4Q82A

Crystal structure of phospholipase/carboxylesterase from haliangium ochraceum
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
236
structure length
235
Chain Sequence
b'AMVDDRPSSARLSVRALDTTEAGNGFWEYLPPRYGAEPAPLMVFWHGIGENGDGSEAALDKVLANGPPRYIERDEWSNERPFVVLSPQHAGGGCPSADEIRDFLAFAVDTYEVDESRIYLTGLCGAIGSWNYLRAHLDTTPIAAAVLIAGNGRPAFNDHGCDLAQVPIWGFHGDADPTVAPAGTIEPMNGLIACAQPRADQQLTVYEGVGHDSWSRTYSLSAGHDIYAWLLSQSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase/Carboxylesterase
molecule tags Hydrolase
source organism Haliangium ochraceum
publication title Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum
rcsb
total genus 78
structure length 235
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q82A00
4U2BA 5CT4A 2XUAA 5ALGA 3C45A 4MXDA 3TEJA 5JALA 5A7GA 5KREA 4AX4A 3R40A 4OU4A 4QLAA 1DINA 2LIPA 2YXPX 3AJAA 1JMKC 3JYHA 4WFJA 3AIKA 2GBIA 1NU6A 4H7EA 4WFKA 3H2KA 5LKAA 3FNBA 3FWHA 1QGED 3O4HA 2JIDA 2XUQA 5IVIA 2WUDA 2GYWA 3I2GA 3ICWA 5IH7A 4X92A 1TIBA 1VZ3A 5AKKA 4OB6A 3HSSA 5AM0A 3PFBA 5T4BA 3BIXA 3I6ZA 1TAHA 4AMZA 4PF1A 4CFSA 1JMYA 3EQ7A 2JGLA 3HC7A 3FLEA 3W06A 2HDWA 5HZGA 1WPRA 3DL7A 2I03A 1PFQA 5CT6A 4K6GA 5JATA 3FYTA 1WHSA 4AO8A 3B12A 3V1LA 4RGYA 4RPCA 2Z8ZA 1U4NA 3WWEA 4QDUA 2O7VA 3WL6A 1W75A 1C7JA 3EQ9A 3IVMA 2XMZA 5CBKA 3AZPA 2XQIA 4XJVA 2QVBA 4HXEB 1ORVA 4GLBA 5JD5A 5A6VA 1C4XA 4FTWA 2IX9A 3M81A 1Y7IA 4C6HA 4BC1A 1HQDA 5EHNA 1DWQA 1EHYA 5ALPA 4QA9A 2P8SA 4L3WA 1E5TA 2WIFA 1QTIA 2XQFA 2ZJFA 5T4EA 5A7FA 1VKHA 3H04A 1K6EA 4UHEA 5JZBA 1U2EA 3DDUA 4WY5A 4B6GA 3QMMA 5JYCA 4P93A 1G66A 4QDXA 4DMCA 1ZI6A 4G4IA 4GEGA 1EVQA 1JI3A 1XLVA 3I28A 2OXEA 4BRZA 3NOXA 5IVHA 4J0CA 3WA7A 3VJLA 4FBMA 2XE4A 4X71A 3V48A 1FFEA 2EDCA 4H7IA 4IO0A 5ALIA 3CCBA 4AZ0A 2B20A 3ZWQA 2OCLA 5ISMA 1XZEA 3GELA 1ZD4A 3BWXA 1UK6A 3C5WP 2WTMA 4NS4A 3PE6A 2R11A 2XDWA 3EF3A 4UHCA 4HXGA 1H2ZA 4YK7A 4N8DA 3D5EA 5ALWA 2XUOA 4IH4A 3AZOA 1P0MA 2Y2VA 4BZWA 3G0CA 4WJLA 1JJBA 2ZYSA 4H7JA 2HRRA 2CKMA 4C4XA 1TK3A 4EA6A 4OU5A 1QIDA 3VJMA 2J3DA 3AZQA 3PF9A 2JF0A 1NU8A 4XX1A 1BEZA 1EB8A 2E3JA 1LPSA 2BGRA 1IMJA 4WDQA 1FFCA 5AI9A 3D7RA 4KRXA 4BP8A 2C5GA 4A5SA 2JGEA 4LHEA 2PSFA 4B7ZA 2G5PA 4DNPA 2C0PA 1SOMA 5EI5A 4DNFA 2GYVA 3BXPA 2OPHA 4RE6A 1PJAA 2PUJA 3QPCA 4JUIA 1H23A 1JKMA 4QDZA 2QMQA 5ALNA 1EI9A 2C5FA 4KACA 3WK4A 4UHHA 3WJ1A 5IKXA 1R4ZA 2WJ6A 1XZFA 1WB5A 1ZD3A 3STXA 1UOPA 4G4JA 1XQYA 5JAHA 3HXKA 3EQ8A 3E1GA 1H2WA 4MWSA 4BAGA 2V98A 3R3YA 2R8BA 1HL7A 2WG1A 1OCEA 3PFCA 3SX4A 2QM0A 2OAEA 2XMSA 4TPKA 1WB4A 4FLEA 4OPMA 4Q3LA 3AUKA 2BCEA 2WFLA 3BJRA 4RNCA 4KAFA 5LZ7A 2G5TA 3U0VA 2Y6UA 3FLBA 2ORYA 1NX9A 4X97A 1FSSA 1W76A 4H35A 4AZ3A 2OCKA 1WCYA 2XUGA 2ZYRA 4QWMA 4EUSA 4K6HA 2XUDA 5F4ZA 5LYYA 5K3EA 3H17A 2C7BA 1PV1A 2FJPA 4ZGBA 3V1NA 5YASA 1LPPA 4QLOA 2PSHA 1R3DA 5ALRA 1EA5A 1LLFA 2QZPA 1ZD5A 4PSCA 4CG1A 3Q8WA 3OTQA 3D2AA 2PM8A 1WHTA 2OG1A 1GPKA 4P9NA 1MPXA 3BE8A 3DOIA 1ZIYA 2ONCA 4QEKA 4CCWA 4EBBA 5A62A 3DD5A 4KE9A 3DNMA 3X3HA 1GGVA 3DYVA 1FFAA 1P0QA 2WIDA 4H77A 1UZAA 4MQLA 4FNGA 4LXIA 2VQ6A 4G5XA 1CIJA 4W1QA 3CN9A 4C89A 1A7UA 5ALVA 4X6XA 4EHBA 1IZ8A 1DQZA 2DHEA 4Q05A 2FX5A 4NVRA 4A23A 4QDOA 5AK5A 5I9IA 3KD2A 5SYMA 4ZV9A 4XVCA 1QTRA 1FJ2A 2HA3A 5FRDA 2PBLA 1IUPA 1G5FA 3I2KA 5DWDA 5K3BA 1QFSA 4AO6A 2HA0A 1CUIA 2UZ0A 2OQVA 3L1JA 2RGUA 4IH9A 1BEEA 1F0NA 2HA5A 5EIEA 3O4GA 5FXMA 4KYVA 1GT6A 2DR0A 1QIHA 1UT6A 4X94A 2WFMA 4DSZA 4M0EA 2CUTA 4BATA 5BV7A 2YH2A 3KWFA 4DGQA 4BAUA 3S8YA 1DWOA 5AH0A 3VKFA 1TCBA 3DQZA 2VTVA 2WIKA 5LLSA 3V9AA 2WUFA 1CUVA 3ESCA 4DLNA 3Q0TA 4B84A 5EGNA 5C8ZA 5HKAA 2JGKA 2WTNA 3STVA 2B9VA 2VT7A 3HYSA 4OYYA 3R3ZA 1MT3A 2VATA 2WHPA 2AJBA 3BL8A 1UOOA 4BTVA 1MNAA 3V1KA 3VVLA 3AIMA 2XMCA 4F5ZA 4FLMA 1MTZA 4M0MA 2OCIA 4INZA 1YAHA 4E15A 1J07A 4X95A 2Z5GA 3QYJA 4YX9A 3ZLUA 4P08A 5K3AA 1CUFA 3B3QA 5CH3A 5ALEA 1P0IA 1UXOA 2WQZA 3ICVA 1CUSA 5AM5A 2QRUA 2ZVDA 5E4JA 5LIPA 4FMPA 1XZBA 5CURA 1CV2A 1AX9A 1CUBA 4K5QA 4V2IA 1VOTA 3I2IA 1Q0ZA 2OCGA 3UMJA 4HZGA 3MUOA 4MEBA 1G4HA 4B0OA 2B61A 5CXUA 4WDRA 3WWDA 4OSEA 1CUJA 4HRYA 3H2IA 3FCYA 3O4IA 5CXXA 1XZDA 4Y2PA 1YS2X 1XLUA 4J0JA 3DYIA 1VE7A 5HFNA 1EB9A 4GXNA 4UPDA 3E3AA 4ZI5A 4UBMA 2WU4A 5AKLA 4WCVA 3ESDA 2QXTA 1KU0A 5ESRA 2VF2A 1JU3A 3M83A 3O9MA 1TRHA 4Y2XA 4G8BA 3GA7A 3QBJA 2XI4A 4LIPD 4LKOA 2ZYHA 5JIBA 3WKAA 1XZHA 3M3DA 2BUCA 4Q3KA 1L7QA 5D6OA 2QJRA 2WG0A 4BDTA 3K2IA 1LBTA 4IH1A 1QLWA 1XQXA 5AKYA 3G9ZA 3ZLVA 5ALHA 4MWTA 2Y6VA 5E2IA 1XROA 3STUA 3FBWA 5KWIA 5IVKA 4H7KA 3IULA 5ALXA 4PW0A 5JZSA 1TKRA 5AI5A 4GW3A 3WI7A 5AK3A 4EY5A 5EHZA 4BAZA 5AM3A 4BVKA 1QIMA 1XZAA 5IVDA 1XLWA 5C8VA 5CT5A 3R41A 1UKAA 2DHDA 4ZREA 5HKBA 5HF6A 2HFKA 3ZLTA 2JGFA 3D2BA 2C4HA 1UKCA 3QVMA 2V97A 1LBSA 3QITA 1YAJA 2QS9A 3ANTA 1TCCA 3CCCA 3FCXA 1K5PA 1Q0RA 4AMYA 2DCMA 3QZUA 3IA2A 3H2HA 1RYYA 2VA9A 1ETHA 3HACA 5E4YA 1TCAA 4DIUA 1E8NA 2HA2A 1XZMA 4GHWA 4X93A 1GXSA 4X91A 1A88A 4Q34A 4HRXA 4OD0A 1LPMA 1CUCA 4G9GA 1R9MA 4ZXFA 2OGZA 4MEAA 1XRRA 1HLGA 1GPLA 4DMFA 1QE3A 3HLKA 1XRMA 3QH4A 4AN0A 3C87A 2XMRA 3OPMA 5ALSA 1HBJA 4QE3A 4OCZA 4NZZA 1HKHA 4Y2QA 4RE5A 4UBOA 3HZOA 3I1YA 2HU8A 3IIIA 4BC0A 3H18A 2O2HA 1VJ5A 1MNQA 2PL5A 4P92A 4E46A 2AJ8A 3RM3A 1CVLA 2AJCA 1R50A 2QR5A 1A8UA 2GYUA 5DTJA 4S0XA 3GROA 3HRHA 1EVEA 1Q83A 1N1MA 2GBCA 2QOEA 3ESAA 5C81A 1CUWA 1W52X 2J4FA 1B6GA 3F8SA 5DYTA 5AOCA 4AQDA 2WSLA 3WKEA 5LZ8A 4JH0A 4B85A 1YSCA 3C6ZA 4B82A 3ZV7A 1DQYA 3DOHA 5LZ9A 2YASA 3FVTA 3D0KA 4ITVA 4G8DA 1VXOA 5K3DA 4W1PA 2XLCA 2ZSHA 4J0DA 4BTLA 4IQ4A 1UOQA 2Z3ZA 5K3CA 2XUJA 4J0KA 5HQ3B 1F0PA 1CUHA 3N0TA 4ETWA 1WPXA 3DEAA 3WK8A 1T2NA 3PICA 1E8DA 1BN7A 5CTAA 2GZSA 3VISA 4C4YA 4N8EA 2PUHA 3NGMA 1XKTA 3O4JA 3L1HA 4HS9A 2FUKA 4C88A 3D3NA 1RP1A 3W2TA 4PSDA 1RWQA 3GFFA 1QO9A 5BWBA 5D7BA 4F60A 3BDIA 4G9EA 1XQWA 5HFAA 2JGJA 1EINA 5ALFA 2XLBA 3H0CA 1EK2A 1A8SA 5LZ5A 1CR6A 3FAKA 5AKXA 3PDCA 5SYNA 3C43A 4GI1A 1CPYA 1DU4A 2WU3A 1BCRA 2OQIA 4BDSA 2EEPA 2RONA 1XRLA 4H7DA 4QDTA 4B81A 4FFVA 3VDXA 4UHDA 4GECA 5I8PA 4FNMA 3NWOA 5E4TA 4Y2SA 3A6ZA 1ZICA 2AXEA 3KXPA 3I6YA 1YA4A 2CB9A 3P2MA 1QIKA 1MX5A 4QWWA 2JGMA 5AIBA 4EY7A 4LXGA 4G1FA 4U2CA 5JAPA 5CW2A 5K3FB 4HTAA 5BWCA 2H7YA 4O08A 1K63A 4OB7A 1X70A 4Z49A 3F96A 2YYSA 1XRQA 2RAUA 3PUIA 1AGYA 3WKCA 1ZGBA 4UFNA 5AI8A 4L0CA 4X6YA 1VLQA 3I1IA 1GZ7A 3H1BA 5AM2A 1CLEA 3CXUA 1DWPA 1BU8A 2K2QB 3LCRA 2PVSA 2H7XA 5ALTA 2V9ZA 2CJPA 2HM7A 1MN6A 3H19A 2VEOA 3PUHA 1XZCA 3FYUC 3C8HA 1MX9A 3UUEA 4E14A 5FUMA 2I3ZA 1G42A 2QKYA 5AKJA 2OAGA 4BVLA 3G02A 4Q3OA 5K3FA 3DJYA 2HU5A 2CZQA 2XB6A 5K5EA 3ZI7A 2XUHA 2D0DA 1ZJ4A 3C6YA 3O9VA 1LPNA 1W1IA 1XKLA 5AKHA 3ESBA 2V96A 2W6CX 1R88A 1OXMA 4KAJA 2HFJA 5FDFA 1ZJ5A 1QZ3A 2XT0A 1YASA 1XZKA 3MUNA 3BJMA 3R0VA 1HDEA 1Y37A 4BB0A 3GZJA 2GBFA 1EK1A 3STWA 4H7HA 3T4UA 3BDVA 2AJDA 1ODCA 3QPAA 2XMQA 4BCBA 2Y2UA 4BZZA 2VJDA 4Q82A 1CQWA 2NW6A 3IUNA 3I2HA 4FKBA 3G0GA 3H2GA 1E66A 4W1SA 3VVMA 1LPBB 2RI6A 2QUBA 4B80A 4F21A 4CIBA 2I3DA 5ALJA 3W9BA 1AMNA 2WIGA 1XFDA 3N2ZB 3L1IA 1AQLA 2WFZA 1CRLA 4D9JA 5HQ3A 5C8XA 2PSDA 3WZLA 3RKSA 3CN7A 4N8SA 3FYUB 4EZIA 4I19A 3C70A 5AI4A 5EFZA 4EY8A 1LZKA 4IHAA 1QIGA 2WUGA 4PV7A 3D4LA 1VE6A 1SCKA 5LZ2A 1KEZA 2W22A 5ALOA 3HI4A 2HRQA 4QNNA 5FP0A 2H9YA 1THGA 1JJFA 3HABA 1B41A 3UUFA 4ARAA 4CG3A 3I2FA 4ROTA 3WZMA 1VZ2A 3PF8A 3LLCA 7YASA 1GQRA 1SCQA 2ZYIA 2BJHA 1EDDA 5KWJA 5AKGA 4GDMA 5AP9A 5AO9A 2WIJA 1R9NA 5AKEA 3WIOA 4X85A 3IUMA 1MJ5A 3WK5A 4CCYA 1AUOA 2Q0XA 1MX1A 3A70A 3WA6A 4BE4A 2I78A 1BRTA 1L7AA 4UBNA 4FBLA 1F6WA 1ZIXA 2BAGA 5HF8A 2AJLI 1CUZA 3G9TA 3TGLA 1E8MA 1CUAA 1ZOIA 4DMKA 3WYDA 3DLTA 1O6GA 1XZGA 2QTBA 4TVKA 3OURA 2WFLB 1XRNA 3HEAA 4FFWA 4BRSA 3M82A 5ALDA 4AB1A 4QZVA 3I2JA 3JW8A 3D2CA 1EDEA 1O6FA 1ODSA 3VJKA 2JEZA 4H18A 2Y1KA 4FHZA 5AI6A 2EDAA 5BOVA 4BCCA 1H22A 3WWCA 2XUKA 4F0JA 2XQJA 2BKLA 1VA4A 3C6XA 1QFMA 4C4ZA 3F9CA 1QIEA 4X7BA 3IUJA 3WQHA 2O2GA 3FOBA 4FDMA 4MJ3A 2HL6A 5LP1A 3R3VA 5AI0A 4E11A 5D3ZA 3EBLA 3FVRA 3WIBA 1H2XA 4ARBA 3E0XA 5FPQA 3FSGD 4YPVA 3WYNA 4EY6A 1MU0A 4BP9A 3V1MA 4KE8A 1U8EA 3DCNA 4HAIA 5A7HA 1USWA 2ACEA 3A2NA 2WILA 3WJ2A 3E4DA 3G9XA 2OGSA 2JGIA 4W1RA 2XMGA 1ZI9A 1FFDA 3WK6A 4U2DA 3WWPA 3K9BA 4BVJA 1ZGCA 4DYHA 1LPOA 4DSAA 2BUAA 3OG9A 2GBGA 4ZWNA 4Y2UA 2HADA 4KEAA 5AOAA 5A71A 5AM1A 1AKNA 3DS8A 2VJAA 1LNSA 3WL5A 3FLAA 5EIAA 3DL4A 5JARA 3F98A 2ROQA 4H7FA 2IITA 2QXUA 2H1IA 5CRIA 4JYMA 1QOZA 1T4MA 5AJHA 1MO2A 3SC2A 1CEXA 2QJWA 2XUPA 4UHFA 1H2YA 4DM7A 5CT8A 3LP5A 4W9RA 5DYYA 4J7AA 4BE9A 2G63A 1YB7A 1J1IA 5AK4A 3LIIA 3AILA 4J0GA 1LZLA 3C6BA 3OC0A 4C01A 1I6WA 3H1AA 2GZRA 2DQZA 1E89A 2WJ3A 1R1DA 1YA8A 2X8BA 3QPDA 4U2FA 4W63A 4C87A 5LZ4A 5CT9A 4DNQA 3A2LA 3BF8A 1WOMA 2C0QA 2DFPA 3WK9A 4OB8A 3H2JA 3G0IA 2RIPA 2WUEA 3G0DA 1GQSA 1UWCA 4PQEA 1IUOA 3MGAA 3FYUA 5ALLA 5DJ5A 2VJBA 2RHTA 1X2BA 3VXKA 4XWGA 4DMHA 1D07A 4MYDA 1GPNA 1IVYA 3C8DA 5FV4A 1SCIA 1UK9A 3RARA 4Y2YA 1DX6A 4OUKX 4NMWA 2BUBA 1EDBA 4UBJA 3GUUA 5A2GA 3G7NA 3K6KA 2HA7A 1QONA 3WL8A 4Y2RA 1QO7A 3QMWA 3KWJA 1SFRA 1GKLA 3WLAA 2PU5A 5DTIA 1CUYA 3IBTA 3OM8A 3AFIA 4FWBA 4M0FA 1XZLA 4N5HX 4JYPA 4J0IA 3W04A 2HU7A 4LYDA 4BYMA 5D3KA 1QIJA 1CUUA 1TQHA 4BBZA 1BCSA 5AKIA 2ECFA 3IUQA 1AURA 1CQZA 1BROA 3WKBA 5EIHA 5AOBA 3TJMA 1ODTC 3WL7A 1W4LA 1N5MA 1UKBA 1Z68A 3PI6A 4Y9SA 2OLEA 3BIWA 5JAOA 4EY4A 5HF9A 4MYSA 4I3FA 5JD4A 5JASA 2WHRA 1EX9A 4JEIA 2H7CA 4KJXA 5T4HA 5KBYA 4FOLA 1AC5A 3ILSA 5AK6A 6YASA 1HPLA 4WFIA 4CI9A 5CMLA 2WHPB 3W9UA 5HCUA 1KU6A 4CIAA 3HJUA 4X00A 3KOOA 2CBGA 4B83A 2O2IA 4U2GA 4K6KA 1VXRA 2HHAA 2JEYA 1EXWA 3LS2A 4HXFB 3R3UA 1X2EA 2PSEA 3DKRA 1GKKA 2BFNA 1M33A 2XQKA 1W6RA 1UK7A 5ALYA 2FJ0A 3G9UA 5DNUA 4B9AA 3RLIA 1LPAB 3LIPA 3I6MA 5JANA 4TGLA 3IURA 3NUZA 3C5VA 1VA5A 5JADA 1OILA 1K4YA 4PNZA 3WMRA 1A8QA 4CG2A 2OGTA 3D59A 1JT2A 1N5RA 3WWOA 2WHQA 5LKRA 4YASA 4DNOA 5ALKA 4MQMA 5HK9A 1ACLA 1IUNA 2DSNA 2X5XA 3JWEA 2RHWA 4L72A 4PSUA 2J3QA 2VAXA 2ZSIA 1BE0A 3AIOA 4G8CA 3YASA 3GBSA 2PSJA 3IDAA 4XIIA 4UUQA 2QUAA 3T52A 5ALQA 2PKYX 2XMBA 4ZRDA 4B9EA 4UFOA 4ZV7A 1LGYA 1DT5A 4EB0A 5HK8A 2ZJ7A 2O7RA 1YR2A 2ZJ6A 1E3QA 4LXHA 1ZD2P 1CUDA 4CCYB 4FLFA 4BCDA 4Y2TA 2CEKA 3TRDA 4UBIA 1F8UA 3MVEA 1MAHA 3RK4A 5CH8A 1EH5A 2QT9A 4UHBA 1ISPA 1SC9A 1WM1A 2XQGA 1WB6A 3S2ZA 3IB3A 3G8YA 1CUEA 2VAVA 3U1TA 1CUXA 1JFRA 4JNCA 1JJIA 1S8OA 2ACKA 4H0CA 4Q1VA 1IZ7A 5EHXA 4K2AA 5I7UA 3WK7A 3A2MA 3KSRA 2D5LA 1P0PA 2IIVA 5HF5A 4PO3X 4KAAA 2HA4A 1JU4A 4AXBA 5ALZA 2C58A 3ZPXA 3WKDA 3FSGA 3DKKA 2Z8XA 1J2EA 2VJCA 4KE6A 1DT3A 4B0PA 5DNVA 2DHCA 4OYLA 5JD6A 1BN6A 1YB6A 3SK0A 3QMVA 1N8SA 1U65A 3O0DA 4J03A 5DYWA 1UK8A 5AIAA 4N5IX 1DTEA 4L9AA 2HIHA 2Z3WA 3OOSA 5JAUA 5H3HA 5AKZA 1MAAA 5AHXA 1L7RA 2WM2A 3O95A 4AN1A 3B5EA 3ANSA 1FFBA 2PU7A 1YS1X 1XZIA 2XUIA 4J3JA 4DTCA 1XQVA 5AICA 4X6UA 3SWWA 5J3JA 1BS9A 3F67A 5AM4A 1THTA 4Y7DA 3G0BA 3STYA 1DX4A 4G4GA 2PPLA 1C7IA 4WY8A 1CUGA 3STTA 1XZJA 5ALMA 2HA6A 2XUFA 5C7YA 5ALUA 5DNWA 2WKWA 3R3WA 4X90A 2ES4A 5CH5A 2VSQA 1K8QA 5FOQA 4I4CA 1AZWA 4KR0A 4A16A 3F97A 1Y7HA 3R3XA 2XMDA 2WLSA 4X3CA 2VT6A 4AO7A 2DQYA 2X76A 2J4CA 4Y2JA 3AINA 3QM1A 2CMFA 1XRPA 5EHQA 2BGNA 4KE7A 2B4KA 2JBWA 5JZ9A 2WJ4A 1ORWA 5FLKA 1ZI8A 4UFPA 4UBLA 5T4FA 1J06A 1QJ4A 1Q84A 3KDAA 2PX6A 4KRYA 1QIIA 4J0HA 4GWLA 4GBGA 5FKJA 2WG2A 1CFJA 3ED1A 1QIFA 4LYEA 3BF7A 5FPPA 4HVTA 4U2EA 3W05A 1YCDA 4UBKA 1UFOA 3EIOA 5DLPA 4Y2VA 2G4LA 1ACJA
chains in the Genus database with same CATH superfamily
1OHHA 2XUAA 1VLVA 5ALGA 4CUKA 3C45A 2JJMA 3AR5A 3F7MA 3IV7A 4UU0A 2OT3B 3B1KA 4FYJA 2CVZA 3JR7A 4OU4A 4RDHA 1J2JA 4Q9DA 4CN9A 3K35A 2GMWA 2WTBA 3ANMA 4Q9LA 4E70A 3LZ6A 5I01A 5EVJA 2YC2C 4HPJB 1O4VA 3QHQA 4Z1MA 4B40A 3ETEA 2HNBA 1DRJA 3O8RA 1OAOC 1XCLA 1FXWA 4M0DA 4U8HA 2QORA 3R24A 3FCUB 4KG7A 3HEMA 2BT4A 2R8PA 1RLTA 1S2IA 1MJFA 1J7KA 2IYXA 1M1NA 2XTMA 1UC5B 1A9ZA 2NXNA 1P2SA 4ER6A 3GGJA 3MT9A 4NYJQ 1S2OA 3WNDA 3FWHA 1KORA 3PNVA 2VRWA 1RAGA 2FZ4A 2NXWA 2X8WA 3FZEA 2FSUA 3O4HA 2DQSA 4R0VA 1JIJA 1WVMA 3MBKA 4HWSA 2AVDA 4PLCA 4HWGA 5LQDA 1UC4B 1YGPA 2GYWA 4PYNA 3UEOA 1UIMA 4OF4A 2O5CA 4WK2B 4Y6RA 4US2R 1RJ9A 1E2JA 3VR6A 3R44A 2TS1A 1YF3A 4GX5A 4ZCSA 1EE2A 4X92A 4RKYA 1TIBA 3FCCA 3GFTA 5KJFA 2G9UA 3VOTA 1OV6A 4BNTA 2F64A 3I4FA 1WZCA 4Z3OA 4OB6A 3THWA 5DH9A 2WFAA 3D43A 3W8EA 3OY7A 4G0QA 3PFBA 3RSOA 1DFGA 2BFPA 5T4BA 1XTSA 3BIXA 3R6WA 4Q93A 1JEYA 4OUDB 1FTSA 2GCNA 2AMFA 2Z9CA 4JVLA 4MX8A 2Y71A 3L4BA 4C0XA 1CQJB 5KKCA 1CY2A 1NNI1 1MB4A 4YRCA 1NKTA 4PY2A 1K6XA 4PG4A 2OQ2A 2P5SA 1SQ0A 3CNEA 1Z2OX 1DB3A 3F7NA 2WPDA 4L6IA 4K9PA 4N6GA 2XTZA 1RYFA 4J1TC 2X2EA 4O4IB 4CMIB 2I8LA 4HTFA 1V48A 2MSWA 3NS7A 4Q7QA 3C1UA 3HFSA 5AW6A 2WYHA 2ECKA 4L8YA 5CLJA 1PN3A 2Q4BA 1ORTA 1J0BA 1ORRA 2F7SA 2PFGA 3DL7A 2R66A 4BLWA 4D4IA 5G3YA 2HR1A 3QEBZ 5CT6A 4FJ1A 1PBNA 1KXZA 5AW4A 4QM7A 3ADKA 3FYTA 3D1VA 5CDHA 4J75A 2OK7A 1TO1E 4I46A 2B8WA 4NOMA 4RV4A 5F9FA 4UEWA 3V9PA 3IBCA 4G5RA 5G0WA 1K75A 4QTZA 2AW5A 1K1EA 2Z8ZA 3EHEA 5CLGA 4QDUA 4YRMA 5TMPA 3FH0A 2VQEB 2KQUA 2AS0A 5F23A 3FM9A 3UQYS 5A5GA 1XCPA 2R4QA 5SY6A 4DG8A 3GVCA 4Q5IA 3ER8A 4AAYA 3EQ9A 2UZIR 3L8GA 1L4YA 2PIAA 2AG5A 2Q9BA 1ZM3A 2VRBA 4LE0A 4N6OA 4YXFA 5CBKA 2UZ3A 4I4IA 3AZPA 3SKVA 3PJGA 5EQJB 1PZMA 3N58A 1GGHA 5K0EA 3WNBA 3H5LA 4F1KA 5DI9A 4XJVA 3W8RA 5I48A 3KJNA 3UGJA 4AG3A 1B73A 4QJIA 4HNHA 1BRMA 1CX9B 1N0IA 1VSTA 3ZV6A 5TXGA 3VR5H 2EZ9A 4CDMA 4QATA 1E3JA 5KC8A 1XNQB 5KHLB 3WAJA 1G8GA 1KI6B 5EE0A 4CTOA 2AZ4A 4IIYA 3VDNB 4GGOA 5E9WA 4C6HA 2H3EA 3O2JA 2J5RA 3DBHB 2W2TA 3AR2A 3CNLA 3KKZA 1LQTA 1EHYA 3BBPA 1EVKA 1MABA 2ANBA 4LWPA 4ZYYA 5KSOA 2P3QA 1Z35A 1Q7CA 4L3WA 1ZD8A 1E5TA 4RD3A 1QTIA 4DV0B 1Y9ZA 1OHHD 3ROFA 2ZJFA 2OFXA 3FHLA 3QVLA 1G1MA 4UD2A 1N7HA 3H4TA 2X1MA 2HTFA 4UQOA 3T3GA 1VKHA 4JI0B 3Q2IA 4MUYA 3ELWA 4IOLA 4BUZA 5F7JA 5B1YA 1TNDA 3CEAA 5JZBA 1LW7A 1HMYA 3GRVA 1PQPA 1Z6QA 1C1YA 4ONEA 5FX2A 1KE2A 4CM6A 3JARB 4GT1A 2OXFA 3K94A 5CFQA 1LI7A 2C97A 2MWMA 3PJFA 1QF7A 5E95A 2B0CA 2IQIA 3F6CA 3KKKA 3QOFA 2JCBA 4N5DA 5FPSA 3RSFA 4NH4A 4Q4CA 2WVAA 4QDXA 3JTMA 3T7DA 1T9KA 3PD7A 3ON5A 4XGNA 3UMYA 1NT2A 3I28A 3N87A 3OPVA 4W8GA 1XEFA 4RK6A 2OXEA 5DBEX 5DTEA 4BRZA 3UJ7A 4R68A 5K6RA 2QVLA 3L7NA 1UMDB 4B87A 4ABTA 3UHAA 1KI9A 4FBMA 4IV8A 4MHOA 3A3PA 4AY6A 2B1QA 3QG5A 5CD1A 1G8AA 2XOKA 1IXZA 4GLLA 5HKLA 2AOUB 3TD6A 1B6TA 3FZGA 4MV8A 1TD1A 4NZ9A 4OP2A 4C5CA 1EM8A 5TGTA 4RVDA 2ZB7A 1M6NA 1JU9A 3GIDA 3RHSA 3OHSX 4M1EA 2EBHX 1MFPA 3P0HA 5ANRB 1V4BA 4H7IA 3TX6A 4FYMA 4PLFA 3VR6D 4JA2A 3CTMA 2BMWA 3EA4A 2K7FA 3CNQS 4JP1A 2QX8A 5KWEA 1W5TA 1ZVQA 4X7PA 1FP1D 5NULA 3RHFA 3TZBA 4OY3A 3KXDA 3RUHA 3ZWQA 2OCLA 4MV6A 1C1DB 5CDFA 4P3NA 5M29A 1YFKA 2ZUBA 3NJ8A 2FPLA 1F20A 2XBLA 3OCCA 3GELA 1VI5A 2Y1DA 3IEIA 3GFGA 1ZD4A 4ZQCB 1UBEA 4FUTA 1MKYA 1SBHA 1UK6A 1GFZA 1N3IA 5JSFA 2WT8A 2R5NA 5HS4A 1E9FA 2CCGA 2QRKA 2CD9A 3EGVA 2W2QA 3L8CA 4GKVA 4IGIA 4Z8XA 3O8LA 4IIFA 1D7AA 5FLYA 4ZEXA 5TPWB 3ZLBA 4EITA 4L22A 1I8TA 3H5VA 1SURA 2YQZA 4JBNA 1O6ZA 4HXGA 4ZO8A 3RK0A 4JI3B 3V46A 1WXGA 4MW2A 4BQSA 2CCKA 4CF6A 2DT5A 3OTGA 5K4GA 3ROKA 3ZWPA 2V7XA 3H9GA 1FE8A 3AF5A 5KNLA 1I01A 3NDRA 5JS1A 2X7XA 4JI6B 4UAGA 1B8OA 2LTAA 3EEBA 1DC6A 1T1IA 4PSAA 5ALWA 4QBTA 2C8LA 2XUOA 3VQTA 4EUKA 4ZI7B 3AZOA 4RENA 3EZYA 2XWJI 1SIWA 4HGYA 4KLAA 4KWEA 2BZ1A 3RG8A 4H7JA 2BTQB 2E5LB 1W94A 5F5XA 5KC9A 1L7NA 2FY8A 1ZN2A 4V0SA 2LIVA 3A36A 2B2XA 3ET5A 1A72A 3LWZA 3EXHB 4HHEA 4EGQA 4EA6A 4NJMA 2Y9PB 4I1PA 4OIFA 2AMLA 1Y5LA 4RXUA 1HUQA 4BQFA 1JPVA 2RGDA 1GDTA 1HT2E 2VP9A 1TKBA 2TSYB 4FGUA 2JF0A 2R8EA 3PDIA 3Q7IA 1Q3TA 1EB8A 1KAEA 3NH6A 3M4ZA 4WUVA 3GXBA 5CK5A 1NQAO 3GZ4A 1TYAE 4FFLA 3FNFA 2WYUA 5AI9A 3KZKA 1A98A 4DANA 3AFNA 2NO5A 3S28A 3OLWA 4KRXA 4MRVA 4TSFA 5K6TA 1U3CA 2C5GA 2QUHA 3BRSA 2P8JA 4A5SA 2JGEA 4H3HB 2PSFA 5T6MA 1PNOA 4EG8A 2ZR8A 4IVNA 4B7ZA 4M8NE 2G5PA 2RH9B 4F3RA 5BXQC 4Q48A 1SOMA 1SVMA 3GDFA 4DNFA 2X3YA 2GWHA 1WW8A 1XO1A 2PV0A 3AJEA 1T0JB 1E9BA 3BXPA 1PJAA 2F62A 3ODPA 2A57A 4RE6A 5IG2A 1AKQA 4FOSA 3QEJA 3DGFC 2BGMA 4F91B 1PT6A 1J25A 2AG0A 1S4MA 2VZEA 3ETCA 3NXKA 4B4DA 4CR8A 1U04A 2GHQA 4BNNA 2NZ8A 2L19A 2I1QA 3BD6A 4PC2A 3RGGA 3ZIAD 3W9YA 1AHHA 2YMMA 3W34A 4H0FA 2G1AA 4YJHA 1JFFA 1XJCA 5DX0A 3TNJA 1FP6A 1QGUA 4ICIA 4DCVA 3IHWA 5IHPA 3COJA 2EBFX 5A1JA 4DCJA 3DO8A 3WK4A 1PJ4A 5IKXA 4B8WA 4M83A 4QL3A 1XZFA 4DR6B 2D1RA 1WMBA 4JP3A 3STXA 1RWOA 2A4KA 5CVUA 1L8QA 1C41A 4YJ2B 4KQHA 2ZJ3A 1MDBA 3TRHA 3C3WA 2AFHB 5IT4A 3T7AA 3E1GA 1ILEA 1EVYA 4DCMA 2ZTVA 2NP7A 2LVBA 1U7WA 3IJPA 3MWJA 2W6JD 1VBNA 2WJIA 3CF6R 3EXIA 4KO2S 2V5UA 1H2WA 4MWSA 2YV4A 3QUQA 3S68A 2ZITA 4BAGA 4GYJA 1AN9A 5G0VA 3T3IA 1YZNA 4IUYA 3ZDFA 1UEXC 1X9IA 1L7EA 1MG0A 1Z4MA 1VHTA 1KJZA 3EOZA 4WA8A 1PV4A 3A58B 1I5RA 3FTEA 4YAEA 4RDIA 4EHJA 4ZYZA 4B3SB 4IYJA 1D2MA 1FRNA 1Y80A 4WTOA 1A7AA 1G8JA 2EJUA 5KSWB 4AFNA 3UF0A 1TGVA 2H2HA 2VDUE 4HNSA 1HE8B 4MUMA 5H80A 1NNLA 1EDZA 1MEJA 1RBMA 2IC5A 2ZRGA 1H1DA 4FZ3A 3GJ0A 4HI0E 5AXAA 1DELA 4MS3B 5DIZA 1TT5B 3RADC 1XMQB 1KAMA 1GPYA 3MS2A 1S4QA 2XRMA 1HFEL 3PFFA 1ZIDA 1I24A 1QNLA 1GPBA 1OR8A 3IP1A 3VM6A 5HJEA 5KO2A 4B6QA 3GHHA 3L6DA 4M1MA 1LU9A 1VP3A 4QRHA 5EXXA 5LZ7A 3L4EA 3V2GA 3U0VA 1EFLA 1A8HA 5AVUA 1MOPA 4IWXA 5EIOA 2FQWA 1QQ7A 3U62A 2R85A 3TLYA 1Q6YA 3JZMA 1F0KA 1LLQA 3RT7A 1G291 4LJ4A 3KTOA 2Q1UA 2AXQA 4L07A 2HSWA 3D0QA 3DAFA 4AZ3A 3BRCA 1WF3A 3R4CA 1CHNA 1DL5A 4C2UA 1L5HB 1M8KA 4ZDWA 4ENPA 4YXWA 1TAGA 4NCIA 3EXIB 4I4TB 1HL3A 5LYYA 4UARA 3HHEA 4X8OA 3WB1A 5ADWA 5B3LA 5IDQA 2ZE7A 1NVAA 1AUQA 3E53A 3OZXA 3WP1B 3DEFA 2I22A 4K88A 3BGVA 2PT7A 2QT1A 2BFCA 2EWWA 3HA3A 3OX2A 5AOVA 3A4MA 4YJKA 1ZNWA 4JC0A 1G0NA 5E3HA 1ESNA 1LPPA 1L5SA 2ZRDA 1V25A 4F9GA 1P1IA 3O1HB 4HYYA 1WXWA 4WCFA 5KJEA 1UJBA 3CKYA 1R0KA 4ER0A 1ZCAA 4ZZ2A 2UU9B 3MGGA 4G9BA 2FX2A 5IDXA 1UJMA 5JSUA 3A3OA 2O8BA 4AF8A 1LLFA 1EGAA 3BH7A 1AZLA 4MS4A 4ZK2A 2YUTA 1OX4A 3WB2A 1ZD5A 2FQYA 3JWIA 3LXRA 3N74A 1KJYA 2BKUA 3KE8A 1MVOA 3G85A 2F8SA 3IIKA 2ZRMA 2I8AA 4LRQA 4P5PA 1A5ZA 3AM3A 1AXGA 3EWAA 1Q6ZA 2QP9X 2XTNA 3CJTA 4MWGA 5KDOA 2OG1A 4P3OA 1ID1A 1SU4A 1GPKA 2AMJA 3H5AA 3ZCXA 4KQ2A 1NN0A 2QYSA 2BHNA 3AHIA 3M89A 4HDNA 3LCUA 5EP3A 4LZJA 3L1KA 2C8VA 2O07A 3BE8A 3QNWA 5DX8A 1CF2O 4ZVLA 5THXA 4DXHA 5ELXA 1XJWA 1H1LA 2MSLA 2ONCA 2Q8QA 4GO1A 4QEKA 1SXJD 4JLUA 1FOEB 3INYA 2WDPA 1Z4LA 4ROSA 3ZZUA 4UPEA 5JNUA 2O8DA 5LC1A 2ZW9A 4M1OA 4QGAA 1KY5A 3SR3A 3F4LA 3JZDA 1OBFO 3MILA 3X3HA 5DBOA 1J4AA 2LRHA 3DYVA 3OT5A 2DTEA 3EEIA 2GPYA 1SBCA 4AY4A 5HDQA 4D0SA 2IEDA 4H77A 4K3VA 1WW3A 2VHUA 1L5RA 2IHZA 4DN6A 1OW3B 1KS2A 5DFAA 3SBEA 1TTHA 1FL9A 4LXIA 3RLFA 2V6GA 2B25A 3TUJC 4ZCPA 3HBAA 1I2DA 3B1YA 3E9EA 1CIJA 3IA7A 3QLVA 4G5XA 4B79A 4B43A 2P5TB 4L2IA 1DJQA 1P33A 2GVDC 3I1JA 4F3KA 2C07A 1JS1X 1PLLA 4C89A 2C1XA 3ZE6A 5ALVA 4EHBA 1S5PA 2I71A 2NM0A 2ZG6A 2ZXEA 4GZ5A 1IZ8A 1DQZA 4RMJA 4JJGA 3HTXA 4G81A 2HLNA 4KXXA 3MCWA 1U5AA 5A04A 4Q05A 4B71A 2Q0HA 3QFRA 2EFYA 3ZXYA 3DBIA 5CVJA 4O4LB 3AI2A 4P83A 1UT8A 2ZCUA 3N28A 4BNDA 2ZE6A 1EXMA 1LK5A 3A1UA 3KD2A 5SYMA 1Z5PA 3B13B 4OFZA 2ZXFA 3OQPA 3OQ1A 4MLDA 3SCZA 4QXMA 1XD2B 4XVCA 1AKEA 2JJYA 1FJ2A 2HA3A 3FDFA 3FWZA 5LJIA 1I7PA 4UUOA 4I6GA 2OO7A 2WD8A 3BHJA 1EA7A 3GOHA 3ZE2B 4DGSA 1U9CA 3EEQA 4L73A 5K3OA 3DBOB 3AWIA 3GUYA 3V00A 1OI7A 2ISQA 2QAIA 4URFA 4WK0B 2ZWPA 5K3BA 2ZSBA 1VE5A 4MRPA 2P65A 3I9OA 1WVGA 2JD0A 3HO6A 4K1LA 4LWOA 3TPZA 3PZBA 1Z7BA 2IYEA 3A1DA 2I4NA 3SF8A 2BKXA 1CR1A 1T4BA 3DWFA 1EK5A 2UZ0A 3JQ7A 2GR9A 1R6VA 2ASEA 2YOGA 4IH9A 4LBWA 3H8JA 2Q5HA 4FSDA 2H0QA 3EFOA 3OT4A 2HK9A 2OHIA 1F0NA 1FSFA 2J0UB 4K9OA 5G4KB 2CLSA 2G1JA 1J2TA 4XW2A 3ILYA 3R5XA 1T6BY 4XYEA 4DW8A 5IUJC 1R37A 1GZ6A 1K2VN 4FR2A 3EEOA 1KY2A 1PT5A 5A5VA 5SZIA 2AVNA 4KSBA 4W5TA 4KRGA 3TM4A 2AOUA 2WWRA 1CJKC 1RZUA 2DKNA 3IOCA 2WFMA 4LOIA 1SB8A 4WZBB 2QLBA 1U1CA 1FTGA 3LQYA 1ZRHA 3NZEA 5IF9A 3Q9NA 5KTNA 4AWBA 3GJTA 5BSHA 4NU6A 3MHPA 5BV7A 4PQFA 2HDOA 4ZPJA 3LPNA 5FT9A 4MCIA 4EEKA 4LOKA 1JWBB 2VYFA 4JSTA 1BFDA 3F5SA 3VKFA 3DDSA 1MVNA 3N8IA 4FD3A 5DMXA 4YP7A 5FI1B 4ZZ0A 3Q5GA 1X1TA 5B2FA 5BSRA 1R8QA 1M2VA 4RV9A 2HV9A 3OLZA 1BX1A 2WIKA 2Q21A 4QNRA 4L7VA 4DLVA 2X40A 1CUVA 3ESCA 3H6GA 4G23A 5JOQA 1U3VA 4EHIA 5HMMA 4BGUA 1VG1A 4B84A 4H9GA 4HN2A 2BE9A 5EGNA 3DVSX 2VRCD 1Y6FA 2JI7A 1QB7A 4REQB 3PVSA 4C29A 1MC8A 1PJTA 2RGYA 3PWTA 3CONA 4BNYA 2AWOA 3CTPA 4PFSA 3USES 2EYUA 4E33A 4LF5B 1QRUA 4JEHA 2ZCVA 1M6VB 2B78A 2G08A 3FNRA 3ZTTA 2VT7A 4WESA 3ILXA 2EFHB 2V7QA 3R3ZA 2QXYA 1UP7A 2V74B 1JFLA 2YOHA 4CQNA 1Q1QA 5K8IA 4KQXA 3BL8A 4BTVA 3E18A 4ZAYA 1HLFA 1NXPA 1HFKA 1YVDA 5DYNA 3FPFA 5E3IA 2WMOB 3T9DA 1E0SA 1E2KA 3WOVA 1XDZA 5J2UF 4RHUA 2Z6QA 4IJUA 1PFKA 1Y0BA 3ZKWA 4DJEC 3Q3EA 3H4VA 1YBHA 4TYPA 5EXSA 5F3RA 1MTZA 4MVJD 1Q7GA 3EVAA 3TMYA 2JFGA 4JUAA 4QD3A 4RHYA 2D8AA 2K6GA 4PAQA 5TSDA 3OO0A 4E15A 4E3ZA 1TLFA 2ZJAA 4O0MA 1QQBA 2Z5GA 3FF1A 4LTDA 3QYJA 3U40A 1ISRA 2H9IA 3DZCA 4NAVA 4B7AA 1C1XA 2PX3A 3VPCA 2XZPA 1QE5A 5K3SA 3LW8A 1GL7A 1WU8A 4KQWA 5KMGA 3G2OA 1J42A 3GK3A 3OIDA 1P0IA 4TMXA 3IT2A 3VO2A 2YUIA 1Q77A 1WKCA 2AG8A 2P2YA 4AURA 2B69A 2OAP1 4O2RA 2AFIA 2V9CA 2WQZA 2QRUA 2NVUB 4BGVA 4LKRA 4BFZA 3U3ZA 1F9AA 2B21A 1GVHA 5A6SA 1U2DC 2X22A 4MB0A 4QUDA 5CURA 5ARCA 3K05A 1U7DA 3OCUA 2BLNA 4MVJP 4QBGB 3GMIA 1CUBA 1DZ3A 4K5QA 4UOEA 1GA1A 1RJEA 5LOVB 4MSUA 5JXJA 5IT0A 1G7CA 1YJ5A 4BO7A 3O8QB 4Q15A 3SFZA 3WTBA 2FF7A 3UMJA 3PNMA 2DH5A 1OFVA 1STOA 4Q0MA 4EJ0A 3TTYA 4DUPA 1HG0A 1U8FO 3GMDA 3L8DA 3FPSA 4OHZA 1DO0A 2Q9CA 1G4HA 3L6UA 2B61A 1JTFA 1GG5A 1WUKS 3K96A 1N4AA 5CXUA 4KITB 4EF6A 5B7NA 2V3WA 2GXQA 3IV6A 3LY9A 4ETMA 3DEJA 4UPVA 1IY1A 1YK1A 4OSEA 5FNVB 3SXJA 1TRKA 2O0KA 2Q5LA 2UVPA 2OK8A 3ENZA 2GPNA 2P4HX 1KFBB 4HRYA 4FGZA 1P1BA 4G25A 1PR5A 4QPCA 1R8JA 2OOSA 1UANA 3NHYA 1AUXA 1SXJC 1XLUA 3OBBA 3DYIA 4R7ZA 3RYFA 3EA5A 3TNYA 3ETGA 2DBYA 3WDMA 4AYWA 4DBVO 1VE7A 1X1DA 5CNIA 1BYIA 1HYBA 5HFNA 1ZOOA 1DJMA 1EB9A 4TTTS 4GXNA 3LX4A 4D57A 4UPDA 2VNAA 2FMFA 4QXRA 2DEUA 4EEZA 5LUBA 2PKRA 4RKQA 3RQIA 4HEA6 5FWXB 3LGXA 4AF7A 4CBVA 5ESRA 3ZS9A 4KPFC 1KTIA 2VF2A 3ONWA 3ORQA 3SAJA 1E6UA 4RTSA 1CVIA 4H1UA 2R60A 4MV9A 5TJ9A 3M83A 2X7HA 3ACDA 3PENA 4MQFB 1T2UA 3IPCA 5DHTA 3C5HA 2VYVA 2X5NA 3QBJA 1GSAA 2X2PA 2PMEA 4B09A 1O94A 5EERA 3HVIA 3ZHSA 4FEGA 1XK7A 3QXSA 2ZR9A 3T9AA 5FD8A 3Q8MA 1P4SA 2YINC 4G86A 2ZYHA 1QXSA 5JIBA 1S2NA 1H2FA 2QJFA 2HKIA 1JVBA 3K92A 4WZZA 4ZI2A 3HDJA 3V8RA 1M72A 3O4VA 3GB9A 2R96A 4KQFA 4P82A 2OVBA 3OZIA 2UUBB 3QVTA 1UJCA 5LNK6 4Z9YA 1H2HA 1WB9A 1Q1BA 2IYOA 5DISB 2JARA 3TNFA 3DWIA 4B75A 4BDTA 3K2IA 4IMRA 1ZK4A 1W9MA 4U7TB 2ZTHA 4ZQIA 2PCJA 3SIWA 1CY0A 1VBKA 3KQOA 3L8FA 2V7QD 1H0KA 3SJBA 4H1TA 5K0GA 3U61B 4COKA 3UH1A 1Z28A 4OMUA 3BTSA 3M9XA 3VZRA 1QLWA 2H9AA 2AR0A 3L2OB 4XM0A 4EYSA 3NUQA 2FPKA 2SECE 2OO5C 3ZV3A 5AKYA 3L4SO 2QNRA 3KO8A 4WX2B 1WVIA 4HRVA 5ALHA 2O2ZA 4MWTA 5CIWA 3WLTA 3L46A 1EWVA 4WXYB 1DX9A 3VC2A 5HQTA 2WU8A 2JFPA 5U9CA 3RJTA 1ONSA 2AN4A 3AJ8A 4FDLA 1VHDA 1Z5VA 2VSNA 4OP1A 5FOVA 4BVGA 5C3MA 5GJVC 3GR6A 5F3WB 4TROA 2JIZA 3MAGA 1N2OA 3Q88A 4MUJA 2GPJA 4BV8A 1CDEA 2XKAA 1IULA 2O5VA 3E9RA 3GO4A 4FI3C 5K2OA 4WADA 2WHXA 1P81A 3F90A 3PWKA 1UC9A 2OYRA 2BIFA 1KRWA 3WLSA 2OENG 5I6DA 4BTEA 4CCSA 2GM3A 1U2QA 1GAJA 2HMAA 1AXRA 1QO0A 2P41A 3OKAA 4DV6B 2ZI7A 3GLSA 4EY5A 1RLUA 4JP5A 4B3CA 2UZ1B 4A0SA 5FJJA 1J9GA 5IVDA 4Q47A 3R6DA 4RKEA 2JLRA 1GR0A 2W70A 2Z5FA 2BJWA 4Q9KA 4ZCIA 1WETA 1DMSA 2DP4E 3KYCA 3KSBC 3WNZA 3S70A 3SOPA 3SQNA 4EJFA 1PDVA 3DMHA 5DBGA 1OROA 1PNQA 2JCSA 2QL6A 4O2AA 1CY1A 2CDNA 2PKQO 3QP9A 4B4WA 1EE9A 1PHPA 3T7KA 1NY6A 4J3FA 4ZREA 1YUNA 4UTRA 3JQ9C 4PZ0A 5LWQA 3S2GA 5EN4A 1UWKA 3BC1A 3RD5A 3QIAA 1RADA 5JPIA 1O5OA 5JQGB 1W48A 1QF6A 3I5XA 1QYWA 3QVMA 2ZEJA 3IAM6 5IHXA 3GL9A 4N7RA 1P91A 2ONJA 4JB0A 5G0UA 2AX4A 2Z3VA 3ER6A 1TCCA 4R71A 5AJVB 5KAMA 3FCXA 1K5PA 3H65A 4ZT2A 1Q0RA 1YU6A 1KS9A 1C9DB 3QXGA 3UXYA 3VYSB 4AMYA 2DCMA 1AOXA 1I4LD 5B1IA 3RJ5A 3I83A 4FGSA 1YFLA 1XWIA 1L4UA 2A58A 1RYYA 4KR9A 2QVYX 3W2EA 3DQQA 1SHJA 2Y0CA 3RUFA 3ZLJA 1ETHA 1RU3A 1TCAA 2A35A 2GB4A 5CFOA 4M76B 1QPBA 1E1KA 1PFYA 3EY4A 2HK8A 2BP7A 2HA2A 2II6A 4E88A 1C4KA 1NW5A 1V1JA 1XZMA 2VDOB 4KDCA 3IVXA 4GOXA 4X91A 5E3JA 1O7JA 3KHKA 2GDJA 2GHIA 5IN5A 3UK6A 4AZ0B 1NLUA 4QO7A 5BYJA 4LFBB 3IUSA 3GEPA 3P9CA 3SHVA 2PLRA 4O2AF 2VYQA 3CGWA 1SCJA 5EJIA 4K9NA 4HRXA 4OD0A 3U19A 3MWDA 3BD7A 4PTYA 4TS3A 3W7AA 1QTQA 1K8RA 4B3GA 4DCUA 4UD6A 4G9GA 2GCPA 4LJAA 3O6VA 3DMGA 4JU8A 2BEUA 1I0ZA 3RBXA 2OGZA 3BFXA 4URVR 2ZM5A 1G5HA 2OGUA 3LT5A 3MC1A 3CZ4A 3ONFA 4O2BB 1W88B 2IPOA 2MSNA 3R0XA 4NBKA 4PM4A 1V16A 1QE3A 4X1IA 3IUBA 4XUEA 2VTDA 4DMFA 2OHOA 2PQ0A 4JDUA 4CTKA 3A05A 3QH4A 4RQBA 4AN0A 4QICA 3C87A 1W36C 3VVCA 3PCXA 4HD8A 2PPVA 4Y2QA 2FVYA 2PUBA 3U26A 2PYZA 1N92A 1DOAA 4GMDA 4RE5A 5LYJB 1S3IA 4WRRA 3OAAA 5TEVA 3HCBA 3RIYA 4LY0A 3L41A 3R2JA 1E59A 2IEBA 5J63A 5M3BA 3B2EA 4L28A 2YZNA 1RWXA 3KB2A 5GZ3A 5JV5A 4E46A 2G6BA 3EZ2A 2VUSA 1WZIA 3Q6MA 5AJWA 2V7PA 1FNMA 3PQ4A 1ZONA 2AJ8A 2P90A 4FX5A 4Y2GA 1BDJA 3RIHA 3EWSA 4WK6A 4BVFA 1Y1RA 2B94A 4DA7A 1JYSA 1WDMA 4GOJA 4H27A 4IINA 2I6UA 4CV1A 5CYGA 3RRXA 3ZCUA 2QPAA 2KMLA 5FWNA 3WMGA 2EJBA 3E58A 1IQUA 3PTLA 1A8UA 2GYUA 3IXMA 4S0XA 2ODNA 2BDEA 1UBRS 3HRHA 4RA6B 2FPSA 1QCZA 4PZAA 1Q83A 2GBCA 3QF4B 1UBHS 2GPSA 1VHJA 4C2AA 1DTSA 3F3MA 2CVQA 2WA2A 3MGKA 3P32A 3P9IA 4IEEA 2FW6A 1G8KA 1TGYA 1DKMA 1WP4A 3KOZA 4FYYA 1CUWA 4FMCB 3UIEA 1E1LA 5C81A 5EJ5A 4OQLA 4EP1A 3KVYA 3NHBA 5K0NA 1FRQA 4W5HA 1IM5A 1B6GA 1T4CB 2NTYC 3KALA 3GZNB 1B2RA 3F8SA 3M7IA 3UG7A 1DS6A 3O8DA 4UUPA 1F2DA 5AOCA 3QLUA 4XA8A 3RVMA 4XFDA 2WTUA 1EUDB 2WSLA 5C80A 2R7NA 2RCYA 1JN0A 4O25A 1FBTA 1SPBS 3JZIA 3MWGA 3LCJA 2RDMA 2NVBA 4FU0A 1YS6A 3KPJA 4JH0A 4RHXA 3VNQA 1HEIA 1VC2A 4NMXB 4CZ2A 4D43A 2QRVA 3H5OA 4CI0B 2DERA 3C6ZA 4A4DA 1U7XA 3ESQA 1G9SA 4V0KA 1MC1A 1QE0A 4B3JA 3C0KA 1BJTA 5LZ9A 3WHKA 3HADA 5K8UA 3CVWA 1JA9A 1V7CA 3UT0A 2CN1A 3KJIA 3V8PA 4D9NA 2Q7XA 2HMSA 5FYDA 4BPBA 2H2FA 4KO8A 4ARZA 1NWHA 4ZODA 3CB2A 2HJGA 2POCA 3KPVA 3KZOA 4PTZA 5B2ZA 4W1PA 1VCMA 4DADA 2D13A 2FG5A 1CP3A 2XLCA 2ZIXB 1R0XA 2XHEA 2ZSHA 4WEQA 4CETA 3GZNA 4PQGA 1YTUA 2QQ5A 2E48A 2P75A 1BHO1 1WDWB 2PV7A 3B5JA 3ESYA 4R2JA 3QU4A 3KETA 2IUTA 3LKDA 1QYIA 1UOQA 3C3JA 1FNBA 3OA0A 4EVIA 1DLJA 2XUJA 2JLQA 1NUUA 4II2A 4GX1A 3ZS8A 5COAA 2QTVB 3GJ4A 3N0TA 2DGDA 5E7QA 4ETWA 2Y0EA 1XTPA 2BMEA 3B6JA 5CDYA 1E8DA 1I4OA 2PWYA 5K8TA 1Z2EA 2GZSA 2VVTA 3VISA 4C4YA 5GVSA 3E9NA 3FPEA 3OFVA 3VPSA 3AERB 2G80A 1MR3F 2X0IA 3QOWA 5E38A 2DULA 4BN4A 1IEWA 4IJ5A 3TRIA 3DMRA 1JNYA 3O3OB 3ZHOA 3BMCA 3UGKA 2QX7A 3W2TA 3GRKA 4RWZA 2GBPA 1ZMOA 2H5IA 1G55A 2HAEA 2ISCA 3DDWA 5AQEA 1X7ZB 1L5GB 1JYFA 2DPMA 3GGDA 5IJZA 2AYXA 3BDIA 5HIJA 1XQWA 2JGJA 2NU9B 1FRZA 2BEWB 1PZFA 4CLEA 1ZGHA 2FFBA 2PCLA 3DVLA 1EK2A 3H0EA 3LYAA 3WXMA 3B3GA 1KHHA 2JFZA 3WHLA 2OWEA 5JECA 1Z17A 1BKDR 1CJBA 3AUJB 5LZ5A 4QBKA 3IQFA 5J1SB 2XVAA 4P31A 3O9ZA 3P4YA 4ZT5A 3PVZA 4U6SA 1OV4A 4N18A 3M6AA 3MINB 2X0NA 4WZAA 2JFWA 2V4MA 2ZE8A 2WT9A 5LQNA 1GTVA 3HJTA 4UTXA 3P9NA 5IAEA 5E0KB 3TQQA 2BLLA 3SZOA 5M34A 4RZ3A 4TL6A 2OL4A 1Q1ZA 2H6EA 3C98A 2XAAA 3MXOA 4NIMA 2ODTX 4B4OA 3BOSA 1DDOA 2R8OA 1D1PA 1BXKA 4AMUA 2RONA 3H9UA 3RDPA 4B4VA 4H7DA 5IT5A 4FYIA 4DV1B 1H5QA 2ATEA 3HCOA 4FFVA 4PGFA 4E5DA 1NLYA 5BN4A 1Z88A 1ZXLA 4DYVA 2PMKA 4K9SA 2LDBA 2PXAA 4A2PA 1MA3A 4BZPA 1RKXA 1TYEB 4OJQA 4BMVA 3FDZB 1ZH4A 3HYNA 2QRZA 2O8EA 3EASA 5E4TA 5JBIA 1O5IA 2Q0QA 3UM9A 3TR0A 2H1LA 5JJBA 3T9BA 1E61A 4IOMA 1Z4OA 3RANA 1YA4A 5KSZA 2RJOA 2XEDA 3KOXA 4QWWA 3FGNA 4X64B 1DQNA 4EY7A 4LXGA 2ODPA 2VYNA 2E5FA 3RSSA 4I5FA 1HG1A 3OJCA 4U2CA 4BNJA 4YUAA 3G2PA 2NZVG 3AU8A 2Q1TA 3QHPA 4M1ZA 1G21E 5K3FB 3SM9A 1QRAA 4F5EA 4KR7A 3TW0A 3NBXX 1XJ5A 4RTJA 1GO2A 1XX6A 1OFGA 3BE6A 3SFTA 5K6AA 4O08A 5EMNA 1WAMA 3C14C 3LHSA 2CLFB 1XSEA 3DR5A 2EX1A 4OB7A 4V38A 2O0MA 3KB8A 4CF7A 1PEYA 2BGJA 4HEQA 4MGKR 2O59A 4ZV4A 1UQUA 2X9VA 2VN8A 3F96A 3NOQA 1HQKA 4Q3DA 1XWFA 3RVRA 5AW3A 2VP5A 5M5BA 3WE7A 1NMZA 1OAKA 1OTXA 3PUIA 1O96B 3ZH2A 4R9VA 4RCZA 3RU3A 8ADHA 1C0PA 4E08A 4O2BF 4UFNA 5AI8A 3FZYA 4X6YA 5EWMB 4ND8B 2AHOA 4FIZA 2GK6A 3LTEA 3CEPB 1MH9A 3PR3A 5CDGA 2SKCA 3OKPA 1CLEA 5DRTA 4ZARA 3CXUA 1DWPA 1SY7A 4OX9B 4R98A 2QRQA 2ATCA 2GJKA 3DOFA 1OGIA 2A9RA 3TEFA 4TXJA 2YVAA 1XGKA 3MTDA 1KMQA 1FTYA 2YJ5A 4DVGA 2YN2A 3T9FA 1AGNA 3N59A 2FPIB 2AWNA 1GGFA 1MRSA 3R3SA 5U4QA 3ST7A 4OQPA 2V9ZA 4V03A 3UXMA 3WHPA 5LNK1 4OGWA 3BORA 3NHZA 2IT1A 1CRWG 3P94A 4K0RA 5T6BA 1Q22A 4PN7A 5I4KA 5LBUA 4NXNB 5L4LA 3E8SA 2QD1A 2C2BA 1DP4A 4QJBA 2IYNA 3B6KA 1S96A 1N75A 3Q9LA 3SC2B 1U28C 3UB4A 2JH3A 4LUCA 4WOBA 3E9ZA 4KOAA 1Y5IA 4P3KA 4H60A 4IHJA 4D99A 2FPPA 3B9BA 2OAGA 2XZTA 2P9CA 4I50B 3X1WA 1XMPA 2HCJB 5GOZA 5K3FA 1RXWA 2AJTA 4PGMA 1GPWB 1LI5A 2CZQA 2HU5A 2OSVA 2X5OA 4PCLA 1NPDA 1G20A 1PJBA 2V6BA 4QBFA 4BX2A 3DLBA 2D0DA 2X4IA 1ZJ4A 2ZI4A 1F5SA 2WUVA 3KKQA 1X77A 1ZLYA 4FOOA 1Y34E 2IF2A 1ZUNA 5AKHA 5HG0A 3P27A 4G6ZA 3KLBA 4QOHA 3URMA 4HOYA 2VDVE 4LNHA 4P58A 4KAJA 5JAMA 2H52A 5C31A 4DFDA 2HFJA 2XWPA 4FN4A 1TZCA 3WIDA 3S2SA 1ZJ5A 4BKUA 3OEHA 4OH7A 3OD1A 4ITRC 3SQDA 3A25A 3F1LA 3AXSA 3H2BA 3RRJA 5AVQA 1T43A 2C4WA 3R0VA 1HDEA 3C8MA 3W5CA 5CPBA 1Y37A 1JG2A 3GZJA 3O03A 2INGX 1QR2A 2GBFA 2JCXA 5LLTA 3M6XA 1X1EA 1IQPA 3GPCA 5JC8A 4PX5A 3TNDA 4TTPA 3ZHXA 3FUVA 2LCFA 4UMEA 5MN5A 1VRCA 2QSYA 2P9TA 4BO8A 4Y0AA 4RNDB 4F96A 4LDAA 2B82A 1W0JA 2OP1A 1E9VA 3U7QA 2XMQA 3L7MA 3HXPA 1XOIA 4JJ4A 4BMCA 2CMKA 3MTEA 2ZYDA 1ULZA 3LRTA 4EUHA 5AUPB 2BFFB 3D6AA 1CRPA 2BFOA 3IUNA 1OXKB 1DARA 1W0KA 2O2JA 4JLNA 3RQSA 4FKBA 4LZWA 4W1SA 1G17A 3A3KA 4JDPA 4KQMA 4DTIA 2CF6A 1XYGA 4BWFB 1FVXA 1PZNA 3A9WA 4KIFA 1FVFA 4ZRNA 1ZS9A 3SGLA 2QD4A 3JSXA 5F2KA 4BIIA 1I5OA 4HEJA 1U0SY 1LPBB 2CGEA 1IATA 4CIBA 3P20A 3B1XA 2FI1A 2RK4A 2ZI5A 4CIVA 2I3DA 1MFZA 2DTDA 3CLTD 1AMNA 2FGJA 4I2VA 4LOAA 1E6LA 1XFDA 2IPLA 2N0SA 3N2ZB 1ENPA 3QLVC 3RAPR 4NMMA 3LQKA 3R7SA 5AT1A 5KDLA 1IOLA 3WGUA 5AW0A 4K9LA 1GLGA 4IEIA 4H1WA 3REQA 1TEZA 2D62A 2B4QA 3KYCB 1FUEA 4YBZA 1GRRA 4D9JA 1PNTA 3DOCA 1NV9A 3MJVA 5HQ3A 2JFXA 3NYIA 1B0PA 2R2GA 3VOBA 3COYA 4B3FX 2PSDA 2QTVA 3I6QA 2OXCA 4GXTA 3WZLA 4HDSA 1QH9A 3FYUB 1G19A 4N8SA 2H92A 1BQ3A 5EFZA 3GMSA 5HP4A 1MMFB 2ZRFA 1W4RA 4IZOA 4ZT7A 1IDOA 2WUGA 2QE7A 1DCKA 2FW8A 1WXFA 2R8XA 4ALKA 2OUKA 1KVSA 2FAXA 1VE6A 2JCGA 4RKRA 5H4HA 4DA9A 1SCKA 3ETJA 5J1TB 1EK0A 1KEKA 3JQ8B 4DXAA 2QYOA 1KEZA 2Q4OA 4IV0A 1NE2A 3HI4A 1GILA 3Q7EA 1XE3A 2Y1LA 3FZQA 4I5EA 1OXXK 2JKVA 3GUCA 3ZY4A 2O48X 1K89A 2P78A 5L4NA 4BQPA 4KFSA 5DNEA 4OATA 3OHMA 3WADA 1JJFA 3B78A 3HJCA 4WK4B 1B7GO 3OPYB 2QX4A 1BXGB 2XJ9A 4NBVA 3UUFA 3N86A 2V5VA 1RQXA 1A2OA 1ISSA 1RP7A 3DMTA 5EZQA 1V3QE 4WCFC 3FUWA 3CRZA 1F1BA 3CUYA 3LLCA 3N8KA 4OK5A 3TUIC 4EG5A 4GR4A 3FMGA 1UDWA 4C6TA 2A0XA 2RGCA 3AF1A 4GP9A 2VP4A 1SVIA 5EEGA 4RIHA 5KWJA 1RWBA 2ZBUA 3TLGA 4LJKA 3VR0A 2FEOA 2JI4A 3O38A 5AO9A 3UWKA 3QELA 3CRW1 1WCWA 3IUYA 1V45E 1F2TB 1VMDA 5ABPA 2YXLA 4ZALA 1VKRA 4CEJB 4CCYA 3JV7A 1TX4B 1WE2A 1C4WA 3TSAA 1XU7A 1A5BB 3IHTA 4JLAA 4F2HA 1XNHA 2V9PA 1EXDA 3QV2A 1TTPB 1ZZGA 2HQRA 1RLOA 3A70A 2PAAA 3IKTA 2WF8A 3RYCA 3L49A 2NSLA 5FO1A 4DZRA 4ZO6A 1W4ZA 1BIFA 1ZOPA 2PD3A 1ZIXA 3BIOA 4S1NA 3W7VA 5HF8A 3EPKA 1UFKA 1WDKA 4Q37A 1RTKA 4FZVA 4ETIA 1LSSA 4E1AA 2ISSD 3WR5A 1CUAA 3AHEA 5L6MB 2R7LA 1K88A 1E3WA 1YE5A 2WSBA 3KTAA 3OLXA 3RT1A 1DI0A 4C03A 4DMKA 3A31A 3IV9A 3ZWBA 3BX1A 4DMLA 2DFLA 1MHPA 3LQQA 4JLDA 5F5LA 3VYTB 4D9HA 1RYDA 1XRNA 2LR0A 4BRSA 3ZVMA 2VQDA 3OEWA 2EEZA 2VIIA 1JHPA 3PC4A 1NPYA 4OLHA 4R16A 5KYUA 4YHHB 1NONA 4H6VA 3HKCA 2LBPA 2X0DA 4QZVA 2K7ZA 4EELA 1HYQA 1DADA 1ODSA 1O6FA 1PQWA 3BK7A 1NSFA 3EIWA 4OHBA 2R68A 2O2EA 3T5BA 4HUQB 4CLHA 1DRWA 4UNPA 4JHXA 2Y67A 1UL1X 4FHZA 2EDAA 4R8MA 5AI6A 4OSPA 4B5LA 4EG6A 5BXYA 3ZDCA 2NG1A 3E3LA 1NT4A 4QJ5A 3Q1LA 2FGKA 4WZBA 5P21A 3TZCA 1H22A 1Z0UA 2HJHA 5LN1A 2XUKA 4OBXA 5H3LA 4F0JA 5I7OA 3LVRE 5JUWA 4P53A 2AEMA 1SVNA 1C7ZA 5F4BA 1KDPA 1G2OA 3CXRA 2QX9A 1JEQB 1EDOA 1R0RE 3F9CA 1YBMA 3LWNA 3MWDB 5G4KA 1R12A 4BASA 3A9TA 3G8BA 3I0MA 3ZWDA 1T5DX 4YRLA 1K97A 1EPUA 1VE9A 2VDWA 3TYXA 2GKGA 1QSGA 3RASA 1D04A 4FDMA 4MJ3A 4LRXA 2R7KA 4WXRA 2HL6A 5H68A 3E4CA 4LAFA 4AVYA 5L6LB 3TTSA 4ENQA 4RHEA 1YDFA 1T9GR 4HEHA 4LXTA 1C7QA 2O20A 1L4MA 4LZZA 2IXAA 4HLNA 3LUPA 1I94B 1NRXA 4UUMA 1L4GA 2P4EA 2C9MA 1AA6A 4PPGA 3PEEA 1JIUA 2H0RA 2IE8A 3AV3A 2WD7A 2HMUA 3GFPA 1MC4A 3M3HA 3V1UA 1E2HA 2GI4A 2WWFA 2AT1A 2WC1A 3HMKA 4QODA 4MUIA 1BXRA 2I4MA 2CXHA 3E0XA 4K86A 1UBCA 1LBIA 3FSGD 3WZ2A 4E12A 4G2NA 1MU0A 3FCEA 4BP9A 3V1MA 4ZVRA 3DHVA 1U8XX 2B5OA 1KGSA 1R4MB 2JK1A 3NANA 5ICCA 2WP0A 4K81B 1G38A 4DB2A 1USWA 2ACEA 5EIBC 3ZBUA 5GQSA 3K8ZA 3UMMA 4BNIA 2AQKA 3OJFA 3MMZA 4KO4S 1NOIA 2EKZA 5LMCA 2OGSA 1B6RA 2NO9A 4RF4A 3WQBA 1N8NA 4E31A 2O3SA 1ZI9A 4QQNA 4BMDA 1JSLA 2GCIA 4PZPA 2QN8A 1CG6A 1GQFA 1QQ6A 1W88A 4KQJA 4RO0A 3VPGA 1R0BA 4R3NA 3N2GB 2QUJA 2PRIA 3CZ5A 3KUKA 3DBRA 4GKAA 5T7BA 4EHHA 4PGHA 3JSAA 4EY6A 2GPAA 2CVPA 3GCZA 3LTNC 1SKUA 3AG5A 4HYEA 5DKFA 3K5IA 4DVJA 2EW1A 1ISFA 1LPOA 3K0CC 4M9SA 3T99A 4XDZA 4DSAA 1AS0A 1R27A 3HY4A 4RMIA 1N0HA 1M5UA 1F60A 3TZ6A 4YR9A 5JMWA 2Q1SA 5JT1A 1NMQA 3QLUC 5KQGA 4XX0B 3SJCA 3FOCA 4LZAA 2NVWA 3EGIA 3M4JA 5JH7A 4ALJA 3PSAA 4ZWNA 4ZN6A 1DEAA 5T67A 3NBAA 3R8FA 4LPKA 2HADA 3G8DA 4Q6BA 2CNBA 5FWAA 4P80A 1X87A 2DB3A 1Y6ZA 3HNRA 4J1QA 2GEUA 2XVXA 3IYLW 3DS8A 4FFNA 1LNSA 4O1HA 2PMDA 2Z95A 3BXXA 4UC0A 3RK1A 3VR4H 5K45A 3FLAA 3RHZA 4GRIA 3B48A 5EIAA 1W2GA 3E5MA 5FA6A 1VMIA 3EH2A 3F98A 5BSUA 5HUHA 2ZS7A 3KHTA 2WHYA 4HJXA 4ZVVA 4P7JA 3Q9SA 1AUVA 1K68A 4DEYA 4ZJZA 1XVIA 1KC3A 2XGOA 3SICE 3E81A 2I2BA 1VCOA 1J9ZA 2ZYUX 3V8QA 1SGWA 1VKJA 5BW8A 3OQJA 5G02A 1BOFA 3LU1A 4YMUA 1Y8RB 3N7AA 1Q0SA 3PX2A 4NZMA 3WISA 4F2WA 1YDEA 3MBOA 3QWFA 2I6SA 3HK2A 2H63A 1PWEA 2ZP1A 5LB2A 3IAS1 3SC2A 4MRAA 4QJ4A 2VLIA 2C00A 1N77A 4UHFA 3ESRA 3KJGA 1JG3A 4IW3B 4C4SA 1Z45A 1U3TA 5IJXA 1H2YA 2OBNA 3DEYX 2GM5A 5AR1A 4DM7A 4KZPA 2BOVA 5FR2A 3RTDA 1N2GA 5CDTA 2CJXA 1OZ0A 5JS7A 3BN3A 1AUPA 4YJ3A 1PSWA 4KVZA 3OOJA 1VP9A 3QFTA 5F21A 1Q2UA 4YP1A 1NA5A 3Q85A 2GFQA 3LWDA 5AHRA 2VC2B 4K8RB 4RTPA 2GK4A 4GRDA 4JBXA 3ZU3A 1QVZA 1CYDA 3N2LA 5AD1A 1QFYA 1NP6A 5EMJA 4YRNA 2D1YA 4UVHA 3OF5A 4LVOA 1NXQA 3C6BA 1COWD 2BEKA 4JT4A 3H1AA 3V7WA 4DWWA 2CD7A 3N8DA 5IVPA 5K0CA 1OOEA 3QEOA 2BM8A 4NX2A 3U81A 1MAUA 2HHLA 2HSGA 4CLOB 3F73A 3TI9A 4M89A 5FPYA 5EOVA 3IT3A 3ERCA 1USVA 4WNIA 1BVHA 1E6CA 4TRMA 4ZVOA 1YMVA 1AQNA 5B58C 4IX1A 4B33A 1EG7A 3GPIA 4WXMA 2IUSA 3DHNA 3V97A 1SHLA 4PWYA 4TWBA 3RYFB 1V4VA 2QD3A 3E70C 3OZRA 1O08A 4GYKA 4R8LA 1WD5A 1L1FA 2C0QA 4Z9BA 1VG8A 1IBRA 3F7TA 2JLXA 4W7SA 4F4HA 1ZHFA 4HGZA 1C9JA 2RIPA 3MLAA 5JCZA 1FPQA 4DREA 4DJAA 2WUEA 2B3DA 2FRXA 3HDYA 1V39A 4DWVA 1W4CA 1M6YA 2PUCA 1IUOA 5FOWA 3QU7A 5G1PA 1HE1C 3UT5A 1JT9A 5HJ5A 3PHJA 4M7WA 3AJ9A 3I0NA 4GIBA 4P7KA 2VJBA 5DZSA 4RVOA 1X2BA 3RYTC 4AMGA 5I47A 5IXSA 2VH1A 1H1TA 1TPZA 2JJQA 4R0NA 4RY9A 4P0TA 621PA 4MCAA 5LOVA 4MV7A 4Z4FA 2J3EA 4JASB 4TMVA 4XWGA 1Z15A 1DXYA 4UULA 5MDHA 4FQ5A 3W77A 5C1IA 5FH9A 1D07A 2QY9A 4RKWA 4YRZA 1GPNA 1IVYA 1DAGA 5A6SB 3RREA 1M0EA 1OI2A 4FCTA 5B36A 3CJQA 3HN2A 1BAPA 1F0YA 1OTYA 4WAUA 3TAHA 2CC2A 5EMKA 4R2XA 1SCIA 3RARA 2Q5IA 3EWIA 1DX6A 4UDXX 5EJAA 5TQ2A 1UODA 4TMZA 1NBIA 2E0IA 3L6BA 4X63A 3RVPA 1B42A 4OHOA 4OFXA 3OM9A 2FOLA 1QG2A 2I3BA 3WVNA 1NG1A 4TWZA 2DECA 4CT0A 2ZCJA 3WL8A 4TQ9A 4FT2A 2RC6A 3MS4A 1VRWA 3DTVB 2FYTA 1A5AB 4MWDA 5HGJA 5JY6A 3GD7A 4L02A 1Q91A 3F49S 1Y7TA 2HLDA 5GP1A 1DCMA 3TMAA 5KNCD 3AEUB 5LIRA 1PR9A 2A7XA 3NYQA 1U63A 5AW2A 1CZHA 1COZA 2QEQA 1X8KA 4PGGA 1BS2A 1PZGA 3CO5A 3E82A 3AFIA 2X0FA 5G0SA 3MTGA 4HF7A 2BRUC 2PFKA 3WBFA 1ZR2A 4ID9A 3HDTA 2Q49A 1QZUA 4MVWA 4ENVA 4WOCA 3G89A 3GUZA 3HVJA 2OE2A 2RI1A 3HA5A 4RVNA 5HM6A 2IS4A 1XDUA 2F3QA 3RS5A 3VR4D 1N6NA 4DDMA 1YKSA 4M1QA 3I52A 4C7XA 1KSGA 4BWVA 5T5QA 3SKXA 4BYMA 1P6QA 3TRKA 3CEHA 3SSNA 2XRZA 5CFZA 1QIJA 1TQHA 1GLNA 1C80A 1EP9A 4BBZA 1BCSA 3L7AA 2XUZA 1B1CA 3VX3A 2G72A 1Z2AA 5LR6A 4M54A 1E2NA 1TI7A 1O96A 1VPLA 1KFCB 3H9QA 5DX1A 4DRXB 4ZQFA 4ZFNA 2X1LA 3D31A 5KU7A 3KEMA 1AURA 5FTKA 3O1IC 3TR6A 2Q3FA 1SNYA 3B1JA 4YEDA 2QI9C 2BSXA 2E7ZA 1POWA 1J97A 4IDFA 1JHMA 5EIHA 3UW1A 5KIAA 3TSCA 3DMYA 2BTEA 2AFIB 1N9ZA 1XTRA 4J49A 2GNOA 3T1VA 3U49A 4Q7LA 2OFFA 2GUWA 4Y9SA 3B7PA 1HYHA 3BIWA 3EVTA 4IZ6A 2V0GA 1GNRA 3P0IA 3QFFA 4V24A 3X1DA 2HDHA 1AK2A 3DB1A 1HLDA 4IRMA 4MYSA 5C2JB 3A11A 3OOWA 5IN4A 1JQEA 1Z6YA 3N07A 2NQ8A 5JD4A 2GEFA 1C0IA 5JASA 1CEYA 1H2BA 2ZBDA 4BO9A 1YJAA 1N2ZA 1VKZA 3DFFA 1A76A 2Q4EA 3AF2A 3HBJA 3UOAB 4JA0A 3OE5A 4F3YA 3LX5A 4KJXA 5JCOA 4QYIB 4JVOA 2XX3A 3KAQA 4JS0A 4MQEA 1ZAYA 2XAUA 4UOZA 1Z06A 3NOVA 4AM8A 1F4PA 1U7UA 2DF8A 2OHFA 4XX0A 5BT8A 5JVDB 1X80A 1J8QA 1WCXA 4KN5A 4IHJF 2PUAA 5BN4B 1NG9A 1AC5A 1K7XB 1U2DA 5FUQA 2ZJYA 5ITZA 3O7WA 3UMBA 4HT3B 1SIUA 1GZSA 1VIVA 1XTTA 3LBIA 4WFIA 4CI9A 2H85A 1W44A 2KPOA 1SC6A 5KOJB 3A2KA 2WHPB 2H2AA 1V1MA 1E9CA 4R2KA 1HTWA 4UHJA 1NVWQ 3MIIA 5HCUA 3MTIA 3KSZO 1EFAA 2G9NA 4CIAA 2J41A 5FBQB 2W90A 3CF0A 2XB8A 3E1KA 3OIYA 4U2GA 4ZVKA 1A95A 1VXRA 3UKJA 3ZDBA 1T5TA 5KTPA 4MAAA 1ZSNA 1FUUA 1P17A 4N0MA 1N1EA 4UUBA 3W3AD 3FPJA 3ICCA 3I8XA 3W5UA 2OB1A 3O2QB 9MHTA 5C32A 3G59A 3QTLA 2Q3JA 3DKRA 4Z9XA 1GP2A 1O0SA 1X1CA 4NNOA 3UYKA 3A9UA 3SPXA 1ARZA 1M33A 2XQKA 2ZRNA 4ZYXA 16PKA 5CYOA 2QPTA 1A04A 1UQTA 3G79A 4I8IA 3HPQA 4PYOA 4KPYA 3KEFA 2V7VA 4NG5A 4RF5A 3EG5A 4B9AA 3ZQ4A 1QLHA 3E15A 1U9JA 2QQFA 4DV5B 4YI5A 5CB4B 3F78A 2PKWA 1XTUA 4AS3A 3CHYA 3O3NB 3BTVA 5DT9A 4BY9E 5HZMA 2QN7A 5F51A 4RPHA 1JZSA 2V1XA 1I3LA 1LV8A 3R9KA 4CEHA 1HXHA 1HQYE 2XTAA 4KB5A 1XCOA 3WMRA 1RJFA 7GPBA 1JXMA 3IX7A 4Z86A 3TG8A 1N57A 2A5YB 1M66A 3B38A 3P26A 5FLXA 1CF4A 2YZ2A 2X13A 3SYTA 2GCGA 4M9RA 1XLTA 4YUZA 5EQFA 1TJ4A 1M75A 1Y1SA 1YR8A 2AK2A 3VX4A 2CNOA 1A69A 5GY7A 4DNOA 2RGEA 1GJRA 2F8MA 1U5BB 2AX3A 2CDCA 4QVIA 3FJOA 3K9WA 1F48A 4JUFA 4UCQA 5A3QA 1V37A 1A1VA 1IUNA 4HUQA 1UJ4A 1FQWA 4UNRA 3TN7A 1KQNA 5IFKA 3CUWA 1L1QA 6CHYA 5D3MA 2J5BA 4WBNF 2HIGA 2J3QA 4JT8A 1Q0TA 1Z4NA 1BNCA 3R0ZA 4PG7A 1BE0A 3IXQA 5KX5A 3INTA 2W6OA 3RVKA 4XVQA 4ED9A 5DP1A 1N2IA 1ST3A 1K8XB 1DNPA 3IUEA 3LV8A 1KR5A 3GLVA 4XIIA 5LB4A 2GO1A 4KKVA 1PR6A 2V3CC 3DR3A 1KYVA 4OOFA 4BMOB 2VQFB 3OWOA 4EQZA 2QUAA 1D2CA 4KVGA 2PKYX 2H48A 4UXHA 1AMOA 1PR4A 1HEYA 1TTQB 4JYCA 2C31A 3BL5A 3IAAA 2Z4SA 2FWBA 4DARA 2JLBA 2FEMA 4UFOA 1PE0A 1USGA 2X6RA 3MOSA 1M34A 2GWRA 4ZV7A 1M2NA 1B8UA 3QU5A 4GVLA 4Q3BA 2WKSA 1NF8A 2D3TA 1W73A 4JCOA 4DR3B 1FDTA 2WQ7A 2E6UX 2IHJA 3KQSA 2P6NA 2R751 1WUHS 1WUIS 2DUWA 1VSVA 1VE3A 4LXHA 4BLOA 3WO0A 2PL1A 3IXLA 2BV3A 3A37A 4M21A 4PC3A 4ZICA 3ITNA 4FLFA 1RHMA 3DHEA 1JLLA 3IO3A 4Y2TA 2CEKA 3FR8A 2C9ZA 2HMWA 1F8UA 4YAKA 4M55A 3W2HA 3T1OA 1YS7A 1Y6JA 3KR0A 4IJWA 2CV1A 3A6GA 2EQ5A 3AEKB 3K9QO 3PDHA 4LPSA 3L6EA 5GWXA 4OQDA 4IM7A 1Y4SA 4M88A 4UHBA 1PLKA 2QROA 1X7XB 3D3WB 2C5LA 4ILEA 3JWHA 4INJA 4RFSB 4RJIA 4TUYB 3UY4A 1WM1A 4AZ3B 2C83A 4CL8A 1F12A 1WB6A 2JIPA 2MU1A 1M8PA 1Z5GA 4GSKA 3TBFA 1XLTC 4ACBA 3K0AA 5AVWA 2OD9A 2P0YA 2HJ9A 3KOMA 3LUKA 2ZKIA 3VBEA 2FWRA 4X3OA 2QTWB 5LXTB 4BFVA 1JJIA 1EM6A 2C2YA 1DC3A 1QUEA 2NYRA 4MUNA 4WKNA 2GYYA 2WW8A 3AM5A 1IZ7A 2WWYA 1D4ZA 1EVJA 3OKFA 3L05A 4QULA 5I7UA 1Z0FA 3IALA 3QKIA 1E0AA 1ISIA 4YAGA 4E6EA 2O8BB 3NTXA 1FP7A 3N2YA 3HR7A 1SHZA 3DOJA 4FUQA 5C1BA 1C7RA 3SLKA 2IIVA 1A50B 1N2HA 2ZTLA 5AJXA 4NESA 1H69A 3QEMB 3RPEA 2RHCA 3SXPA 3W8DA 4ZYVA 4YP5A 1BH6A 1YRHA 4CQLA 1PYOA 3Q10A 1GZ5A 2C58A 2VQSA 2Z04A 3BWVA 2IZ7A 1XWWA 5JSQA 1ZN8A 1KOGA 4G0PA 2VYCA 4ZQBA 4HFJA 2KYRA 1PI3A 2Z8XA 1QWOA 1J2EA 2NLOA 2XXAB 2BHSA 3AUTA 3C41J 5EFOA 2CUKA 3FPGA 3VVBA 4RZXA 2VSYA 2JFHA 1KEWA 4B0PA 4QPDA 4PZDA 4CKZA 3L8HA 4YS6A 4EAAA 2B35A 2ZJZA 3FWYA 5ICFA 5L7TA 2OV3A 1N5JA 5F78A 3HSKA 1X1AA 4CQLB 4I5DA 2FR0A 3VR1A 4A1OA 1BN6A 2X86A 3IT0A 3K0BA 4LQ4A 3HKDA 3DT8A 4QEDA 1YB6A 1I2BA 1KSFX 1F3OA 4KIUA 4TT8A 1V5FA 1MW8X 1YVRA 3UJNA 1L1RA 1S8NA 2B5VA 3O0DA 2HT6A 1NXWA 4X1YB 4ZOLB 1ID8A 1ZRMA 3RAGA 3SHWA 2RB4A 2DU8A 3GZTB 2ONYA 4UJ3A 1TK9A 2XZOA 4N5IX 1I14A 2QW1A 3T1TA 1O89A 1YR3A 3ABOB 3VSCA 3PXUA 4BCCA 3OQOA 2I91A 2VXYA 2E4YA 2JIBA 1P4JA 4ENWA 2CZCA 4TKVB 1TECE 4J1NA 4RS3A 3PJDA 5BRJA 2C77A 4PYRA 4KK3A 3ML1A 3AETB 3WS7A 1L7RA 1FW6A 2IIBA 4AN1A 3I05A 4LY3A 1W47A 1L4BA 3WRWA 4AWXA 4MYCA 3AJRA 5E6RB 3U4MA 2W4QA 2GK3A 3UK1A 1Z8HA 1MG5A 4D0GA 1EGQA 1XZIA 5FQOA 3I5UA 4J3JA 2DFKB 3TQCA 5ENVA 4DTCA 4HUTA 2WWHA 2HRCA 1DAIA 4XR9A 3SS7X 1REQA 1P6XA 1FU7A 3G5TA 3GT0A 1N5IA 2VPXA 8OHMA 2C2WA 1VHQA 1GU0A 5B4TA 1KJIA 2WY2D 2DETA 1G6OA 1GPMA 1SUSA 4E30A 3SMQA 2GA9A 3T3HA 2IGBA 3M1IA 4KAXA 4LYFA 1BS9A 3ZE7A 4WGGA 1JEYB 1THTA 4HB2A 4LZPA 3R8CA 4AJIA 4QSHA 1V7QA 4IR7A 3U4CA 4RSHA 5I4IA 4DDVA 1HFJA 3L43A 1V6SA 2WWVD 4ZJPA 2TYSB 1NN5A 2D00A 4TTAA 4MPJA 2W2XA 1PGJA 1T6XA 4WY8A 4EKYA 1SCUA 3NAMA 4YJGA 1TW3A 2WRZA 4QNMA 3NDBB 3GBPA 2CT8A 3NHRA 2QG6A 3M1YA 2J09A 1XZJA 2BEVB 3W79A 3HB9A 2PMCA 4MR8B 5C7YA 2Q6OA 3DVQX 1PWXA 3F74A 3GAMA 3W1VA 1L8AA 4KIWA 2GVNA 4WE3A 3TRJA 3CLRC 3K16A 3L4KA 3R74A 3ICOA 2SNIE 4X90A 3ZDXB 1VLMA 5IJ0A 1NBWB 3N5CA 5BO5A 3EZ6A 1NRIA 1E2GA 3TKAA 1PTJA 3FW1A 2GFIA 2XDYA 4V3CA 2X41A 4KR0A 4TKZA 1OB2A 4A9AA 3SOZA 5D00A 2NACA 3BCRA 1KF0A 3QU9A 1NAHA 4M49A 2XVZA 3OMXA 3DTVD 3A10A 3F97A 2WSMA 3A14A 4TUYF 2IU0A 3HFGA 2O8VA 4NICA 4WBNB 3R3XA 4OQX