4Q97A

Ignar antibody domain c1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
SHMGIPPSPPIVSLLHSATEEQRANRFVQLVCLISGYYPENIAVSWQKNTKTITSGFATTSPVKTSSNDFSCASLLKVPLQEWSRGSVYSCQVSHSATSSNQRKEIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Novel antigen receptor
publication title The structural analysis of shark IgNAR antibodies reveals evolutionary principles of immunoglobulins.
pubmed doi rcsb
source organism Ginglymostoma cirratum
total genus 18
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4q97A00
3WFBH 4XAWL 3PIQB 2DQFB 4IBLT 3D69B 1IGIH 2ATPB 1N26A 5D7IE 4XCFH 1JPTH 4LSUL 4UBDD 2P47B 2D7TL 1QSFE 3KLDA 3QUYC 5DUPL 5E00B 5ESVA 2B7DT 1FG2A 1BZQK 5F3BB 3VW3L 1R6VA 4NQCD 2AK1H 1LILA 4JGMA 2ESVA 1V3MA 2H26A 2AS5M 5DEGA 3U6RA 4LP5A 5HHPA 2EIBA 2BHZA 4M7ZC 4YEEA 3FJTA 2QHRL 3EOAA 4IRJA 2XWJB 5D7IA 2OK0L 4IOIB 1QSFA 5E94B 5CKAA 3SKOB 5DUMH 2VXQL 3QXUA 2VLKB 4Z7VB 2RFXA 5C0CD 2XN9D 4POZC 2VZ1A 4NQTA 3Q3GA 4WEMB 3L3IA 3JWOC 1WT5C 2RAMA 4PREB 1BOGA 3U46B 1J0IA 1S9YB 3A0OA 2WIIB 4KKCC 4FFWD 4Z9KB 3ZZ1A 4QGYA 4CNIA 1IFHL 4G9DA 4HK3J 3O3DB 1DBKL 1J0ZA 2A0LC 3NFSH 4YXLH 3BWAB 3EYQC 3VWJC 2NNAB 1X3DA 1UWGH 1QLFB 4JN1H 4IHOA 2JB5H 3C08L 1GHFL 3PWVA 1FL5A 4BSJA 1Z3GH 4GKNA 5L6YH 4FXGA 5CJXA 2VSCA 3EDKA 3BISA 3GJEB 3K1DA 3O45A 1HK6A 4Y2DC 3RA7H 2XICA 4GRWF 1A3LL 1BGXH 1FG9C 1A5FH 2P5WD 1R3KA 4U1IA 3RVTD 3M8OL 1U95B 4NFBA 4CGTA 1LO3H 4JM2B 2AEQH 5IJKA 1I1AC 4UAOC 5HDQL 1D5XA 5JTWA 1XIWD 4YDVB 5C8JB 1M1SA 5I18H 1NCDH 1QBLL 2DJSA 4LSRL 1WUNT 3ROOA 2BERA 1LQSR 5JOFA 2HMID 2FO4B 3IDMA 4OV5A 5IFAL 1INDL 4X9BA 1RVFH 1D9KD 5GQBA 1PKQE 3QEHA 5FKPB 4ZS7L 1U2HA 1ZT7B 3QQNA 3SGJC 4EN3A 4I3RL 1DBBL 2W92A 3K4ZA 1PYWA 3MX0A 5IFJA 4IDJH 4KROC 3TWCH 4H25B 3RVUD 3KYMB 4DGVH 3SDCA 1RJYA 2W0FA 2VZTA 4HWEH 2EKSB 3E3QC 1PKQA 3GSXB 3BZ4B 3THML 3OSKA 2FGZA 3IAPA 1QRND 3WYRA 3PHQB 1ADQH 1ZS8B 5D72L 1ZHKA 4PY7A 4B50A 3VFSA 2FJHA 3LPFA 1U8QA 5DC4B 1JF5A 1FPTH 1C5CH 1LMKA 2YPLE 4HGKC 3C6LA 1MH5A 3QUML 4XBEH 3KLSA 1R5VB 3V4PH 1KT2A 3NIGE 1CLOH 5T3ZH 3F7YB 4NQXA 2XZCH 1EV2E 3RNKA 2V17L 1YEJL 2DI7A 5C0GA 3MREB 1A9EA 1X5IA 4JAMB 1JWSB 2YPLA 1HQ4B 3TJHD 3U7YL 1T83A 5JPMA 4BYHA 1ES0B 5CZXC 3MV7E 5E5MA 4MD5A 3LKNB 1NKOA 4FP8H 1R3LA 1W0WA 2IAMA 1ND0B 4IRSA 3DXAB 5HJ3A 3QCUL 3TM6A 5A2FA 2NXYD 3ZKXC 4O02L 5E2VL 4JY6A 3MLTA 2A1WL 4XP4H 4HJJH 1QKZH 5LKNA 3VG9B 3V6FA 4OCSH 4OKVA 2WV3A 1AFVH 1T6VN 4R8WL 1FDLH 5BJTB 3MV7A 5FA3B 2NR6D 5BOZG 1BMGA 1MVUA 1LDSA 2R56L 3L5JA 4L9LC 1CD8A 4PJEE 4TSAH 2F5AL 3RWEB 2DQHH 3SKJL 5F8QC 4BZ2L 5GGSB 2R69H 5IV2A 5ID0A 1KJMB 3EIFA 5BZWB 2FX9L 3P4LA 1BX2A 2X9WA 5CIPB 4LLYB 3QQ9D 2JF1A 1J1OL 1G9ML 1T1YA 1YYLL 2RCSH 5A16A 5FGCE 2ZCKL 4NJAL 3A67L 4G8GD 3TCLB 2G9HA 2UYLA 4AIZA 1LEIA 3GBMH 4ODVL 5GGRY 1BZ7A 3GJFK 1IGCL 4APQD 4PJ7E 1AD9B 1U58B 3ALXA 3VXNA 5TF1H 3MGOB 1EO8L 2FEDC 3D2UD 4ZG1A 5GGUA 1ZHBA 4KUZH 4GXVH 5HHVH 3MR9B 1NCNA 1MFAL 4AJ0A 3NIDE 3SDDD 2CKBB 3CXDH 5E9DE 4QRQB 3RTQA 5ITFA 3VWKC 2E9IA 5FGRA 4S1SH 3SBWC 3ARQA 5DD0H 2AJUL 4JRXB 4YHZL 4PJ7A 4JLRA 5IEKA 4Z95H 4P9HH 5A3IC 3BN9C 4WW2C 5DWUH 4U49A 3BSZL 2NY0D 4LOUD 3EYUL 3UJJH 3C5SA 1A1NB 1EEUA 2VXUL 3MRPB 3M1BB 1DLHB 2XY2A 4X6DF 2GKIA 1JFQH 5EZLA 3JV4B 4Y8AA 4HKBA 4HUNB 1H3PH 3MNZB 4HK0B 4JHWL 3O2VL 5J9PB 3TPKA 3H6JA 3VI4F 5HSFA 2YZ8A 1RI8A 1IAKB 5MHSD 3SGKA 4PBXA 5BRZB 2CK0L 2DQUL 4C58B 1KC5H 4CADB 3BYTA 3F7PC 2NMSA 2NXZC 1U3HD 5JO5B 5DYOA 5I1JH 3PNWA 4N8CH 4X5LA 1EJOH 4YHKH 2W9DH 2P43B 2ZSVA 3QISA 2W1NA 3MSPA 4N90E 1NBZA 1RIVH 1HILA 2AEIT 2BVPA 2BZDA 2QBWA 1FZOA 3IDNB 3RRQA 1V7ML 1LO4L 2EDDA 2VLRD 4TTGA 3A6CL 3IRZA 5DGRA 1RZGB 4WO4D 1IGYB 1UACH 2F54E 2H9GB 2VLJE 4O51B 1A6WH 1IM3B 5T1KB 3I6KA 5JW4R 1NC2B 4RAVB 2ARJA 3KJ4C 4G8EA 5I1EH 1D5ZA 3GKWL 2ZG3A 1PZ5B 4LEXH 1E27A 2CDGA 4GRWE 4WGVB 1I8MB 2C4XA 1ZSDA 3UDWC 4QCIB 3SPVA 1M71A 2EIDA 4CBPA 3OKLB 5CJXC 3VD7A 4XVJH 2CRIA 3G6DL 4JPVH 2F54A 2VLJA 2FL5B 4X6BB 2FYYB 2VDKH 1T21B 5F3HB 3GI8H 5IJKC 1RU9H 5HHNA 2ZUUA 4HG4K 3DX8A 4Y19D 1OGAE 1JRHL 3L7FB 1JNJA 3KPLA 5JDSA 5E2TL 3L95A 4G7VH 5HVWA 4MXWH 4EOWL 3TYGH 1WICA 3L5IA 2GJ6D 4ZPVB 2ZKHH 4Y4KD 1A4JA 4HD9A 4DEPB 3WD5L 5ACMA 4BELD 3OGOE 5CP3H 2X70A 2I27N 4HH9B 4P2RD 5GISH 1OGAA 5EBMB 3B9KA 3DWTA 3VFUB 3QJHA 4EN3C 5I1DA 4MLSA 2WLYA 1L0XA 4PJDB 2XWTB 1DQDH 4K23H 3VFMA 5BV7B 4MNGB 5FM5O 1MI5B 3BZEA 3UPRB 4UQ2A 1I8IB 3LSOB 5HD8D 5GJSH 5DRXA 2OI9C 3U48A 2ZUWA 5FOBA 3SDCC 4X6EA 2XWBA 3DGCR 5D2LB 5L2JB 3WFDL 4QTHA 5DZNA 5F89A 3RWHB 4YO0B 5D2NB 3I2CL 1IKNA 4L1HA 3RWGA 3MRLA 1XCTA 5JW4N 3NZHL 3G04A 3UTSB 5DJ2A 1F3JA 1N2RA 5T3ZD 3K2MC 2FLBT 3C6LC 1VEPA 1ZLUH 1MQ8A 3MBEA 3BQUD 4OF3A 3QIWC 4HLZG 5FUOH 1TVBA 3WFHB 2O26U 3GIZL 3C8HA 4PR5A 3LKSA 1CF8H 1V7NL 3BWUC 5AG9A 3BP4A 4JREB 3TZVD 2FGWL 3BDYL 3OHXB 3NCYP 5DQ9A 4F9PA 4JFHE 5ACZB 2XTJC 3FO9B 4FQIH 2GT9A 1LO0H 3WNKA 3EZ8A 3RWCB 1N5YH 2IAMC 4IRSC 4JN2B 3L3KB 3WFEL 3KG5A 3SQOH 3D25B 4OCWH 2VH5H 4O2FA 4HPOL 2ITCB 3JVGA 1R3HA 5I16B 3B2VL 3QFDA 2ENSA 3GSNL 3X17A 4XX1E 4L3CB 1FFPB 4MSWB 4F7CB 3MACL 3TBWA 3VFPB 5EIVA 3IFNH 2HAZA 1MFEL 4HKXA 4KMTH 4IJ3B 1NAKH 4J7RA 1YEDA 1OB1B 2NY6D 3LEXA 5EC1B 3T0EE 4J2XA 4DGIH 2F53B 4PJXF 2O61B 1FGVL 3UEZA 2XZAH 3ULVL 2HT2C 1F4YL 3QWRD 4ZODA 3VXRE 5E4IA 3LV3A 5KZCD 3CPLA 2R4SH 3H0TA 4RCAA 2R9HD 4BZ1L 3V4VH 4YGVA 1ZGLM 3QEUA 1LK2B 3OMZA 1JHLL 2QQNH 2DQTL 5BXFB 3T0EA 3IT8D 2DIBA 3E2HB 1FN4B 3PL6A 1TTGA 4NOFA 3IJHB 3ARBC 3PWPD 3HLAA 3B9EA 1MCIA 3VXRA 3T04D 3HE7A 3GI9L 4FQ2H 1F11B 5CZKA 4ZQKB 1OWRM 3O2WH 2RIKA 3HR5A 3P11H 3LH2H 1FFOA 3O6KL 4FFYL 1XF2B 2OP4H 3MLVH 1PQZB 3FT4B 4XC3H 4CMHC 5DJ6B 1I1FA 2V5YA 4BFIA 2EXWC 1CFBA 1EDQA 4N0YL 3VFRB 4KKLD 1YJDH 1AC6A 1X9QA 3FQWB 5IT2L 2V9TA 1BJ1H 1E28B 2APWA 3CH1B 3BDXA 4ZAKB 3QUYB 4N0FB 1FP5A 1NUFA 3QDAA 1KB9J 2D9QB 3LS4L 4OSUH 2WBJD 1D5IL 1O0VA 5L9DH 3D39E 1MJ8L 1KJ3L 3AREA 3KNBA 3VI4E 1T5XB 4M7ZB 4ZUTB 3B9AA 2F74B 1T7VA 2QSCL 4LARL 4X6DA 5M7QA 2VR5A 1JNNH 1B0RA 1U41A 4RFNC 4IOFC 3SGKC 5C7XH 1G7QA 2XV6B 3PP3H 3QEQE 2C4FU 4K3EL 1WZ1L 3VD5A 3GNMH 2Z31D 1OGTA 1HHGA 5IOPB 5CEZE 3D39A 3MLSH 3MPCA 1PZUB 3DX7B 3GSUB 5B38A 3S6CA 3D3VB 4JRYB 2YD4A 2ICWA 5FUZH 4BH7B 2DQEH 4HT1L 1ZLVK 3VWJB 1PBYA 5FK9A 1NCTA 2VXTL 3QEQA 3BUTA 1NAML 3WFZA 2JJSA 5SWZE 3PGDA 4CN1A 1IGJB 4PV9A 3ILQC 5DSCB 1FGNL 4YDJA 4Y2DB 4DN3H 1OAKL 5F7UA 1KLFA 1NDGB 4H0GA 4Y1AB 1GSMA 3O4LD 4PRID 1AKJB 1VFBA 3O3BA 3GBNL 4JQVA 4BUHA 1I1AB 1WEJH 1EHXA 3CIQA 4UAOB 2NW3A 1A1MB 2XFXA 1QVOA 3WHXA 5SWZA 1J1XH 1IGIL 1CICA 2JK5B 2PO6D 3OQ3B 1MCJA 5BS0D 1RURH 2OMNA 4XVUD 3UTZA 3HC4L 3WLBB 1GZPB 3AAZA 4M61A 4F3FB 4CAGA 1PKOA 2IANE 3L7EA 1DSFH 3K2UL 3QH3B 2AEPH 3K8KA 2VE6B 3BKJH 5C2BL 4ZUWA 3T0AA 3Q6GL 1S8DB 4NO5B 4JFQA 2OMBA 4OLZH 1BWWA 3H9HB 4RFEB 2ADJB 1RZJL 4KROB 1BOYA 4J4PA 5TJWK 3ZHDA 4KWUA 3SO5A 3DBXA 1JPGA 4Y5YC 4WVRA 3B9KC 4FHBD 4NZRL 3BZFB 2IANA 4HUVA 2IALA 3IVKB 1JGVH 1U91B 3RL1B 5DS8B 3UZVB 3V6OE 1P7QA 3NFNA 4V1DD 5FCSH 3U36B 5DUBA 4D9RE 1MHCA 4UUJB 5F1IB 1QEWA 4I0PD 4HCRH 32C2B 4UIKL 4FZEH 4ERSL 4JN1L 5C0JB 3WXWH 5JA8B 2JB5L 3KPRD 4LHQB 4RIRA 2OTWA 5L6YL 2VZSA 1HYSD 1ORQB 5DGQA 3V6OA 2O5ZH 1RZFL 3LEYL 4KJYA 5E8EA 3ARTA 1BGXL 4ODBD 5L2KB 4WWID 5CLTA 1FJ1A 5TDOB 4NCC1 2JJTA 1JN6A 4JQXC 3CSPA 2Y7QA 2GUOA 1CLZH 5IW6B 4OFYD 3S88H 3MBEC 4KQ3H 1NCDL 2P4AB 3MBXL 5C0BD 5HYQB 5FHBH 4YHML 3MUGB 1SM3L 5T1DL 2CUIA 2IBZY 1FNGB 3I9GH 4WEUD 4HGMA 3GSQA 4TPRH 3TA3A 5D7LA 5I73C 1GGBL 2EDXA 1CIDA 1PAMA 2DWDA 4F9PC 1YNLH 3X3FH 3LQAH 5DJYB 4LSPH 3GZKA 3CDGB 4PJCB 4PJHF 5IUSA 3KXFB 5JORA 3H3PH 4X6FA 2YK1H 5CIPH 4L9LB 4IDJL 4XX1G 5IVNA 1QFWM 2ADGB 3MRRA 3JVGC 1T1WB 5CJQL 1FVEA 5A43C 1WBYA 3MRBA 3ZYOA 1HEZB 4YBQD 3S36L 5IBUB 3WEXA 4LCYB 4GBXD 1ROWA 4MDJA 4F7MB 1N5AA 3DV6B 5HI4C 3RI5F 3H9SA 4EUPB 3OR6B 4NYLA 5KSAD 1MQKH 4ZO6A 2BNUA 1ADQL 4X7DC 5EUOB 1ZA3A 4PJXE 4YXHH 4X7TA 4GJTB 1ZGLB 5AAWA 5MI0C 2PYEE 1BF2A 1PGRB 3T1WA 4WUKL 2BVUA 1YN6A 1C5CL 3DROA 4FOMA 2BVQB 5HVFB 2AV7A 3LB6D 2D0GA 4Q58C 3IKKA 2CKBH 1TCMA 2C5DC 4P2QE 1CLOL 3LY6A 4G6MH 1N4XH 3O11B 1TQCC 1G84A 5AD0B 4MLIA 4PJXA 2K1MA 2BVYA 1UM4H 1V3JA 4YH6A 5C3LD 1JK8A 3GUTA 2PYEA 1FZMA 5C6TL 4QXGH 4WI4A 3PE9A 2EKJA 5MERA 3F5WA 3T0EC 1NQBA 3RGVD 2Q8BH 1DN0B 1S9WA 2IBZX 3VWKB 3QSKB 1BIIB 2GITB 4OJFH 1C8PA 4L4JA 3P4NA 2J4WH 4LLDB 1CL7H 5MEOB 4FP8L 4P2QA 2BY0A 5SX5H 1EMTL 4RAHA 3HE7C 4P48A 3FAWA 1FBIH 4WW2B 3VFTA 5E24E 2R15A 1KB5A 1AXSB 1UJ3A 3OKOB 1OAZH 4Z0XB 4WCYL 4LCIH 2ZJSH 3MLUH 3PWNA 4KZEL 3P4OA 2FD6H 1J86A 4PRBA 5I1GL 1AFVL 4GAGL 1FDLL 2JB6A 3LKQB 2D2OA 3Q1SH 3MRNA 5EDXA 2QJDA 4NJ9H 3GO1H 2DQIH 4TSAL 3FO2A 1U8MA 2I9LA 5ESVB 2BP3A 4G8IB 1FG2B 1N6QH 1E4XH 4EI6A 4H88H 3OB8A 5IVXB 4PJAF 5B38G 2R0KH 3AREC 4J3VA 2ESVB 3IS0X 3IDIA 5DEGB 6CGTA 4H1LA 3EOAB 2NXZB 4F7TA 3QIUA 1VADB 5IB2B 1UQSB 5D7IB 1V3LA 1JYXA 2QADC 1WLHA 1P5UA 3W9EA 1RIHL 4BQBA 5HYIA 2PUQT 3GBML 3L3IB 1ZVYA 2EYTB 5I9QC 1KGCD 1G7MA 4TNVF 2VYRE 3ALWA 1OARH 4I3SH 1S5IH 1QA9B 4CNIB 1U92A 2WUBH 5T5NF 2CRYA 3DHMA 3VGHA 1DBAH 4JM2D 3SGEH 5HHVL 3D85B 3B8YA 1YECH 1CDCA 2GI7A 1YEGH 3KJ4B 1QQDA 3CXDL 1RFDL 4IHOB 4MGXA 5L7XL 1AGCA 3ULUH 1HOCB 1U93A 4GKNB 2R2BA 4FXGB 1MCWW 5DD0L 2ORBH 2YSSA 3GMMB 4J3UA 4Z95L 5TE6H 3UZEA 2BHYA 4JQIH 1BFOA 4OCNC 4ZUVA 5DWUL 1R3KB 2FX7H 4U1IB 4JVWA 4QXTA 3FQNA 3G08A 3UJJL 2VDPL 5KG9B 1CQKA 2MQCA 5DD5H 3F6LA 1D5XB 1KJVA 1Q0YH 4Y5VA 1F4WH 2EEBA 4LDEB 1NBVH 2A6JA 1JFQL 4D9QE 3N0PB 4NWTL 1Q9KA 3OR7A 5JOFB 4XP9L 5HI5D 3IDMB 5TPWL 1JGDA 3HRPA 3HMXH 4LLUA 3N1MC 5BV7H 1KG0A 2ICWJ 1KTDB 4GO6B 1KC5L 5J11C 2X4SB 1QOKA 4X4ME 1F3RB 4KAQH 5IJVA 1YPZE 1H3UA 4M43H 3QEHB 4WI2A 3SDXF 2IJ0C 4EN3B 1U42A 1JGUH 1PYWB 5IFJB 2CUHA 2W9DL 3MUHL 1G7LA 4MJIE 4HG4J 2DL9A 2OI9B 3SDCB 1RJYB 2W0FB 3NIFF 3RAJL 2BOBA 2B0SH 5DD1H 3KPNA 3WJJA 2BCKA 2OZ4H 2DRUA 1A6PA 1IJ9A 1U8OB 1YPZA 3MRIA 1DQLL 3D48R 4R2GC 3ZL4H 1ITBB 3DX6B 2XACC 3QZWG 4S2SB 4PY7B 3VFSB 1ULVA 2FJHB 4JO3H 3OKNA 4FXKA 4LEXL 4MJIA 3D0VA 4EIGB 2EC8A 4K9EH 4RISH 3C6LB 2YD9A 5CLWA 1FNEA 1S7WB 2IFFH 4S11A 4XVJL 3DXAD 3L5XL 3HS0A 3V6OC 3QIWB 4JPVL 3RNKB 1XFPA 3FQXB 3UTTE 4XWGH 1KLUB 4LKCB 1RZ8A 2JJTC 3GI8L 4NT6A 4OZHF 4M1DL 1A9EB 1RU9L 5ELIA 3MJ9A 1V3KA 5DTFA 4F37K 3SOBL 4KJPC 4KI5D 2XTJB 1PJ9A 1S7XA 4WHYH 5E5MB 1I85C 4G7VL 1W0WB 1F3DJ 5H8DA 4FQCH 4MXWL 2IAMB 4IRSB 3GSWA 2UV3A 1GAFH 3W2DH 4PJHE 1G1YA 4WW1A 3ILPA 3UTTA 5C9JA 4AT6B 3AS2A 1HHKB 4FTVE 3MLTB 3RX5A 3T0VA 3TV3L 3RX7A 3T2QA 4U0RC 3LOWA 4OKVB 3TFKD 5HI3D 4GRMA 3MV01 2GCYA 1FO0L 3MV7B 1MVUB 4LCWD 4Y88A 4LSSH 2VISB 4PJHA 3P9LA 5GJSL 4FABH 4YXKH 1UXSB 1Q0XH 2D9CA 4L8BA 2P7TA 5IV2B 1MUJB 5DVNA 4FTVA 4HBCH 3EYFA 4LGPB 4O58H 5ID0B 3I85A 1BX2B 1MIEL 4P5TA 5T3XD 3K46A 3HRZA 1HH6B 1RUAH 5J6GA 1T1YB 1J05A 1FYTE 4GLRH 5ALBL 3S4SA 3ARFA 3QUXA 5I66A 4PJEB 2UYLB 4AIZB 3DX9B 4HGWA 4BA8A 4EKXA 4CN6A 1I9JL 4JRXD 3ES6B 3ZTNH 4P3DA 3DRQA 1BD2E 5FUOL 4JFXA 3VXNB 1FYTA 3ARBB 1ACYL 5FGCB 5GGUB 1CVRA 1ZHBB 3U0PA 1CF8L 4R7NA 1I9RL 2DD8L 4D2NA 5KSVB 1C5BL 1K8IB 1VGKA 4YFDB 2X4QB 3KHOA 3ZE1F 4JFOB 2IQAA 5E8OA 5FDWA 4OZFA 4CMHB 4CUCA 4S1QH 3BW9B 3MCKA 5KTEL 1MCPH 4H26B 4PJ7B 4L8SA 3U9UA 1L9MA 1BD2A 2J6EA 2ZOKA 1RIUH 4QT5A 3L3OB 4H1LG 4OCWL 4UINL 2VH5L 2A6KA 1UJ3C 2EDLA 5BRZD 3WE6B 3C5SB 5E9DB 4YDIL 2J8OA 1KENL 3QJFA 1PY4A 3CU1A 1R3JB 2UZIH 5EUKA 4JKLA 2FBOJ 2ITDB 3FRPA 3BP5A 5JW4Q 1ONQA 3VXUE 4ONHB 3IFNL 4RRPA 1DCLA 3ZE0F 4Y16A 3JWOH 1KCSH 5IMLA 4GQPH 3RU8L 1KTRL 3ME0A 5FAAA 4ZFOA 4RFNB 3PABB 3H7LA 4FQPA 4NNYA 5F8RC 2H1PL 4KTYA 2Y36H 3ZKND 5T1KD 4OGAD 3O8XA 1JHTA 1NBQA 3IJSA 1H8NA 3PNWB 4MB4A 3VXUA 3LPGA 1KN4L 2ZSVB 4TYUA 4ODTH 1U3ZA 3HI6H 5KW9L 5I0DA 3MRFA 3ZYJA 3QI9A 4S10A 4MAUL 3AMLA 2PF6A 2DF3A 4ZO9A 4RFOL 1NGZA 3OAYK 1O7VA 3D87B 5BCAA 5LJYH 3CVHL 2ARJB 2BVTA 4FQ2L 4G8EB 1D5ZB 3PGCA 4DWHA 3M17A 3O2WL 3T4AB 3VDBA 1ZVHA 2XT1B 4XXDB 1A6AA 1N0XH 3ZTJH 3MLVL 1BQLL 3SPVB 1IC1A 4XC3L 2C1OB 2ATKB 1L6ZA 3DOSA 2BDNH 4MQSB 2VLJB 5C0IA 3SO3C 5DD6B 3TCXA 1P6FA 2JJVA 4H8WL 2Q86A 5HHNB 4PG9B 1FSKC 3DX8B 4GRWB 3JV6A 2VKWA 1I4FA 4OSUL 2OR9H 3KPLB 1CS6A 3U4BL 5I8OH 3CCHA 3GRWL 5JDSB 1J1PH 4C56E 4R6UA 1UADC 3L95B 1S7UA 1MI5D 1YEKH 2YUVA 5JNYA 1QSEB 2H8PA 3CX5K 3SDXE 1IGML 4KUCF 4MNQB 5C0NC 1G6RA 4M6OH 5IK3A 2LVCA 4OF0A 1A0QL 1QPPA 3IKCA 3GNML 4Y5YB 1OGAB 5CUSH 1UCBH 3H42L 3B9KB 1T2QH 5E56A 3QJHB 3NIFE 3REVA 4C56A 5I1DB 4JR9H 4MX7B 4U7SA 2X4UA 3H9YA 3UTSD 3VFMB 1XCQA 4QHUA 3F7VA 4PJ9C 3BZEB 4JKMA 3SDXA 1KEGL 5FOBB 4MWFA 4POUB 4X6EB 2XWBB 5FYJE 3OXSB 4FQXA 1JTOA 4HS6A 4JFEB 4AYFA 3MLWL 3EBAA 4QTHB 3G9VA 1UJTA 4W6WB 5DJ0A 4CJ0A 4EXPX 3IAQA 3WJJC 3KYKL 5F89B 5JUEL 1EA9C 4M00A 1HSBA 3SJVE 3RWGB 2CMRL 4OQTA 3MRLB 5DMGC 1XGPA 5I17B 4W81A 1YMMB 2QQQA 1TTFA 3DUSB 4DN3L 5F96L 4XPTL 2R8SH 1N2RB 2YD1A 3NABL 4TVPL 1RZ7H 1CBVH 3VMPA 4Z5RA 2AQ1A 3BP7B 3IETA 4OM1L 3NA9L 2DJUA 3MNWA 3MBEB 1CK0H 3AY4A 5JR1H 3SJVA 3OJMB 2WSKA 5DA4A 2NZIA 1A02N 4WTZA 1UVQA 1S7QB 4PR5B 3BPNC 3BZDA 5B22A 1BM3L 3BP4B 4E0RA 4P2YA 5I73B 2KPNA 4K3HA 3FFCB 3MGAA 1NFIB 1J8HE 1CE1H 1T4KA 4PP1D 1DSFL 4U6XA 1RZKL 1D7FA 1EFXA 4Q9BA 4R26L 1TQBC 2VERN 2DTMH 4UBDC 1CD1A 4EUPH 2V9RA 3K1KC 4OTXH 3MNVB 3OF6D 1Z5LA 4O2FB 1XGUA 5HGAB 3S4SG 3DO7A 4OM0H 4W4NA 2MTPA 5DJDB 3PDGA 1IGFL 2F53D 4PUBL 1B88A 3TBTB 2EDBA 2GTWA 4DK6A 3O6FA 4TRPH 4LVOC 3UMTA 1J88A 1LEKA 1JGVL 2Z9TA 4MA3A 4QHKJ 1M05A 1IQWH 2Y6SD 4KU1A 2ZUSA 3WDJA 3GJFB 1LE5A 4OF7A 2G5BA 4PTTB 5MI0B 3DVNA 4GXUN 4HCRL 3LEXB 1N7ML 4FZEL 4HF5H 3WXWL 2BOCA 3ARFC 1OTUD 2BRQA 3QUXC 1Q72H 1X5HA 1TQCB 4OZFG 1I1CA 3TH4T 1JWUA 3BH8A 43CAA 3H0TB 3S96B 2HH0H 1SY6H 2BXZA 3TBVA 1MAJA 3GMRA 1I7UA 1K3IA 2B8OT 3T1FA 3TIEA 4R7DB 1LO5A 1CLZL 3T0EB 4MCYA 1DE4A 4QHKI 4G80A 5ICZB 2VUOA 4UT6H 3B5TA 5EG6C 5TFSL 3VXRB 3QUYD 1T22B 3X12A 4TPRL 3HE7B 2PXYD 3QXVA 1AGDA 4NRYA 4OF5A 2ARWA 1YNLL 3WIFA 2DQGH 3LQAL 1FFOB 4RRPG 3X3FL 1KFAL 4GQ9H 1CFNB 2MPAL 1I1FB 1IEAA 2IPUK 1HE7A 4L8SC 3OAZH 2OL3L 2DWEA 3MCLL 4PJGF 2YK1L 1YQVL 1MRDL 2VAJA 1NMAL 2GFBA 4KTDH 1B6DA 4KY1L 3ZE0E 3BT2L 4POZD 5BO1H 4OCLC 2CRMA 4M7LH 1D9KC 3ARGC 5I1HH 3AREB 3KNBB 3Q6FA 1HNGA 4KKCD 4Z8FL 1MQKL 1NEUA 1L7IH 4Y16C 3D3VD 4JRYD 4OF8A 4YXHL 4U6VL 5LQBH 3V4UL 5F97E 4AIOA 3EYQD 3VWJD 1VDGA 5JXAH 1L0YA 2QADB 2HKFH 5FCUL 1G7QB 4YC2C 4KKAC 2K9UA 1QG3A 2CR6A 4D8PA 5I74C 3BJLA 3VGBA 1OGTB 3WLWC 5IHLB 2QV2A 1HHGB 3I50L 1A9BA 2CKBL 3D39B 5T5NG 5IWLC 5I9QB 5A2JH 2AJ3A 4M6NH 2AJSH 4Y2DD 3OKDA 1X4ZA 3UO1H 5EWIH 2RB8A 2B4CC 4Y1AD 4FQ1H 4MD4A 5IESH 4FN0A 1UM4L 1AKJD 2ICWB 2BSRB 1VKXB 1DQJA 5DMJB 4QXGL 1I1AD 2UVFA 1A8JH 2ED8A 5FK9B 3QEQB 2Q8BL 3L5HA 1NPUA 3QI9C 5EU6E 2X1PA 4J8RA 4PV9B 4HPYH 5EULV 3HE6C 4YDJB 1MJJA 2OSLA 1GGUA 2EDRA 1FBIL 1F02I 4LNVA 1GGIL 1VFBB 4ODUA 1OAZL 1P1ZA 1EUTA 3QNYB 3FT2A 1LEGA 2FD6L 4HQQL 1TVHA 3BEVA 5LWYH 5IP4A 1JMXA 1QVOB 2XFXB 1BBJA 4NO0B 5EU6A 5SWZB 1HI6A 4G3YH 3WHXB 4CU8A 5L88L 4UILH 3Q1SL 3KYOB 1CYGA 4KROD 5FV2A 3L9RA 2DQIL 1E4JA 1JHKH 3IFOA 5LCVH 3UROR 3UTZB 1QD0A 5JQ6H 4KKBC 4D9LL 3N1PC 1OW0A 5EBWA 3AAZB 1QRKA 2D4DA 4M61B 1VPOH 4KRLB 4KMQA 1P53A 5J11B 2DIAA 3LKRB 4ZUWB 1TENA 1PD6A 3P9MB 5KS9F 3RPKA 4NKMB 3FFDA 3ZHKA 4JKPL 2BJMH 3C5ZB 3DBXB 3BX7C 4R0LA 1JPGB 3GIVB 1KJ2A 3HAEB 4HZAA 1IAOA 1X44A 2R0LH 2IANB 2IALB 4X7FC 5DFTA 4MMXC 3CVIH 4R2GB 5L2KD 4YPJA 5DUBB 4HX1A 1MRFH 1UXWB 1QP1A 1YECL 4WTZG 2ICEA 2NY4C 3PWJB 3G5XB 5TGBA 1CDGA 2J8UB 1OCWH 4K3JH 4JVUA 5F7EH 3V0WH 3V6ZA 1G7JA 5HXMA 5CZXD 2VDOH 3K81A 3UJIL 5JXEA 4RIRB 1I75A 3ULUL 1A6UH 2OTWB 2HFTA 4PJIF 1J11A 3SQBA 3QHTC 2ORBL 3VXSE 5INCB 5KANG 1SYVB 5TE6L 3W81A 2XA3A 4XH2A 5E8EB 1QFPA 4H0HB 4BQ9A 4JPIA 1QFWH 3IF1B 1FJ1B 1DQQA 2CH8A 1MWAA 1OTSD 2Y7QB 1CR9L 3U4EB 3IFLH 2R1WA 1TETH 4K2UL 3RQ3A 1KYOK 3KXFD 3WIIH 4RX4D 5DZOA 5J13C 4GG6F 5BW7A 3C6SA 3VXSA 1XGYL 2X05A 1Y18B 3GSQB 4KXZH 3HPLA 1XF1A 2Q3AA 1Q94A 3PG2A 4NO3B 3MTRA 5FO8A 5BV7L 3SY0B 1YEEH 2R1XB 3CFKB 4LSDA 4U0RB 4UDTA 4KAQL 3KS0J 1NFDF 2HTLC 5I2IB 1NUNB 3HUJF 1JGUL 4Q9CA 4EBQL 1IC7H 3F58H 3MRCA 4Z7UF 3IRPX 1A3RL 4P46A 1WFUA 1X5ZA 1YNTB 1FVEB 2WIMA 4CRPA 2M26A 1WBYB 3BD4A 3MRBB 4XVTL 3WEXB 1PDKA 3O6FC 1OP5K 5DD1L 4HZLB 1NUDA 2OZ4L 4NSKA 5C08E 3FB5A 5D7KD 5A2LH 2O5YH 4JPKL 4N68A 4RBPK 4X7TB 5C0AE 4X4YA 2SEBB 5MEND 4XPHH 1A6ZB 4RAUA 1YN6B 4FZ8L 1F90H 3I6LD 4LDLB 4M62H 4K9EL 3VWKD 3TO2A 4RISL 3W9DA 2AV7B 4XP5H 1EEQA 1R5WA 1KELH 1LDPL 2A6IB 1TDQA 5A3ID 3BN9D 1XT5A 4PJXB 5C0AA 1JCKA 1YZZA 2B2XH 1JK8B 4BSVB 2PYEB 1FZMB 2OJEB 3PWUA 1CFVH 3E6HA 4HC1A 2DICA 1A2YA 2YKLH 2XKNB 3HCVB 3CMOL 2GK2A 2EDNA 5DQDH 2L7JA 2O93L 1KPRA 5DI8B 4FQCL 4U31A 4DKEL 4XHQA 4W68A 2BRRH 2VITB 3RKPA 1OSZA 2PNDA 5ADOL 3X14A 4PJGE 5CCKH 2ESVD 1KB5B 1UJ3B 5GGQL 2YXMA 3P4OB 3T2NH 1F45A 3QG6A 4PRBB 2DN7A 2CIKB 2NXZD 4IRJD 4OGYL 5KANI 5EORH 5C6WH 4G9FE 2I9TA 4LLAA 2JB6B 4XXCA 4XCYB 3O0RH 3HB3C 4LSSL 3GMPA 1A21A 3FO2B 1U8MB 1X5FA 2I9LB 5CAYB 5D1XA 2VXVH 4DKFL 3MRGA 1Q0XL 4PJGA 4EI6B 4HBCL 5KBNC 5EIQA 1BEYL 1CDHA 3SE8L 3MJ8A 1ZHLA 5EBGA 4H1LB 4DVRH 1RUAL 5IHBA 4G9FA 3W11C 3RUGE 4UU9B 4F7TB 3D85D 1MELA 5FYLE 1UZ6F 1PSKH 4XNXH 3HFML 1F5WA 1AQKL 5DJCA 4GS7C 4YDKH 1G7MB 1FHGA 1QLEH 4FQQB 1UB6A 4N8PA 1S78C 3FQUB 3WMSA 4X80L 5D1ZA 4F7EA 4HIXH 2R23A 3B9VA 5E08H 5KSBF 2IWGA 4LPWA 1AGCB 3KVQA 1NL0L 1U93B 3V52H 3JTSA 4MA8L 5JHDE 5IMMB 4GRWH 1GGYA 2B1HL 4G5ZH 5C07B 1AD0A 2DLEA 4ZUVB 2EE9A 1EZVY 3HZKA 4QXTB 3FQNB 3G08B 3SO3B 4MB5A 2F58H 3GSVB 2IQ9H 1FSKB 5HHME 3N9GH 3SKNA 1KJVB 2R29L 5JPNA 3V5HA 3ZO0A 2Q7YB 4FFZH 4EN3D 1VFOA 2UZIL 2A6JB 1T66C 3RZCC 1EGJL 5JHDA 1OLZA 1Q9KB 3OR7B 2HN7A 2GSIB 2ADFH 3EOTH 3O9WA 1JGDB 4KQ4L 3DYPA 2P5EE 1RD6A 4LLUB 4UOJA 4R96A 3SDCD 5KS9E 1T7YA 4ZYKA 1KG0B 4GAJH 2D31B 3P30H 2HJFB 3PDOB 2R1YA 3KPOB 4CL7A 2J5LC 2IBGA 5IJVB 2ZPKH 1D5BB 5CS7A 5C92A 3KPMA 4EDXB 4GOSA 3UCRA 3CDYA 4UV7L 4NBZB 5DJZA 2FHCA 1ZVSA 4PJ9B 2P5EA 1G7LB 2A38A 3C6LD 4ORGB 4U1GC 5F9JA 5KS9A 5CINH 4L8DA 1IC5L 3V7MA 3G5YB 4TOYH 1WF5A 3DURB 4XNYH 4OFKA 2BCKB 3QIWD 5J8OA 1I7ZA 1YPZB 1FIGL 3CX5J 3MRIB 3QCTH 2E7MA 4KHXL 2WQRA 2NYYC 1FE8L 4ONFL 2YPLD 4PGCA 1AP2A 4G7YL 4MJIB 4HHAA 1BLNA 5I0ZA 2AQ3A 5JXEC 2XTJD 3S8WA 5HGDB 1JI2A 2IAMD 1FNEB 3TBSB 4IRSD 3GMOA 2PKDA 12E8L 3HS0B 1IGTA 2M2DA 3L1OH 5FGSA 3ARVA 5FKAB 3OKEA 4PJIA 3V79C 3BPNB 1RZ8B 5L8LB 1WWBX 5GSVA 2H6PB 2A6DA 2L0DA 1CGVA 4NNPL 5DTFB 5MEQA 4Z7WE 1PFCA 3MV7D 2CJUH 3MRMA 2OR9L 4QXUH 3ZT7A 5I8OL 5LXGL 2JJWA 2WZPD 1FNFA 1S7XB 4ZPTA 5BW7C 3QUMA 5H37G 1YEKL 4JFFA 3GSWB 4KDTA 4UOW0 1H5BC 5TQ0H 3TIDA 3ILPB 1TQBB 1NFDE 3UTTB 4CDGC 4WWKC 5C9JB 3HUJE 1FFRA 4H20H 4U6YA 1MAML 3VFOA 4NQDE 2BSSB 4F57L 3TVMA 4WTXA 1BFVL 3GJFH 5CUSL 2IMNA 1KUMA 4GRMB 2HT2D 2GCYB 4LVOB 4ZS6D 4UT7L 4G43B 2HVKA 4XPFH 5E03A 4P46C 4PJHB 4IS6A 3CLFH 3P9LB 4NKOA 1NFDA 3RWFA 4XAKE 4P5KB 4L8BB 2P7TB 1MCQA 3HUJA 1T1XA 1SMOA 4HS8L 4FTVB 3EYFB 1RV6X 2YD3A 3TT1L 2Z31C 2WAHA 2XN9B 4P4KA 5J6GB 1J05B 3S4SB 5BOPA 3ARFB 4K3DH 3U4AA 3QUXB 5I30L 5I66B 4NUGH 2A9MH 1WSST 5FV1L 3HKFA 4C57C 1FORH 2R8SL 4HGWB 1RZ7L 4LSVL 2W91A 1LVEA 4PB0L 4HXAH 2EXWD 4TUKH 3R0MA 3ULVF 2ZUYA 4X98B 1CK0L 4P3DB 3DRQB 1AR1C 3HI1A 4JFXB 4LAJH 1FYTB 4N0CC 4QRRE 5AYUH 3EYSL 4YUEH 1Q9OA 3U0PB 1EIBA 3SCMA 4R7NB 5E9DD 3CFEB 3VXTA 2IQAB 5E8OB 4OIIL 1CE1L 1ZA6B 3H2WA 5FDWB 3GSOA 4LQFL 4OZFB 4PY8J 4UNUA 4P3CH 4LP4A 2DTSA 4L8SB 1ZT1A 3U9UB 2ZOKB 2ED7A 4QRRA 2DTML 4QT5B 5ICYB 4D0BA 5T5FL 2HJLA 2YN3A 2A6KB 4XP1H 4IOFD 1LK3H 1GVIA 1RUQH 3UTQA 1IT9L 4OM0L 1KCUL 4BFBD 3P73B 1P7HL 1K4DB 1MRCH 1DR9A 1ERNA 3O3EA 3WIHH 4QHMA 4TRPL 3MUY1 1D9KB 3ARGB 4XXCC 3QO0A 4D3CH 1J5OL 1AO7E 3B83A 3BP5B 3P40A 1WBXB 4RMSA 3OJDA 3LN5A 5D1XC 4Y16B 4WU7A 5LGKA 1OAYH 3IDGA 5I8KL 1UZ6E 2XQBL 3U0WH 4ZFOB 4NNYB 3QULA 1A6TA 4PY8I 4YC2B 1B0WA 3PGFL 3BH9A 2EIZA 5I74B 2DM4A 4AH2A 3ILQD 1Y6NR 3IJSB 2VXSH 3VXUB 1QYGL 5C0RL 2E8YA 5CEZH 1P7KA 3QDJE 4N90D 1NGWA 1VENA 4FQJH 1WAAE 3T77A 4DUXA 1M7IA 2DLFH 4KGLA 4N8VA 4NN5C 2YBRB 3B6SA 2H2PD 4ELMF 3CAFA 3MRFB 4N1HB 5E7FA 3QI9B 2F54D 2VLJD 5KSBE 15C8H 1XF4A 5C3TA 4UT6L 5JHLL 4MVBC 5CBAB 5D1ZC 5ID1A 1FVCA 1NGZB 2YUWA 3HE6B 3S35L 1YEIL 3QDJA 3PGCB 5BQ7B 5CGMA 2J88H 3HC3H 1A6AB 2HA1A 4DZ8A 2NY3C 3LS5H 4K94L 1MREH 2DQCH 1QSED 4KRNA 1Y6MR 5KSBA 5KSUA 3N50A 2UY7A 1J0HA 5C0IB 3QCVH 4ENEC 4M1GH 1QACA 5TE4H 4KTDL 1U8LB 2Q86B 1AXIB 1NGXA 1OGAD 3RBGA 5BO1L 2AERT 3B9KD 4MJ4A 1WBZA 5IMKA 1I4FB 2WUCL 3CCHB 4J6RL 5K33A 1S7UB 2D03H 5JNYB 1D6VH 2H8PB 2OQJB 3HAEH 4E42A 5EPMA 3CD4A 1QO3A 4NM8H 5DFVC 4U0QB 2YEZA 4RWYH 4JFED 5JXAL 1NC4A 4GKSA 2EDQA 3IKCB 1MCOH 2VL4A 1OSPH 3IYLW 2YA2A 5FM4A 1L6XA 3MFGB 1ODAA 1T2XA 1YMMD 2AJSL 1XCQB 4QHUB 1TZHA 1UM5L 4KPHL 5IESL 1AGFA 5M95B 1KIRA 3D9AL 4NQCA 3SDXB 1R3IH 1TVDA 4HS6B 5DJ0B 5SX4I 2ZOLA 3MBED 4GSDL 1D6EA 2WM0A 4U3CA 5EC2A 1HSBB 2RJMA 3DIFA 1XF3B 1XGPB 1D3CA 1NMBH 1SJEA 3FFCD 3RKDC 1UKTA 1IEBA 4TSCH 1INEL 5AEAA 2HLAA 4Z5RB 3IETB 1TJGH 2VL5A 2XIDA 1LO2H 2YPKA 4CVZA 5LWYL 1ED3B 3F6IA 4XPGL 3FTGA 2QSQA 4NZUH 3MYJA 4UILL 1INQB 1PLGL 2P5WE 2VZOA 5J13B 1UVQB 4FMKA 1BZ9B 3OGCA 2NY5L 2QQKL 1FYHB 2R2EA 4E0RB 3TBYB 1F4XL 4Z0BH 5JQ6L 1RY7B 3VH8B 4RGNE 3C2AL 5HI4D 2XZQH 2CUMA 4U6XB 4YE4H 3UC0L 4DAGL 5ERWB 1EFXB 4XPBH 2P5WA 2VZVA 4L1DA 4OLXH 1AGBB 1CD1B 2A73A 3DO7B 5F9WC 3TVMC 2BNRB 3AVEA 2IMMA 5B21A 3S34H 3RDTC 4X8JB 4WEBL 2CDFB 1KYOJ 4FFVC 1J8HB 2YUZA 1ZK9A 2DYPA 3HG1E 3O6FB 5DVKA 5BMFL 3L3DA 3QRGH 1LEKB 2OXHA 3TPUB 2MMXA 3IDJA 4DQOH 2YPVL 3DV4B 1QFOA 4HSQA 2G5BB 4NBYB 3T0ED 3A6BL 3PL6D 1VGEH 1KCRH 3V0WL 5F7EL 5LBSH 1IAII 2CO6B 2EYRA 3RY6A 2BOCB 1CFTA 3HG1A 4OGZA 3VXRD 3GSNA 4E5XA 3GMNA 3HE7D 4WI9A 1R24B 3VD9A 3ULVE 1KTLA 5BVJA 1JWUB 3BH8B 4WO4B 4YAQA 3MLYH 43CAB 1QFWL 3BRFA 1HIMH 3MV11 4L4TE 4O00A 5DRZA 3GMRB 2G5RA 1I7UB 2R0ZH 3TIEB 3JXAA 4PYHA 3GHBH 1LO5B 3IFLL 4NGHL 4K8RL 4M7KL 3U2SA 3WIIL 1KB5H 3RZWA 3GHEL 1S7VA 4G80B 2EYSA 2XTLA 1G9MC 4DK3A 3SCMC 4JHAL 3X12B 2AP2A 2D7OA 1BWMA 4OCYL 4KKNA 4F7PA 3FQRA 2FCBA 1GGCL 5DT1H 1U3JA 4NRYB 4L4TA 5F1OB 4RNRA 3WIFB 3ARED 4EDWL 1S5HA 1B9ZA 4IRZH 1ACZA 3DSNA 1IEAB 7CGTA 1DLFH 2VRAA 2I5YL 2KUTA 5IF0A 1HN1A 1IC7L 2QADD 1V5JA 2AEWA 1KPUA 5I8EA 1A7NH 4H1LH 3VG0L 3IB4A 4WJ5A 4M48H 5I71C 2YR3A 1ZLVH 2AJVH 1L7TH 3D39D 3WKMH 1T0NB 1KBGL 3Q6FB 4N8VG 2DIJA 1CFQA 1X5AA 3SE3A 3TT3H 3CDCA 3QXWA 2FSEA 1LNUA 2VDMH 5F9OL 4TSBH 3QEQD 4TQEL 4JDVA 4F80A 3QAZC 5MP6L 5C09E 2RBLA 4OBSA 5CEZD 2MKWA 2BC4A 4XP5L 4FXLA 1A9BB 2FBJL 4GS7B 1SEBA 1KELL 4U2ZA 4IIQA 3EYOA 1RPQA 3AUVA 4ELME 3OKDB 2QKIA 6FABH 1T04B 2DMCA 4L4VE 3NAAL 5CSZA 4U1KB 4MD4B 2Z93A 5EBLA 4RA3A 5FF6B 3OAUL 3CC5B 1DQJB 1EX0A 3WNLA 2I60H 1MLCA 4PRAA 1DL7H 5C09A 5SWZD 4X0KB 1CICD 2R4RL 1VERA 1CDYA 1GZQA 1S7SA 5DQDL 4J8RB 5CMAA 4KV5F 1XF5B 4O5LH 5EO1A 3ROLA 4GW5A 2BRRL 4ELMA 3MLRH 4L4VA 2OSLB 5DXWA 1GRWA 4LSQH 4N5EC 2QQLH 5EIIB 1P1ZB 3BIKB 4XCEA 3FT2B 1LEGB 3T2NL 1TVHB 4LPCA 4R4FH 2VDNL 1BBJB 1HI6B 1YEFH 1NAMA 2W0LA 3MXVH 3C2SA 1C12A 2EH7H 3RZCB 1RMFH 5ENWA 3L9RB 2D0FA 2IGFH 1CE6A 2VXVL 1IILE 3IFOB 4YX2H 5D6DA 1RSFA 4Q9RL 4NPYB 5EBWB 2IAND 1ZE3C 4NM4L 3OKYA 4ALAL 4UIMA 2DBLH 4ZNCD 1P7QD 2V7HB 2J5LB 4DVRL 4R2GD 1CDJA 1P9MA 5IBLC 4Y5XA 2PTTB 5J4MA 1TZIA 2DI8A 2ADIA 3FFDB 3WJLC 4WV1A 4XNXL 2GJJA 3FQTB 4M4RA 4PJ8A 4U1GB 4EZMA 1KJ2B 1IAOB 5GRWA 1EERB 5EZIL 3EJZC 3E8UH 4D9RD 5GSRA 3NZ8B 4HIHA 4HX1B 3CGTA 5I15H 4XNUH 1IEHA 3MA7A 5TGBB 3ZLQC 1DUZB 1VEMA 1G7JB 1NFKA 2N7AA 1U3HA 1AIFA 1U0QA 5EO9A 3R1GH 3QDGE 1NGQH 2N1KA 3V52L 1EHLH 4UTBH 3MJ9H 1JPSH 4G5ZL 1I8KA 4RGOH 4O2EB 4YPGB 4XH2B 2Y07L 5TDPB 5CEYA 1MWAB 2IQ9L 2VO5A 4I77L 3PHOA 3LPWA 4MAYA 5C0FA 4F58L 2RHEA 3QDGA 5MEPB 1CGWA 4XCCL 1HDMA 1JVKA 4LBEB 2NW2B 3EOTL 2ZUXA 4WNQA 4MCZA 1H5BB 4CDHA 4C4KT 2AGJH 5FO8B 2FJFA 4WWKB 4BJLA 2AQ2A 2G60H 2JELH 4GAJL 4XNZC 1ZLWK 2UWEF 1N59B 4DFHA 2H32A 3LMJL 1EO5A 5DJXB 4CU7A 1DANT 3D1MC 1A7BA 3CZJA 2QSTA 1W72B 3MRCB 1Y0LA 3DO3A 5TE7H 4AQ1B 2IADA 4P46B 1ZANL 4P2RE 2Y5TA 1JPFA 1LD9A 5GGVL 1JTPA 2DKSA 5CINL 4HMEA 1B2WL 2AW2A 4ODXA 4RGNC 4TOYL 3JV5A 3OG6B 4JANA 3ZKNC 2Z31B 1HHIA 3TC9A 4NSKB 4OLEA 1I7RA 3QCTL 2PYED 4X4YB 3BKCH 1MHPL 3KJ6H 3MRQA 2X40A 4RAUB 2WP3O 2XPGB 2AK4E 4P2RA 1F58H 4LFHG 3NPZB 3O41B 1KXTB 3LQZA 3W9DB 3RY6C 3MV9E 4ODHL 3U83A 3WUZA 2F8OA 1R5WB 5HYSG 1RULL 1T6WA 4NKQB 5C08B 1DDHA 1X5LA 2P44B 4U3HA 2NTFB 4OZFH 1H15B 5HYFA 1DQTA 1MCCA 3IU4H 1ADQA 5JZ7C 3E6HB 1PEZA 1WZLA 3L3HB 4JY5H 2V6HA 1A2YB 2CJUL 1OM3L 3MV9A 3PP4H 1KPRB 4JO1L 1RUPH 4OUUA 4XMPH 2W65B 1MEXH 4AEHH 4WUUE 1OSZB 3MMEB 4L29A 4WFGE 25C8L 1Q1JH 1DUYA 3X14B 3RVXC 2YRZA 1BVLB 4ZDHA 3RWDA 2W9EL 1NDMA 5I1KL 1NCAL 2CIIA 3QG6B 3BQUA 1TZGH 5D71H 2AXHA 2Q1EA 3QIUD 4NO2A 2PR4L 2FIRT 3FB6B 2I9TB 3NACH 1XGRA 1QBMH 2P49B 2R39A 3VGEA 1MVFA 4WUUA 3RPIA 5D1XB 5I8CA 1K2DA 3CFBB 2Y72A 4OCRH 3MRGB 1SHMA 5FM5M 1S9XA 4PJGB 1E4WH 4JZOA 4JJ5B 2HWZH 1OY3B 4KZDL 2B4CH 1YY8A 3KPQB 4NC0B 1MPAH 3MJ8B 2EDWA 1J87A 4PJ5B 1E6OH 2VLLA 1XZ0B 4TNWK 4P0DA 1UENA 1CIUA 1GH7A 5IROA 2A9ML 4EI5A 4G6JH 1IQDA 5IBTH 3TF7C 3DHJA 1FORL 1REIA 5IB3A 4OGXL 1NEZB 1BHGA 2ZG1A 5EU5A 1OPGL 4NN5B 1NJ9B 5DJCB 1YN7A 4HXAL 2HFFB 2L4OA 4IIQC 3LIZH 3KPRB 1X5YA 1HH9A 3G5ZB 5C07D 1TCRA 4JZNA 1UB6B 4Q9QL 3K7UA 3IS1X 3P4MA 3RUGB 2X4NA 3DJ9A 3OKMA 4YUEL 3WNNA 4OQ1A 5D1ZB 1U6AL 4F7EB 4KV5E 3ETBF 3QFJE 2R23B 5CEXA 3MXWH 2LTQC 5EOQH 4WHTA 5CSGA 4XHJC 3QHZH 3MRKA 4XTRC 3PWPE 2NY3B 1KN2H 3UBXA 3QWRA 3PWLB 3JTSB 1DEEB 1G0XA 3NN8B 4P3CL 4P5MA 5C1MB 1GGTA 5DD3H 4OLUL 2YRLA 3VMOA 1AD0B 4PRHB 5EA0H 3UPAA 4JZJA 3HPJA 1SBSH 3QUZC 3QFJA 1Z6JT 5C0ND 4N5UA 3TJEH 1LK3L 3I3BA 3MRHA 4WHDA 4FQLL 5E2JA 4PLOB 1ZEAH 1AGEB 1MRCL 3BPOC 5JPNB 3WIHL 3FZUC 3V5HB 2A83A 5HVHC 4NZTL 3PWPA 5K9OA 3D18A 4D9QD 5JHDB 1U8NB 1F4HA 4PJ9D 2HN7B 4MHHG 2X44D 4MJ6B 3G5VA 4NWUL 4R96B 4HIJB 1EJ6A 4ZYKB 5GHWH 3U0WL 4DW2H 1WFTA 4R97C 2Q20A 1FZKB 2R1YB 2EO9A 1NBYA 1NGPH 4Z7VF 3T3MF 4JDTL 3K74B 4LLWA 5GIRA 1M7DA 3B3IA 3KPMB 5DMGD 3AU1A 2V5SA 3KS0H 4Y5XC 1S9VA 3IXAA 2PW2A 5DJZB 1X5KA 3V0VA 4MJID 1ZVSB 4OLYL 4WV1C 3RIFF 5CEZL 2E3VA 5F7HA 4OQTH 3WXVL 4PJ8C 1UA6H 2OTUA 2VR4A 4HWBL 5KS9B 4U1HA 1QHPA 4GMTH 4E9LA 1WCBA 4MJ2A 1O7SA 1CU4H 15C8L 1I7ZB 4OT1L 5TDNA 4NKDA 2B5IC 3RWIB 5JW5A 5E4EC 4AEFA 4KHTH 3VI3E 4NC2B 4QEGA 1I9IL 1IM9A 4PGCB 5FHAH 1RZJC 1UG9A 4HHAB 1BLNB 4NHUB 2J88L 1OAXL 5ESQA 3BRDA 3I75B 2F5BH 4JB9H 3LS5L 4JM2F 1TFHA 1MREL 2DQCL 3RGVB 4XPAL 3GMOB 1VB9A 3QNXA 4UTAL 4YHLH 3RIFK 1IGTB 3N85H 2X5PA 3UTTD 2VQTA 1A22B 1TPXC 4M1CC 1DJSA 3OKEB 5B3JF 2E27H 1IBGH 2PXYC 3VXME 4R90L 5ALCH 5GSVB 1N64H 2PTUA 5AZ2L 2A6DB 4AEIH 3P0VH 1IZKA 4MAYC 3MZGB 4BQCA 4BSWA 2HT4D 1UB5A 3MRMB 5DK2A 4ZPTB 3KYNA 3QUMB 1QLRB 5IIEA 1AE6H 3U79A 4DN4L 4DFIA 4KJQC 4X4XB 2HFEB 4PGJA 4G6FB 3O4LA 4FTVD 3PV6B 1R5IA 3VXMA 1GC1L 3BGAA 3BPLC 4K7FA 4P5TD 3QDMB 5IQ7H 5F9WB 3TVMB 1RJLA 3RDTB 4U1SA 4ETQA 1BBDH 3DYMA 4Z7WB 3ARFD 2B1AH 4I48B 4BH8A 1HINH 3QUXD 1QR1A 4OI7A 2Q87A 2Z4QA 3FMGH 4Y8DC 3LDBC 3LKOA 4LF3A 4Y4HA 5T33H 2OJZH 3NH7H 1NFDB 3BUYB 4OD3H 1R3IL 4XMLH 5CILH 1T1XB 2BFVL 4NQDB 5GRUH 4LEOB 2FX8H 4GH7B 3QA3A 1FYTD 3I6GA 4MHHI 5F9AC 3ECBA 1FO0A 3OV6A 1NMBL 3VXPA 4TSCL 3WN5C 4I18A 1K8DB 3RWJB 1LO2L 4JG0L 5F6IC 2GJZB 1X6NA 1ZV5A 1BD2D 5GRJL 1IKFH 1FV1A 4V1DA 3HI1B 4NZUL 4YHPA 3BFOA 4HEPG 4P57A 5CJ8A 4WGWB 5HDLA 4N9GA 4DGYH 5GZOC 3SCMB 2EDTA 1W0VA 4ZMAT 1IAIL 4BK5A 3RJDA 4KH2A 1KXVC 1T20A 3VXTB 3SE9L 1A7OL 2YOCA 3VXQA 3ARGD 1ORSA 4HJGB 2MQ0A 3ESUF 1ZLSH 3GSOB 2D7PA 2XZQL 4PV8A 5JLZB 4A6YL 4Y16D 1ZT1B 4GUPA 2AJXH 4F15C 4KI5F 4D0BB 3MLXL 3MFFB 2HJLB 3CZFB 1MFCL 3UTQB 4KKAD 4RQQA 5D8JL 1E6JL 3CFJA 3S34L 5I71B 3WLWD 2I07A 4H5SA 3OKKB 3O8XD 4NHCL 3LN4A 5EN2A 2D3VA 3VXUD 1NCBH 1Z9OA 3OJDB 5AG8A 5LGJA 3OAYH 4KTEH 3JTTA 4WU7B 4UV4H 5C0EA 1TXKA 1KCLA 3U9PH 4JO2H 2M8XA 3QULB 1NSNH 3QI9D 1KCRL 3QAZB 3BH9B 5LBSL 3PJSA 4MD0A 3KWWA 5CJOH 4AH2B 2QL1A 4M4PA 5IROC 2Z8SA 3HE6D 1AO7B 4EI5C 2WINB 1JF6A 3UBXG 1P7KB 1NGWB 2PTVA 1WTLA 1HIML 4OIBA 4QWWC 1ZHNA 3T77B 3TESA 1M7IB 4I5BA 3B6SB 5M94B 1KNOB 2WQ8A 4Q0XH 3GHBL 3WO3B 1KIPB 3U7AA 3DGGB 1C08A 5E5UB 2F19H 3CFCH 4PD4K 4XNMB 5HVGB 3HR6A 1FVCB 4ELKA 4F8TA 4TTDC 4M8QA 5E2UL 5F6HI 3VRJA 1GJIA 3ELAT 2YWYA 3QDJB 4KKBD 1FRGL 3ZE2F 2W9LA 3CFDA 2PW1B 4DZ8B 1OTSC 5FECA 4XGZA 2FR4B 3JWDL 4YNYB 1HHJB 1EVUA 5I6XC 4LNRA 5KSUB 2D0HA 3EDDA 4JZJC 4OCXH 4OAWB 5ETUB 1CDBA 5E2WH 3TNNA 3OB0K 5HHQB 3B5HA 3QHFH 1T0MA 4XRCB 1KXQE 3PIQA 3T2OA 4K7PY 3CVHA 4YQXL 4KI1A 2AJVL 3D69A 2A74B 1WBZB 5IMKB 2ATPA 3NGBC 1J0KA 2MHAA 2AJYH 3O6MH 2ZP0T 4CMMA 1EBPA 1WFOA 5E8DH 5F3BA 1F8TL 1KJ2H 2VLKE 4Z7VE 3TGXA 4LCWB 4XC1L 2YEZB 4FQXD 2VDML 4S1RH 5ANMB 4TSBL 1IC4H 1KV3A 2NY4D 1NC4B 4GKSB 1KCVL 1MCHA 4XVSH 3EO0A 4IMLA 4JG1L 4PS4H 2MQ3A 1MY7A 3O2DL 1WV7T 3GRWA 5E94A 5E6YA 2HRPH 3R0NA 4H0IA 6FABL 2VLKA 4Z7VA 2P45B 1AGFB 3EO1A 1KIRB 1OT1A 2X09A 4PREA 5KAQF 3U46A 2WIIA 3UJTL 4UOW1 1DL7L 1VEOA 3V5DA 3SJVD 5HGBB 2CLVA 1E4KC 5EC2B 1MWAH 3FN0H 2VWEE 1YMHA 3L6FA 4O5LL 1QLFA 3MLRL 4LHJB 1H3GA 5SWQA 4LASH 4UMGA 2HLAB 4TVPE 5B3JE 3ULUF 2VL5B 3GJEA 5ICXA 1EFXD 2YPKB 4CVZB 1C16B 4R4FL 1O5DT 2Q8AL 4MQ7A 1YEFL 3FTGB 2HTLD 3UBXI 1BQHB 3GGWA 2IPTL 3NCYS 1TJHH 4JM2A 2EH7L 4LHUB 3OGCB 3ARZA 2IGFL 4RMTA 1A7QL 2BNRD 4KFZC 4YDVA 4YX2L 1J8HD 1W72H 2MNUA 3O6FD 3LAFA 1XH3B 2BVOB 4XNZB 3IU3B 2JKXA 4ZTPL 1MIMH 4IRJC 4ZUUB 1NCCH 3CUPB 1Q9WA 2DDQH 3BE1H 1I9EA 2VDLH 1TIUA 4PJDF 4GRLA 2A73B 3QPXH 5E5RB 5TF0A 1OAUH 1H8SA 1K5NA 3HZMA 5DK0A 4HFUL 2LV4A 2DYPB 1F6FB 1HHHA 4RGNB 2DM3A 1HKFA 5DURB 1G7HA 3ZSTA 1G9EA 2MOVA 3KYMA 4JHBA 1G9NC 2Z8VC 3E8UL 4Y4HC 1BFSA 3KDMA 2EKSA 2Y06H 2WANA 4HS3B 1FAIH 3GSXA 4P59L 3OZ9H 2EZ0C 2EDOA 1FC1A 1K9TA 4PGBB 1ZS8A 1X6LA 2GQHA 2HFGL 3R1GL 1CFTB 3HG1B 1NGQL 5A2IH 3GSNB 4E5XB 3GMNB 5D7SH 5CD3A 1XGQA 3HI5L 1A7RH 5CJ5A 5DEFB 4RGOL 1KTLB 1JPST 2OXGA 2X4PA 3FONA 4YAQB 1R5VA 4HBQA 4PLJC 4I18C 5DRZB 3ULSA 2DQJL 1GPOL 4HCRA 5HDBF 5C71A 1S7VB 2EYSB 3HB3D 1DBML 4ISVA 1FZJB 5LGHH 1JWSA 2IC2A 5HYJE 1F13A 3P0YL 4UDUA 2C7UA 4I4WA 4F33A 2VAAA 4CW1A 4L4TB 1LE9B 4RNRB 3LKNA 2EECA 3IFPB 2X4OA 7FABH 1U8JA 4D0DA 3U7WH 3QEGH 2DLHA 1MJUH 2OS7A 4YFLF 3W11D 4NQSA 2EE3A 1NLBH 1CQYA 5IF0B 3WV0A 5B4MC 3QPQC 4Z78B 4LVHC 4ZUSB 2XY1A 5CGYC 4PGDA 1MCLA 4XAWH 1G6VK 5HYJA 4WJ5B 4UQ3B 3WSQL 4ZFFB 2ZCLL 5FA3A 3SE4A 4LPYA 1UKQA 2VNCA 4LSUH 1DVFA 5DUPH 3ARWA 1SBBA 5KVFL 1S78D 1FLRH 3WNPA 3VW3H 2FSEB 2OBGA 5BZWA 1LNUB 2OL3A 1F2QA 3KJ6L 1YNKH 3AXLA 5CIPA 5I1IH 2N7BA 4JDVB 2QHRH 5FYLH 3BI9X 1K3ZA 4C83A 2BC4B 4P2OA 1H0DB 3GKZA 4MA1C 1SEBB 2X6MA 4IIQB 3TCLA 3EYOB 1MFNA 4X5WA 3EFDH 2QKIB 2XG5A 1JV5A 5CSZB 5K9JL 5EBLB 2Z93B 4XT1C 3IU4L 3RFZC 2XNAB 2M1KA 5DLML 3DVFA 1MLCB 2W07A 1T83C 3ZYZA 5FUCE 5HPMA 4S0SD 3VFNB 2LTQB 5EU6D 1TLKA 1U58A 4WY7H 4JY5L 5C09B 5D1QA 5EOTA 3ZDYF 3ZE2E 1JNLH 1T66D 3PP4L 1C1EH 1GZQB 1S7SB 3MR9A 3RZCD 5CMAB 3HN3A 3ROLB 2CKBA 4GW5B 1MEXL 4QRQA 4AEHL 1I3RB 2EC9T 3V0AC 1A14H 1VCAA 3QUZB 4YWGL 1NGYA 1OF2B 4XCEB 3MODL 4KMLB 4KK8C 1H9VA 1OTTC 1TZGL 3BPOB 5D71L 1P4IH 5HVHB 4KDWA 1NAMB 4X5XA 5I1CL 1QBML 4WDIB 4DOHB 1C12B 3NTCL 4PP2A 3EDEA 2XA8H 4LK4A 1CZ8L 3STZB 5HDQH 3VFGH 1DLHA 4OCRL 1FFQA 3QUKA 1U2CA 1QBLH 4KUCD 1E4WL 4HFWA 1FIEA 2HWZL 3EOBA 4F2MA 2B4CL 2V7NA 4UIMB 4R97B 1MPAL 1H3VA 5D96C 5IB4A 1E6OL 4QYOA 1CD9B 1H3XA 3CNKA 4HK0A 3Q5TA 3G6AA 4ZS6C 2NYYD 3W39A 1EO7A 5F88A 5IHZB 4Y5XB 4G6JL 1H3WM 1TZIB 1RHHA 3QQ4A 5IBTL 4WV1B 2CLZA 4M3JA 5JXED 4H8WC 4PJ8B 4RDQF 1IL1A 4YGAB 1J18A 4I3RH 3GMLA 3Q0HA 3FRUB 5IFHH 3S37H 2OYPA 3BO8A 3NPSB 2B5IB 5GSRB 1E0OB 1XGTB 4HKZA 3RTQC 3MZTA 3WDHA 5B8CA 3THMH 2UVEA 3MA7B 2P8PB 3MQIA 3QHZL 5DQJB 4MXQC 3V2AR 1IM3A 4MDIA 1SEQL 4ONOA 4X99A 1AIFB 1DBJH 1IE5A 5EO9B 1KN2L 3GK8H 1NC2A 4RWHA 3VXSD 4RAVA 3ULUE 1J0JA 1RK0B 1PZ5A 3BMVA 2VLME 3VMNA 1I8KB 3TYFB 4X6DE 1I8MA 3FO0L 2WWKT 5EA0L 5ILTL 4WWKD 5J6HB 3QUMH 1TPXB 5AZEL 3S98A 4PJBB 3OKLA 4Z7OF 2PXYB 5CEYB 5T1MA 1MCBA 3PHOB 4MAYB 1OP5H 1BJ1J 2BMKB 2FL5A 3HZVB 1UFUA 1YEJH 3N06B 3QDGB 3IJYB 1HDMB 4P46D 4RBPH 1A47A 4B0MM 3U7YH 4MCZB 1WFNA 2C3VA 5H94A 4JO4H 3FOLB 4Q97A 1BVKA 2FJFB 4KK6C 1HQRA 4PJDE 3BPLB 4LLMA 4DW2L 1CFSA 1PG7H 4MNGE 4GMSL 3L5WA 2H32B 1NGPL 2XQYG 3S3PA 4O02H 5E2VH 4OZGF 1HXYB 4GRLC 1P4LA 3KGRA 5EOCL 5E95B 1Y0LB 4HH9A 2IADB 3C60A 5D2NE 3LDBB 2Y5TB 1JPFB 1LD9B 5KVDL 1JL8A 4YBLC 5J0BA 3CK0L 4HDIA 4PJFB 4PJDA 5I1AA 2R56H 1A6VH 2PN5A 1K6QL 4ODXB 1YQ2A 4JANB 4MNGA 3UTSE 5C08D 1NANI 1VHPA 1F42A 3UPRA 1CU4L 1I8IA 1AR1D 1QNZH 3LCYA 3LSOA 1QFUL 1RZKC 1YDPA 4N0CD 1I7RB 3I02A 3SKJH 2ZSWA 3FKUS 4BZ2H 2QHLA 2FX9H 5J06A 3MRQB 2BY2A 4M5YL 3RWHA 4YO0A 5D2NA 4AG4L 1CI5A 3T65A 3QIBA 1G9MH 3LQZB 1YYLH 2E9JA 5GRXG 4BKLB 3WN5B 3WFBL 2H2PC 1LGVA 5ITBH 1MNUH 5F6IB 4LPXA 3A67H 3UTSA 1MFDH 2DMBA 5IKCB 3HC0B 3NCEB 3DSFH 5GXBB 4XCFL 2OZ4A 1JPTL 3VXOA 3DECA 5ALCL 1NCUA 2AK4B 2FATH 3P0VL 4M93C 2AK1L 2NY2C 1EO8H 1URLA 3MV9B 1EFQA 5T1LA 1AXTH 1AE6L 4PJCF 5D1XD 2ID5A 1HWHB 4F15B 4JFZH 4AIXA 4L29B 4R3SA 5ACZA 3X3GH 1DUYB 1VACA 4PG2A 5DUML 2K7PA 4ZDHB 1SJHB 4PJ5D 3RWDB 3L3KA 4WFHE 1NDMB 1KIUA 2BX5A 3QXTA 4AEEA 1BBDL 4G9FD 3MOBH 2EDJA 2NPLX 5F72S 2WP3T 3BSZH 1XGRB 3EYUH 2ITCA 2E6JA 3MJGX 2VXUH 4LVNC 3RPIB 3MUJA 5F7DB 5I8CB 3NFSL 3OG4B 5EUOF 2G75B 3TNMA 5FEBA 4YXLL 5F93C 4L3CA 2DJ4A 5CP7A 1UWGL 3SE4C 3J8F7 1DVFC 5AUMA 3STLB 2FX8L 4XZUA 5DHVB 5EO0B 1IKNC 1Z3GL 2VLLB 3ORJA 4MVBD 4JHWH 5D1ZD 5FYLD 3O2VH 5DVLA 3VE0B 5J1TC 3IDXH 2H45A 5D7LE 3RA7L 3DUUA 3L3JA 1CGSH 4HLJA 1A5FL 4YHNA 5IB3B 1LO3L 2O61A 2AEQL 2HLFC 3RGHA 1IAMA 2NY3D 5EU5B 4P2OC 1YN7B 4M6MH 3QZWA 5I18L 2VIRA 4WFFE 5E6IA 3WFCH 1IKFL 4PRHD 1FLTX 3P4MB 2X4NB 4ENED 4XBGA 4DGYL 1TITA 1JYVA 1LO4H 5HGHA 5CEXB 1SJXA 5BXFA 1FN4A 3ZKXB 4WHTB 1FCCA 5D1QC 4WW2F 2Q6WB 2E7BA 1RVFL 1RZIB 3H9SE 5JHDD 3UBXB 3DMMA 4LIQE 2V2XA 3GKWH 4P5MB 1N8ZB 3LRSA 4RZCA 5I6XB 5DFVD 3PUCA 1SQ2N 4JZJB 1XF2A 3TWCL 1PQZA 3FT4A 5IW1A 1QSVA 1GIGH 3QFJB 4DGVL 5GZNC 3MRHB 3LKPA 1AY1H 3KPSE 5DRWB 4Q6IA 3OXRA 4HWEL 3VFRA 5KN5A 3G6DH 3FOMA 2EDEA 2A83B 5IVXF 4HEME 3VRIB 3NGBB 9CGTA 1E28A 3D18B 4PD4J 1T3FA 4ZAKA 1NCBL 3SDAA 5BVPH 2WNGA 1JRHH 4UV4L 3G5VB 5T3XH 1FPTL 2F15A 5E2TH 4QHLA 1T5XA 4JO2L 4EOWH 1NSNL 3KPSA 5DHYB 4AK1A 4XBEL 1U3YA 3V4PL 1SYSA 3WD5H 4LLWB 5CBEB 1M7DB 3B3IB 3AU1B 5T3ZL 2XZCL 1Z0NA 1S9VB 2PW2B 3UYRH 5KAQG 1G0YR 1EGJA 3RKDD 3ET9F 4HUMB 3TN0A 4OD1H 5GS1A 1OD7A 2P8LB 5IOPA 2OTUB 5MENB 4AQOA 1OT2A 5BZDA 3RI5K 1FCGA 3MV8B 3PL6C 4Q0XL 1WCBB 2FECL 3C09C 4I13B 4B41A 3GSUA 5TDNB 4TUOB 3C87A 4NKDB 4B7LA 3CFCL 4BH7A 5JW5B 1HCFX 3P77A 3WFDH 3PDDA 1IM9B 5B8CC 3I2CH 5ESQB 4XP4L 4HJJL 3MROB 1FNAA 1IGJA 1QKZL 2JLLA 5CHNB 3UAJC 1MLBA 2ZUVA 4Z7OE 3NZHH 3UPCA 1B4RA 4OCSL 3G9AB 2VC2H 3QNXB 4Y1AA 4G6FD 2XXMB 5E8PA 4OCXL 5E2WL 2YMXH 3QDMD 3AB0C 3TVMD 2DQHL 3RDTD 2YWZA 2R69L 1WIUA 4FFVD 3UYPA 2HT3C 2H26B 4QRSA 5HHPB 3U6RB 3C9NA 4MQXD 5DK2B 3U1SH 1MCRA 3ULUC 3KYNB 5IIEB 4IRJB 2RCSL 3SEPA 3BDYH 3FB8A 2CKNA 3TO4A 4HWZA 2NX5E 5JMOC 1Q8MA 2VR9A 1QSFB 4OZGE 3VXMB 4NQDD 3ZSSA 4K7FB 1WJ3A 2VE6A 1WWAX 2RFXB 4P4KD 1RJLB 3Q3GB 3WFEH 4U1SB 4ETQB 4PS4L 1BOGB 3H9HA 4BFEA 4HUXA 3CJJA 5FO9A 5J7CC 1QR1B 5TF1L 4G9DB 3B2VH 3C60C 4KUZL 4YK4C 4HUKB 3LKOB 4GXVL 4XAKD 3GSNH 2NX5A 1J9CT 1WVZA 4QRUA 4MA7H 4OZGA 3MACH 3RL1A 2JJSC 5DS8A 3PWVB 4S1SL 4KK5C 3ZKMD 1FL5B 3QA3B 5HYEA 1MCFA 1MFEH 3ECBB 3O45B 3SCMD 4P9HL 1FO0B 2RQ8A 5C0JA 5FXCH 4LASL 3VXPB 3QIBC 2JCCF 4JQVC 1MCDA 3EO9H 4I18B 4TNVK 1B90A 3QBTB 2CXKA 3MJ7A 1CICC 1FV1B 3ROOB 3H3BC 4YHPB 5H35A 1JP5A 4P57B 2AXGA 3NIGF 4N9GB 1JHLH 4OV5B 1H3PL 4PJCE 3W0WE 2KDGA 4WHYG 2FLRT 1T20B 1I3UA 1W72L 4TUJA 4P99A 3SGEI 1ORSB 1YC7A 1T7XA 3ARPA 1MIML 2COQA 4PV8B 4U6TA 3RHWF 4C54A 4DCQA 3N1QC 3AFLA 3REWA 4DJMA 4HV8A 5I1JL 4N8CL 3O6KH 1BF8A 1EJOL 1X5JA 3EJYC 4YHKL 4J4PC 4LVHB 4PG2C 3CDGA 4NIKB 4PJCA 4RQQB 3W0WA 5B3NA 1RIVL 4N0YH 5EUOE 2I07B 1T1ZA 3C8KA 4JJHA 4YR6A 1PKQB 5IM7A 1AO7D 2ADGA 5HTSA 1QZ1A 1T1WA 1UACL 1A6WL 4FG6D 4HJ0C 1ZHKB 5LGJB 4LCYA 1U8QB 1MF2H 3LS4H 5C0EB 5I1EL 1EHNA 1KJ3H 4F7MA 2V5MA 5IHUH 3OR6A 4PJEF 2WW8A 1MH5B 5DMKA 4Z7NF 5EUOA 2QSCH 4MD0B 3EHBC 4I2XE 1KT2B 4JFDE 4LARH 5D7KE 2DL2A 4MA1B 4NQXB 1BQSA 3QDJD 4K3EH 5D7JA 4X9IA 4N5ED 5GS3A 2VDKL 3MOAH 5C0GB 2D7MA 1XEDA 2CK2A 2YPLB 4I5BB 5GGVY 5FYKH 4HMCA 4N1CA 5JPMB 5E6IC 5AD0A 1C08B 4I2XA 4JFDA 4MD5B 1R3LB 4BFGA 4HT1H 4KRPC 3TYGL 3TA3C 4ELKB 2ZKHL 5HJ3B 4M8QB 2VXTH 3VRJB 5JQHC 1NAMH 5ISZE 1IRAY 4JY6B 5EZOH 3CFDB 3SBWA 5D5MF 2LAAA 3PHSA 7FABL 5FECB 3DMMC 5GISL 3V6FB 4PLKC 4ODWA 4AL8H 1OAKH 1DQDL 4K23L 4YEFA 5IVXE 5IBLD 3R4DA 5GRVL 1AXSA 1N0LA 1NC4D 3GBNH 4AENA 3FCTA 4GT7A 1T0MB 5ISZA 3BESR 4Q6IC 3CVHB 5GJTH 3LKQA 3LD8C 4JKWA 2DM2A 3FL7A 1FAKT 2MHAB 4UT9H 4ZAKC 5FGBA 3SDAC 4CMMB 5D96B 1TNMA 5A16B 3EJZD 4G8IA 5F7NC 3T0XA 3HC4H 1FLRL 2AJZA 5IVXA 4RDQG 1YNKL 2G9HB 3K2UH 4YFLI 5I1IL 2I25N 1LEIB 3ARYA 5C2BH 2LU4A 3EO0B 5FYLL 3Q6GH 4IMLB 4WFEE 1BZ7B 1Z9MA 1VADA 5IB2A 4DZBA 1UQSA 1RZJH 3TP4A 3EFFA 3WO4C 1S9KC 3EFDL 3TN0C 4NQEE 4MQTB 3QQ3A 5GS1C 3LVEA 5E8NA 1XAUA 3BYYA 3U30C 3EO1B 3C8DA 2EYTA 4NZRH 3RX8A 2WK2A 5ITFB 1S7RA 3RTQB 5J57B 3CLEH 5F7FA 1QA9A 4J1UA 4FQIL 4WY7L 1LO0L 3V5DB 2CLVB 1JNLL 1N5YL 1C1EL 3D85A 4LHUD 3AM8A 4JLRB 5IEKB 1YMHB 3L6FB 4UIKH 3SQOL 5FB8A 2FNBA 4ERSH 3ZTJG 4NQEA 5SWQB 3MLZH 4GLRI 1HOCA 4X6CF 2F8VA 3DRTA 3UDWA 1A14L 3U0TB 4CVXA 4M3KB 2X89A 4HKJA 4MZ3A 5ICXB 3GMMA 5JIPA 4CKVX 4Z77A 1RZFH 3LEYH 4HIEA 4PJAE 4MQ7B 1P4IL 2GIYA 5EZLB 2GK0A 3GGWB 5SV4A 2H32H 4HKBB 5C9KA 3LQMA 4D94A 5KG9A 2XA8L 3VFGL 4KMTL 1NAKL 3VA2C 3MBXH 3BMWA 5HPOA 2DYPD 4YHMH 1SM3H 4RGND 1TJIH 5T1DH 1NH6A 2X9YA 5DURD 4PB9H 5IVZA 2ENYA 4X9HA 1I7TA 4DGIL 4EQ3A 2XZAL 3QIUC 1GGBH 4PJAA 5DYOB 1Q9WB 3IAGC 3TO4C 4GRLB 4MZ2A 2R4SL 1KTDA 1RHFA 2X4SA 2X10A 3V4VL 2HVJA 3M45A 1NBZB 2BVPB 1HILB 4NRZA 4Z7QF 1FZOB 1K5NB 3HZMB 5DK0B 2QQNL 3HG1D 4YBLB 1Q9LA 1HZHH 1HHHB 1A1OA 3QG7H 3EKCA 4PGZA 5IFHL 1G7HB 3S37L 3ARXA 4NBXB 5CJQH 3I6KB 1U9KA 3S36H 1FNHA 3KDMB 5JZ7D 3D6GA 1NLDH 4DUVA 1E27B 3GEWB 2CDGB 3S7GA 3P11L 3LH2L 2JIXA 1U8OA 1ZSDB 2OP4L 3BP6A 1K4CA 1WCQA 1M71B 1QFHA 3DX6A 2JCCE 4S2SA 4N0RA 1DBJL 3VFWA 3GK8L 1FNLA 4LFHD 3ULVD 1PX4A 5CD3B 1XGQB 4WUKH 3VD4A 2F54B 1YJDL 2X4PB 3FONB 4L4TD 2XTJE 3RVXD 1C5DA 3RY4A 5GGTH 2X4RA 1S7WA 3ULSB 4YHYC 4ORZC 1WWWX 4Y5VC 4M93B 3QIWA 2PETA 5L9DL 1DFBH 5D70H 1BFTA 2JCCA 2NY2B 3BD3A 2P8MA 3FQXA 1KLUA 4LKCA 4OFVA 4ZFGH 1UYWH 5C6TH 4ISVB 1MCNA 1A4JB 3HNTH 5DZLA 4UDUB 1JNNL 2C7UB 4I4WB 1X5XA 2W0PA 4DUWA 4JO4L 4F33B 2VAAB 4CW1B 5C7XL 1M6OA 2X4OB 2X70B 5IBUG 1U8JB 4D0DB 1PG7L 1EMTH 1F6AA 4EUPG 4NQSB 3MLSL 2BSTA 4AT6A 1HHKA 4I9WD 5DHVH 2EH8H 4WCYH 4UQ2B 1J7VR 4PGDB 4KZEH 4LVNB 5D93C 5DRXB 5HYJB 4ZO7A 5CJBA 5FUZL 5I1GH 2DQEL 4GAGH 3FB7A 4M7JH 3BRGC 1A6VL 1FVDA 5E7BA 1DVFB 2VISA 2NZ9C 1T5WA 1QNZL 4Z7NE 4U1NA 1UXSA 3VFVA 1XCTB 1MUJA 4LCUA 3G04B 4NRXA 5DJ2B 2OL3B 5I1LA 1T2JA 1F3JB 2K3TA 3AXLB 5C09D 4XHJD 1HH6A 4XTRD 4C83B 4OZHE 1WEJL 4P2OB 2BNQE 5ITBL 1MNUL 4PJEA 4PFEA 1MFDL 1J1XL 4L4VD 1TVBB 5FYKD 1QHOA 4X5WB 3DX9A 5D7JC 1RIHH 3DSFL 1JV5B 1HSAA 3LKSB 3QUZD 1RURL 4A2MA 3ES6A 4DTGH 5DQ9B 2FATL 3BN3B 4JY4A 5HPMB 3FZUD 2GT9B 1QUNA 5D1QB 3ARBA 5HDOA 5EOTB 4OZHA 2BNQA 2AEPL 5JW3H 2P46B 3BKJL 5D5ME 1AXTL 2ZNWA 3O6LH 4R4ND 5KSVA 1K8IA 4OLZL 1T03H 1RFDH 2X4QA 3CH8A 1JZ5A 4JFOA 4JFZL 5L7XH 1KOAA 3K4AA 3VRLF 3X3GL 4UZGA 5TQ2H 1NGYB 1R3HB 3BW9A 3CXHK 4H26A 3QFDB 1CXHA 2HT4C 1T7ZA 3QDHA 1BAFH 3WL9A 3MOBL 3L3OA 2C4FT 3TBWB 1OQOA 1UH2A 4N9OB 4X5XB 5D5MA 4PP2B 3WE6A 2VDPH 5E9DA 4HKXB 5FA4A 4PJ8D 1YEDB 1Z9LA 3QUKB 1R3JA 4OFPA 2ITDA 4HFWB 4P5TC 3EOBB 4F2MB 4NWTH 2XYCA 2V7NB 5FGBC 4XP9H 4ONHA 4K94C 5TPWH 5IB4B 4QYOB 4PRPE 4NC1E 4EXKA 3G6AB 3IDXL 2EEDA 2O5ZL 1SJVA 3LV3B 3W39B 2YRPA 5F88B 3PABA 3BIBX 1CGSL 3CPLB 1RHHB 3QQ4B 3DETD 5JIKA 3QWQB 2CLZB 4YGVB 3QEUB 4R4BA 1IL1B 5IG7A 1JGEA 4M6ML 1PEWA 3GMLB 3S88L 3PL6B 4KQ3L 3ZE1E 3C09B 3O3AA 3WFCL 5FHBL 3BO8B 4PRPA 3HLAB 3I9GL 3PQYE 4ETYA 4M1CD 5SV3A 3RAJH 3RP1A 3SKMA 4HKZB 2F9BT 3HR5B 5B8CB 4MAYD 3KPPA 1X5GA 1DQLH 2ZNXA 1QPXA 4X6CE 4LSPL 3QDGD 4MDIB 1ZLWH 4X99B 3AM8C 4BFIB 4HAGA 4XWOC 4U2YA 3T4AA 4KJQD 3MO1A 3H3PL 4XXDA 3PQYA 3VD3A 1OAQH 1GIGL 2C1OA 3AB0B 5JIIA 3BPCA 5T1MB 3L5XH 3FN9A 1AY1L 2ATKA 1LWRA 1QSEE 2NY1C 1FL6A 4JCMA 2XOTA 4X6CA 5JIHA 1T0PB 4MNQE 4QOKE 4S1DC 5DD6A 4M1DH 5SWSE 4PG9A 5BVPL 1P4BH 4X6DB 2ZG2A 5EB9A 2CDEA 3SOBH 3GM8A 2C3VB 5H94B 1B0RB 5T3XL 4JPWH 1BVKB 1HQRB 3Q5OA 4LLMB 1G9NH 4M8VA 1CFSB 1QSEA 1CTOA 3L5WB 5KVEH 4P9MH 3O8XC 4Z7QE 1JGLH 4I1NB 4G6ML 1N4XL 4MJ5A 4MNQA 1YA5A 4QOKA 3S37X 4JFEE 5SWSA 2V5TA 1P4LB 4GW4A 3ZKQD 3UYRL 3CSYA 5B38B 2KL6A 3TV3H 2NY5C 4Y5YA 4OD1L 3C60B 4P49A 2YUXA 4YK4B 3OX8A 1FO0H 4MX7A 4HDIB 4XI5C 5I1AB 1B6UA 2VQ1A 5FM8A 1YMME 5LVEA 3GB7A 1G7PA 3BVNA 3T2PA 3PGDB 4OJFL 2J8UF 2J4WL 1CL7L 1YDPB 4G8FA 3I02B 2ZSWB 1II4E 3OXSA 3UTPE 1IZJA 5GZOD 4JFEA 3MC0A 1SMAA 5HHOE 2AK4D 1MIEH 3T65B 3QIBB 3O3BB 3MV9D 3ARDA 4LCIL 5ALBH 2ZJSL 3MLUL 1BJMA 3E0GA 5K59F 4DKDC 5I17A 1YMMA 2NW3B 5F7MC 2DAVA 3DUSA 3LZFH 3B5GA 2VC2L 1PW3A 4KC3B 1CICB 3ZT5A 3FFCE 4NJ9L 1WK0A 2VN4A 3BP7A 3VXOB 3GO1L 4ODSH 4JQXA 2YMXL 1I9JH 5HHOA 1A7PH 4OZ4A 1N6QL 4RGMC 1E4XL 4H88L 2R0KL 3V7AE 1ACYH 3GSRA 5B39A 3L7EB 3NFPA