 1IEXA 1V48A 2P90A 3GX1A 4GOLD 2V4ZA 4R1SA 3ZWKA 1DCKA 1QGUA 5LJIA 5KI6A 4C7OA 1Z8DA 3GFSA 2IGTA 2UUOA 4YCCA 4ZEOA 4EG5A 3IDSA 2W2OA 3F3SA 1WB5A 6PFKA 1V43A 2UVPA 2J6IA 4JUBA 3EAQA 4PHTA 3GFPA 4YQZA 4AXXA 1FNBA 1CFJA 2GYUA 2PT5A 3E9YA 4GP7A 1ZM9A 4S1WA 2WY2D 1H3EA 4G89A 1VA5A 1ZAKA 1NXPA 4B3JA 3CR8A 2Y76A 1C3OB 4UASA 3REFA 5AUOB 1WSDA 2H65A 3LY9A 1A50B 2QJRA 4IYRA 4MW7A 5K3DA 4DUGD 3DP9A 4QXRA 2TECE 2AOUB 3GDWA 2J6HA 3TSCA 3NGMA 2P79A 3ZZTA 2XOKA 1F6BA 2VJQA 4GXTA 1NWCA 1VHDA 4RFSB 1YE5A 1YMVA 3IQHX 3N0XA 5F5LA 2QRLA 5E1MA 5FF9A 5A4DA 5BY2A 3A6KA 1SGWA 5NULA 3VPAA 4L2IB 2YCLA 3FUUA 3GA7A 3I0MA 2WT8A 3A3PA 4XQEA 2GD1O 1MAAA 1KOLA 2PPLA 4BX3A 4GBED 2ZYVX 1BO6A 1NTRA 1ANKA 3ODPA 1L5WA 5FJJA 3DV2A 1L2TA 4EEZA 2XVXA 3EPJA 1YC2A 5M2QA 4Q7LA 4RORA 4YWJA 3DEKA 4IXTA 4NARA 4WTOA 5AOVA 2V7QA 2P27A 3HSSA 5KB3A 1ISJA 4TKVA 3VR5H 3SR4A 4ZGBA 4LJAA 2X1VA 2KJQA 2ORED 3S7TA 1UOQA 1PZNA 2NV2B 5CVDA 1SN7A 1HORA 5TSDA 3WGQA 3RTDA 2N47A 3UJDA 4B73A 3O6VA 3ZY3A 3DBOB 5ALQA 2VJKA 1E4EA 1N1GA 1P1FA 1Y4ZA 2PKWA 1V1RA 2VLIA 3FAKA 4NMXB 4QE3A 4QNRA 2VCHA 1TZCA 1K75A 5IAGA 2C7VA 1RQ2A 4JOSA 2CDCA 2V8BA 1VG1A 1OBOA 5EHIA 3FYUA 2EW1A 3COYA 3B20A 3P26A 5TLSA 5E3JA 2QVGA 3G0GA 1BE0A 1RZUA 3HU5A 4CM9D 1Q84A 4U7WA 1U5BA 4EJSC 3CZ9A 1YZNA 4G5SA 1UBRS 4II2A 1PG0A 3ZCQA 2J5QA 1XTQA 4X8HA 4ZGGA 3ESDA 1KK1A 3CSUA 2I2FA 3IKLA 5HDQA 2VHZA 1Y7IA 1MB9A 5FOWA 5HWSA 1XD9A 3RIGA 4QYWA 1CIVA 4Y6QA 3K09C 1ISMA 4I50F 4LJ4A 4FKZA 1H2ZA 1QFYA 2G5GX 1A5BB 3D7NA 1PGNA 5AESA 3M2PA 2WM9B 4DA4A 4F9TA 1WVMA 2FP4A 4YMTA 5CEJA 1NI3A 2ZIXA 5CM9C 1TADA 1UAYA 3FWKA 5AH0A 4KO1S 3WK7A 3ZE9A 3ZIAD 3HVRA 3EPHA 4ND4A 3ENNA 3Q3EA 3C7AA 1Z82A 5FOQA 3TAHA 4D4KA 1RTKA 3PGKA 3QUQA 2NLOA 5KYYB 3MOGA 1W0JD 2AN4A 2VDKB 3DE7X 4P3XA 4IIFA 4MGHA 2EW2A 1CRWG 2H2HA 1NVEA 4CFYA 1PTJC 1MNQA 1UMCB 5F1KA 2VWPA 4EJ6A 4ZV4A 1S89A 3BMOA 4HNAA 4UNQA 2POQX 5TX7A 2R97A 3UK6A 3ZZMA 1J1IA 1ILEA 1UT6A 5I8WA 4LBZA 4CM7A 3H5RA 5HM8A 2LTAA 2REQB 4EECA 5KOJA 4RENA 1DX4A 1X1EA 4OL9A 2Y71A 2WDPA 5B1SA 5TS3A 1VGVA 2FSHA 4CT0A 5JYDA 1PZHA 1HYQA 1T3LA 1E6UA 1R6AA 1RACA 2F1KA 4N1AA 3WK5A 2DKOA 2RBKA 4J0GA 3PUJA 5E2BA 2GEUA 3V8PA 4EPXA 3NNSA 1IXKA 3SKYA 1JLLA 3EE6A 3RV4A 3SEZA 1JHRA 2CFSA 3EZ6A 1RU3A 4PX9A 1VPTA 4BX0A 4ESEA 1PKXA 2OGUA 3ZDDA 4H6XA 1FS4A 1JKJB 2L82A 1LK7A 3TLJA 4KAJA 3EGWA 4FMPA 4NEQA 3A1CA 4E94A 2DSNA 4KPGA 3SVLA 3L7CA 4J7UA 5HMMA 3P19A 1RC0A 3A6LA 2BFDA 3ZW9A 5KQSA 1T8UA 4RETA 3SVTA 3KB8A 3EGVA 3EASA 4UHCA 1DAFA 1II8B 1XZBA 2NXJA 2YZGA 3R23A 4Q3EA 3F6EX 4JB2A 4GKJB 3T38A 2XUFA 4TV9F 3KU1A 5BSWA 3KLNA 3N8KA 1A8UA 1YKSA 5LM3A 4UCXA 4R05A 3BTUA 1EFVA 2PLFA 3RFVA 1W4ZA 1JWAB 3QPBA 4AYXA 1KJQA 3QLVC 1IQRA 2X6RA 3CNHA 5CVUA 1K6EA 4PYJA 3G0IA 4Y6SA 4MS1A 2B99A 3OTOB 4C7XA 3LC2O 2VHTA 3IE0A 1W36B 5FWNA 3DUFA 3QHQA 1K7YA 2ZAIA 5GZ1A 5JCOC 3C3XA 3FCCA 5FI0B 4E88A 4JXZA 4QQNA 2GZ3A 3REOA 3TIVA 3IIJA 3RPEA 3P94A 5EUMA 5EXXA 4WW0A 2C9DA 5T6BA 1QIKA 1K6IA 1X86B 3ODGA 2EW8A 4R41A 3ENWA 3B3FA 3SJ7A 1P91A 3TRFA 3S2SA 2AOVA 1T5LA 2OT3B 4FGZA 4OJKA 2E1PA 1PL0A 2OEPA 1U7WA 2YNMD 3A9WA 5EJGA 4EYEA 2GBFA 4HAIA 3DUFB 3ACDA 3PUKA 4IICA 3OTHA 5JU6A 2HLNA 3FFBA 4LOIA 3NGLA 2DJ5A 2JNWA 3IOCA 1V5WA 1N3LA 3P5BA 2KPOA 3R5FA 4ZREA 3VVBA 2ZI5A 1SKMA 1H4SA 1RI5A 4OJQA 3T7TA 4K9PA 2HMWA 1WG8A 3HS3A 1IB6A 2H7YA 2WUGA 4WACA 1M75A 1X7XB 3UJAA 1VYUA 4WZBA 2FP3A 5E3HA 2ZIVB 1TIBA 4BFZA 2BJVA 1T15A 2QTCA 4XYMA 3SX4A 5CFRA 4B80A 3AEQA 3GCDA 1P18A 3IERA 1NUQA 2UV8A 4N5NA 4Q1DA 4JR2A 2BFFB 1KAGA 3FHOA 2VZ8A 5KS2A 3DMPA 1M8GA 3K4HA 5TGTA 5FTLA 2YOGA 4PYQA 3GZNA 2VYND 1OZHA 4G0VA 5AT1A 1MXFA 4B43A 3GNTA 4AWXA 3N6VA 4G1BA 4YMIA 4B3HA 5I4KA 1OZFA 2XMQA 1SUIA 1U1IA 2O7NA 4LDPA 1JA0A 2W2LA 1DBQA 3DBVO 3KAQA 1M2VA 1R5JA 4IP0A 4WXYB 2AD1A 3BGVA 2B2CA 4P22A 3TI7A 3D6JA 3A2KA 1QUEA 1ZM2A 3PYXA 4N8EA 1HRDA 1IEQA 3QG1A 1ZH0A 2X4LA 5C3MA 1M73E 1TW3A 3KOMA 1JKJA 4NCBA 4GU5A 2M32A 4UM5A 3BB4A 2D7CA 2HV8A 3L8MA 4QFDA 5GONF 4NE7A 5I9BA 1RRGA 4RKFA 1CDOA 1YO6A 3UQYS 4ZU6X 3G2LA 5ALWA 1UFRA 2FQ1A 3TD2A 4RK4A 4WKPA 5HJEA 3NAMA 5LN1A 4QOIA 2D5LA 1MZPA 1Q7EA 1YBAA 1SVKA 3QBVA 1DOZA 3FF1A 3TAUA 2C00A 3F47A 4C3UA 4C4TA 4EG8A 4YUWA 3D8BA 2NO5A 1P3JA 4LY6A 1EX7A 4ZK2A 2QRJA 4AP9A 1XT6A 1CDZA 1GNLA 2AS0A 1CQXA 2VZ0A 3QP9A 3V1MA 4E12A 4R68A 2XR1A 3C24A 3IULA 4G6ZA 2O48X 3OJXA 4XA8A 2SKCA 3LMKA 1R6VA 3AYXB 3IUMA 4MK4A 4WK2B 1QHHB 1ZMBA 1EB8A 3BMOB 5D86A 10MHA 2JFZA 4OHPA 4AKEA 4G5XA 4K8OA 5L6LB 3LCRA 3D0RA 2NYAA 4INZA 3R44A 3O4VA 2X13A 1OAOC 2K7FA 1IQUA 3EXHB 1RM3A 2BM9A 5B1IA 2GBLA 3OOYA 1Z34A 1IWPB 3EZ9A 4JC5A 4LC0A 1F8UA 1IOLA 1P29A 1DG9A 4MQMA 3X3HA 2X41A 1EXVA 2CV1A 1OX4A 2A9QA 3HSKA 3V97A 2R0QC 3PXCX 1KKMA 2H1WA 4A2CA 2FMIA 4XR9A 5E95A 1WUTA 2PJRA 3N0TA 2QVXX 1KPHA 3TO5A 4C7JA 1WHSB 2JLQA 3E9RA 3PQ7A 4GZ5A 3UCEA 3HYLA 3IP6A 1HQYE 2HI0A 2OV2A 2ZRMA 3WL6A 4EA6A 5KVAA 2UUBB 3KB6A 5E6RB 1IM2A 1PR0A 4X20A 1PJQA 5F1PA 4C4YA 3K5WA 4IV5A 4F4HA 5E7JA 1EUDB 4MV0A 4RTLA 2IYSA 1FCJA 3AZQA 2I4OA 4YRDA 1ITZA 1U5BB 1T2CA 3F7NA 5LYYA 1TECE 1SVWA 1Y81A 1LB1B 1WCV1 1U1CA 4J3JA 3VYSB 5L51A 4JVSB 4PW0A 3L0SA 2H8KA 4UAGA 1PEAA 1N4AA 3HYNA 1PBNA 2BCGY 1U9ZA 3UB2A 5MFPA 1XMJA 2D2IA 1CJVC 4MW5A 4AO6A 2CHGA 1G7CA 1MH1A 3EEFA 3USCS 4AECA 5JCJA 3TL2A 4CTOA 2B7BA 3CH6A 1GPKA 3FWPA 4ZT4A 3GLFA 1CZOA 2QT1A 3SS7X 5I8ZA 4WKOA 3WZMA 1NDHA 1US8B 4AULA 1D03A 3GV0A 4WJLA 4Q9NA 2PS3A 1OMOA 2AFHE 2I33A 4J29A 5H82A 1N1MA 1UAGA 5T67A 1V1MA 3C1OA 4CV2A 4LKRA 3NBQA 2UKDA 2VYVA 3KK0A 2JH9A 1VYTA 3RABA 3OOJA 1H4QA 1B16A 1TCUA 1S1MA 3M5PA 4NH4A 5DN6A 2DWOA 5CDUA 4XIJA 4M1SA 1XQVA 4C4ZA 3AY6A 1JR3E 1FX1A 3C3BA 1EVKA 4KXLA 1BXGA 1AO0A 1C41A 1IEWA 5I7WA 1N34B 3K6SA 1QGAA 1NLUA 1SCBA 4I99A 1U8TA 2WVJA 2ZVPX 4LYDA 4PZYA 4EHFA 2GRUA 5KIAA 1K27A 4M8LA 1PN3A 2VEDA 2JCSA 3JALA 1N1DA 2HU5A 1N4DA 3RUCA 2HJHA 5CDTA 2QVBA 3K5PA 3PFGA 4RKEA 1IU9A 2O6HA 3MJTA 1HURA 3OFKA 4JUFA 4MW1A 4L95C 3FNRA 4CM4A 5TQ0A 3GF4A 1Z17A 2QVZX 4UE6A 5DB4A 3RTEA 3VU1A 3WKDA 8ABPA 5JRJA 4HQKA 1NOKA 2DJIA 1RBQA 1R6DA 1C3VA 1SQGA 4QOHA 4UATA 1U8XX 5E6UB 3RBZA 4CTJA 3C97A 5BN1A 4CKWA 5JANA 2P0YA 2YWXA 3TDMA 3I92A 2D0IA 2GPSA 2BFPA 3H2ZA 3IOYA 5TPWA 2YV4A 4PQYA 5AKIA 3L93A 4OYYA 1QPZA 1EX6A 1E2DA 1Z0DA 1EK1A 1JYEA 1JYFA 4JXKA 1CJKC 1WA5A 2ZIGA 1PVDA 3K92A 3LX5A 2HZ7A 4WRRA 4A8JB 4CCWA 4PC3A 3KXIA 1LUAA 2ZSHA 4I9UA 1UM9B 2Z3WA 4QJIA 2P6UA 5HS6A 2EAUA 4YJDA 1I1NA 3KR0A 4MROA 2VTVA 3MQ2A 3CB2A 4WXPA 1C8LA 4ASUD 2ZUVA 1EB9A 1YQUA 2G1KA 2F3SA 1AGYA 3Q8WA 3IOBA 4H77A 2VAPA 2Z6VA 4P34A 5JI3E 3RKUA 3SX2A 5JS7A 5HS4A 1QE3A 5CDHA 3MAAC 2IU6A 2ZIFA 2VDOB 3DZCA 3H3FA 3PU6A 4Q4HB 4XB1A 5AKEA 2C4KA 4RC9A 3ZVLA 3LL4A 3LBIA 3AH8A 4DFDA 4JJIA 2V59A 4IFEA 3IBCA 1RTTA 2CNNA 3EIQA 3TRIA 3EC7A 1MRNA 2JFUA 4ALLA 4BV3A 5B5SA 5D1NA 2WF5A 3FCSB 1NBIA 4RS4A 3H42B 1NX6A 4ECEA 5J4VA 1RWQA 1T0HB 2BGTA 5BQ3A 4HTAA 5HX7A 4MQFB 3M0EA 1HDEA 3NIBA 2QTAA 3IAAA 1Z8NA 1J22A 2EBUA 3U81A 2GCGA 2BBSA 1AZSC 1DIAA 1FDIA 2XTJA 3F2VA 4G0XA 4P81A 4PR0A 2QRVA 3IESA 5EINA 4F72A 1NNEA 2VA8A 2YN0A 5AKGA 4MS4B 4LS3A 3R3YA 3SWWA 1FYDA 2HTFA 1CZHA 1E66A 1NUAA 1YR2A 2DPLA 3GUZA 3W8FA 1R0CA 2VRNA 3IEUA 1B8VA 3PVSA 1G8JA 2CHUA 5HKAA 5ALLA 3QEBZ 1XRRA 3HZOA 1XV5A 3FFWA 1UXIA 2I66A 1E62A 2WWRA 1UQTA 2W2VA 2M6RA 1PG5A 2YHBA 4HGOA 4B4VA 4OHYA 4LX0A 4BO8A 1ZISA 4WZZA 1XNRB 1GPH1 1PTKA 4X7BA 5ESDA 1R4NB 3D7SA 3K6JA 3FWNA 2YJGA 3A1SA 2EFDB 4TTQA 5DK4A 2H5LA 2R6AA 3I58A 2EFCB 1T29A 4IVPA 3F5SA 5EP3A 4RPCA 4EYKA 3M1YA 3OEWA 1TL7C 4J7XA 4KXMA 2OCXA 2YBDA 3I4CA 4GRDA 4RSMA 1PQ4A 1P5JA 3K8YA 4DA7A 8AT1A 2W2KB 4HY3A 4HS4A 2Y6UA 2I1WA 2X8BA 1BA2A 4WERA 4MCAA 5DVZA 3GJXC 2PLRA 2H5IA 1TU4A 4OL0A 2VBIA 4JLJA 4YCBA 4DBLC 2FOIA 1H85A 2QY6A 3E9CA 3O75A 4Q9KA 5DBHX 2J31A 1JSXA 1WLSA 3BBPA 3HC7A 4GOKA 3Q87B 2WSSD 1YQEA 4C1BA 4Q03A 5JFTA 2FX3A 4RCZA 3NEYA 4HLUC 2YY6A 3IP5A 1TIPA 2A7XA 2N3ZA 4AZ3A 1W8IA 4IQ4A 4XYGA 4G36A 4FUTA 1DBSA 3K1AB 4JFRA 2Q0SA 2YHIA 2Q1WA 4RVSA 1CZKA 2PUHA 4DXDA 4B9EA 3P9KA 2EJWA 5E9AA 3ADOA 3MMNA 4D02A 3DAOA 3JQGB 3H86A 3LPAA 5A6SA 4QSMA 2GBCA 3JQ9C 2FPIA 5EERA 1Z33A 3V4OA 2APJA 5A6VA 5ESWA 2F55A 4MB2A 5EZYF 4CGZA 1KO1A 1DMRA 3KLPX 5IJWA 2HSZA 3IUQA 1V8DA 4HEJA 3GRRA 4OEHA 2FSVC 3NHFA 4C03A 5BSVA 1SCIA 3X2FA 1E3MA 4RK1A 3O4FA 4QEDA 4INPA 5KJCA 5C1IA 4B35A 5FNVB 1XHFA 2R5FA 2X6QA 3N8IA 2OQVA 3GJRA 1Z16A 3EGXB 3K73O 1U2DC 3L7KA 1WZCA 2IQIA 1DDIA 1XEFA 1ZIOA 2L69A 3AJRA 1JHYA 1X8LA 3BICA 4KU4A 4DMRA 5ITWA 2NMVA 1JHXA 4IGEA 3RV3A 2WWHA 3AT1A 1RPZA 3CNEA 1AK1A 3MWFA 1NHWA 2R6CA 4M8KA 4MO2A 4KFTA 5FO1A 2HSEA 4BYGA 5EQFA 1G4UR 1B73A 3I6BA 5LYJB 3V1KA 4GZMA 4MR8A 2BE7A 3BXHA 3BK1A 3FTCA 3O9ZA 3T7RA 1QBKC 5K8IA 3AO0B 3MGCA 1GYRA 3DOHA 1J07A 1ZC3A 2R6DA 1SXIA 3H9UA 4X44A 4C6RA 1VBNA 1RSZA 1XCBA 1SOWA 1P75A 1Z4OA 2AVDA 4JX8A 3UC5A 3MINA 3BEOA 5AW6A 1RQLA 1JU4A 2PKXA 3CM0A 3TUIC 4UTPA 1K3FA 1NU6A 3L6RA 2O8BB 3ESZA 2HJWA 4L5CA 3GLVA 5BNFA 4NF2A 3OICA 4BGUA 2ZKLA 2FR1A 2MYUA 3K9FC 4OBBA 5E4JA 1U0FA 1J5EB 3IO3A 3QF4A 4BLUA 2IDKA 1SOUA 5LZ2A 4MKFA 2DXIA 3ZGYA 3NIGB 1DXQA 2BGIA 3FBTA 4LHXA 4L76A 1SXJD 1OAAA 3IVXA 4GOXA 3UOGA 3KELA 4RTQA 2ZXUA 3ST7A 1EVIA 3T9CA 1MC5A 2VJBA 1KFJB 3DDCA 1UP7A 1ELOA 2PMCA 1BQEA 4U4AA 1K6JA 5GM2A 5TE9A 1ZMXA 3D3QA 4M21A 1II0A 4CLXA 4CEJA 3UGTA 2QSZA 1K68A 1EEHA 1H4VB 3B3GA 3THSA 3TSAA 1C8VB 1GAXA 1VP9A 3K30A 4GMDA 4J43A 3FH0A 4GI1A 4V24A 4Z53A 3AVWA 1AQJA 3TIGA 1JEDA 2R60A 4DDKA 1WTCA 2JEYA 1V9CA 4US1R 4EDHA 5ICSA 4CMBA 5K03A 3WYAA 1QCZA 1YR8A 3M3HA 1EQ2A 2G4LA 3UV6A 4RHTA 2FPUA 5DRTA 3WAKA 4EB8A 2ST1A 2O8CB 1L3IA 2JAQA 5J2UF 3F7OA 1EZ1A 2QRZA 4A7PA 1BEEA 2CLLB 4OXQA 3KOOA 1B7GO 4ZQBA 3V46A 2I4IA 2MINB 3VVLA 1YTUA 2DQYA 1NVAA 1Y3IA 1YDFA 1G42A 4GDFA 2X76A 5DGTA 5IRCD 1M5UA 5LOVB 3C85A 1SULA 1SBHA 2QZJA 3AG6A 3CLTC 1JIVA 2O2JA 1KS2A 3AIIA 1Z56C 1B74A 5IEBA 2NU9B 2GF2A 3L7IA 2FCRA 4QOGA 2Q2VA