4Q9GA

Crystal structure of k12v/c16s/c117v/p134v mutant of human acidic fibroblast growth factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
b'HHHHHFNLPPGNYKKPVLLYSSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILFLVLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 1
publication title Mutation choice to eliminate buried free cysteines in protein therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4q9gA00
2BEBA 1S0EA 3AZWA 1HIBA 1T4QA 4I4YA 5FZZA 4OEEA 2DRYA 1RMLA 3AKHA 2Y9GA 2F2FC 3FUQA 1Q04A 4ZKTB 3FJJA 7I1BA 2KI4A 3HN1A 1YXWA 2QN4A 4P0JA 2X2SA 1W3FA 2ESUA 3KMVA 3O4CA 1JY0A 4I4OA 1BLAA 4GOVA 1PC8B 3NBCA 3V79C 3CRIA 3POKA 1G9DA 3NBDA 5FNXA 3WMUA 5D63A 2HWAA 3S8KA 1JQZA 4EEEB 3VT0A 3S8JA 4J2SA 5FNWA 3H6RB 4IY9A 1S0DA 2D20A 3E8LC 3CA1A 1DIWA 1NZKA 2D24A 1DFQA 3CA6A 2D43A 3CA3A 5GAQA 4P0KA 3WO2A 3SNVA 4KEIA 5G00A 1EPWA 4I1BA 2Y9XE 1IHKA 5BQUC 5HPZA 5JLVA 3VSZA 3BRFA 3N7JA 3N7LA 1I1BA 1DZDA 5BXSA 1TIEA 3B9UA 4LO0C 1IRPA 4I8MA 2UUSA 1HWNB 4G6JA 3N7KA 1DJSB 2Z48A 1JTCA 1TFMB 4GOYA 3OGFA 4DENA 1HCEA 3UD7A 1Q03A 5DUYA 3N7MA 4LO1A 2P39A 4I1EA 1T9FA 2D22A 1FWVA 3W9TA 2Y9FA 1W3GA 4FVVA 4R6UB 2D1ZA 1AVUA 4A7KA 3A22A 1FQ9A 3FJEA 3CAHA 4LO0A 3T8SA 3H6QA 3MPPG 4HA2A 3BAOA 4JKXB 2WBCA 4QD2C 6I1BA 3CA5A 3I2XA 1JT4A 2KI6B 4I4PA 4GAFA 4L4IA 3H6SE 5BP5C 2J3PA 4I3NA 2GZBA 4KC3A 3P53A 2E4MA 3FJCA 1HWMB 5DSSB 3BAUA 4JAWA 1QQKA 4D0TA 1S0FA 1TP0A 2RQ9A 4OWLA 1HWOB 1EV2A 2P23A 4LO7C 1Z0HA 4QBVA 1V6UA 3WINA 4Z9WB 31BIA 4Q91A 1W3AA 1FMMS 4G9MA 3AJ6A 5FZUA 1BFGA 1PUMB 2ERMA 4KEJA 1I1EA 4OWJA 2KLLA 4I4VA 3PUBA 3V0BA 1ILR1 1MD6A 2XOAA 3F62B 1BLDA 3JRRA 4OUJA 3CRHA 5B2HA 4IY8A 1S0BA 2VSAA 1AVAC 4I4SA 2D7RA 3Q7WA 1NUNA 2K43A 1R8OA 4I4RA 5DVHA 2RSTA 4A7YA 1V6VA 3FJFA 4J2KA 3EF2A 4FGFA 4IZEA 4EFPA 1HKNA 4WBCA 3FJ9A 4OWKA 1PZZA 2AFGA 2YUGA 3AH1A 4I6IA 3BA4A 4A7ZA 3HMYA 2X2TA 1JT7A 1IOBA 3QR5A 3UD8A 4D8HA 3ILAA 2NYYA 4I7IA 1G9AA 3OBTA 1E0OA 4LO2A 2Z49A 3OJVA 1BFBA 3FJAA 1IILA 3VWCA 3I2AA 3A23A 3D7WB 2NZ9A 1K5VA 3JUTA 2BFHA 1YBIA 1ABRB 4QBCA 4LO1C 4YOLA 3PMEA 3MALA 1BA7A 3UDAA 5JMCA 4I2SA 5D61A 3FJ8A 3A21A 3ZXGA 3F1RA 21BIA 3IAGC 4EFQA 4GAIA 1M2TB 1IRAX 4OEGA 3UJ4A 9ILBA 5F8YA 4X37A 1F31A 3CA4A 5F8WA 3AH2A 4USPA 3QYDA 4QC4A 3CA0A 4EB2B 3AKIA 3O4DA 4JKQA 2M49A 1TWMA 3OJMA 2R9KB 2VSEA 4QKRA 1DQOA 3FGMA 3V0AB 2E4MC 4II0A 1CE7B 3BA5A 2VXTI 5F90A 2NTDA 1JLYA 3HSMA 4GP0A 3RSJA 1AVXB 4IZXA 1N4KA 2HWMA 1CVSA 4I37A 2FDBM 4HR6C 2MIBA 3IM5A 1AFCA 1IJTA 2QYIB 3WINC 2KKIA 5EG6C 3O5WB 3FFZA 1S0GA 4ZLBB 1ITBA 2GO2A 4OW4A 4F83A 1GGPB 1UPSA 4D0ZA 1MC9A 2MC2A 4I4UA 3FJDA 1FWUA 3IM6A 4X38A 1XZZA 4DCKC 1FGAA 3H6RA 3R4SA 4Z8SB 4ZFUB 1IT0A 1DQGA 5DZUA 3BA7A 4JPZA 1DLLA 1YTOA 4ISQA 3O3QA 3ZXDA 5BOWA 1J0SA 1BFCA 1G9BA 4ZFYB 1JLXA 4JP0A 1G9CA 4XFTA 4HJJA 3P6IA 2L5XA 3OJ2A 1Z2VA 1OQLB 1SR4C 4KEKA 3IM7A 2LIEA 1XYFA 2DREA 1PWAA 4ZFWB 4F34A 2AAIB 4XFSA 4J2XA 1YYNA 3UJ0A 4H04A 4DEPA 4LO2C 2NVHA 4IHZA 1BARA 3C9ZA 2FFUA 3V0AA 1ONKB 4EFRA 2HW9A 3FJIA 3VSFA 5BVPI 1D0HA 3RMYA 2K4AB 4ZA3B 1JT5A 4X3AA 2DS0A 2Q3NB 4I96A 2KH2A 2ET2A 4G9NA 3BAQA 1V6WA 1SR4A 4G1RA 4Q9GA 1EVTA 2HZ9A 3WO3A 3RTJB 2MLLB 1QQLA 3BX1C 5D62A 5EHAA 3P6JA 2I1BA 2F8XC 1FMZA 4G6MA 1ISVA 4IQPA 3NBEA 4H9WA 2RG9B 1Q1UA 4L4HA 1WD4A 1A8DA 3BRGC 4I4QA 3NBNA 1ISZA 4ZBVB 2VLCA 4QO3A 1QXMA 1HWPB 1FN0A 1RY7A 1EYLA 3WMVA 3OGGA 2WRYA 2Y9WC 3AKFA 1S0CA 3I29B 3BRDA 2NM1A 2AQZA 1V6XA 5E24E 4AN7B 1AXMA 1DFCA 1YF8B 4EKXB 3VT2A 3RMXA 2F2FA 3WO4A 1PUUB 1L2HA 4LO3C 3ZC9A 4J23B 4QD2B 3OBRA 1DZCA 4XKIA 4LO8B 3FUOA 1XG6A 1FV3A 1K5UA 4ZGRB 3LLPA 3CU1B 3A07A 4JQ0A 4OEFA 2VXRA 3RTIB 2NP0A 5BXTA 3IIRA 1KNMA 2ZQNA 4XFUA 5BXRA 3V0BB 1BASA 3N0KA 4IONA 3CRGA 1ISXA 1G82A 2Q9XA 4GP3A 3AKGA 3WA1A 3CQAA 4LO7B 4AN6A 4LO3A 2FGFA 3O4OA 1S0LA 3ZC8A 1HCDA 4ISRA 3BAGA 5BQUA 1ISYA 5F8SA 4X39A 3O44A 3FJKA 3PHZA 1TOOA 2K8RA 3FJBA 1RG8A 2D7IA 3VUOA 4J2YA 3FJHA 2DRZA 1AVWB 3LTQA 3K1XA 2IHOA 1M16A 1WD3A 1R8NA 4Q9PA 1RZOB 3AZVA 4KBBA 4USOA 1II4A 1FV2A 5I1BA 3TC2A 2D23A 4P0LA 2BEAA 3AH4A 3HALA 3O49A 4ENDA 3O4BA 1SZ6B 1Z4SA 2FO1A 1ISWA 3VEQA 1TTUA 1AF9A 3BTAA 1WBAA 3AJ5A 3VT1A 3R4UA 3O4AA 8I1BA 2AXMA 3Q7YA 3BB2A 4CJMA 5BXPA 5EC5A 3Q7XA 3NJ5A 3BAVA 4I0YA 2FFVA 3BAHA 3ZX7A 1XHBA 1P63A 4TLPA 4ZOTA 4P6AA 3BADA 2IWTB 2VUAA 2ZR1B 4QKSA 1TWEA 4I4XA 4IYBA 3HBWA 4PC4A 5BP5A 2D44A 3UD9A 3HOMA 2VU9A 1BFFA 4QALA 1JT3A 2ZQOA 5FZYA 1VCLA 3PG0A 1WBCA 4JRAA 41BIA 2LIQA
chains in the Genus database with same CATH superfamily
2BEBA 1S0EA 3AZWA 1HIBA 1T4QA 4I4YA 5FZZA 4OEEA 2DRYA 1RMLA 3AKHA 2Y9GA 2F2FC 3FUQA 1Q04A 4ZKTB 3FJJA 7I1BA 2KI4A 3HN1A 1YXWA 2QN4A 4P0JA 2X2SA 1W3FA 2ESUA 3KMVA 3O4CA 1JY0A 4I4OA 1BLAA 4GOVA 1PC8B 3NBCA 3V79C 3CRIA 3POKA 1G9DA 3NBDA 5FNXA 3WMUA 5D63A 2HWAA 3S8KA 1JQZA 4EEEB 3VT0A 3S8JA 4J2SA 5FNWA 3H6RB 4IY9A 1S0DA 2D20A 3E8LC 3CA1A 1DIWA 1NZKA 2D24A 1DFQA 3CA6A 2D43A 3CA3A 5GAQA 4P0KA 3WO2A 3SNVA 4KEIA 5G00A 1EPWA 4I1BA 2Y9XE 1IHKA 5BQUC 5HPZA 5JLVA 3VSZA 3BRFA 3N7JA 3N7LA 1I1BA 1DZDA 5BXSA 1TIEA 3B9UA 4LO0C 1IRPA 4I8MA 2UUSA 1HWNB 4G6JA 3N7KA 1DJSB 2Z48A 1JTCA 1TFMB 4GOYA 3OGFA 4DENA 1HCEA 3UD7A 1Q03A 5DUYA 3N7MA 4LO1A 2P39A 4I1EA 1T9FA 2D22A 1FWVA 3W9TA 2Y9FA 1W3GA 4FVVA 4R6UB 2D1ZA 1AVUA 4A7KA 3A22A 1FQ9A 3FJEA 3CAHA 4LO0A 3T8SA 3H6QA 3MPPG 4HA2A 3BAOA 4JKXB 2WBCA 4QD2C 6I1BA 3CA5A 3I2XA 1JT4A 2KI6B 4I4PA 4GAFA 4L4IA 3H6SE 5BP5C 2J3PA 4I3NA 2GZBA 4KC3A 3P53A 2E4MA 3FJCA 1HWMB 5DSSB 3BAUA 4JAWA 1QQKA 4D0TA 1S0FA 1TP0A 2RQ9A 4OWLA 1HWOB 1EV2A 2P23A 4LO7C 1Z0HA 4QBVA 4MZGB 1V6UA 3WINA 4Z9WB 31BIA 4Q91A 1W3AA 1FMMS 4G9MA 3AJ6A 5FZUA 1BFGA 1PUMB 2ERMA 4KEJA 1I1EA 4OWJA 2KLLA 4I4VA 3PUBA 3V0BA 1ILR1 1MD6A 2XOAA 3F62B 1BLDA 3JRRA 4OUJA 3CRHA 5B2HA 4IY8A 1S0BA 2VSAA 1AVAC 4I4SA 2D7RA 3Q7WA 1NUNA 2K43A 1R8OA 4I4RA 5DVHA 2RSTA 4A7YA 1V6VA 3FJFA 4J2KA 3EF2A 4FGFA 4IZEA 4EFPA 1HKNA 4WBCA 3FJ9A 4OWKA 1PZZA 2AFGA 2YUGA 3AH1A 4I6IA 3BA4A 4A7ZA 3HMYA 2X2TA 1JT7A 1IOBA 3QR5A 3UD8A 4D8HA 3ILAA 2NYYA 4I7IA 1G9AA 3OBTA 1E0OA 4LO2A 2Z49A 3OJVA 1BFBA 3FJAA 1IILA 3VWCA 3I2AA 3A23A 3D7WB 2NZ9A 1K5VA 3JUTA 2BFHA 1YBIA 1ABRB 4QBCA 4LO1C 4YOLA 3PMEA 3MALA 1BA7A 3UDAA 5JMCA 4I2SA 5D61A 3FJ8A 3A21A 3ZXGA 3F1RA 21BIA 3IAGC 4EFQA 4GAIA 4MZHA 1M2TB 1IRAX 4OEGA 3UJ4A 9ILBA 5F8YA 4X37A 1F31A 3CA4A 5F8WA 3AH2A 4USPA 3QYDA 4QC4A 3CA0A 4EB2B 3AKIA 3O4DA 4JKQA 2M49A 1TWMA 3OJMA 2R9KB 2VSEA 4QKRA 1DQOA 3FGMA 3V0AB 2E4MC 4II0A 1CE7B 3BA5A 2VXTI 5F90A 2NS2A 2NTDA 1JLYA 3HSMA 4GP0A 3RSJA 1AVXB 4UY4A 4IZXA 1N4KA 2HWMA 1CVSA 4I37A 2FDBM 4HR6C 2MIBA 3IM5A 1AFCA 1IJTA 2QYIB 3WINC 2KKIA 5EG6C 3O5WB 3FFZA 1S0GA 4ZLBB 1ITBA 2GO2A 4OW4A 4F83A 1GGPB 1UPSA 4D0ZA 1MC9A 2MC2A 4I4UA 3FJDA 1FWUA 3IM6A 4X38A 1XZZA 4DCKC 1FGAA 3H6RA 3R4SA 4Z8SB 4ZFUB 1IT0A 1DQGA 5DZUA 3BA7A 4JPZA 1DLLA 1YTOA 4ISQA 3O3QA 3ZXDA 5BOWA 1J0SA 4MZFB 1BFCA 1G9BA 4ZFYB 1JLXA 4JP0A 1G9CA 4XFTA 4HJJA 3P6IA 2L5XA 3OJ2A 1Z2VA 1OQLB 1SR4C 4KEKA 3IM7A 2LIEA 1XYFA 2DREA 1PWAA 4ZFWB 4F34A 2AAIB 4XFSA 4J2XA 1YYNA 3UJ0A 4H04A 4DEPA 4LO2C 2NVHA 4IHZA 1BARA 3C9ZA 2FFUA 3V0AA 1ONKB 4EFRA 2HW9A 3FJIA 3VSFA 5BVPI 1D0HA 3RMYA 2K4AB 4ZA3B 1JT5A 4X3AA 2DS0A 2Q3NB 4I96A 2KH2A 2ET2A 4G9NA 3BAQA 1V6WA 1SR4A 4G1RA 4Q9GA 1EVTA 2HZ9A 3WO3A 3RTJB 2MLLB 1QQLA 3BX1C 5D62A 5EHAA 3P6JA 2I1BA 2F8XC 1FMZA 4G6MA 1ISVA 4IQPA 3NBEA 4H9WA 2RG9B 1Q1UA 4L4HA 1WD4A 1A8DA 3BRGC 4I4QA 3NBNA 1ISZA 4ZBVB 2VLCA 4QO3A 1QXMA 1HWPB 1FN0A 1RY7A 1EYLA 3WMVA 3OGGA 2WRYA 2Y9WC 3AKFA 1S0CA 3I29B 3BRDA 2NM1A 2AQZA 1V6XA 5E24E 4AN7B 1AXMA 1DFCA 1YF8B 4EKXB 3VT2A 3RMXA 2F2FA 3WO4A 1PUUB 1L2HA 4H75A 4LO3C 3ZC9A 4J23B 4QD2B 3OBRA 1DZCA 4XKIA 4LO8B 3FUOA 1XG6A 1FV3A 1K5UA 4ZGRB 3LLPA 3CU1B 3A07A 4JQ0A 4OEFA 2VXRA 3RTIB 2NP0A 5BXTA 3IIRA 1KNMA 2ZQNA 4XFUA 5BXRA 3V0BB 1BASA 3N0KA 4IONA 3CRGA 1ISXA 1G82A 2Q9XA 4GP3A 3AKGA 3WA1A 3CQAA 4LO7B 4AN6A 4LO3A 2FGFA 3O4OA 1S0LA 3ZC8A 1HCDA 4ISRA 3BAGA 5BQUA 1ISYA 5F8SA 4X39A 3O44A 3FJKA 3PHZA 1TOOA 2K8RA 3FJBA 1RG8A 2D7IA 3VUOA 4J2YA 3FJHA 2DRZA 1AVWB 3LTQA 3K1XA 2IHOA 1M16A 1WD3A 1R8NA 4Q9PA 1RZOB 3AZVA 4KBBA 4USOA 1II4A 1FV2A 5I1BA 3TC2A 2D23A 4P0LA 2BEAA 3AH4A 3HALA 3O49A 4ENDA 3O4BA 1SZ6B 1Z4SA 2FO1A 1ISWA 3VEQA 1TTUA 1AF9A 3BTAA 1WBAA 3AJ5A 3VT1A 3R4UA 3O4AA 8I1BA 2AXMA 3Q7YA 3BB2A 4CJMA 5BXPA 5EC5A 3Q7XA 3NJ5A 3BAVA 4I0YA 2FFVA 3BAHA 3ZX7A 1XHBA 1P63A 4TLPA 4ZOTA 4P6AA 3BADA 2IWTB 2VUAA 2ZR1B 4QKSA 1TWEA 4I4XA 4IYBA 3HBWA 4PC4A 5BP5A 2D44A 3UD9A 3HOMA 2VU9A 1BFFA 4QALA 1JT3A 2ZQOA 5FZYA 1VCLA 3PG0A 1WBCA 4JRAA 41BIA 2LIQA
chains in the Genus database with same CATH topology
2BEBA 1S0EA 3AZWA 1HIBA 1T4QA 4I4YA 5FZZA 4OEEA 2DRYA 1RMLA 3AKHA 2Y9GA 2F2FC 3FUQA 1Q04A 4ZKTB 3FJJA 7I1BA 2KI4A 3HN1A 1YXWA 2QN4A 4P0JA 2X2SA 1W3FA 2ESUA 3KMVA 3O4CA 1JY0A 4I4OA 1BLAA 4GOVA 1PC8B 3NBCA 3V79C 3CRIA 3POKA 1G9DA 3NBDA 5FNXA 3WMUA 5D63A 2HWAA 3S8KA 1JQZA 4EEEB 3VT0A 3S8JA 4J2SA 5FNWA 3H6RB 4IY9A 1S0DA 2D20A 3E8LC 3CA1A 1DIWA 1NZKA 2D24A 1DFQA 3CA6A 2D43A 3CA3A 5GAQA 4P0KA 3WO2A 3SNVA 4KEIA 5G00A 1EPWA 4I1BA 2Y9XE 1IHKA 5BQUC 5HPZA 5JLVA 3VSZA 3BRFA 3N7JA 3N7LA 1I1BA 1DZDA 5BXSA 1TIEA 3B9UA 4LO0C 1IRPA 4I8MA 2UUSA 1HWNB 4G6JA 3N7KA 1DJSB 2Z48A 1JTCA 1TFMB 4GOYA 3OGFA 4DENA 1HCEA 3UD7A 1Q03A 5DUYA 3N7MA 4LO1A 2P39A 4I1EA 1T9FA 2D22A 1FWVA 3W9TA 2Y9FA 1W3GA 4FVVA 4R6UB 2D1ZA 1AVUA 4A7KA 3A22A 1FQ9A 3FJEA 3CAHA 4LO0A 3T8SA 3H6QA 3MPPG 4HA2A 3BAOA 4JKXB 2WBCA 4QD2C 6I1BA 3CA5A 3I2XA 1JT4A 2KI6B 4I4PA 4GAFA 4L4IA 3H6SE 5BP5C 2J3PA 4I3NA 2GZBA 4KC3A 3P53A 2E4MA 3FJCA 1HWMB 5DSSB 3BAUA 4JAWA 1QQKA 4D0TA 1S0FA 1TP0A 2RQ9A 4OWLA 1HWOB 1EV2A 2P23A 4LO7C 1Z0HA 4QBVA 4MZGB 1V6UA 3WINA 4Z9WB 31BIA 4Q91A 1W3AA 1FMMS 4G9MA 3AJ6A 5FZUA 1BFGA 1PUMB 2ERMA 4KEJA 1I1EA 4OWJA 2KLLA 4I4VA 3PUBA 3V0BA 1ILR1 1MD6A 2XOAA 3F62B 1BLDA 3JRRA 4OUJA 3CRHA 5B2HA 4IY8A 1S0BA 2VSAA 1AVAC 4I4SA 2D7RA 3Q7WA 1NUNA 2K43A 1R8OA 4I4RA 5DVHA 2RSTA 4A7YA 1V6VA 3FJFA 4J2KA 3EF2A 4FGFA 4IZEA 4EFPA 1HKNA 4WBCA 3FJ9A 4OWKA 1PZZA 2AFGA 2YUGA 3AH1A 4I6IA 3BA4A 4A7ZA 3HMYA 2X2TA 1JT7A 1IOBA 3QR5A 3UD8A 4D8HA 3ILAA 2NYYA 4I7IA 1G9AA 3OBTA 1E0OA 4LO2A 2Z49A 3OJVA 1BFBA 3FJAA 1IILA 3VWCA 3I2AA 3A23A 3D7WB 2NZ9A 1K5VA 3JUTA 2BFHA 1YBIA 1ABRB 4QBCA 4LO1C 4YOLA 3PMEA 3MALA 1BA7A 3UDAA 5JMCA 4I2SA 5D61A 3FJ8A 3A21A 3ZXGA 3F1RA 21BIA 3IAGC 4EFQA 4GAIA 4MZHA 1M2TB 1IRAX 4OEGA 3UJ4A 9ILBA 5F8YA 4X37A 1F31A 3CA4A 5F8WA 3AH2A 4USPA 3QYDA 4QC4A 3CA0A 4EB2B 3AKIA 3O4DA 4JKQA 2M49A 1TWMA 3OJMA 2R9KB 2VSEA 4QKRA 1DQOA 3FGMA 3V0AB 2E4MC 4II0A 1CE7B 3BA5A 2VXTI 5F90A 2NS2A 2NTDA 1JLYA 3HSMA 4GP0A 3RSJA 1AVXB 4UY4A 4IZXA 1N4KA 2HWMA 1CVSA 4I37A 2FDBM 4HR6C 2MIBA 3IM5A 1AFCA 1IJTA 2QYIB 3WINC 2KKIA 5EG6C 3O5WB 3FFZA 1S0GA 4ZLBB 1ITBA 2GO2A 4OW4A 4F83A 1GGPB 1UPSA 4D0ZA 1MC9A 2MC2A 4I4UA 3FJDA 1FWUA 3IM6A 4X38A 1XZZA 4DCKC 1FGAA 3H6RA 3R4SA 4Z8SB 4ZFUB 1IT0A 1DQGA 5DZUA 3BA7A 4JPZA 1DLLA 1YTOA 4ISQA 3O3QA 3ZXDA 5BOWA 1J0SA 4MZFB 1BFCA 1G9BA 4ZFYB 1JLXA 4JP0A 1G9CA 4XFTA 4HJJA 3P6IA 2L5XA 3OJ2A 1Z2VA 1OQLB 1SR4C 4KEKA 3IM7A 2LIEA 1XYFA 2DREA 1PWAA 4ZFWB 4F34A 2AAIB 4XFSA 4J2XA 1YYNA 3UJ0A 4H04A 4DEPA 4LO2C 2NVHA 4IHZA 1BARA 3C9ZA 2FFUA 3V0AA 1ONKB 4EFRA 2HW9A 3FJIA 3VSFA 5BVPI 1D0HA 3RMYA 2K4AB 4ZA3B 1JT5A 4X3AA 2DS0A 2Q3NB 4I96A 2KH2A 2ET2A 4G9NA 3BAQA 1V6WA 1SR4A 4G1RA 4Q9GA 1EVTA 2HZ9A 3WO3A 3RTJB 2MLLB 1QQLA 3BX1C 5D62A 5EHAA 3P6JA 2I1BA 2F8XC 1FMZA 4G6MA 1ISVA 4IQPA 3NBEA 4H9WA 2RG9B 1Q1UA 4L4HA 1WD4A 1A8DA 3BRGC 4I4QA 3NBNA 1ISZA 4ZBVB 2VLCA 4QO3A 1QXMA 1HWPB 1FN0A 1RY7A 1EYLA 3WMVA 3OGGA 2WRYA 2Y9WC 3AKFA 1S0CA 3I29B 3BRDA 2NM1A 2AQZA 1V6XA 5E24E 4AN7B 1AXMA 1DFCA 1YF8B 4EKXB 3VT2A 3RMXA 2F2FA 3WO4A 1PUUB 1L2HA 4H75A 4LO3C 3ZC9A 4J23B 4QD2B 3OBRA 1DZCA 4XKIA 4LO8B 3FUOA 1XG6A 1FV3A 1K5UA 4ZGRB 3LLPA 3CU1B 3A07A 4JQ0A 4OEFA 2VXRA 3RTIB 2NP0A 5BXTA 3IIRA 1KNMA 2ZQNA 4XFUA 5BXRA 3V0BB 1BASA 3N0KA 4IONA 3CRGA 1ISXA 1G82A 2Q9XA 4GP3A 3AKGA 3WA1A 3CQAA 4LO7B 4AN6A 4LO3A 2FGFA 3O4OA 1S0LA 3ZC8A 1HCDA 4ISRA 3BAGA 5BQUA 1ISYA 5F8SA 4X39A 3O44A 3FJKA 3PHZA 1TOOA 2K8RA 3FJBA 1RG8A 2D7IA 3VUOA 4J2YA 3FJHA 2DRZA 1AVWB 3LTQA 3K1XA 2IHOA 1M16A 1WD3A 1R8NA 4Q9PA 1RZOB 3AZVA 4KBBA 4USOA 1II4A 1FV2A 5I1BA 3TC2A 2D23A 4P0LA 2BEAA 3AH4A 3HALA 3O49A 4ENDA 3O4BA 1SZ6B 1Z4SA 2FO1A 1ISWA 3VEQA 1TTUA 1AF9A 3BTAA 1WBAA 3AJ5A 3VT1A 3R4UA 3O4AA 8I1BA 2AXMA 3Q7YA 3BB2A 4CJMA 5BXPA 5EC5A 3Q7XA 3NJ5A 3BAVA 4I0YA 2FFVA 3BAHA 3ZX7A 1XHBA 1P63A 4TLPA 4ZOTA 4P6AA 3BADA 2IWTB 2VUAA 2ZR1B 4QKSA 1TWEA 4I4XA 4IYBA 3HBWA 4PC4A 5BP5A 2D44A 3UD9A 3HOMA 2VU9A 1BFFA 4QALA 1JT3A 2ZQOA 5FZYA 1VCLA 3PG0A 1WBCA 4JRAA 41BIA 2LIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEB A;  1S0E A;  3AZW A;  1HIB A;  1T4Q A;  4I4Y A;  5FZZ A;  4OEE A;  2DRY A;  1RML A;  3AKH A;  2Y9G A;  2F2F C;  3FUQ A;  1Q04 A;  4ZKT B;  3FJJ A;  7I1B A;  2KI4 A;  3HN1 A;  1YXW A;  2QN4 A;  4P0J A;  2X2S A;  1W3F A;  2ESU A;  3KMV A;  3O4C A;  1JY0 A;  4I4O A;  1BLA A;  4GOV A;  1PC8 B;  3NBC A;  3V79 C;  3CRI A;  3POK A;  1G9D A;  3NBD A;  5FNX A;  3WMU A;  5D63 A;  2HWA A;  3S8K A;  1JQZ A;  4EEE B;  3VT0 A;  3S8J A;  4J2S A;  5FNW A;  3H6R B;  4IY9 A;  1S0D A;  2D20 A;  3E8L C;  3CA1 A;  1DIW A;  1NZK A;  2D24 A;  1DFQ A;  3CA6 A;  2D43 A;  3CA3 A;  5GAQ A;  4P0K A;  3WO2 A;  3SNV A;  4KEI A;  5G00 A;  1EPW A;  4I1B A;  2Y9X E;  1IHK A;  5BQU C;  5HPZ A;  5JLV A;  3VSZ A;  3BRF A;  3N7J A;  3N7L A;  1I1B A;  1DZD A;  5BXS A;  1TIE A;  3B9U A;  4LO0 C;  1IRP A;  4I8M A;  2UUS A;  1HWN B;  4G6J A;  3N7K A;  1DJS B;  2Z48 A;  1JTC A;  1TFM B;  4GOY A;  3OGF A;  4DEN A;  1HCE A;  3UD7 A;  1Q03 A;  5DUY A;  3N7M A;  4LO1 A;  2P39 A;  4I1E A;  1T9F A;  2D22 A;  1FWV A;  3W9T A;  2Y9F A;  1W3G A;  4FVV A;  4R6U B;  2D1Z A;  1AVU A;  4A7K A;  3A22 A;  1FQ9 A;  3FJE A;  3CAH A;  4LO0 A;  3T8S A;  3H6Q A;  3MPP G;  4HA2 A;  3BAO A;  4JKX B;  2WBC A;  4QD2 C;  6I1B A;  3CA5 A;  3I2X A;  1JT4 A;  2KI6 B;  4I4P A;  4GAF A;  4L4I A;  3H6S E;  5BP5 C;  2J3P A;  4I3N A;  2GZB A;  4KC3 A;  3P53 A;  2E4M A;  3FJC A;  1HWM B;  5DSS B;  3BAU A;  4JAW A;  1QQK A;  4D0T A;  1S0F A;  1TP0 A;  2RQ9 A;  4OWL A;  1HWO B;  1EV2 A;  2P23 A;  4LO7 C;  1Z0H A;  4QBV A;  1V6U A;  3WIN A;  4Z9W B;  31BI A;  4Q91 A;  1W3A A;  1FMM S;  4G9M A;  3AJ6 A;  5FZU A;  1BFG A;  1PUM B;  2ERM A;  4KEJ A;  1I1E A;  4OWJ A;  2KLL A;  4I4V A;  3PUB A;  3V0B A;  1ILR 1;  1MD6 A;  2XOA A;  3F62 B;  1BLD A;  3JRR A;  4OUJ A;  3CRH A;  5B2H A;  4IY8 A;  1S0B A;  2VSA A;  1AVA C;  4I4S A;  2D7R A;  3Q7W A;  1NUN A;  2K43 A;  1R8O A;  4I4R A;  5DVH A;  2RST A;  4A7Y A;  1V6V A;  3FJF A;  4J2K A;  3EF2 A;  4FGF A;  4IZE A;  4EFP A;  1HKN A;  4WBC A;  3FJ9 A;  4OWK A;  1PZZ A;  2AFG A;  2YUG A;  3AH1 A;  4I6I A;  3BA4 A;  4A7Z A;  3HMY A;  2X2T A;  1JT7 A;  1IOB A;  3QR5 A;  3UD8 A;  4D8H A;  3ILA A;  2NYY A;  4I7I A;  1G9A A;  3OBT A;  1E0O A;  4LO2 A;  2Z49 A;  3OJV A;  1BFB A;  3FJA A;  1IIL A;  3VWC A;  3I2A A;  3A23 A;  3D7W B;  2NZ9 A;  1K5V A;  3JUT A;  2BFH A;  1YBI A;  1ABR B;  4QBC A;  4LO1 C;  4YOL A;  3PME A;  3MAL A;  1BA7 A;  3UDA A;  5JMC A;  4I2S A;  5D61 A;  3FJ8 A;  3A21 A;  3ZXG A;  3F1R A;  21BI A;  3IAG C;  4EFQ A;  4GAI A;  1M2T B;  1IRA X;  4OEG A;  3UJ4 A;  9ILB A;  5F8Y A;  4X37 A;  1F31 A;  3CA4 A;  5F8W A;  3AH2 A;  4USP A;  3QYD A;  4QC4 A;  3CA0 A;  4EB2 B;  3AKI A;  3O4D A;  4JKQ A;  2M49 A;  1TWM A;  3OJM A;  2R9K B;  2VSE A;  4QKR A;  1DQO A;  3FGM A;  3V0A B;  2E4M C;  4II0 A;  1CE7 B;  3BA5 A;  2VXT I;  5F90 A;  2NTD A;  1JLY A;  3HSM A;  4GP0 A;  3RSJ A;  1AVX B;  4IZX A;  1N4K A;  2HWM A;  1CVS A;  4I37 A;  2FDB M;  4HR6 C;  2MIB A;  3IM5 A;  1AFC A;  1IJT A;  2QYI B;  3WIN C;  2KKI A;  5EG6 C;  3O5W B;  3FFZ A;  1S0G A;  4ZLB B;  1ITB A;  2GO2 A;  4OW4 A;  4F83 A;  1GGP B;  1UPS A;  4D0Z A;  1MC9 A;  2MC2 A;  4I4U A;  3FJD A;  1FWU A;  3IM6 A;  4X38 A;  1XZZ A;  4DCK C;  1FGA A;  3H6R A;  3R4S A;  4Z8S B;  4ZFU B;  1IT0 A;  1DQG A;  5DZU A;  3BA7 A;  4JPZ A;  1DLL A;  1YTO A;  4ISQ A;  3O3Q A;  3ZXD A;  5BOW A;  1J0S A;  1BFC A;  1G9B A;  4ZFY B;  1JLX A;  4JP0 A;  1G9C A;  4XFT A;  4HJJ A;  3P6I A;  2L5X A;  3OJ2 A;  1Z2V A;  1OQL B;  1SR4 C;  4KEK A;  3IM7 A;  2LIE A;  1XYF A;  2DRE A;  1PWA A;  4ZFW B;  4F34 A;  2AAI B;  4XFS A;  4J2X A;  1YYN A;  3UJ0 A;  4H04 A;  4DEP A;  4LO2 C;  2NVH A;  4IHZ A;  1BAR A;  3C9Z A;  2FFU A;  3V0A A;  1ONK B;  4EFR A;  2HW9 A;  3FJI A;  3VSF A;  5BVP I;  1D0H A;  3RMY A;  2K4A B;  4ZA3 B;  1JT5 A;  4X3A A;  2DS0 A;  2Q3N B;  4I96 A;  2KH2 A;  2ET2 A;  4G9N A;  3BAQ A;  1V6W A;  1SR4 A;  4G1R A;  4Q9G A;  1EVT A;  2HZ9 A;  3WO3 A;  3RTJ B;  2MLL B;  1QQL A;  3BX1 C;  5D62 A;  5EHA A;  3P6J A;  2I1B A;  2F8X C;  1FMZ A;  4G6M A;  1ISV A;  4IQP A;  3NBE A;  4H9W A;  2RG9 B;  1Q1U A;  4L4H A;  1WD4 A;  1A8D A;  3BRG C;  4I4Q A;  3NBN A;  1ISZ A;  4ZBV B;  2VLC A;  4QO3 A;  1QXM A;  1HWP B;  1FN0 A;  1RY7 A;  1EYL A;  3WMV A;  3OGG A;  2WRY A;  2Y9W C;  3AKF A;  1S0C A;  3I29 B;  3BRD A;  2NM1 A;  2AQZ A;  1V6X A;  5E24 E;  4AN7 B;  1AXM A;  1DFC A;  1YF8 B;  4EKX B;  3VT2 A;  3RMX A;  2F2F A;  3WO4 A;  1PUU B;  1L2H A;  4LO3 C;  3ZC9 A;  4J23 B;  4QD2 B;  3OBR A;  1DZC A;  4XKI A;  4LO8 B;  3FUO A;  1XG6 A;  1FV3 A;  1K5U A;  4ZGR B;  3LLP A;  3CU1 B;  3A07 A;  4JQ0 A;  4OEF A;  2VXR A;  3RTI B;  2NP0 A;  5BXT A;  3IIR A;  1KNM A;  2ZQN A;  4XFU A;  5BXR A;  3V0B B;  1BAS A;  3N0K A;  4ION A;  3CRG A;  1ISX A;  1G82 A;  2Q9X A;  4GP3 A;  3AKG A;  3WA1 A;  3CQA A;  4LO7 B;  4AN6 A;  4LO3 A;  2FGF A;  3O4O A;  1S0L A;  3ZC8 A;  1HCD A;  4ISR A;  3BAG A;  5BQU A;  1ISY A;  5F8S A;  4X39 A;  3O44 A;  3FJK A;  3PHZ A;  1TOO A;  2K8R A;  3FJB A;  1RG8 A;  2D7I A;  3VUO A;  4J2Y A;  3FJH A;  2DRZ A;  1AVW B;  3LTQ A;  3K1X A;  2IHO A;  1M16 A;  1WD3 A;  1R8N A;  4Q9P A;  1RZO B;  3AZV A;  4KBB A;  4USO A;  1II4 A;  1FV2 A;  5I1B A;  3TC2 A;  2D23 A;  4P0L A;  2BEA A;  3AH4 A;  3HAL A;  3O49 A;  4END A;  3O4B A;  1SZ6 B;  1Z4S A;  2FO1 A;  1ISW A;  3VEQ A;  1TTU A;  1AF9 A;  3BTA A;  1WBA A;  3AJ5 A;  3VT1 A;  3R4U A;  3O4A A;  8I1B A;  2AXM A;  3Q7Y A;  3BB2 A;  4CJM A;  5BXP A;  5EC5 A;  3Q7X A;  3NJ5 A;  3BAV A;  4I0Y A;  2FFV A;  3BAH A;  3ZX7 A;  1XHB A;  1P63 A;  4TLP A;  4ZOT A;  4P6A A;  3BAD A;  2IWT B;  2VUA A;  2ZR1 B;  4QKS A;  1TWE A;  4I4X A;  4IYB A;  3HBW A;  4PC4 A;  5BP5 A;  2D44 A;  3UD9 A;  3HOM A;  2VU9 A;  1BFF A;  4QAL A;  1JT3 A;  2ZQO A;  5FZY A;  1VCL A;  3PG0 A;  1WBC A;  4JRA A;  41BI A;  2LIQ A; 
#chains in the Genus database with same CATH topology
 2BEB A;  1S0E A;  3AZW A;  1HIB A;  1T4Q A;  4I4Y A;  5FZZ A;  4OEE A;  2DRY A;  1RML A;  3AKH A;  2Y9G A;  2F2F C;  3FUQ A;  1Q04 A;  4ZKT B;  3FJJ A;  7I1B A;  2KI4 A;  3HN1 A;  1YXW A;  2QN4 A;  4P0J A;  2X2S A;  1W3F A;  2ESU A;  3KMV A;  3O4C A;  1JY0 A;  4I4O A;  1BLA A;  4GOV A;  1PC8 B;  3NBC A;  3V79 C;  3CRI A;  3POK A;  1G9D A;  3NBD A;  5FNX A;  3WMU A;  5D63 A;  2HWA A;  3S8K A;  1JQZ A;  4EEE B;  3VT0 A;  3S8J A;  4J2S A;  5FNW A;  3H6R B;  4IY9 A;  1S0D A;  2D20 A;  3E8L C;  3CA1 A;  1DIW A;  1NZK A;  2D24 A;  1DFQ A;  3CA6 A;  2D43 A;  3CA3 A;  5GAQ A;  4P0K A;  3WO2 A;  3SNV A;  4KEI A;  5G00 A;  1EPW A;  4I1B A;  2Y9X E;  1IHK A;  5BQU C;  5HPZ A;  5JLV A;  3VSZ A;  3BRF A;  3N7J A;  3N7L A;  1I1B A;  1DZD A;  5BXS A;  1TIE A;  3B9U A;  4LO0 C;  1IRP A;  4I8M A;  2UUS A;  1HWN B;  4G6J A;  3N7K A;  1DJS B;  2Z48 A;  1JTC A;  1TFM B;  4GOY A;  3OGF A;  4DEN A;  1HCE A;  3UD7 A;  1Q03 A;  5DUY A;  3N7M A;  4LO1 A;  2P39 A;  4I1E A;  1T9F A;  2D22 A;  1FWV A;  3W9T A;  2Y9F A;  1W3G A;  4FVV A;  4R6U B;  2D1Z A;  1AVU A;  4A7K A;  3A22 A;  1FQ9 A;  3FJE A;  3CAH A;  4LO0 A;  3T8S A;  3H6Q A;  3MPP G;  4HA2 A;  3BAO A;  4JKX B;  2WBC A;  4QD2 C;  6I1B A;  3CA5 A;  3I2X A;  1JT4 A;  2KI6 B;  4I4P A;  4GAF A;  4L4I A;  3H6S E;  5BP5 C;  2J3P A;  4I3N A;  2GZB A;  4KC3 A;  3P53 A;  2E4M A;  3FJC A;  1HWM B;  5DSS B;  3BAU A;  4JAW A;  1QQK A;  4D0T A;  1S0F A;  1TP0 A;  2RQ9 A;  4OWL A;  1HWO B;  1EV2 A;  2P23 A;  4LO7 C;  1Z0H A;  4QBV A;  4MZG B;  1V6U A;  3WIN A;  4Z9W B;  31BI A;  4Q91 A;  1W3A A;  1FMM S;  4G9M A;  3AJ6 A;  5FZU A;  1BFG A;  1PUM B;  2ERM A;  4KEJ A;  1I1E A;  4OWJ A;  2KLL A;  4I4V A;  3PUB A;  3V0B A;  1ILR 1;  1MD6 A;  2XOA A;  3F62 B;  1BLD A;  3JRR A;  4OUJ A;  3CRH A;  5B2H A;  4IY8 A;  1S0B A;  2VSA A;  1AVA C;  4I4S A;  2D7R A;  3Q7W A;  1NUN A;  2K43 A;  1R8O A;  4I4R A;  5DVH A;  2RST A;  4A7Y A;  1V6V A;  3FJF A;  4J2K A;  3EF2 A;  4FGF A;  4IZE A;  4EFP A;  1HKN A;  4WBC A;  3FJ9 A;  4OWK A;  1PZZ A;  2AFG A;  2YUG A;  3AH1 A;  4I6I A;  3BA4 A;  4A7Z A;  3HMY A;  2X2T A;  1JT7 A;  1IOB A;  3QR5 A;  3UD8 A;  4D8H A;  3ILA A;  2NYY A;  4I7I A;  1G9A A;  3OBT A;  1E0O A;  4LO2 A;  2Z49 A;  3OJV A;  1BFB A;  3FJA A;  1IIL A;  3VWC A;  3I2A A;  3A23 A;  3D7W B;  2NZ9 A;  1K5V A;  3JUT A;  2BFH A;  1YBI A;  1ABR B;  4QBC A;  4LO1 C;  4YOL A;  3PME A;  3MAL A;  1BA7 A;  3UDA A;  5JMC A;  4I2S A;  5D61 A;  3FJ8 A;  3A21 A;  3ZXG A;  3F1R A;  21BI A;  3IAG C;  4EFQ A;  4GAI A;  4MZH A;  1M2T B;  1IRA X;  4OEG A;  3UJ4 A;  9ILB A;  5F8Y A;  4X37 A;  1F31 A;  3CA4 A;  5F8W A;  3AH2 A;  4USP A;  3QYD A;  4QC4 A;  3CA0 A;  4EB2 B;  3AKI A;  3O4D A;  4JKQ A;  2M49 A;  1TWM A;  3OJM A;  2R9K B;  2VSE A;  4QKR A;  1DQO A;  3FGM A;  3V0A B;  2E4M C;  4II0 A;  1CE7 B;  3BA5 A;  2VXT I;  5F90 A;  2NS2 A;  2NTD A;  1JLY A;  3HSM A;  4GP0 A;  3RSJ A;  1AVX B;  4UY4 A;  4IZX A;  1N4K A;  2HWM A;  1CVS A;  4I37 A;  2FDB M;  4HR6 C;  2MIB A;  3IM5 A;  1AFC A;  1IJT A;  2QYI B;  3WIN C;  2KKI A;  5EG6 C;  3O5W B;  3FFZ A;  1S0G A;  4ZLB B;  1ITB A;  2GO2 A;  4OW4 A;  4F83 A;  1GGP B;  1UPS A;  4D0Z A;  1MC9 A;  2MC2 A;  4I4U A;  3FJD A;  1FWU A;  3IM6 A;  4X38 A;  1XZZ A;  4DCK C;  1FGA A;  3H6R A;  3R4S A;  4Z8S B;  4ZFU B;  1IT0 A;  1DQG A;  5DZU A;  3BA7 A;  4JPZ A;  1DLL A;  1YTO A;  4ISQ A;  3O3Q A;  3ZXD A;  5BOW A;  1J0S A;  4MZF B;  1BFC A;  1G9B A;  4ZFY B;  1JLX A;  4JP0 A;  1G9C A;  4XFT A;  4HJJ A;  3P6I A;  2L5X A;  3OJ2 A;  1Z2V A;  1OQL B;  1SR4 C;  4KEK A;  3IM7 A;  2LIE A;  1XYF A;  2DRE A;  1PWA A;  4ZFW B;  4F34 A;  2AAI B;  4XFS A;  4J2X A;  1YYN A;  3UJ0 A;  4H04 A;  4DEP A;  4LO2 C;  2NVH A;  4IHZ A;  1BAR A;  3C9Z A;  2FFU A;  3V0A A;  1ONK B;  4EFR A;  2HW9 A;  3FJI A;  3VSF A;  5BVP I;  1D0H A;  3RMY A;  2K4A B;  4ZA3 B;  1JT5 A;  4X3A A;  2DS0 A;  2Q3N B;  4I96 A;  2KH2 A;  2ET2 A;  4G9N A;  3BAQ A;  1V6W A;  1SR4 A;  4G1R A;  4Q9G A;  1EVT A;  2HZ9 A;  3WO3 A;  3RTJ B;  2MLL B;  1QQL A;  3BX1 C;  5D62 A;  5EHA A;  3P6J A;  2I1B A;  2F8X C;  1FMZ A;  4G6M A;  1ISV A;  4IQP A;  3NBE A;  4H9W A;  2RG9 B;  1Q1U A;  4L4H A;  1WD4 A;  1A8D A;  3BRG C;  4I4Q A;  3NBN A;  1ISZ A;  4ZBV B;  2VLC A;  4QO3 A;  1QXM A;  1HWP B;  1FN0 A;  1RY7 A;  1EYL A;  3WMV A;  3OGG A;  2WRY A;  2Y9W C;  3AKF A;  1S0C A;  3I29 B;  3BRD A;  2NM1 A;  2AQZ A;  1V6X A;  5E24 E;  4AN7 B;  1AXM A;  1DFC A;  1YF8 B;  4EKX B;  3VT2 A;  3RMX A;  2F2F A;  3WO4 A;  1PUU B;  1L2H A;  4H75 A;  4LO3 C;  3ZC9 A;  4J23 B;  4QD2 B;  3OBR A;  1DZC A;  4XKI A;  4LO8 B;  3FUO A;  1XG6 A;  1FV3 A;  1K5U A;  4ZGR B;  3LLP A;  3CU1 B;  3A07 A;  4JQ0 A;  4OEF A;  2VXR A;  3RTI B;  2NP0 A;  5BXT A;  3IIR A;  1KNM A;  2ZQN A;  4XFU A;  5BXR A;  3V0B B;  1BAS A;  3N0K A;  4ION A;  3CRG A;  1ISX A;  1G82 A;  2Q9X A;  4GP3 A;  3AKG A;  3WA1 A;  3CQA A;  4LO7 B;  4AN6 A;  4LO3 A;  2FGF A;  3O4O A;  1S0L A;  3ZC8 A;  1HCD A;  4ISR A;  3BAG A;  5BQU A;  1ISY A;  5F8S A;  4X39 A;  3O44 A;  3FJK A;  3PHZ A;  1TOO A;  2K8R A;  3FJB A;  1RG8 A;  2D7I A;  3VUO A;  4J2Y A;  3FJH A;  2DRZ A;  1AVW B;  3LTQ A;  3K1X A;  2IHO A;  1M16 A;  1WD3 A;  1R8N A;  4Q9P A;  1RZO B;  3AZV A;  4KBB A;  4USO A;  1II4 A;  1FV2 A;  5I1B A;  3TC2 A;  2D23 A;  4P0L A;  2BEA A;  3AH4 A;  3HAL A;  3O49 A;  4END A;  3O4B A;  1SZ6 B;  1Z4S A;  2FO1 A;  1ISW A;  3VEQ A;  1TTU A;  1AF9 A;  3BTA A;  1WBA A;  3AJ5 A;  3VT1 A;  3R4U A;  3O4A A;  8I1B A;  2AXM A;  3Q7Y A;  3BB2 A;  4CJM A;  5BXP A;  5EC5 A;  3Q7X A;  3NJ5 A;  3BAV A;  4I0Y A;  2FFV A;  3BAH A;  3ZX7 A;  1XHB A;  1P63 A;  4TLP A;  4ZOT A;  4P6A A;  3BAD A;  2IWT B;  2VUA A;  2ZR1 B;  4QKS A;  1TWE A;  4I4X A;  4IYB A;  3HBW A;  4PC4 A;  5BP5 A;  2D44 A;  3UD9 A;  3HOM A;  2VU9 A;  1BFF A;  4QAL A;  1JT3 A;  2ZQO A;  5FZY A;  1VCL A;  3PG0 A;  1WBC A;  4JRA A;  41BI A;  2LIQ A; 
#chains in the Genus database with same CATH homology
 2BEB A;  1S0E A;  3AZW A;  1HIB A;  1T4Q A;  4I4Y A;  5FZZ A;  4OEE A;  2DRY A;  1RML A;  3AKH A;  2Y9G A;  2F2F C;  3FUQ A;  1Q04 A;  4ZKT B;  3FJJ A;  7I1B A;  2KI4 A;  3HN1 A;  1YXW A;  2QN4 A;  4P0J A;  2X2S A;  1W3F A;  2ESU A;  3KMV A;  3O4C A;  1JY0 A;  4I4O A;  1BLA A;  4GOV A;  1PC8 B;  3NBC A;  3V79 C;  3CRI A;  3POK A;  1G9D A;  3NBD A;  5FNX A;  3WMU A;  5D63 A;  2HWA A;  3S8K A;  1JQZ A;  4EEE B;  3VT0 A;  3S8J A;  4J2S A;  5FNW A;  3H6R B;  4IY9 A;  1S0D A;  2D20 A;  3E8L C;  3CA1 A;  1DIW A;  1NZK A;  2D24 A;  1DFQ A;  3CA6 A;  2D43 A;  3CA3 A;  5GAQ A;  4P0K A;  3WO2 A;  3SNV A;  4KEI A;  5G00 A;  1EPW A;  4I1B A;  2Y9X E;  1IHK A;  5BQU C;  5HPZ A;  5JLV A;  3VSZ A;  3BRF A;  3N7J A;  3N7L A;  1I1B A;  1DZD A;  5BXS A;  1TIE A;  3B9U A;  4LO0 C;  1IRP A;  4I8M A;  2UUS A;  1HWN B;  4G6J A;  3N7K A;  1DJS B;  2Z48 A;  1JTC A;  1TFM B;  4GOY A;  3OGF A;  4DEN A;  1HCE A;  3UD7 A;  1Q03 A;  5DUY A;  3N7M A;  4LO1 A;  2P39 A;  4I1E A;  1T9F A;  2D22 A;  1FWV A;  3W9T A;  2Y9F A;  1W3G A;  4FVV A;  4R6U B;  2D1Z A;  1AVU A;  4A7K A;  3A22 A;  1FQ9 A;  3FJE A;  3CAH A;  4LO0 A;  3T8S A;  3H6Q A;  3MPP G;  4HA2 A;  3BAO A;  4JKX B;  2WBC A;  4QD2 C;  6I1B A;  3CA5 A;  3I2X A;  1JT4 A;  2KI6 B;  4I4P A;  4GAF A;  4L4I A;  3H6S E;  5BP5 C;  2J3P A;  4I3N A;  2GZB A;  4KC3 A;  3P53 A;  2E4M A;  3FJC A;  1HWM B;  5DSS B;  3BAU A;  4JAW A;  1QQK A;  4D0T A;  1S0F A;  1TP0 A;  2RQ9 A;  4OWL A;  1HWO B;  1EV2 A;  2P23 A;  4LO7 C;  1Z0H A;  4QBV A;  4MZG B;  1V6U A;  3WIN A;  4Z9W B;  31BI A;  4Q91 A;  1W3A A;  1FMM S;  4G9M A;  3AJ6 A;  5FZU A;  1BFG A;  1PUM B;  2ERM A;  4KEJ A;  1I1E A;  4OWJ A;  2KLL A;  4I4V A;  3PUB A;  3V0B A;  1ILR 1;  1MD6 A;  2XOA A;  3F62 B;  1BLD A;  3JRR A;  4OUJ A;  3CRH A;  5B2H A;  4IY8 A;  1S0B A;  2VSA A;  1AVA C;  4I4S A;  2D7R A;  3Q7W A;  1NUN A;  2K43 A;  1R8O A;  4I4R A;  5DVH A;  2RST A;  4A7Y A;  1V6V A;  3FJF A;  4J2K A;  3EF2 A;  4FGF A;  4IZE A;  4EFP A;  1HKN A;  4WBC A;  3FJ9 A;  4OWK A;  1PZZ A;  2AFG A;  2YUG A;  3AH1 A;  4I6I A;  3BA4 A;  4A7Z A;  3HMY A;  2X2T A;  1JT7 A;  1IOB A;  3QR5 A;  3UD8 A;  4D8H A;  3ILA A;  2NYY A;  4I7I A;  1G9A A;  3OBT A;  1E0O A;  4LO2 A;  2Z49 A;  3OJV A;  1BFB A;  3FJA A;  1IIL A;  3VWC A;  3I2A A;  3A23 A;  3D7W B;  2NZ9 A;  1K5V A;  3JUT A;  2BFH A;  1YBI A;  1ABR B;  4QBC A;  4LO1 C;  4YOL A;  3PME A;  3MAL A;  1BA7 A;  3UDA A;  5JMC A;  4I2S A;  5D61 A;  3FJ8 A;  3A21 A;  3ZXG A;  3F1R A;  21BI A;  3IAG C;  4EFQ A;  4GAI A;  4MZH A;  1M2T B;  1IRA X;  4OEG A;  3UJ4 A;  9ILB A;  5F8Y A;  4X37 A;  1F31 A;  3CA4 A;  5F8W A;  3AH2 A;  4USP A;  3QYD A;  4QC4 A;  3CA0 A;  4EB2 B;  3AKI A;  3O4D A;  4JKQ A;  2M49 A;  1TWM A;  3OJM A;  2R9K B;  2VSE A;  4QKR A;  1DQO A;  3FGM A;  3V0A B;  2E4M C;  4II0 A;  1CE7 B;  3BA5 A;  2VXT I;  5F90 A;  2NS2 A;  2NTD A;  1JLY A;  3HSM A;  4GP0 A;  3RSJ A;  1AVX B;  4UY4 A;  4IZX A;  1N4K A;  2HWM A;  1CVS A;  4I37 A;  2FDB M;  4HR6 C;  2MIB A;  3IM5 A;  1AFC A;  1IJT A;  2QYI B;  3WIN C;  2KKI A;  5EG6 C;  3O5W B;  3FFZ A;  1S0G A;  4ZLB B;  1ITB A;  2GO2 A;  4OW4 A;  4F83 A;  1GGP B;  1UPS A;  4D0Z A;  1MC9 A;  2MC2 A;  4I4U A;  3FJD A;  1FWU A;  3IM6 A;  4X38 A;  1XZZ A;  4DCK C;  1FGA A;  3H6R A;  3R4S A;  4Z8S B;  4ZFU B;  1IT0 A;  1DQG A;  5DZU A;  3BA7 A;  4JPZ A;  1DLL A;  1YTO A;  4ISQ A;  3O3Q A;  3ZXD A;  5BOW A;  1J0S A;  4MZF B;  1BFC A;  1G9B A;  4ZFY B;  1JLX A;  4JP0 A;  1G9C A;  4XFT A;  4HJJ A;  3P6I A;  2L5X A;  3OJ2 A;  1Z2V A;  1OQL B;  1SR4 C;  4KEK A;  3IM7 A;  2LIE A;  1XYF A;  2DRE A;  1PWA A;  4ZFW B;  4F34 A;  2AAI B;  4XFS A;  4J2X A;  1YYN A;  3UJ0 A;  4H04 A;  4DEP A;  4LO2 C;  2NVH A;  4IHZ A;  1BAR A;  3C9Z A;  2FFU A;  3V0A A;  1ONK B;  4EFR A;  2HW9 A;  3FJI A;  3VSF A;  5BVP I;  1D0H A;  3RMY A;  2K4A B;  4ZA3 B;  1JT5 A;  4X3A A;  2DS0 A;  2Q3N B;  4I96 A;  2KH2 A;  2ET2 A;  4G9N A;  3BAQ A;  1V6W A;  1SR4 A;  4G1R A;  4Q9G A;  1EVT A;  2HZ9 A;  3WO3 A;  3RTJ B;  2MLL B;  1QQL A;  3BX1 C;  5D62 A;  5EHA A;  3P6J A;  2I1B A;  2F8X C;  1FMZ A;  4G6M A;  1ISV A;  4IQP A;  3NBE A;  4H9W A;  2RG9 B;  1Q1U A;  4L4H A;  1WD4 A;  1A8D A;  3BRG C;  4I4Q A;  3NBN A;  1ISZ A;  4ZBV B;  2VLC A;  4QO3 A;  1QXM A;  1HWP B;  1FN0 A;  1RY7 A;  1EYL A;  3WMV A;  3OGG A;  2WRY A;  2Y9W C;  3AKF A;  1S0C A;  3I29 B;  3BRD A;  2NM1 A;  2AQZ A;  1V6X A;  5E24 E;  4AN7 B;  1AXM A;  1DFC A;  1YF8 B;  4EKX B;  3VT2 A;  3RMX A;  2F2F A;  3WO4 A;  1PUU B;  1L2H A;  4H75 A;  4LO3 C;  3ZC9 A;  4J23 B;  4QD2 B;  3OBR A;  1DZC A;  4XKI A;  4LO8 B;  3FUO A;  1XG6 A;  1FV3 A;  1K5U A;  4ZGR B;  3LLP A;  3CU1 B;  3A07 A;  4JQ0 A;  4OEF A;  2VXR A;  3RTI B;  2NP0 A;  5BXT A;  3IIR A;  1KNM A;  2ZQN A;  4XFU A;  5BXR A;  3V0B B;  1BAS A;  3N0K A;  4ION A;  3CRG A;  1ISX A;  1G82 A;  2Q9X A;  4GP3 A;  3AKG A;  3WA1 A;  3CQA A;  4LO7 B;  4AN6 A;  4LO3 A;  2FGF A;  3O4O A;  1S0L A;  3ZC8 A;  1HCD A;  4ISR A;  3BAG A;  5BQU A;  1ISY A;  5F8S A;  4X39 A;  3O44 A;  3FJK A;  3PHZ A;  1TOO A;  2K8R A;  3FJB A;  1RG8 A;  2D7I A;  3VUO A;  4J2Y A;  3FJH A;  2DRZ A;  1AVW B;  3LTQ A;  3K1X A;  2IHO A;  1M16 A;  1WD3 A;  1R8N A;  4Q9P A;  1RZO B;  3AZV A;  4KBB A;  4USO A;  1II4 A;  1FV2 A;  5I1B A;  3TC2 A;  2D23 A;  4P0L A;  2BEA A;  3AH4 A;  3HAL A;  3O49 A;  4END A;  3O4B A;  1SZ6 B;  1Z4S A;  2FO1 A;  1ISW A;  3VEQ A;  1TTU A;  1AF9 A;  3BTA A;  1WBA A;  3AJ5 A;  3VT1 A;  3R4U A;  3O4A A;  8I1B A;  2AXM A;  3Q7Y A;  3BB2 A;  4CJM A;  5BXP A;  5EC5 A;  3Q7X A;  3NJ5 A;  3BAV A;  4I0Y A;  2FFV A;  3BAH A;  3ZX7 A;  1XHB A;  1P63 A;  4TLP A;  4ZOT A;  4P6A A;  3BAD A;  2IWT B;  2VUA A;  2ZR1 B;  4QKS A;  1TWE A;  4I4X A;  4IYB A;  3HBW A;  4PC4 A;  5BP5 A;  2D44 A;  3UD9 A;  3HOM A;  2VU9 A;  1BFF A;  4QAL A;  1JT3 A;  2ZQO A;  5FZY A;  1VCL A;  3PG0 A;  1WBC A;  4JRA A;  41BI A;  2LIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...