4Q8KA

Crystal structure of polysaccharide lyase family 18 aly-sj02 p-catd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
TIPSSITSGSIFDLEGDNPNPLVDDSTLVFVPLEAQHITPNGNGWRHEYKVKESLRVAMTQTYEVFEATVKVEMSDGGKTIISQHHASDTGTISKVYVSDTDESGFNDSVANNGIFDVYVRLRNTSGNEEKFALGTMTSGETFNLRVVNNYGDVEVTAFGNSFGIPVEDDSQSYFKFGNYLQSQDPYTLDKCGEAGNSNSFKNCFEDLGITESKVTMTNVSYTRETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginase
publication title Molecular insight into the role of the N-terminal extension in the maturation, substrate recognition, and catalysis of a bacterial alginate lyase from polysaccharide lyase family 18.
pubmed doi rcsb
source organism Pseudoalteromonas
molecule tags Lyase
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2014-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4q8kA00
5DXDA 3VV1A 4XJ8A 3M2MA 1W6OB 2EALA 5GM0A 3FUOA 1WD4A 1W0PA 2LALA 3JU9A 1FATA 3C2UA 1GZCA 3O0XA 1N3QA 2A5ZA 3WNXA 1MZ5A 2E7TA 2DTYA 2JD4A 3M3QA 2WT2A 5KXCA 1CESA 2JJ6A 5DZFA 1SCSA 2GMMA 1W6NA 1WD3A 5FREA 1Q8SA 1N1SA 2D3SA 2ZKNA 1PZ8A 1AJOA 1UN1A 5KXBA 4AVSA 4M00A 2D6MA 4LBOA 5CA6A 2NN8A 1LGCA 1BZWA 3VUOA 1GZ9A 2ZMKA 2PHWA 2CWMA 1HQWA 5DUVA 3M3EA 1MS5A 4CTEA 1LEDA 1DQ1A 3V65A 2W68A 4ISQA 1H30A 4K21A 4W65A 3OPZA 4Y20B 2VUAA 2D6NA 4YM0A 5DUXA 1AX2A 2P2KA 2GNMA 1CIWA 3ILRA 3O12A 2NMOA 3SH3A 3T2TA 3TAYA 5KXDA 3IKWA 1N3PA 1C1LA 4P9WA 5T5OA 1KQRA 1W6QB 4U2AA 3WG1A 1LHWA 3RSJA 5H9SA 1DBNA 2C5DA 1GBGA 1S0JA 2VW1A 3D4KA 4K1ZA 3PMEA 2DWRA 2VXRA 3PVNA 4CZSA 3V0AA 1D2SA 1HLCA 5BYNA 1B09A 1DQ4A 4JC1A 1JBCA 1G7YA 4HL0A 5JVVA 1IKQA 5T5LA 5E8AA 2P3IA 2VW0A 3SH5A 4DRRA 3WLUA 4YZ3A 4ZXKA 1CQ9A 2DVFA 3FLPA 3APBA 2I2SA 2CNAA 2Q5TA 3RMYA 1D0HA 4XTMA 2JECA 3AZZA 4NO4A 4XXPA 1V6IA 3BIWE 3AJYA 1W6PB 2A6ZA 3ILFA 5DG1A 3WDUA 1DQ0A 1YYNA 4XIKA 2TEPA 3AXDA 3ZYRA 1BYHA 3N7JA 4TYSA 1LU2A 5GZFA 1QDCA 1V6NA 1C1FA 2D3RA 3L2YA 1W6NB 1AX0A 3FLRA 2NZ9A 3LSEA 4LBMA 5H9PA 3M1HA 5T54A 1Q8VA 5GALA 3SISA 1S0BA 3D6EA 5CAZA 1DZQA 2DUOA 2PHRA 2ZHKA 2NP0A 1JUIA 1SFYA 4ATEA 1FNZA 4FPLA 4AVVA 3MW4A 2R49A 4AVTA 1JW6A 2JKBA 1Q8OA 4BLJA 1WLDA 4M3CF 4BLIA 4DRVA 3ASIA 4FPJA 4LBLA 4DQAA 1GV9A 2ZGKA 4FP2A 3V64A 3AFKA 1IS6A 5GLTA 3Q9OA 4YW2A 4BM8A 1V6OA 1AXZA 2YMZA 1QF3A 1GYKA 3ENRA 3MW3A 4Y20A 2WKKA 4XIOA 4XJWA 3ZYPA 3WZ1A 4YFWA 1CPNA 4XOGA 1JHNA 3OYWA 3UK9A 5HCFA 4FPHA 4Y24A 1S0GA 1Q56A 1GLHA 1BQPA 4FPYA 3WUCA 1G8WA 1W6MA 4XJAA 5GZGA 3B69A 3AYAA 5L73A 4JRAA 4Q26A 3FLTA 1FV2A 4BMEA 1R1ZA 3M3CA 3ZPYA 1QMJA 5GZCA 4FP3A 4XDQA 4P14A 3ZSLA 2H0BA 2AREA 5KXEA 1HQLA 2YZ4A 1WBLA 2WT0A 2SBAA 1DGLA 2GNTA 2NYYA 3ILNA 3V0AB 2R0HA 2UWCA 4YGCA 1MS8A 1YO8A 3WHUA 1UMZA 4BQ1A 1DLLA 4I30A 3O0WA 4PCRA 2ZMLA 4YW1A 2EXIA 2EXKA 2EXHA 3MPPG 1UKGA 1SACA 1LHNA 3SNMA 1JXNA 3I8TA 2XB6C 3IM0A 1LESA 4RA0A 2VY0A 4XJ9A 3WUDA 1G9AA 2A6WA 2LTNA 3QLQA 1ZM1A 1NXD1 1W6PA 2ENRA 1FV3A 1X50A 2D43A 4AYUA 1LHVA 5IK5A 2XG3A 1O4ZA 5GLZA 3WV6A 4FOYA 5GJ6A 3RS6A 4WVVA 4XMAA 1FX5A 4FPFA 5JOYA 2G4IA 3RG0A 1LOCA 4FPGA 1ULFA 4XBQA 1SLTA 2CWSA 2Z42A 2C9AA 1GNZA 3AYDA 3AP5A 2AH2A 4GKYA 3FUQA 2D44A 2A3XA 2V73A 2ZHLA 4WVWA 4XZPA 2E7QA 1MVQA 1CVNA 2ARBA 1Y7BA 1F9KA 1RIRA 1DYKA 4U36A 3VKMA 2ZBJA 4ASMB 1OQ1A 1Q8QA 1VAMA 2E6VA 2CYFA 1LHUA 2ZGLA 4XYXA 2D6LX 5AVAA 4Y22A 3W58A 2UWAA 5IUQA 3AYEA 1QOSA 2ZGUA 2ZGRA 5T50A 2DVDA 2ZAAA 3N36A 5LK5A 4Z8BA 3OYWB 1G9BA 1N1YA 4BMBA 1VLNA 4DS0A 2DUPA 4PQ9A 1SCRA 1F31A 2W52A 3FFZA 2EXJA 1W6MB 1ULCA 2ZHNA 4ATFA 2P3KA 5T5JA 1JOJA 1LOFC 1V6LA 3DUIA 3GNEA 2UURA 1LU1A 2OVUA 5JOXA 2R1DA 5T5PA 4GKXA 3GALA 3WG3A 4M3CA 2HYKA 1UZYA 4YM2A 4Y1YA 2ZGTA 4D69A 2R0FA 1VAVA 1OFSA 5F5QA 1PZ9A 2RHPA 3UJQA 1Z0HA 2DU1A 1WW4A 1JN2P 5DUUA 3N35A 1LHOA 4UW3A 4YGDA 4P9XA 3POYA 2OUHA 1WBFA 2AGSA 1GICA 1KDKA 3AYCA 2JE9A 1QOOA 1AF9A 1SLAA 1YIFA 1LCLA 1MS0A 4GALA 3ZXKA 5JMCA 1UL9A 1N1VA 2A3WA 3TB0A 4L8QA 1AJKA 1CJPA 2V5YA 4H55A 2FMDA 1IOAA 3AP9A 3N3HA 3AJZA 1DYPA 1W0OA 1QU0A 1AVBA 2ZZJA 3WHTA 1WW5A 2D6KA 2PHFA 3V0BA 2ZGMA 4FPKA 3IPVA 1HKDA 3KM5A 1AXYA 2GNBA 4HANA 4Q1PA 1MS1A 1LECA 2ARXA 3WG2A 1V00A 4C1XA 1SLLA 5HCBA 3T1LA 1C57A 1RINA 1G9DA 2FHRA 2OW4A 1KITA 3AK0A 3NV3A 4BPZA 1G86A 2YY1A 3B00A 3ZSJA 2JDZA 3OGGA 4FOQA 2A6VA 1S0IA 3AXEA 3OBTA 4Y22B 3R4SA 3OY8A 1V6JA 4R9AA 2KM2A 1I3HA 2AENA 2GN7A 3AX4A 2B7YA 4AGGA 4DFSA 5F9TA 5H9QA 4YG3A 1CN1A 4GWNA 3ZSKA 5IK4A 2P3JA 1V6MA 1YI7A 2BQPA 2P34A 3NV4A 5DG2A 4ITCA 1LENA 1SLCA 2D6OX 4JCKA 4YM3A 1LULA 3UL2A 4F83A 2D6PA 1DFQA 3QCWA 2WJSA 1GANA 3RRDA 2EF6A 4M3CB 3BTAA 1UAIA 4ISRA 2GNDA 4UW5A 1MZ6A 4XBLA 4XJZA 2GN3A 5FRAA 4XE9A 1WCSA 4BOWA 3WDTA 1MS3A 1IS5A 1S1AA 1SBFA 3AP6A 3D5OA 3INAA 4LBQA 5EYXA 5T52A 2UWBA 1F5FA 4XHBA 5T55A 4AGVA 1GSLA 1ENRA 3ZVXA 2A70A 1IS3A 1FYUA 1SLIA 1NLSA 1A78A 2DVBA 1DQ6A 2D3PA 4Q27A 2ZA9A 3HMYA 2DTWA 2ES3A 3FBYA 4Y26A 4DPNA 3NV1A 1LGBA 3H0OA 4XXAA 1Q8PA 4M01A 2AUYA 3ZXJA 1C4RA 2PHXA 2A6YA 4PBPA 3HR9A 4YG0A 1ENQA 2PHTA 2VH9A 2A3YA 4YZ2A 1WLWA 4GA9A 1DIWA 1I1EA 1G9FA 1WLCA 2YROA 1MS4A 1YXWA 3ZXFA 3A0KA 2ZABA 3N7MA 1LOBA 2NMNA 1TEIA 1ENSA 3VKFC 3V0BB 1DQ5A 2D7FA 4KBBA 3RMXA 5EWSA 1QGLA 3CNAA 1QDOA 2VU9A 3IPVB 2ZGQA 5CNAA 4GWMA 3M3OA 4UW6A 2DU0A 4WZFA 3RQ0A 2CL2A 3WDYA 3KQRA 2P37A 1ZA4A 3NWKA 3PVOA 1APNA 1AXKA 2W08A 4YZ1A 4UW4A 4YZ4A 1WW7A 2ZMNA 4YG6A 3AP7A 3NV2A 4P9YA 3R4UA 4XMIA 1MR5A 2NM1A 5DZGA 2E53A 3OY8B 3WOGA 1DHKB 2WNEA 2W39A 3WCRA 4MYEA 4R9BA 1MACA 3R05A 5GLWA 2DVAA 2ZACA 1HDKA 3AZYA 4YM1A 2ERFA 2R16A 1S0EA 4PF5A 4XBNA 5IK8A 1V6KA 4FPCA 4FOWA 1QNYA 3B9CA 3BODA 5DZEA 4YW5A 2JE7A 1KJRA 4XJUA 2CTVA 1PZ7A 2A7AA 3B3QE 3O0VA 1CONA 2AYHA 5DUWA 1BJQA 5GLUA 4GXLA 5JLVA 3ZXLA 1VIWB 2YV8A 3A0NA 3HN1A 3OBRA 3U4XA 1XQNA 1GNHA 1LOFA 3WDXA 5GLVA 2WT1A 3USUA 3ZXEA 5EYYA 4LBQB 4M3CE 5EXOA 1LODA 4YW3A 5IT6A 2ZGNA 2DYCA 3LSDA 1Z78A 4Q8LA 1YRZA 3PJQA 4LBQD 1FNYA 3AP4A 2DUQA 3AZWA 3MEPA 1UPSA 1ULGA 3A4UA 1A8DA 4FPEA 1AX1A 1ONAA 2EAKA 3IN9A 2OUJA 3WVJA 4YGEA 2A71A 3AZVA 3ZSMA 2ZGSA 1ULEA 1GZWA 3DGTA 1S0CA 1AZDA 4CRQA 3WCSA 4YZ5A 1LTEA 2SLIA 3POWA 1J1TA 2ZGPA 1G9CA 4FPOB 2UU8A 3O5SA 1W6OA 5GZEA 1KJLA 3UJOA 2WLQA 3AZXA 2DVGA 4YGBA 1QKQA 2ZHMA 3B01A 4AGRA 1H9WA 1O4YA 5E88A 5JDBA 1LOGA 4Q1RA 1N47A 2E51A 2WSVA 1FAYA 3VKLA 1SBEA 3VKNA 3LCPA 1WW6A 2R1BA 3T1MA 1IS4A 2VW2A 4NOTA 1QNWA 5E89A 2EIGA 3SH4A 4OZXA 3POSA 4RL7A 2DV9A 4LBNA 4XTPA 4Y1ZA 2YXSA 4PBOA 5IK7A 1U0AA 1QOTA 1ULDA 2DURA 3SITA 4TZDA 3I4IA 4YLZA 4SLIA 4K1YA 3WDVA 3N7LA 1KRIA 3OJBA 1URXA 4Y1VA 2GDFA 4IQPA 4C1WA 2A75A 1DQ2A 1MS9A 5SV8A 4FQZA 5H9RA 1WUVA 4FVVA 4XILA 4YFZA 5JOZA 3PVEA 2A6XA 2GMEA 1VALA 2GMPA 4R9CA 5JOWA 1JYIA 1EPWA 1KDMA 1LOEA 2WSUA 1CPMA 4FQ4A 1S0DA 4LBKA 4Q2FA 3JUUA 3VKOA 5HCAA 1BKZA 1LJ7A 4WV8A 1LGNA 1N1TA 3MW2A 2WQZC 1UZZA 4R9DA 1RITA 4LBJA 5GZDA 1A3KA 3BOPA 2GALA 1IKPA 1W6QA 4Q8KA 2PELA 3USUB 2PHUA 1LEMA 4XHXA 4Y1XA 1SLBA 2ZGOA 2CY6A 3N7KA 3WDWA 3W59A 1OKQA 1S0FA 1H9PA 4K20A 3SLIA 1MVEA 3IMNA 4Y1UA 5CBLA 2AR6A 3WG4A 1GKBA 5CB7A 3ATGA 1BXHA 4ZKTB 1SBDA 4AWDA 1JYCA 1LOAA 1UX6A 1GZWB 4YW4A 1CR7A 1N3OA 4FOVA
chains in the Genus database with same CATH superfamily
5DXDA 3ALQA 3DKQA 3GGLA 3QH6A 2UY8A 4A44A 3KV4A 3N4MA 1IG3A 1UCXA 3MV01 4D6QA 4XDPA 3MLLA 2CGNA 2LALA 1W0PA 4Q4X3 4UBHA 1CZSA 1QXPA 1MZFA 4GZ9A 2ZXQA 3C2UA 3HNBM 1N3QA 3MUZ1 4HSJA 3WP5A 2A5ZA 4FAGA 1CAWB 1H8TC 1LKNA 2JD4A 4CEYA 2WT2A 2RR12 4S2FA 1R081 2RJLA 4UFHA 2DDUA 1YQ6A 5LB6A 3S5QA 2GMMA 4IE5A 3WXPA 3B94A 5FZ0A 2BWCA 3ETQA 4RQPB 4LOTA 5IAXA 1ZZ9A 3ZFEB 3ZN4A 2PQQA 2ZX1A 3SQOA 1OPMA 1AJOA 3MLKA 1UN1A 4MOAA 5DPNA 3EBRA 3IAQA 2NN8A 1HX6A 3LAGA 5BNPA 1UZ0A 4H2AA 5LBBA 1HQWA 3M3EA 1ND3C 4QX2A 2WQ4A 3FHAA 2OPKA 3ZFFA 4QQLA 4HLTA 4CP0A 3HBKA 4QQHA 4ZPIA 5BY5A 4W65A 1CZVA 3OPZA 4D0QA 1BK1A 1RUJ3 5JCTA 1WCQA 2JDNA 4Q0QA 3FJSA 1GWMA 5KXDA 2WA4A 1IHMA 1N3PA 1C1LA 1EPZA 2XQRA 1ZZ8A 1Y3TA 4U2AA 5L9RA 1LHWA 1TNRA 5CKMA 5H9SA 1DBNA 3VBSA 1OOPB 4K1ZA 3J26N 3I2KA 3ZIWA 5FYTA 1H8VA 4GWJA 1X36A 4CXWA 1RVF2 5EHDA 3VN4A 5K7PA 1JS9A 4JC1A 4MLOA 1BEV2 2DCYA 4Q0PA 5AFEA 5F32A 5E8AA 4DUVA 3TRSB 2VBBA 5DABA 1GQPA 2GSYA 3SMHA 4SBVA 1VAKA 3ZFGA 4JGYA 1ZBA2 3AKRA 1R091 3PDQA 3PHMA 2JECA 2RMU1 2OZJA 5JIAA 5FMOL 3VBHA 3VD4A 1W8FA 1YYNA 4LMFA 4IEOA 4JDOA 4I3GA 5JSOA 1RUOA 5GZFA 4RYDA 1V6NA 5H9PA 5KHKA 1R083 2NZ9A 4QX3A 1SMVA 3DN7A 2XKPA 5GALA 2CU5A 5CAZA 2DUOA 2QQPA 5IFPA 2R063 4FPLA 1RUG2 4AVTA 2Y6FA 3T3YA 2VMEA 1Q8OA 3OTFA 5L7OC 4KWLA 1TME2 2K46A 4KG0A 1JOPA 4DOUA 2FCTA 4DEVA 4DQAA 1GV9A 2ZGKA 3V64A 1AL21 3H8RA 3AFKA 3Q9OA 4LULA 5I8YA 3MW3A 3T2OA 5A7PA 5DAQA 5AC91 1B35A 4YFWA 1CPNA 4KWJA 4XOGA 2LUWA 3VHRA 3SKJE 3OYWA 1OH4A 1RUD1 1PO13 4FPHA 1UYPA 1FOD3 1Q56A 4XUNA 4DY3A 3RZLA 1SDWA 1AR92 4TLFA 5GZGA 5L73A 4Q26A 1K5MC 1W2UA 4FCAA 1FV2A 1W8OA 2J1SA 4WM8A 1R1ZA 3WW3A 5BUVA 1XU1A 3ZPYA 4FP3A 4P9IA 4P00B 2H0BA 2RDRA 3Q8FA 4FI9A 1HQLA 3I54A 3UKNA 3VZJA 2X5IC 3UESA 3WQ0A 2H0VA 3LF7A 2C0ZA 4YGCA 4QPIB 4CE8A 1JZ8A 2VQ0A 3KSCA 4BQ1A 4XFAA 3M4FA 1VMJA 3NL1A 4PCRA 2WNVB 2EXKA 4I09A 1LHNA 2WS92 3SNMA 2LS6A 3NAPB 3IM0A 3RZHA 1YUDA 4IL7A 5I0TA 3ROUA 4QB6A 3UETA 1DZRA 3UGHA 2D43A 1LHVA 1SEFA 4YVWB 2R30A 1UQXA 4LO8A 1KGYA 3WY6A 4HPKA 5FZLA 3PTYA 2RMU3 5GJ6A 1RJ7A 4XMAA 2DFCA 3N9QA 2G4IA 1BBT3 4LO5B 5CADA 3MHZA 2LROA 1EUUA 3GF6A 3T4VA 1LOCA 3BTZA 2VQTA 2HWE3 5M0TA 1SLTA 3J7NA 5FMDA 3JQWA 2OA2A 5FZ1A 3ES4A 3CL1A 4J6GA 1VBB2 5BXXA 2UYBA 3T08A 3KZ4C 4AEKA 5A3PA 3AYDA 5A6ZA 3AP5A 4NHYA 4GKYA 3FUQA 5L9BA 3NVCA 4RR3B 5IHRA 3OOXA 2E7QA 3HD8B 4AAPA 4CCOA 4NRPA 4AL9A 3K77A 1NKGA 1ST8A 1Y7BA 5D8AC 5FBZA 4UFJA 4PJYA 1O4TA 3VKMA 2D93A 2E6VA 3WT3A 2CYFA 1LHUA 4Q4Y2 2V09A 4QGLA 4WVMB 2DCTA 4XYXA 3SCFA 3MF6A 1AL23 1SFNA 2QCSB 3W58A 4IE0A 3ZXGA 4L97A 2ZGRA 3L2HA 1W28A 3N36A 2PLV2 2B9VA 1ZNPA 1G9BA 4BMBA 4NRQA 1QH7A 4DS0A 1GWKA 1QQP1 1RUD3 2W1QA 2EXJA 1V0AA 2R32A 4NWWA 3ZMOA 4IEWA 1ODMA 3MIDA 2YG0A 3ZYBA 4WZCA 1V6LA 5JI9A 1Z7S2 2VZOA 1LU1A 1R1A2 1XNCA 3GALA 1S55A 4M3CA 3WG3A 2V72A 4B1MA 1YJLA 4NAOA 1BHGA 2BYVE 1JYNA 3BIEA 1JUHA 5IJRA 4GH4C 3NQHA 1W9SA 1OFSA 1W8HA 2RHPA 4UFMA 4YRDA 1D4M2 1RUI2 4CDXB 1D2QA 1WW4A 4HN1A 3H9AA 4OI2A 2ZJCA 3RVHA 5F7UA 4B29A 4RGGA 1GOFA 4D7SA 4UW3A 3I2JA 4P9XA 1CGPA 3AYCA 3RYKA 2JE9A 5LRSA 1LCLA 4GMP0 5K4LA 4C8DA 1DGRN 1N1VA 2RS11 5HV4A 2A3WA 5FO8B 1H1IA 3JB8A 3KT4A 4L8QA 4QX7A 2V5YA 5FWJA 1JYVA 2XWBB 2Q0AA 3CU7A 4H55A 3J8F3 1RHI2 4W6YA 3V0BA 2KD7A 1AVBA 1KFUL 2ZZJA 3LDKA 2PHFA 1UYXA 2EIBA 4QPGA 4JQTA 3WF0A 5IVBA 1RC6A 4RR3A 3KHBA 3GJAA 2WO7A 1UY0A 3POFA 5HCBA 2WWSA 3GYDA 1ND2C 3HPNA 4QPYA 1G9DA 1SHWB 2OW4A 1EAH3 3AK0A 3NV3A 3KQ4B 3Q8EA 4W6XA 2IVJA 2OKXA 3B00A 4WVMA 4XABA 5A7WA 3FE5A 4QWNA 4Y3OA 2A6VA 4YSFA 5C8CC 4LA3A 1PGW1 4Y22B 4K7JA 2WZ8A 3TYJA 4R9AA 5FR3A 1CWPA 1GQGA 1I3HA 2AENA 2VCMA 5F9TA 2XPJA 1UOFA 5JWPA 1XBFA 1CN1A 3H1WA 4GWNA 3MI8A 4AFCA 1W3VA 5FFOC 5IK4A 2VOXA 1UIJA 5EV7A 2RM21 3NV4A 5CFDB 5FUIA 5F37A 5DG2A 4BWOA 2Z4FA 1GOGA 3L9JT 4YM3A 1L7RA 3I59B 2R073 4COZA 4PLOA 5F3EA 1DFQA 3WP3A 1Y9GA 4OHZA 1FPN2 3H7YA 1S2EA 2XUMA 5I93A 3DXTA 3O1PA 4XJZA 4CDXA 5LW9A 4TXWA 2GN3A 2WO2A 4PDWA 5E6HA 4RHV3 1NG0A 1S1AA 3E6DA 3INAA 3IIAA 1NZIA 4E4SA 2QDRA 2BP6A 4LK6A 4LA2A 1OT5A 4AGVA 3CJXA 5LY1A 4HN0A 1ENRA 3E5QA 3EYPA 4YPJA 5C5UA 2A70A 5KC5A 1FYUA 2AZ5A 1VMFA 3VZKA 5BV6A 5I0DA 1DQ6A 2FQPA 1WMXA 4JGZC 5FY1A 4A42A 3TN92 2GU9A 1YI9A 4Y26A 3H8OA 5A80A 2XKOA 2QDNA 4XXAA 4M01A 3WR0A 2GZWA 4YG0A 5C3QA 4RSUA 1WLWA 1DIWA 3RYPA 3OCPA 5FYYA 1WLCA 2VTXJ 3A0KA 2IWGB 2X10A 2WZR1 2ZABA 5IYYA 1TEIA 2XBO2 1DQ5A 2B8MA 3RMXA 4GIQA 5FZCA 3ZMNA 1QDOA 3MV11 4RN5A 5CNAA 4CDUB 4GWMA 2BV4A 2I74A 1GNYA 1C5IA 1SQ4A 4AEDC 2Y0OA 2WDBA 3AKSA 1AXKA 2FDIA 2VTXA 4YZ4A 2GC2A 3VDDA 3RDIA 4MG2A 1AL0G 4A7YA 3O1RA 5DZGA 4UFKA 4LKDA 5B2GB 1NCRA 3H7JA 4C90A 5GLWA 2XJUA 3AMQA 3BCWA 1HDKA 1UMHA 2PHDA 4YM1A 5JXGA 4XACA 4YVSC 3WNKA 1VBA2 4RS5A 2Q8CA 2VR4A 3B9CA 1OHFA 1OXCA 4G3YC 3AFGA 2A7AA 1YQ8A 2VZPA 1QJX1 1VBE2 2AYHA 2ZPXA 4FO9A 4NIAA 1BJQA 1XE8A 3EB7A 4NN0A 4AXOA 3ZXLA 3HN1A 5IVVA 5FUPA 3U4XA 3KVAA 4CDQB 1AYM1 5AVPA 1WGPA 3WDXA 4Z82A 1OH3A 3USUA 4CXXA 1RVF1 4IEZA 4GB31 1GR3A 2WNOA 1LODA 4LBQB 5EXOA 4YW3A 2OYZA 5IT6A 1BEV1 3MGUA 3GBWA 3KCXA 3WINE 1FNYA 2YUEA 4QDSA 3AZWA 2DUQA 4L9BA 4FPEA 5HI0A 3OGJA 4LKFA 3ZOIA 1C8NA 1KFXL 1ONAA 2EAKA 2P6HA 4XFIA 1OVSA 4LE4A 4Z2WA 3POEA 2WQ8A 3MIHA 4Z07A 3ZSMA 4EWAA 1NQDA 5JAXA 5C9AC 3WNPA 3PLQA 4JKKA 2ZX0A 4QHBA 1Y4WA 2JICA 3K48A 4AZZA 1LTEA 4QDQA 2C1FA 4UXAA 2ZGPA 4JQRA 3LKJA 3UJOA 5GZEA 2WLQA 3CZUA 5A3WA 4RFT0 1O4YA 3C3VA 2BUKA 1W99A 2RR13 4XAAA 3VKNA 4COVA 4A6SA 4AVBA 2VGDA 4AG4A 1TQ5A 2VW2A 2Y6KA 2VC9A 5FIXA 5JMOA 4OZXA 4QM8A 1HXS2 1CAUA 1HB1A 1Q43A 2ATFA 1PM7A 2Y6LA 4LBNA 5F3GA 3U10A 4MH0E 1AR72 1OD3A 4MXVA 3T2PA 1ALYA 2OIIA 3PJYA 5IVFA 2ILMA 2PAEA 3JBG1 4Y5SA 5DAPA 4CUCA 5LK7B 1U0AA 1QOTA 1ULDA 1YJKA 3EQEA 4K1YA 1FT9A 3KVBA 3OJBA 4P9GA 4PHZA 1U5ZA 4IQPA 4C1WA 1QJZA 1RUH2 2A75A 2WNUB 4QX5A 2BDRA 2YGLA 5SV8A 2D40A 3NNLA 4ES8A 2JX9A 4CP2A 4QHOA 1AR91 3IAPA 1VALA 3P5BA 3IBMA 2WINB 1PVC2 5FPBA 3NO8A 4F7ZA 4HETA 3POJA 1KDMA 1LOEA 1AHSA 4NHXA 1PHMA 2WSUA 1CPMA 3IWZA 3LB9A 2WC2A 3M3IA 1DU3D 4CCCA 1LJ7A 3LEKA 1N1TA 4JDNA 1AR82 4W8JA 2WQZC 2XWJB 1PMHX 4R9DA 4A41A 4B4QA 4IV1B 3FHIB 1K5JA 1A3KA 2P5BA 4ZS3A 3RPQA 4XFHA 4XHXA 1SLBA 3PIJA 5FZBA 5A32A 3N7KA 3I97A 3W59A 1RVF3 3AM2A 3ES1A 2QQVA 1H9PA 4K20A 3IMNA 4Y1UA 1OVPA 4OI4A 1BEV3 2AR6A 2WS91 5LY2A 3FL7A 3FFQA 4IV3C 1OD5A 3THCA 3VBOB 4FSJA 1COV2 5CB7A 2OZ6A 4FFFA 5JIUA 4AWDA 1UPIA 1RUF1 1JYCA 1ZBA3 2I45A 1I5ZA 1ZRDA 4XJ8A 2XLAA 3VHPA 1VBC1 4BE3A 3KWVA 1W6OB 2EALA 4QHZA 4DXTA 4NPMA 1NAEA 1QH6A 2JDPA 2JE8A 2VOTA 1WD4A 3JU9A 3LFIA 4MGZE 1YLLA 1X82A 3DF0A 4L92A 2YPJA 3O0XA 2O14A 5A7QA 3J7HA 3WNXA 3RGBA 1MZ5A 1NCQB 2E7TA 3ST7A 4BQ5A 2DTYA 1E5HA 1UKRA 3M3QA 4WM7A 5I0RA 4NROA 5KXCA 1HV0A 2O8OA 1L7QA 5ACA1 1WD3A 1RUG3 1VRBA 3AKTA 1NLRA 5FREA 1Q8SA 4DNYA 1N1SA 5FMCA 2JG8B 1POV0 4AI1A 2J22A 2VZRA 1TME3 5JI7A 5IATA 5KXBA 3OPWA 4META 3ZR6A 5E16A 4FXGB 2ARCA 4AVSA 4MGSA 3VUOA 1LGCA 1BZWA 1ZBE2 2P3YA 5C5TA 2ZMKA 3NJXA 1T6BX 4XF4A 2RS52 3C7FA 1UOJA 4EZ4A 2VXJA 4JHZA 4CTEA 1DQ1A 1W9YA 1AR93 4K21A 1UY3A 4P9JA 1RMU1 2VUAA 1H0BA 5DUXA 5B4XA 4HKOA 1PK6B 1PO21 2JB4A 1RUC2 3FN9A 2NMOA 3O12A 2O8QA 4PIZA 3TAYA 1U5IA 5T5OA 1EV12 1X33A 1OQEA 4ARYA 5BNQA 1MQTC 5C71A 2C5DA 2F4LA 4R8HA 4E4DX 1S0JA 3ORJA 3NJYA 4LEJA 3D4KA 3BKZA 1OSGA 2DWRA 2FMYA 4Q29A 4DZGA 4BJ0A 2W9XA 4DIQA 4CZSA 5J98B 2QKDA 4D7YA 2WS93 4W6WA 4LHKA 5FKCA 1DQ4A 1W0NA 4HSLA 1XYPA 2JKXA 1G7YA 5T5LA 5CFCA 3QD6A 2DFBA 4Q4X1 3T09A 4ZHNA 2BW8A 3I2FA 4DRRA 2JDUA 2DVFA 3FLPA 4CUBA 3APBA 4GULA 5C4WB 2OXBA 2NPIA 2OQ7A 3RMYA 4XTMA 3DYMA 1NCQA 3VDCA 5LA0A 1V6IA 3Q8CA 3LGRA 2A6ZA 2Y26A 3WDUA 1DQ0A 5FP9A 4CEYB 2TEPA 2PHLA 4AFDA 3ZYRA 1VBB3 1BYHA 4AHYA 4YGEA 3CLPA 2D3RA 5APAA 4ZZ8A 1AX0A 4LBMA 1C8M2 3M1HA 1Q8VA 1NLQA 5FK8A 1S0BA 4JX0A 2BVBA 2PHRA 1HJGA 2FDGA 1ASJ2 4B1LA 1P8JA 4WBBA 4N53A 1QWRA 4RQPC 4Y5Z0 4AVVA 4XFFA 3ZFEC 3G7DA 2JKBA 2J1AA 4Q4Y3 3VBFA 5CISA 4BLIA 5BNPB 4Q0SA 4BHPA 4COUA 2PLV3 1RUJ1 4EYUA 1IS6A 3ZFFB 4YW2A 4BM8A 4BB3A 2YMZA 3ENRA 1GYKA 5CKNA 1BCXA 3BUCA 2BBVA 2IVIB 4MGQA 4XIOA 2MPFA 4XJWA 2YBSA 3ZYPA 4CEWA 2VZQA 3VZNA 1BLZA 5HCFA 2XL7A 5EFUA 4BZ4A 3BPZA 4Y24A 1S0GA 1FPN1 1UW8A 3H3UA 1XOYA 1GLHA 3H1YA 4FPYA 3S30A 1R1A3 4XJAA 3KGZA 3B69A 2BFUL 4AI0A 3VBRA 2DCJA 4D94A 2P6CA 3T0AA 3GHNA 3JXSA 2OQ6A 4DINB 4ES9A 1CIYA 1KEXA 3M3CA 4NIHA 3VBSB 4FT8A 3W9AA 5FY8A 4P14A 1D4M3 1RUI3 3QBQA 2AREA 5KXEA 5FYUA 2C6SA 2QZ3A 2DCZA 2YZ4A 1WBLA 2WT0A 4ORFA 4XQ4A 5EPAA 5JXJA 5FXZA 1W90A 5EQUA 1OOPC 2R0HA 1YO8A 4BQ2A 1UMZA 1DGWX 2I07B 1H4GA 4K8RB 4I30A 3O0WA 2XJRA 3BVCA 4AI3A 5FZAA 3TNPB 5J09A 2AEYA 2EXIA 1DZTA 3MPPG 5C4WA 3ZYJB 1SACA 2W47A 5FY4A 1X8MA 1JZ5A 2XB6C 4RA0A 1LESA 4RD7A 1Q3EA 4JGYB 3WUDA 3ZFGB 1ZREA 2A6WA 5FPVA 2VJXA 1SZBA 4A7ZA 1JI6A 1NXD1 2XJPA 4LQRA 5J96B 1NA1B 1FV3A 1X50A 4GMP3 2E9QA 5ABJA 1RHI3 3VBHB 3SC7X 1W39A 2FDHA 4FOYA 1TZOA 3K51A 2RDQA 1FX5A 3U14A 5JOYA 4A3ZA 1HRV2 3RG0A 3CJIA 1NY72 3OD4A 2GH2A 2R061 4FPGA 3I2DA 2EVXA 3MDPA 4XBQA 2WWUA 4AI9A 4QQ2A 2JG9A 1W9WA 1O59A 4MGKE 3B5LB 5FAXA 2AH2A 4EJRA 2ZHLA 2QQKA 4KL1A 4WVWA 4E8CA 4QAWA 3PL0A 1MVQA 1K42A 4QU1A 4BU2A 1F9KA 5K0UB 1DYKA 2X53S 4MVTA 5JR2A 3KLSA 1QXJA 1PO11 4ASMB 1XNTA 3ZYIB 1PNGA 2D6LX 3CMGA 1FOD1 2K2SA 1J3PA 4J25A 5A6XA 2H6BA 3LD8A 1B35B 2ZAAA 4AFAA 3OYWB 3I3EA 2VECA 4QXHA 3SKVA 4KBZA 3K4DA 4I01A 4PQ9A 4PLNA 2W52A 5DAWA 1RTVA 1UU5A 5FYHA 1FPN3 1ZRFA 3UNPA 1J83A 4QM9A 2BGOA 4WM8B 3DUIA 2XHNA 1UU4A 2E33A 2UURA 1XNAA 3GNEA 4G9SB 4PI2A 2R1DA 3QH7A 5T5PA 4GKXA 2Q1MA 2FDJA 4PIXA 2HYKA 2EIDA 4Y1YA 2WZEA 3KS7A 2RS32 1WZXA 3DYPA 3T0BA 4D69A 4XZUG 1IQDC 5FYVA 5F5QA 1PZ9A 3UJQA 2DU1A 4A3XA 4N43B 4E9KA 1JZ3A 3QOPA 1JN2P 1REFA 3DL3A 1W3XA 3K4AA 3N9OA 5A7NA 3TN93 3S5AA 4QPIC 4R4ZA 1AYN2 2ORZA 1KS5A 5IFTA 1WBFA 2AGSA 1GICA 1NA1A 3NNGA 5L36A 2IUWA 1PGL2 4BXFA 4AQSA 4DUXA 1AF9A 4Q0VA 1YIFA 1MS0A 3O7OA 1BBT1 3ZXKA 1HN1A 5FMOS 5F5CA 5DDJ2 3NAPC 3C7OA 1DGWA 1UXZA 2HWE1 3PU8A 3TB0A 3WSOA 2XBO3 1CJPA 4HPKB 4QXCA 4PQQA 2WFF2 4UBGA 2E26A 4YVWC 3WF3A 5IVJA 2D6KA 1YEWA 1AR71 5CZKA 5C3PA 3CDZB 5J1XA 3IPVA 2CAUA 1YWKA 1HKDA 1UWWA 4K3UA 3M70A 2O0OA 4KMQA 3FBMA 1DF0A 5L9VA 3AMPA 3E97A 4IERA 2E7AA 3WG2A 1SLLA 4Q4W2 4BQ4A 2B9UA 3M8LA 4LOSA 5K0UA 1RINA 5CG8A 4BPZA 5BNOA 1SDDB 2HWF2 2YY1A 2ZKLA 1MEC2 3ZSJA 2CHHA 4A7KA 2VNOA 1JU4A 1MZEA 2FDKA 3AXEA 2MNGA 1VBA3 3R4SA 1L3JA 1V6JA 2ZCWA 2KM2A 3OUIA 2GN7A 2RVAA 2B7YA 4Y4RA 2X05A 3LA3A 4JHTA 4JKMA 3GZAA 3HBZA 4NPRA 5BNNA 2W1UA 2P3JA 1V6MA 1AR81 1VBE3 3CZJA 1STMA 5LEKA 4QU2A 5KHJA 4PI0A 5I8SA 2XJQA 3NKGA 4ITCA 1YC61 2VZ3A 1FMD2 4F83A 2Q1FA 4LXLA 4V1PA 2WJSA 2BNMA 2A73B 2EF6A 4M3CB 2Q1ZB 3KB5A 1T6GC 2GNDA 4BOWA 4N43A 4XBLA 4DEQA 3WDTA 1COV1 5LBEA 4KWUA 1WA6X 4C0HA 1QJU2 5EYXA 4AEJA 1UYYA 1F5FA 3NRUA 4Q0UA 2Q8DA 5T55A 3IDEA 2XVKA 2PAKA 1O8SA 1VBD2 4BK4A 1XXNA 4C91A 1SLIA 1NLSA 3AKPA 2DVBA 3MIGA 4IE4A 4NWVA 2WBKA 5KBFA 4Q27A 5C3SA 3JD72 2ES3A 1CAXA 1RUE2 4CP1A 1O5UA 4UF0B 3J8F1 2PHXA 2A6YA 3HR9A 2A3YA 3DPRC 3PTRB 4LIVA 3OBZA 3LA7A 3PURA 4IEPA 1US2A 3ZXFA 1H8TA 1PIV2 3V0BB 3VKFC 2D7FA 3O1TA 1OA4A 3RWKX 1HXS3 4HG6B 4IGQA 2MHFA 2HEYF 2IXHA 3USSA 2VU9A 4QPGB 2ZGQA 3VLBB 1EAH1 4A4AA 1AR73 4OCTA 3ZR5A 3RQ0A 1ENXA 2YPDA 4X6RB 2LM3A 3WDYA 2JDYA 4P5YA 5FY5A 3UGGA 2CSGA 4OYUA 4ZXEA 3U75A 3BTXA 1APNA 1NQJA 3MBWA 4XVHA 1POV1 3E1F1 3UT0A 4YZ1A 5FXVA 1RUH3 2XUEA 4EN7B 1WW7A 2ZMNA 4YG6A 4DUWA 3HNYM 2AACA 3NV2A 5FJHA 5A7WB 2FCVA 5LEJA 4XMIA 1ND3A 2E53A 2VCAA 1DHKB 2QQWA 2W39A 1UO9A 3CHXA 4MYEA 5FZOA 4R9BA 3T2QA 1CJDA 4OLLA 1PVC3 2ZACA 3THPA 2CGPA 2ZEWA 1HRI2 1T2XA 2ERFA 2R071 2WYSA 4PF5A 4J1WA 2HWD2 5A3NA 4JRLA 3IDBB 4LKSA 5FZGA 3TEZA 4GAZA 4KGGA 3BODA 3NSTA 4IXLA 1AR83 5DZEA 5F5IA 4XJUA 2CTVA 3B3QE 1CONA 3A7QA 3POGA 4DO0A 4RHV1 1VB4A 1G6NA 4GXLA 1CX1A 1BMV1 2XGXA 5IK7A 2KXLA 1S2BA 4OUMA 4QGMA 1XQNA 3ACHA 4PDWB 4P02B 3DCQA 3I2HA 4CU7A 4JTOA 4XF3A 4Q4V2 3PU3A 4EROA 1COV3 1Z78A 4RFRB 1YRZA 3PJQA 4LBQD 2BOIA 1BK0A 2YC0A 1A6CA 1KXGA 3AP4A 5JSRA 2VOKA 1UZWA 3O1OA 4KI5M 1UPSA 1ULGA 2EIEA 3EMRA 4M4PA 2PAMA 4NHKA 3THTA 4UF0A 1AR62 3PNAA 3WVJA 2A71A 3AZVA 1H4HA 2ZGSA 2VMFA 1GZWA 1JYWA 3DGTA 4CRQA 1AZDA 3CF6E 3WCSA 4YZ5A 4XCAA 1O3QA 4B7EA 1PMIA 1J1TA 1EP0A 2RJKA 4UOJA 4FTBA 1QJY2 4QT6A 2UU8A 2VUDA 4GJZA 1KJLA 2F4PA 4AGRA 4YGBA 4XFCA 2A1XA 2VZTA 5E88A 3BYWA 2WSVA 1C8M1 5G05L 3LCPA 3MLJA 1DGRA 2R1BA 4FXKB 2EAAA 2VBDA 1O3RA 4DB5A 1PVXA 4N8MA 2Y6JA 4UI9L 4XTPA 1H1AA 4CDUC 4NE9A 4E27A 4UT5A 2YXSA 3VB9A 2YHJA 1ZBE3 1V9U2 2WRAA 4JVAA 3F95A 4UYBA 5L7OA 3VDDB 1POV3 2DURA 2CDPA 2BU9A 2Y6GA 3T30A 1KRIA 2RS53 4E8DA 5FLIA 4BDVB 1QJEA 4EN6B 1NCRB 3W5MA 3CIHA 4YNIA 3H8XA 1WMEA 5H9RA 2BTVC 1OF4A 3MF9A 4RS5B 2QQJA 4QQOA 2A6XA 2GMPA 4BQWA 1JYIA 3GXUA 3AC0A 1RUC3 2RJ2A 1EV13 2W0XA 3OF1A 5C33A 5HCAA 4Q2FA 3VKOA 1K5MA 4H7LA 2VAUA 5FZ8A 4ZU7A 3PIGA 2CDOA 1UZZA 3MIEA 5GZDA 1OI6A 2DCKA 3I2OA 4Q8KA 4QKNA 1W6QA 1H6XA 5SV5A 2X5IA 3USUB 2PHUA 4DXRA 2PTMA 4CDQC 1LNSA 1S0FA 2QQIA 5FPXA 1WWYA 3PUAA 3U37A 5IAVA 3KGLA 2HWB2 3OB8A 5FZMA 5J36A 3VHNA 2XOMA 1HV1A 4ZU4A 4CDWC 3U11A 4HKLA 4K40A 4B4RA 1WA4A 1UY1A 1UX6A 3KM5A 4YW4A 1DYOA 4AFMA 3S7EA 5FPUA 2RR11 1JZ2A 3M2MA 3N9MA 1JODA 1REEA 4LLOA 5F2WA 1MPXA 4CPBD 5GM0A 1F4AA 2J1EA 3FUOA 3HIFA 1FATA 3WQ1A 3GBFA 1YQ2A 2YFUA 5FV3A 1GZCA 3KT1A 2QQOA 1SPPA 3AMHA 4IDZA 2PA7A 2W46A 2HBTA 3WF4A 4BA6A 1C8M3 1OURA 2V4VA 2J42A 3WEZA 2VOVA 2ZEZA 4Q5OA 1ASJ3 1CAUB 1W6NA 2X29A 2QZ2A 4MGIE 1YFYA 3KMHA 1AUYA 1K3IA 4OI0A 2D3SA 2HEWF 1M06G 2GH8A 5D8AA 4AAXA 1ZRIA 3LPGA 4LTAA 4A6OA 1SG3A 3D8CA 1ZYBA 5FY7A 2ID4A 2D98A 4LBOA 3LWCA 3WQBA 1TMF2 5C9AA 1GU3A 1YNAA 2FD8A 2HBUA 1W2OA 2ZOEB 3O1MA 1HIXA 1YFXA 2CWMA 5DUVA 4B7KA 2P1BA 5C8CB 1GP5A 2Q8OA 4LPLA 2WNUC 4CCEA 3B7MA 1LEDA 2W68A 2VMGA 2VULA 3K4ZA 4E4ZA 2PXJA 2ET1A 3K46A 2YBKA 1PM4A 2WABA 2D6NA 3OUJA 2VM9A 4AI8A 5JSPA 2L9LA 1AX2A 2GNMA 1CIWA 2XLGA 3ILRA 3SH3A 3T2TA 2V5DA 5CU1A 3GJBA 4NIIA 3VBUC 4FAHA 3Q8AA 3ZM8A 4FTSA 1KQRA 3KT7A 4I3PA 4KH9A 4NRMA 5LASA 2ZX3A 2VL4A 1GBGA 1J58A 2O1QA 2YU2A 2JDKA 2ZEYA 2VW1A 4GH4A 4IV1C 4XURA 5A32B 3DEMA 1PMJX 5LA2A 3UV9A 5IVYA 1ZBA1 3MUY1 3PVNA 4I0WB 3ELNA 3R0RA 3V0AA 4OMCA 1H2KA 4XEZA 2CGOA 1HLCA 4CUAA 5BYNA 1EYBA 5A7SA 1B09A 2WL1A 5JVVA 3CO2A 3VBOC 1UY4A 4KU8A 1UD1A 2P3IA 2VW0A 3RZZA 1E5RA 3SH5A 4Z1VA 1OLME 2J1TA 1ZRRA 3WLUA 2DBIA 4ZXKA 2VMCA 4J1XA 2Z5WA 3OSDA 5KC6A 1CAVB 2I2SA 3JZVA 4K8FA 2NLRA 5EZWA 1HRV3 4TWTA 3AZZA 4NO4A 4XXPA 3AJYA 1W6PB 3ILFA 1RUG1 1GMMA 1YFWA 5A3LA 2HH9A 3LDRA 4WM7B 1RXFA 4PIYA 4XUOA 5FOBB 5A70A 1LU2A 1TME1 4QB1A 2VNRA 3L2YA 1C1FA 1O3TA 2JIGA 4IGPA 1HJFA 3EJKA 3H3LA 1UY2A 4W50A 1O6UA 1R092 2J7MA 1XPWA 3SISA 2B4KA 2BVVA 1ND2A 2ZEXA 4MADA 3UKVA 4CP9A 2YC4A 2VNVA 3VD5A 4KGQA 2NP0A 1SFYA 3H42B 1FNZA 2RE9A 1JZ4A 1JW6A 3U78A 2JG8C 3SCGA 4BLJA 1WLDA 4M3CF 3WNMA 5C8CA 1HB4A 2WO3A 3SEEA 4LBLA 3VD9A 4L99A 2DBNA 4AOCA 2QQUA 1OBNA 1OF3A 1W8TA 2X09A 4KQ7A 5GLTA 3THDA 1W8WA 1AXZA 3LPFA 1F4HA 3OD0A 1XC6A 4M0HA 4IW3A 1FMD1 3WZ1A 3LEIA 1JHNA 4QB2A 3UK9A 1VE0A 4YVSB 4B3NA 4P5HA 4JTNA 5FJKA 5FXWA 1BQPA 3WUCA 1U12A 4QDRA 4ONUA 1W6MA 5A33B 5CKQA 2W91A 3FLTA 4BMEA 1PK6C 2RS33 1W2TA 1DDLA 1IQAA 4Y5TA 2HKXA 3HQUA 1QMJA 4YW7A 5AC92 5GZCA 5LRRA 4XETA 1JYXA 1XYOA 1IPKA 3ZSLA 4FFGA 4ASKA 5FOJB 1VBD1 3AL6A 1UOBA 4JV4A 4XUTA 2NYYA 3ILNA 2ORXA 1E57A 5ANQA 1ULPA 1AYN3 2G9ZA 3N9LA 3GBGA 3I3QA 2Y60A 5JZGC 1DLLA 4QQPA 4IGOA 4JGZA 4GQ7A 5CFCB 4Z92B 2GC1A 1UOGA 2EXHA 1CAVA 1J84A 5DDJ3 1JXNA 2D5HA 4JAAA 3QLQA 4OQ9A 2ENRA 1W6PA 1VBB1 2E31A 4AF9A 2ZZQA 4AYUA 2WFF3 1CX4A 1GP4A 1PGSA 1M4WA 1O4ZA 3RS6A 1U5XA 4WVVA 5DN2A 2XXZA 4OHXA 4K9SA 4RGKA 3HT1A 2R042 4P08A 2VO5A 3LFMA 4OI1A 4CEYC 4AEDA 4Q4W3 1BVVA 2EICA 4Q4Y1 5JR7B 4Z2AA 2C9AA 4LIUA 2HWF3 4EV0A 3I3DA 4N53B 1MEC3 2PLV1 3U0ZA 2V73A 2PFWA 2E63A 2C24A 2WN3A 3VBFB 4YARA 1CVNA 2B39A 4NAMA 4AHWA 1RIRA 4U36A 3BALA 3BGAA 4N7IA 2ZBJA 2GP5A 3LIGA 1ZRCA 4CVUA 1Z7S1 5BNPC 4YVSA 1VB2A 5IUQA 3AYEA 1R1A1 4CEWB 5T50A 2DVDA 4NHMA 5C3RA 3ZFFC 3HT2A 5T3NA 2VZSA 1WCUA 1FMD3 5FP7A 5FWEA 1VLNA 5A33A 2BEOA 1V70A 1X8EA 2BGCA 2VVEA 3OEAA 3UKTA 4HBNA 1SCRA 2JB8A 3FFZA 2XR4A 5FO9B 4AVCA 4DY5A 4NUBA 1D4M1 1RUI1 1L7LA 2ZHNA 4QD2A 4ATFA 3ZN6A 3OBAA 3VBRB 5HPOA 5T5JA 1YQ5A 3H50A 1LOFC 4OFGA 1XJAA 2OVUA 4Q4V1 5JOXA 1PX3A 1IPSA 4TLGA 2PN5A 3U1XA 1QJU3 1K12A 3K2OA 1UZYA 1WMFA 4H14A 4HOOA 5F6KA 5FP4A 5CVRA 3MICA 1QQP2 1A34A 4LHNA 3NMBA 1VAVA 1AR61 1VBD3 4HT1T 1Z0HA 4D7TA 1JU3A 1F15A 5DUUA 3WW1A 5JPMB 3JD73 3N35A 1RUE3 1DP0A 1LHOA 4GMP1 1RHI1 1W2NA 3HEIA 3POYA 3PUIA 3LIHA 5KHGA 2V4AA 4QMAA 1QOOA 1SLAA 4O9EA 4GALA 5JMCA 3ACGA 5ISLA 3U4SA 5ABJB 2WZPP 5GKAC 1UL9A 3VDAA 3RZKA 1RJ8A 1PIV3 2W1WA 4JGYC 1RL3A 1AJKA 3MPBA 4MV2A 4CPBA 2JXAA 2MEV2 2FMDA 3CJIB 3OGVA 1IOAA 4H3WA 4N9HA 5FZKA 3VBHC 3AJZA 1DYPA 1QU0A 3WHTA 1XNDA 1WW5A 3LOBA 2ZGMA 4FPKA 4LUMA 2FBEA 2VZVA 1C28A 1V9U1 3B02A 1AXYA 1ODNA 1RGSA 5D1IA 2GNBA 2JG9B 5FLHA 2RS12 4HANA 5LBCA 3CQOA 3OGRA 4HZFA 4Q1PA 2IXJA 1F35A 3W20A 3OPTA 2ZAHA 4C1XA 1C57A 3U07A 1KITA 4CXYA 4ZONA 3OUHA 4AQ6A 3MZHA 2JDZA 4QXKA 4O65A 4XC9A 5I8TA 1HRI3 2VG9A 1S0IA 3OBTA 4QKBA 3BU0A 1Y43B 2HWD3 3OY8A 5JXHA 1UNBA 4OUSA 4AGGA 1Z7S3 2TNFA 5H9QA 1JHJA 4YG3A 4Y4YA 1YI7A 2BQPA 1B35C 2RDNA 2P34A 1VR3A 2BFUS 2HWC2 2Y38A 2D6OX 4JCKA 2F6BA 1GWLA 1LULA 2HEVF 2XVLA 3UL2A 3HVDA 1PGW2 5I0UA 5A1AA 1GP6A 3NNMA 1GANA 4Q4V3 5F39A 4LLFA 4WM8C 1ULOA 4UW5A 3TN91 4FFHA 3I2GA 3VDBA 3NKTA 1WCSA 1IZ3A 4XE9A 1MS3A 5FUNA 1JTZX 2RM22 3AP6A 1WKYA 3D5OA 3M7AA 5HXVA 4IV3A 4EWDA 4BIFA 2VMHA 4IEQA 1AR63 5TSWA 4X6QB 3ZVXA 3BTYA 1IS3A 1J3QA 4O7XA 1XYNA 3E5XA 1A78A 5JZGA 4TSVA 2XBO1 2Z69A 5CIRA 1QJY3 2DTWA 2BGPA 3LE0A 4I2OA 1LGBA 3ON7A 1HB3A 3ZXJA 1C4RA 1QJFA 4PBPA 3LQCA 4QGNA 1XNKA 2TBVA 3KD4A 1H1MA 4YZ2A 1I1EA 3NNJA 3TEWA 1G9FA 3BI3A 4O9GA 4ZY9A 1MS4A 1ZZ6A 2PMWB 4LR4A 3OEBA 1LOBA 3FMGA 1ENSA 4KBBA 3RWNA 5A1LA 1W06A 2BBAA 3IPVB 2W87A 3ZPOA 5FYZA 2DU0A 4WZFA 5DAVA 1KS4A 1V9U3 2CL2A 3ZN5A 2W94A 4MXWA 1XNBA 1TMF1 1ZA4A 3PVOA 1JH5A 1VBA1 3S6PA 5BNOB 2WZR2 4OULA 2B45X 5ANNA 3EHKA 4MZUA 1J3RA 4P9YA 2UYAA 1VBE1 2VQUA 2J1RA 3WOGA 3JB4C 3WCRA 4ZS2A 1MACA 2YFZA 3WNLA 2DVAA 3P3NA 2R16A 4XBNA 4COWA 5BNNB 3LA2A 1H2LA 2XJVA 1XB9A 5FZFA 3QACA 4FPCA 1QNYA 2JE7A 1KJRA 1PZ7A 3AL5A 1HN0A 1Q5OA 5FZ3A 3SHRA 4IEVA 1MQTA 1PX4A 3H8UA 3A0NA 4MX3A 2LW8A 1GNHA 1LOFA 2IXCA 2BRTA 2WT1A 1X9TA 2QNKA 4LK7A 2HWB3 4EN0A 3I49A 4I02A 5FZ7A 2XL9A 2ZGNA 5DAXA 2DYCA 3LSDA 3HJRA 3KF3A 1QJX2 3T0DA 1NT0A 3JQXA 3MEPA 4XW3A 1W8UA 3A4UA 1A8DA 2WNVC 4M4RA 3IN9A 4AK3A 2OUJA 1OLMA 1VRH2 3W21A 4R52A 1AYM2 4LUKA 4OHWA 3ZSEA 1CAXB 1ULEA 1W8ZA 4K6BA 1WCDJ 4GB32 1S0CA 1YHFA 2VQAA 2SLIA 3POWA 3S7IA 1G9CA 1XRUA 2YC2A 1HXS1 1TVGA 2R7EB 1O8PA 2WIIB 4HFSA 3J7MA 4JZRA 2DVGA 1QKQA 3B01A 4UAPA 2YGMA 1H9WA 1UYZA 1H8TB 3KV9A 4CYDA 1O7FA 2OPWA 3VHOA 5C70A 2HLEA 3VKLA 1SBEA 1A8MA 3C8XA 1F2NA 1W2AX 2K0GA 3FHQA 1CAWA 3AVSA 5FCCA 5FKBA 3T1MA 3TEYA 1RUH1 1JOBA 3DV8A 3POSA 4RL7A 4QPGC 2DV9A 3BPSA 4RQPA 3URFA 3DECA 4RR3C 3VZMA 3ZFEA 3AVRA 4CDQA 2VBPA 1TMF3 4X8NA 1EY2A 1PVC1 3SITA 3GCXA 3KV6A 4YLZA 1TNFA 2G19A 1XE0A 3N7LA 1URXA 2GDFA 1ND3B 4BH9A 2JEMA 3FWEA 5FZOB 3C7HA 5G04L 1IGOA 4FVVA 4XILA 5IW0A 3PVEA 4BISA 3T4HB 2GMEA 3JBG2 3IDCB 2WA3A 3EO6A 4MGYE 4R9CA 4M0NA 5IWFA 2YBPA 3P6BA 4RGAA 3VGIA 1OPOA 4NMIA 1C3HA 2XONA 4MHRA 4A45A 5LCWL 3HAGA 4FQ4A 1S0DA 4LBKA 1BKZA 4LORA 1LGNA 2Z2SB 1OLRA 1H2NA 1QXRA 2JD9A 1F8VA 2GALA 1IKPA 5A3MA 4AE2A 2PELA 4Y1XA 2VPVA 5A3UA 1OC1A 2QBXA 1OOPA 2XVGA 2IC1A 1OKQA 5FPLA 4CDXC 3LOIA 3I7DA 4L0PA 4PDWC 1W05A 5A7OA 1YQCA 3N9NA 4R4XA 4QKDA 1GKBA 3ACFA 2BJSA 3ATGA 3DKWA 3WF1A 1SBDA 2VUJA 3PUSA 2B5HA 4E2SA 1GZWB 1W04A 5FYMA 4F3JA 3VV1A 4S2GA 2WYFA 4OHYA 4MHUA 2BWAA 1ZA7A 2VTFA 3HNMA 3B9IA 4CA9A 2C4XA 2R041 2WFPA 4HVOA 3A23A 3D0SA 4XFGA 5EIYB 3JCIA 1RUF2 5HV0A 4CCKA 1R093 4H7MA 2XLFA 2JIJA 3SXWA 1LB2A 1RXGA 1ZBE1 2QUOA 3HQXA 4HVQA 1CESA 2JJ6A 2QTWB 5DZFA 1VBC2 5C8WA 1SCSA 5C7GA 2BNOA 1ZZCA 1OMIA 4OHVA 2ZX4A 2RS51 2PYTA 2KR2A 4PF1A 5L7OB 4FFIA 4BXSV 2ZKNA 4QX0A 1PZ8A 4XAEA 3IZOA 4M00A 3K3OA 2D6MA 5CA6A 5KHIA 4JKLA 3EXUA 4MSVA 3VDDC 2ZTNA 1GZ9A 1OUXA 1RUC1 2OT7A 2PHWA 4XQDA 5ACA2 3RJ2X 1EV11 4XCBA 2J1UA 1MS5A 3ECQA 4HXCA 2BPA2 1NCRC 3VL8A 3WP6A 1S4CA 2WAAA 3V65A 4L2NA 4ISQA 1H30A 4OMDA 5CFDC 4XF0A 1POQA 1JYTA 4DXSA 4RS5C 1X9PA 4NVPA 4Y20B 1VJ2A 4YM0A 1K5MB 3ZO0B 3ZYFA 5FZ4A 2VCBA 2P2KA 2Q30A 4AI2A 5AC93 2Y33A 3N9PA 5FY9A 2P4EA 4N7UA 3WW4A 1GUIA 1D0GA 3IKWA 4P9WA 3RI8A 2FDFA 3D82A 1W6QB 1H2MA 2E32A 3WG1A 3S57A 2X5IB 3RSJA 3MIBA 2Y6HA 1O91A 5EJZB 4AQTA 3PMEA 3V56A 1RMU2 5HXMA 2XJSA 1ZVFA 2VXRA 4HK8A 5CEHA 1PO22 4QPIA 1D2SA 2JWPA 1QY4A 2BNNA 4LHSA 1JBCA 4HL0A 5FPAA 1IKQA 1JZ7A 2W5FA 2WNVA 3S0MA 2FZ2A 2J1VA 1NZCA 2JDAA 4IESA 1CQ9A 3NAPA 4YZ3A 3RNSA 3VZOA 4E4HA 4CU9A 2MEV1 3LEGA 2CNAA 2Q5TA 4NJ4A 1D0HA 3X29B 1KD7A 3DPRB 1ASJ1 4NIDA 4YVWA 3BIWE 1SPPB 5DG1A 2R043 1LAJA 2G9FA 4XIKA 2VE1A 4Q4X2 3AXDA 3IIIA 1J59A 3N7JA 4TYSA 1QHDA 3WP4A 1HW5A 1VMHA 2R6QA 1QDCA 2VNGA 1E5IA 3LSEA 2YYOA 1W6NB 1LR5A 2QVSB 3FLRA 5T54A 3ZDVA 5LA9A 4D6SA 3AMMA 3KHCA 3D6EA 2QFEA 1DZQA 3BN6A 1OUSA 2ZHKA 5DQ0A 2Y64A 1JUIA 4EE2A 3SCHA 5D8AB 3Q8BA 4ATEA 3MW4A 2R49A 1O5LA 5FYSA 2ZX2A 5C9AB 4O61A 1FI2A 1I9RA 1VP6A 5C3OA 1U5YA 4DRVA 4S2HA 3ASIA 2WUHA 4FPJA 4FP2A 4OUEA 3RZMA 5J7MA 1V6OA 4G4FA 5EJ3A 1QF3A 2HWC1 2W3JA 4HONA 4IEYA 1OLQA 2WKKA 4LKEA 4Y20A 4KWKA 4MUVA 2Q8EA 4BQYA 5HCHA 1GQHA 4CCNA 5JPNB 3FZ3A 2GC0A 2XHKA 1YIPA 2HJIA 5J37A 1CD3G 1G8WA 2IFRA 4CCJA 4B4PA 1RUJ2 3AYAA 1NE6A 4JRAA 4L11A 1QQP3 5LATA 5FYCA 1TG7A 2XQXA 4GH4B 4QX8A 4XDQA 4XUQA 3RFRA 4LJHA 2IFWA 1WMDA 2SBAA 1DGLA 2GNTA 3AB0A 1J1LA 2UWCA 3V0AB 2BZDA 1MS8A 3UYJA 3WHUA 4N9IA 1DG6A 3FC0A 4QKFA 3I3BA 5KR7A 5CG9A 2ZMLA 4YW1A 1HRV1 1BVP1 1UKGA 1EUTA 4TTGA 1OA3A 1NY71 3ACIA 3I8TA 4LO6B 2K9ZA 4OZOA 3WD5A 2VY0A 4OVEA 4XJ9A 3DPRA 1G9AA 4MGTA 3B93A 4EQVA 2LTNA 1ZM1A 2MEV3 1REDA 1C5HA 3ZKUA 5IK5A 2XG3A 3WV6A 5GLZA 2JENA 3NJVA 5F1RA 3ITQA 3VL9A 4FPFA 5JXIA 3WF2A 5C6CA 1UXXX 2RS13 5FO7B 1H6YA 4AFBA 1ULFA 2VD7A 3LDBA 2CWSA 2Z42A 3K75B 4WM7C 3HOBA 1ND2B 1XU2A 4CP9B 4AEMA 2QE3A 2UY9A 2RDSA 1GNZA 2VMIA 1R082 4XUPA 5F5AA 4ZU5A 4X8PA 4DMIA 5JUVA 2P17A 2D44A 2A3XA 4NIGA 2W95A 4S2DA 4XZPA 5FDBA 2H6CA 1NOVA 4QPWA 4LO7A 2ARBA 1DCSA 4TN7A 3ME2A 4KNCA 5I91A 2R062 4C0BA 4PLMA 1OQ1A 1Q8QA 1VAMA 1NUKA 3P1IA 4KG8A 3RYRA 2FZ1A 2EA7A 2ZGLA 2AEZA 5AVAA 4Y22A 5A3TA 3ZKYA 2UWAA 5LBFA 1YFUA 1QOSA 3MFAA 5A3OA 2ZGUA 4LHLA 2BOJA 5LK5A 4BQ3A 2HWC3 4Z8BA 2Y0IA 3AMNA 4NHLA 3ZXDA 1N1YA 1US3A 3VD3A 2G1MA 1W9FA 2DUPA 2RS31 5I0SA 4LT5A 5A6QA 4AVAA 1F31A 1W03A 5HBAA 4HMZA 1W6MB 1ULCA 5CFDA 4F8AA 1Y9QA 2P3KA 4IE6A 2WLPA 1PO12 1OKOA 2ET7A 3I59A 1JOJA 5FZEA 1FOD2 2QJVA 2YDEA 4YYOA 2ARAA 2VUCA 3LEMA 1AYN1 2RM23 3HN3A 3TWIA 3IMMA 4AQ2A 4BK5A 3J4UH 1PGL1 3NJZA 4YM2A 2ZGTA 5FXXA 4LO4B 3A21A 4N90A 1D7PM 2R0FA 3O14A 4MO3M 1VRH1 5DDJ1 3W5NA 3O1VA 4BQXA 4BCUA 2G9GA 4ZZ5A 3O1SA 4JGZB 2W92A 4BYYA 1QEXA 3GZEA 5FK7A 2WFF1 4YGDA 2OUHA 2VVDA 4CDWB 1KDKA 5CFCC 2JDHA 2IZWA 3VD7A 4GJYA 5FPZA 3WW2A 4UFLA 5FTTC 4INDA 4WVZA 3IB3A 3MYXA 4Q4W1 4FBFA 2YU1A 3CKHA 1NCQC 5DMYA 3J9SA 3AP9A 5FMBA 2HWF1 1IPJA 1XE7A 2B46X 3N3HA 4URAA 1MEC1 1W0OA 4EWEA 2RMU2 2AC1A 4KU7A 3TOJA 1O3SA 2KA3A 4AEDB 1BBT2 2F17A 4XF9A 4CDUA 1R64A 3C7EA 5FQ0B 1RUNA 2WZR3 2NQYA 2HWE2 1MS1A 1LECA 2ARXA 1V00A 2RG4A 2OX0A 3T1LA 3TNQA 3WQ7A 3G6JB 1S2KA 3PMSA 2FHRA 1G86A 1OA2A 1OQDA 2BERA 3KCCA 4IEXA 4N53C 4XFBA 2IXLA 3WNOA 3ZIXA 1RB8G 3OGGA 5A6YA 4FOQA 3VBFC 4BIOA 1UZVA 2ADEA 1TE1B 4CCMA 2Q4SA 4DFSA 2RV9A 3AX4A 2Y8KA 3F2ZA 5FP8A 3ABZA 3POIA 3GZTB 2WAOA 3ZSKA 1AL22 3IDAA 3NNFA 1GZTA 4CEWC 3RZGA 3R6SA 3KV5A 1QJU1 2YB7A 1LENA 1SLCA 5FLJA 3ZN6B 3AKQA 3ZX7A 4AW7A 4CUGA 4DXZA 4EN8B 4FTEA 2D6PA 5FYIA 1RUD2 4I0AA 3QCWA 3RRDA 3MIFA 3VBUB 4AHZA 3VBRC 1UF2C 3BTAA 3D3AA 1UAIA 3E5UA 1OFNA 3JD71 1MZ6A 1IG0A 2OS2A 3KF5A 4ISRA 5FRAA 1RUE1 3ZXAC 1QJX3 4CSWA 5A1FA 2QQLA 3ZYGA 1IS5A 1SBFA 4LBQA 5EJ1B 5T52A 2ADDA 3RJRA 3DYOA 1NYWA 2UWBA 3BOWA 1VRH3 4XHBA 4CDWA 5LA1A 1AYM3 1GSLA 2VOWA 1DLCA 1SFPA 4LNVA 4GB33 4IUGA 1NE4A 1PIV1 2W2IA 5FZDA 2JDMA 2D3PA 2Y34A 4EZHA 2ZA9A 3HMYA 1LRHA 3FBYA 4PT6A 2DF7A 3NV1A 4DPNA 3H0OA 3I2IA 5C4WC 1Q8PA 2AUYA 1UMIA 3MO4A 1ENQA 1RYYA 2PHTA 2VH9A 2VZ1A 4GA9A 5KHHA 2VMDA 4HK9A 2YROA 2IXIA 5ABJC 1YXWA 1QIQA 1I6XA 2IXKA 3N7MA 2NMNA 4XDOA 1W9TA 1ZX5A 4UFIA 5F6LB 3IT8A 3ZDSA 4D3WA 4E2GA 5FQ0A 2XMLA 1QGLA 5EWSA 3CNAA 3C7GA 3ACLA 5E1RA 3CJIC 1I5PA 3J8F2 5LZ6A 3M3OA 4UW6A 1D4VB 2D97A 3KQRA 4AHXA 5K8SA 2P37A 3NWKA 1HRI1 3DXUA 2GAUA 2JG9C 4YW6A 3PUQA 2HWD1 2W08A 2GC3A 4UW4A 5K9YA 3CBNA 4COYA 2WR9A 1WLTA 3LZZA 3SEPA 4AR2A 3AP7A 3HQRA 3R4UA 2CAVA 4IE7A 1EAH2 1MR5A 2NM1A 2C26A 3OY8B 5FY0A 2WNEA 1YCIA 2WNUA 3JBG3 2XJTA 3R05A 3OGSA 4HKWA 3OG2A 3AZYA 1S0EA 3D0JA 5IK8A 5AFBA 1V6KA 2ETEA 3TBDA 2ZS6B 3GCWA 4FOWA 4B8EA 4YW5A 5FYBA 1E5SA 5LWBA 3O0VA 3VBUA 1UIKA 4CCDA 5DUWA 4EN9B 5GLUA 5JLVA 4ASLA 3VBSC 1VIWB 2YV8A 3OBRA 2Z79A 4QXBA 4IV1A 2R072 4IETA 4A2UA 2WN2A 4XQWA 5GLVA 3RI9A 2GP3A 3ZXEA 4GWIA 4M3CE 5EYYA 2QQMA 4IV3B 1UX7A 2CV6A 4YWAA 4D6RA 4Q8LA 2VZUA 1QJY1 1ACCA 1HB2A 3FX3A 4RHV2 3MFCA 5ERLA 2VCCA 1XSRA 5BPXA 3VBOA 2HYXA 2QQNA 1AX1A 5JZGB 1BMV2 5FP3A 2XDVA 2VVFA 2TUNA 2FCUA 2X8KA 3ZFGC 3HWJA 4IEUA 3GHMA 1F5JA 5F3CA 1NA1C 5CYYA 4LITA 3E6BA 3PVBB 5F8PA 5IVEA 3A22A 4FPOB 4Y33A 5FZIA 1UU6A 1X7NA 1ZZ7A 1RUF3 1W6OA 2PQSA 3O5SA 3AZXA 4NR1A 4ZKTB 2ZHMA 5KWRA 5JDBA 1LOGA 4Q1RA 1N47A 2C9KA 1VPHA 2E51A 4XPVA 1VBC3 1FAYA 3ETPA 3NW4A 4CU6A 1WW6A 4URTA 4XF1A 1IS4A 4NOTA 5FZHA 1QNWA 2W1SA 5E89A 2EIGA 3SH4A 3I3MA 1NX9A 3J7LA 4HVRA 2LRPA 3CEWA 5D21A 5J48A 4MXWB 3POBA 4Y1ZA 3RZJA 4PBOA 2D5FA 4V2VA 5FZ9A 2JG8A 2WO1A 4TZDA 5IVCA 2B42B 3I4IA 5K0UC 3GDBA 4SLIA 3WDVA 3H3ZA 5ACA3 4ARXA 5BNOC 4Y1VA 3KCYA 4JDMA 1WCKA 4I0BA 1DQ2A 1MS9A 1NXMA 5EP9A 3O1UA 4FQZA 4ET7A 2XH6A 1WUVA 1Y9MA 5J3UA 4YFZA 4E2QA 5FBJA 1GFF2 3VZLA 5JOZA 3WX5A 1JZ6A 5D2AA 4D8MA 5F2SA 1XSQA 5JOWA 5F3IA 1FXZA 4P9LA 3GZUC 1EPWA 3H1MA 2N7GA 3GM8A 4W4ZA 5BNNC 3BB6A 4QX1A 3JUUA 5FZ6A 5B4NA 2HWB1 1MQTB 1HQNA 3PUHA 4WV8A 1PK6A 4CCLA 3MW2A 3ZYHA 1RITA 4LBJA 3ZLIA 4GD4A 1RMU3 3BOPA 4V2WA 4CU8A 1LEMA 1W8NA 3P3PA 2ZGOA 3R4DB 5L19A 1PO23 1GOHA 2CY6A 3WDWA 4N43C 1CZTA 4UWDA 4NPLA 3SLIA 4OQ8A 1MVEA 5CBLA 1PNFA 1K45A 3WG4A 3WNNA 3BU7A 1ZZBA 3K3NA 1JMUB 1BXHA 3TEXA 2WWJA 1LOAA 4LE3A 3UGFA 3E6CC 1CR7A 1N3OA 4FOVA
chains in the Genus database with same CATH topology
5DXDA 3ALQA 3QH6A 2UY8A 3N4MA 1UCXA 3MLLA 2CGNA 2LALA 1W0PA 4Q4X3 4UBHA 1QXPA 1MZFA 3C2UA 1N3QA 4HSJA 3WP5A 2A5ZA 4FAGA 1CAWB 1H8TC 1LKNA 2JD4A 4CEYA 2WT2A 2RR12 4S2FA 1R081 2RJLA 2GMMA 3WXPA 3B94A 2BWCA 3ETQA 4RQPB 1ZZ9A 3ZFEB 3ZN4A 2PQQA 2ZX1A 1OPMA 1AJOA 3MLKA 1UN1A 3EBRA 2NN8A 1HX6A 3LAGA 5BNPA 1HQWA 3M3EA 1ND3C 2WQ4A 3ZFFA 2OPKA 4QQLA 4HLTA 4CP0A 4QQHA 5BY5A 4W65A 3OPZA 1BK1A 1RUJ3 5JCTA 4Q0QA 3FJSA 5KXDA 2WA4A 1IHMA 1N3PA 1C1LA 1EPZA 1ZZ8A 1Y3TA 4U2AA 1LHWA 1TNRA 5H9SA 1DBNA 3VBSA 1OOPB 4K1ZA 3J26N 3ZIWA 1H8VA 1X36A 1RVF2 3VN4A 5K7PA 4JC1A 4MLOA 1BEV2 2DCYA 4Q0PA 5AFEA 5E8AA 3TRSB 2GSYA 3SMHA 4SBVA 1VAKA 3ZFGA 4JGYA 1ZBA2 3AKRA 1R091 3PHMA 2JECA 2RMU1 2OZJA 5JIAA 5FMOL 3VBHA 1YYNA 4IEOA 4JDOA 4I3GA 5JSOA 1RUOA 5GZFA 1V6NA 5H9PA 5KHKA 1R083 2NZ9A 1SMVA 3DN7A 2XKPA 5GALA 5CAZA 2DUOA 2QQPA 2R063 4FPLA 1RUG2 4AVTA 3OTFA 1Q8OA 5L7OC 4KWLA 1TME2 4KG0A 4DOUA 4DQAA 1GV9A 2ZGKA 3V64A 1AL21 3AFKA 3Q9OA 4LULA 5I8YA 3MW3A 5AC91 1B35A 4YFWA 1CPNA 4KWJA 4XOGA 2LUWA 3VHRA 3OYWA 1RUD1 1PO13 4FPHA 1FOD3 1Q56A 4DY3A 1SDWA 1AR92 4TLFA 5GZGA 5L73A 4Q26A 1K5MC 1W2UA 4FCAA 1FV2A 4WM8A 5BUVA 1R1ZA 3WW3A 1XU1A 3ZPYA 4FP3A 4P9IA 2H0BA 1HQLA 3I54A 3UKNA 3VZJA 2X5IC 3WQ0A 2H0VA 4YGCA 2C0ZA 4QPIB 2VQ0A 3KSCA 4BQ1A 4XFAA 3M4FA 3NL1A 4PCRA 2WNVB 2EXKA 4I09A 1LHNA 2WS92 3SNMA 3NAPB 3IM0A 1YUDA 4IL7A 5I0TA 3ROUA 1DZRA 2D43A 1LHVA 1SEFA 4YVWB 2R30A 3WY6A 4LO8A 4HPKA 3PTYA 2RMU3 5GJ6A 1RJ7A 4XMAA 2DFCA 2G4IA 1BBT3 4LO5B 5CADA 3GF6A 1LOCA 2HWE3 1SLTA 3JQWA 2OA2A 3ES4A 3CL1A 4J6GA 1VBB2 5BXXA 2UYBA 3KZ4C 4AEKA 3AYDA 3AP5A 4GKYA 3FUQA 3NVCA 4RR3B 2E7QA 3HD8B 5FBZA 1Y7BA 5D8AC 4PJYA 1O4TA 3VKMA 2D93A 2E6VA 3WT3A 2CYFA 1LHUA 4Q4Y2 2V09A 4QGLA 4WVMB 2DCTA 4XYXA 3SCFA 3MF6A 1AL23 1SFNA 2QCSB 3W58A 3ZXGA 4L97A 2ZGRA 3L2HA 3N36A 2PLV2 1ZNPA 1G9BA 4BMBA 1QH7A 4DS0A 1QQP1 1RUD3 2EXJA 2R32A 4NWWA 3ZMOA 4IEWA 3MIDA 4WZCA 1V6LA 5JI9A 1Z7S2 1LU1A 1R1A2 1XNCA 3GALA 1S55A 4M3CA 3WG3A 1YJLA 2BYVE 1JUHA 4GH4C 4YRDA 1OFSA 2RHPA 1D4M2 1RUI2 4CDXB 1D2QA 1WW4A 4HN1A 3H9AA 4OI2A 2ZJCA 4B29A 4RGGA 4D7SA 4UW3A 4P9XA 1CGPA 3AYCA 3RYKA 2JE9A 5LRSA 1LCLA 4GMP0 1DGRN 1N1VA 2RS11 2A3WA 5FO8B 1H1IA 3JB8A 3KT4A 4L8QA 2V5YA 2XWBB 2Q0AA 3CU7A 4H55A 3J8F3 1RHI2 4W6YA 3V0BA 2ZZJA 1AVBA 1KFUL 2PHFA 4QPGA 1RC6A 4RR3A 5HCBA 2WWSA 3GYDA 1ND2C 4QPYA 1G9DA 2OW4A 1EAH3 3AK0A 3NV3A 4W6XA 3B00A 4WVMA 3FE5A 2A6VA 4YSFA 5C8CC 4LA3A 1PGW1 4Y22B 4K7JA 3TYJA 4R9AA 1GQGA 1I3HA 2AENA 5F9TA 2XPJA 5JWPA 1CN1A 3H1WA 4GWNA 3MI8A 4AFCA 5IK4A 5FFOC 2VOXA 1UIJA 5EV7A 2RM21 3NV4A 5CFDB 5DG2A 4BWOA 3L9JT 4YM3A 3I59B 2R073 4COZA 4PLOA 1DFQA 3WP3A 4OHZA 1FPN2 3H7YA 2XUMA 5I93A 4XJZA 4CDXA 2GN3A 4PDWA 4RHV3 1NG0A 1S1AA 3E6DA 3INAA 3IIAA 4E4SA 2QDRA 4LA2A 4AGVA 3CJXA 4HN0A 1ENRA 3E5QA 2A70A 5KC5A 1FYUA 2AZ5A 5BV6A 3VZKA 1DQ6A 2FQPA 4JGZC 3TN92 2GU9A 1YI9A 4Y26A 2XKOA 2QDNA 4XXAA 4M01A 3WR0A 2GZWA 4YG0A 4RSUA 1WLWA 1DIWA 3RYPA 3OCPA 1WLCA 3A0KA 2IWGB 2WZR1 2ZABA 1TEIA 2XBO2 1DQ5A 2B8MA 3RMXA 4GIQA 3ZMNA 1QDOA 5CNAA 4CDUB 4GWMA 2I74A 1C5IA 1SQ4A 4AEDC 2Y0OA 3AKSA 1AXKA 4YZ4A 2GC2A 3VDDA 3RDIA 1AL0G 4A7YA 5DZGA 5B2GB 1NCRA 3H7JA 4C90A 5GLWA 2XJUA 3AMQA 3BCWA 1HDKA 2PHDA 4YM1A 4YVSC 1VBA2 4RS5A 3B9CA 1OHFA 4G3YC 3AFGA 2A7AA 1QJX1 1VBE2 2AYHA 2ZPXA 4FO9A 4AXOA 1BJQA 1XE8A 4NN0A 3ZXLA 3HN1A 3U4XA 4CDQB 1AYM1 5AVPA 1WGPA 3WDXA 4Z82A 3USUA 1RVF1 4IEZA 4GB31 1GR3A 4LBQB 1LODA 5EXOA 4YW3A 2OYZA 5IT6A 1BEV1 3MGUA 3GBWA 3KCXA 3WINE 1FNYA 2YUEA 3AZWA 2DUQA 4L9BA 4FPEA 5HI0A 3OGJA 1C8NA 1KFXL 1ONAA 2EAKA 4XFIA 4LE4A 4Z2WA 5JAXA 3MIHA 4Z07A 3ZSMA 4EWAA 1NQDA 5C9AC 3PLQA 2ZX0A 4QHBA 2JICA 3K48A 1LTEA 4UXAA 2C1FA 2ZGPA 4JQRA 3LKJA 3UJOA 5GZEA 2WLQA 4RFT0 1O4YA 3C3VA 2BUKA 2RR13 3VKNA 4COVA 4AVBA 2VGDA 4AG4A 1TQ5A 2VW2A 4OZXA 4QM8A 1HXS2 1CAUA 1Q43A 2ATFA 1PM7A 4LBNA 3U10A 4MH0E 1AR72 4MXVA 1ALYA 2OIIA 3PJYA 5LK7B 2ILMA 2PAEA 3JBG1 1U0AA 1QOTA 1ULDA 1YJKA 3EQEA 4K1YA 1FT9A 3OJBA 4P9GA 1U5ZA 4IQPA 4C1WA 1QJZA 1RUH2 2A75A 2WNUB 4QX5A 2YGLA 5SV8A 2D40A 4ES8A 2JX9A 4CP2A 1AR91 1VALA 3IBMA 2WINB 1PVC2 3NO8A 4F7ZA 4HETA 1KDMA 1LOEA 1AHSA 1PHMA 2WSUA 1CPMA 3IWZA 3LB9A 2WC2A 3M3IA 1DU3D 1LJ7A 1N1TA 4JDNA 1AR82 2WQZC 2XWJB 4R9DA 4B4QA 4IV1B 3FHIB 1A3KA 3RPQA 4XFHA 4XHXA 1SLBA 5A32A 3N7KA 3W59A 1RVF3 3AM2A 3ES1A 1H9PA 4K20A 3IMNA 4Y1UA 4OI4A 1BEV3 2AR6A 2WS91 4FSJA 3FFQA 4IV3C 1OD5A 3VBOB 1COV2 5CB7A 2OZ6A 5JIUA 4AWDA 1UPIA 1RUF1 1JYCA 2I45A 1ZBA3 1I5ZA 1ZRDA 4XJ8A 2XLAA 1VBC1 4BE3A 1W6OB 2EALA 1QH6A 1WD4A 3JU9A 4MGZE 1YLLA 1X82A 3DF0A 4L92A 2YPJA 3O0XA 3WNXA 3ST7A 1MZ5A 1NCQB 2E7TA 2DTYA 4WM7A 1UKRA 3M3QA 5I0RA 5KXCA 1HV0A 2O8OA 5ACA1 1WD3A 1RUG3 3AKTA 1NLRA 5FREA 1Q8SA 4DNYA 1N1SA 4AI1A 2JG8B 1POV0 1TME3 5JI7A 5KXBA 4META 5E16A 4FXGB 4AVSA 3VUOA 1LGCA 1BZWA 1ZBE2 2ZMKA 4XF4A 2RS52 4CTEA 1DQ1A 4K21A 1AR93 4P9JA 1RMU1 2VUAA 1H0BA 5DUXA 4HKOA 1PK6B 1PO21 3O12A 1RUC2 2NMOA 4PIZA 2O8QA 3TAYA 1U5IA 5T5OA 1EV12 1X33A 1OQEA 5BNQA 1MQTC 2C5DA 4R8HA 4E4DX 1S0JA 4LEJA 3D4KA 1OSGA 2DWRA 2FMYA 4Q29A 4DZGA 4CZSA 5J98B 2QKDA 4D7YA 2WS93 4W6WA 4LHKA 1DQ4A 4HSLA 1XYPA 5T5LA 1G7YA 5CFCA 3QD6A 2DFBA 4Q4X1 2BW8A 4DRRA 2DVFA 3FLPA 3APBA 4GULA 5C4WB 2NPIA 3RMYA 4XTMA 1NCQA 1V6IA 3LGRA 2A6ZA 2Y26A 3WDUA 1DQ0A 4CEYB 2TEPA 2PHLA 4AFDA 3ZYRA 1VBB3 1BYHA 4AHYA 4YGEA 3CLPA 2D3RA 1AX0A 4LBMA 1C8M2 3M1HA 1Q8VA 1S0BA 2BVBA 2PHRA 1ASJ2 4WBBA 4N53A 1QWRA 4RQPC 4Y5Z0 4AVVA 4XFFA 3ZFEC 3G7DA 2JKBA 3VBFA 4Q4Y3 4BLIA 5BNPB 4Q0SA 4BHPA 4COUA 2PLV3 1RUJ1 1IS6A 3ZFFB 4YW2A 4BM8A 2YMZA 3ENRA 1GYKA 1BCXA 2BBVA 4XIOA 4XJWA 3ZYPA 2MPFA 4CEWA 3VZNA 5HCFA 2XL7A 5EFUA 4BZ4A 3BPZA 4Y24A 1S0GA 1FPN1 1UW8A 3H3UA 1GLHA 3H1YA 4FPYA 3S30A 1R1A3 4XJAA 3KGZA 3B69A 2BFUL 4AI0A 3VBRA 2DCJA 4D94A 3GHNA 4ES9A 4DINB 3M3CA 3VBSB 4FT8A 3W9AA 4P14A 1D4M3 1RUI3 3QBQA 2AREA 5KXEA 2QZ3A 2DCZA 2YZ4A 1WBLA 2WT0A 4ORFA 4XQ4A 1OOPC 2R0HA 1YO8A 1UMZA 1DGWX 2I07B 1H4GA 4I30A 3O0WA 2XJRA 4AI3A 3TNPB 5J09A 2EXIA 1DZTA 3MPPG 5C4WA 3ZYJB 1SACA 1X8MA 2XB6C 4RA0A 1LESA 4RD7A 1Q3EA 4JGYB 3WUDA 3ZFGB 1ZREA 2A6WA 4A7ZA 1NXD1 2XJPA 5J96B 1NA1B 1FV3A 1X50A 4GMP3 2E9QA 5ABJA 1RHI3 3VBHB 1W39A 4FOYA 3K51A 1FX5A 5JOYA 1HRV2 3RG0A 3CJIA 1NY72 3OD4A 2GH2A 2R061 4FPGA 3I2DA 2EVXA 3MDPA 4XBQA 4QQ2A 2JG9A 4MGKE 3B5LB 5FAXA 2AH2A 4EJRA 2ZHLA 4WVWA 4KL1A 1MVQA 1F9KA 5K0UB 1DYKA 2X53S 4MVTA 3KLSA 1QXJA 1PO11 4ASMB 3ZYIB 1PNGA 2D6LX 1FOD1 2K2SA 1J3PA 2H6BA 1B35B 2ZAAA 3OYWB 2VECA 4I01A 4PQ9A 4PLNA 2W52A 1RTVA 1UU5A 1FPN3 1ZRFA 4QM9A 4WM8B 3DUIA 3GNEA 1UU4A 2UURA 4G9SB 2R1DA 3QH7A 5T5PA 4GKXA 2Q1MA 4PIXA 2HYKA 4Y1YA 3KS7A 2RS32 4D69A 5F5QA 1PZ9A 3UJQA 2DU1A 4A3XA 4N43B 4E9KA 3QOPA 1JN2P 1REFA 3DL3A 3TN93 4QPIC 4R4ZA 1AYN2 1KS5A 1WBFA 2AGSA 1GICA 1NA1A 5L36A 1PGL2 4AQSA 1AF9A 4Q0VA 1YIFA 1MS0A 3O7OA 1BBT1 3ZXKA 5FMOS 5DDJ2 3NAPC 1DGWA 2HWE1 3TB0A 2XBO3 1CJPA 4HPKB 2WFF2 4UBGA 4YVWC 2D6KA 1AR71 3IPVA 1YWKA 1HKDA 2CAUA 4K3UA 3M70A 2O0OA 3FBMA 1DF0A 3AMPA 3E97A 4IERA 2E7AA 3WG2A 1SLLA 4Q4W2 2B9UA 3M8LA 5K0UA 1RINA 5CG8A 4BPZA 5BNOA 2HWF2 2YY1A 2ZKLA 1MEC2 3ZSJA 4A7KA 2VNOA 1MZEA 3AXEA 2MNGA 1VBA3 3R4SA 1L3JA 1V6JA 2ZCWA 2KM2A 2GN7A 2B7YA 3LA3A 3GZAA 3HBZA 4NPRA 5BNNA 2P3JA 1V6MA 1AR81 1VBE3 5LEKA 4QU2A 5KHJA 5I8SA 2XJQA 3NKGA 4ITCA 1FMD2 4F83A 4V1PA 2WJSA 2BNMA 2A73B 2EF6A 4M3CB 2Q1ZB 3KB5A 1T6GC 2GNDA 4BOWA 4N43A 4XBLA 3WDTA 1COV1 4C0HA 1QJU2 5EYXA 4AEJA 1F5FA 4Q0UA 5T55A 3IDEA 2XVKA 2PAKA 1VBD2 1XXNA 4C91A 1SLIA 1NLSA 3AKPA 2DVBA 3MIGA 4NWVA 5KBFA 4Q27A 3JD72 2ES3A 1CAXA 1RUE2 4CP1A 1O5UA 3J8F1 2PHXA 2A6YA 3HR9A 2A3YA 3DPRC 3LA7A 4IEPA 3ZXFA 1H8TA 1PIV2 3V0BB 3VKFC 2D7FA 1OA4A 3USSA 1HXS3 3VLBB 2MHFA 2HEYF 2IXHA 2VU9A 4QPGB 2ZGQA 1EAH1 1AR73 3RQ0A 1ENXA 4X6RB 2LM3A 3WDYA 1APNA 1NQJA 1POV1 4