4Q9NA

Crystal structure of chlamydia trachomatis enoyl-acp reductase (fabi) in complex with nadh and afn-1252
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
295
structure length
295
Chain Sequence
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSLELGKFNASRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKDLSGYTVSEVVEQVKKHFGHIDILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNAGASTISLTYLASMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERMVDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.
pubmed doi rcsb
source organism Chlamydia trachomatis f/11-96
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 102
structure length 295
sequence length 295
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4q9nA00
4O5OA 3VVCA 4FJ2A 2C20A 1G0OA 4E5NA 1V3UA 4FS3A 5ITVA 1ZSYA 1FDSA 3ROMA 3TOXA 2Z95A 5JLAA 4PG4A 4R16A 5I9NA 4RQUA 4I1IA 4DXHA 5DOVA 2X22A 3JQBC 4XKJA 2X0JA 3CINA 2P91A 2GNAA 2X0RA 1AXGA 3OJFA 4JBIA 3DL2A 4BV9A 1ZKMA 3ENKA 4MP8A 3IMFA 4A27A 2DBQA 3GRKA 4P4LA 3WGOA 4RORA 1NYTA 3F1LA 4YDRA 1R0LA 3DOJA 4G2NA 3LC7O 5G0TA 4XCVA 3IUSA 3WQRA 4LMRA 1YQDA 3QQPA 1SOVA 4K28A 4WCDA 2ZB7A 4UVGA 2JD1A 4O0LA 4PLGA 1N9GB 2WWRA 2VZ8A 2VHYA 2DFVA 2F1KA 3D1LA 2JJYA 5A5EA 4EEZA 2Y1DA 2YFQA 1I36A 2AEFA 4ZQFA 3DC2A 1J6UA 1QYWA 5TT1A 3SXPA 5A03A 2NM0A 3LT0A 1NP3A 3WSVA 3OJOA 4PG8A 2ZTLA 4OOEA 4OJNA 3WTBA 3RD5A 4ZQHA 1TA4A 4IM7A 3V2GA 3G79A 3NV9A 3OSUA 3EUWA 3BA1A 4YJGA 1GD1O 3UF0A 4BO2A 4BNZA 1LSJA 1M6HA 5G0VA 1WW8A 4LVUA 1X7GA 3DTTA 3K96A 3KOUA 1A5ZA 1HSOA 4L4XA 4IGFA 3EHEA 3ZV4A 2Z5LA 4LMPA 4RVDA 5TS3A 3I1JA 4RCVA 5DDIP 5LDHA 4PLVA 4PRKA 1NFFA 3AI1A 5JYEA 2CDAA 3MWEB 2G82A 1NASA 3HWRA 3RJ5A 1IUKA 1WZIA 3LT1A 3OJEA 1A72A 1P0FA 4LGVA 4PLWA 4CQMD 1HF3A 4INAA 5EPOA 1LBEA 1T24A 1RM4A 3FR7A 4PVDA 3GPIA 3U4CA 2GZ1A 4XGNA 3AUAA 2ZYDA 3PHJA 4AJNA 2HJSA 3B1JA 1DC5A 2WSBA 5IDXA 1HL3A 3KLPX 4U7WA 1ZIDA 1DHRA 4R41A 1EVZA 3H9EO 3V1UA 3JQBA 5EQDA 4ND3A 1FK8A 2PY6A 4PG7A 4AJ1A 1OC2A 2QG4A 3ZWMA 3FPLA 4IS2A 2AG8A 2VWQA 1LQTA 3NGLA 5DZSA 5ES3A 4RDHA 4IZIA 4UVDA 3IKTA 4CV2A 4R3WA 4HUJA 2UUOA 1NWHA 1DO8A 1ZZEA 3MZ0A 2PWZA 4Q3EA 1XU7A 1I01A 1P1HA 4RDIA 1KERA 3MOIA 3KYDB 4J4TA 4NI5A 5IZCC 3U62A 4RVHA 3F4BA 1B8PA 4W7HA 1Y7TA 3VTFA 2UUPA 4JJFA 1M67A 2X5JO 3WIDA 3TFOA 1A7AA 4URFA 4WE3A 3GVHA 5JXWA 4OXNA 2O3RA 2DBVO 4MDHA 1E5QA 1PTJA 1NM5A 3LZ6A 3BMCA 3FR8A 2CY0A 4DLAA 4FGWA 5JW6A 1G6KA 1GUYA 5U1PA 1HDGO 2EV9A 1EEHA 2FR1A 1QG6A 1HDZA 4Q3NA 2FPPA 3LSYA 4BIIA 1GR0A 4BO5A 5K9ZA 3WYCA 2EKQA 3EAGA 2QRLA 1MP0A 5IFLA 1GU7A 3TNLA 3TPCA 2PH5A 2VOJA 2AG5A 5JDCA 3B70A 4YQZA 3RC2A 1ULUA 2G5CA 1P33A 1MA0A 2OFPA 3C7AA 4XIYA 1QP8A 3MOGA 1CIVA 2E37A 4IIUA 1GZ3A 1EFKA 4P4NA 5CDUA 4RJTA 2UDPA 1MUUA 5A5FA 3GHYA 1XCBA 5U9CA 1FDUA 1W73A 3OQBA 3WYEA 4W7IA 2Q99A 4KWHA 1WMAA 5C7OO 1EBFA 2XAAA 4IZHA 2IZZA 2ZTVA 2ZTMA 3HDHA 4NH4A 2O7QA 1ZJZA 3T4EA 3PTZA 4CM9D 1ZUD1 5A3VA 2Y1EA 4YVFA 2XXBA 4DUPA 4IUYA 1X14A 3VH3A 1X7HA 1YB4A 2ET6A 2V6GA 4ALNA 1ONNA 1GYRA 3HJAA 1NAHA 1BDBA 3C7CB 3E18A 4BNXA 1TB4A 3N58A 1T2FA 5KVQA 3P2OA 1ZMOA 3Q1LA 1GPJA 3LT4A 1A9ZA 5GZ3A 4E2YA 5K6AC 4U8GA 1A9YA 2H9IA 3DBRA 3SX2A 4CMHA 1VPDA 1EFLA 4NFYA 2X9NA 4K1LA 5GY7A 3CSDA 4G65A 4BUCA 1G0NA 1AHIA 4BGEA 1DRVA 1LI4A 2PZMA 4FFNA 1N1GA 2OUIA 4J7CA 3SVTA 4BQPA 4DBVO 5JAZA 3OP4A 4A5OA 4YR9A 3DFUA 4BNGA 2Y66A 1H5QA 5JC8A 4PZCA 2DAPA 3TJRA 2X8LA 2GO1A 4TRJA 4YJFA 2NACA 1HETA 2AW5A 2YJZA 3UVEA 1GZ6A 4NMHA 3DHYA 2D2IA 4J90A 1UJMA 3RCBA 3WBFA 4A26A 3HDQA 1H0KA 3U4IA 1PGOA 2IZ1A 4NK4A 5TT0A 3V1YA 1GV0A 4NK5A 4MVJI 3MTJA 4RPKA 3JQ9C 3OETA 4MKXA 2W8ZA 2PLAA 3DFZA 2P2SA 2FR8A 3IKVA 3IJRA 2EP5A 4E0BA 9LDTA 1DRUA 4WLNA 4D3FA 5BNTA 4BO8A 3WMWA 2XXJA 2CVOA 4MVJG 4Q9NA 4BNNA 3AW9A 1B26A 3DAGA 4B8WA 3PJEA 1Q7GA 1ZJYA 4M86A 3DZKA 3OHSX 3GG2A 4CLRB 1GY8A 5EN4A 5LDGA 2Y0EA 3HADA 3UCFA 1CERA 4JP2A 1HYGA 1FDVA 1HTBA 1TT5B 1UUFA 3PJFA 4KTTE 2X86A 4TVOA 3G1UA 2J6IA 2A92A 3DHEA 3QVSA 5EJ2A 2FP4A 4GBJA 2B35A 4CLRA 1QSGA 4KDEA 2PTGA 3GF4A 2O2YA 3A9WA 3JQ6A 2Y1CA 3EVTA 1HE2A 1C0KA 3VPFA 1E5LA 1GEGA 2AHRA 1O89A 3HE3A 4HXYA 1ORRA 4LN1A 2P5YA 3U4DA 3RASA 3BMCB 2BLLA 1ADFA 4BB6A 2POQX 2O3SA 2DM6A 4DREA 1JW9B 1R4MA 3JV7A 1WLYA 3QVWA 2BGMA 2WEKA 4JP3A 5CDSA 1JWBB 2EP7A 4PLZA 5CEEA 3AWDA 1E92A 1LDGA 3ASVA 4NJOA 4CODB 1O94A 2FSVA 3PFWO 3SEFA 1NQTA 2EXXA 4XEHA 3ZW9A 4CMJA 3H5RA 3UKOA 1C1DA 2EERA 3PPIA 1ULSA 4Q3BA 3AUSA 3CEAA 1ISHA 3GOHA 4QECA 3ZWYA 5F5NA 4M49A 5H83A 4FB5A 1HZJA 3R0IA 1GL3A 1WAMA 3R1IA 1ADCA 2DLDA 3GEGA 3I6IA 5G0WA 1ONPA 2Q4BA 1LRLA 1UXKA 4Z0TA 1JWAB 1R66A 5HS4A 3AU9A 5IZCA 4OKIA 1SO8A 1P31A 3LF1A 1Y9EA 2FPGA 4NNJA 4CMEC 1L7DA 1PJBA 3F6YA 3LVFO 4RO0A 4U6QA 1C0IA 1PL6A 3GLQA 3AFNA 3D4NA 1I10A 1YL7A 2HRZA 1E1LA 2PKQP 3CZMA 4CL3A 2E82A 4HFMA 2TMGA 3L07A 3STHA 2ZQZA 3VTZA 3FNHA 2JAPA 4IJVA 1Y8QA 1NPTO 3BHMA 4II2A 5B4VA 3QIVA 4GGPA 1JVBA 2FZEA 2X0NA 4BNKA 5KKAA 5B4UA 3LC1O 2OGUA 3FNGA 3MJCA 3NX4A 1U5AA 2NSDA 3D4PA 4XQ9A 3TZQA 4OQYA 3ST7A 4D3SA 3DBRB 2YQ5A 1A71A 2BGKA 4J0EA 1KC3A 2I3AA 3ZU5A 5JO9A 3H2ZA 1DC3A 5B4TA 1ZH8A 5I7VA 1YDEA 5AVOA 3TZHA 1P1JA 2VZ9A 4AJHA 5I7EA 1P1IA 1GCOA 3AI2A 3FNEA 3JD1A 5G4KA 4E2XA 3ROPA 1M75A 2GASA 4NHEA 3RC1A 1SAYA 1I2CA 1CWUA 2J5QA 4NU5A 5TF4A 1N1EA 2DC1A 3DBHA 2DU8A 4IXWA 4EUFA 1X0VA 1JLLA 1XSEA 3DZFA 3FF4A 3U3XA 1QRRA 3ADPA 3HB4X 4YYZA 5G4KB 2Q3EA 3HG7A 2BGLA 4XYGA 1M2WA 4QFCA 2B83A 3GA0A 4Q3AA 3COSA 4C4OA 4B4UA 1WP4A 1ID1A 2NUAA 3GNSA 4R69A 3ZWXA 4XDZA 3E5RA 3WGIA 5IXYA 1P1RA 1R4NB 3RROA 1C0LA 1FDWA 4EUHA 5C7LO 2Y1OA 5L40A 4AVYA 5CPBA 3MEQA 5FI3A 1E7YA 1XQ6A 4BOYA 3S1LA 4BO6A 1BSVA 1KYQA 3KUXA 3E6AA 3RU7A 3DDNA 3IAHA 1P0CA 4FOOA 4KUHA 1B16A 5HBRA 4J2OA 1BVRA 3OJLA 3ONDA 4FPXA 4FCCA 4IQ8A 4WLVA 3QWIA 3QVXA 3W8FA 2DTXA 2R00A 4KDFA 4B8ZA 4E12A 2JHGA 4YT2A 3ZZNA 3GNTA 3GAFA 3TDKA 5TIIA 4YTEA 4EITA 4MVJE 4K26A 3HDJA 2EW8A 4OYRA 1PZHA 4UEOA 3NTOA 4FR5A 4JIGA 4L0QA 3BMQA 3ZWAA 1J4AA 4ESOA 5JFOA 5AOVA 4IDGA 4MVJM 4XJTA 4XR4A 2WD8A 1P9LA 5F21A 5F5LA 5TC4A 1RPNA 4BS9A 3FTPA 4I9HA 3GY0A 3NDIA 1MC5A 4J43A 3WJ7A 3NJ4A 4IQ0A 3D3WB 4BV8A 4Z0PA 1GYQA 5L4LA 1CQIA 5KIAA 3VPXA 4FBGA 1PL7A 4FC7A 3GUCA 1CJCA 5DULA 3JD3A 1TT7A 2GGSA 3WLEA 5KNLA 2Q45A 3UOGA 2VYNA 3OM9A 1XR3A 4IIVA 2NTVA 4MVJD 1VSUA 3RUIA 1N92A 2P5UA 4EEXA 3G17A 4YB8A 1YBVA 4Y67A 5HA5A 3LLVA 4KQXA 3WJAA 4L76A 3AJRA 2CVQA 1JKFA 3IJPA 4II3A 2TMDA 5TQVA 5A06A 3KEQA 3VC7A 4XR9A 3CKYA 1O9BA 3W8DA 5KJ6A 3INGA 2HU2A 4XDYA 2WD7B 5CP8A 3FBGA 1KEPA 3OA0A 3ICPA 4TZKA 3AOEA 1BVUA 1Y9AA 2YHIA 3JD2A 3VZRA 4P38A 2BRUA 1TXGA 3RKRA 3AK4A 4NBRA 4UUOA 2JHFA 1PIWA 5ICMA 4CM8A 4WUVA 3W8EA 1TVEA 2GR9A 3WSWA 3TWOA 3AY7A 1EUDA 1W0CA 3I9NA 1HDCA 4Q39A 2ZIZA 5C3MA 4DLLA 3WWYA 1GQ2A 2VNAA 1ENPA 2VYVA 4IY1A 1VL0A 4CUZA 2AE1A 3WIEA 5AXCA 4DC1A 4GWGA 5TJ9A 4FFOA 1NQOA 5KVSA 2X58A 2YW9A 1QORA 3ASUA 5ADHA 1NHWA 3WGYA 2PV7A 3D7LA 4PRLA 2VRCA 3NRCA 1X13A 2Y0DA 1A4IA 3A1NA 2WMDA 3H6KA 3SC6A 2ZJ0A 1WDKA 3E8XA 5KWEA 9LDBA 5JCXA 3GC6A 2Q46A 4JN6B 1R15A 5GZ1A 5HTOA 2C29D 4DC0A 2DKNA 3EK2A 5I8ZA 4F46A 5T67A 3UHAA 4MP6A 2NNLD 4Y6PA 5TGDA 2DUWA 4DL9A 4YT5A 2D5AA 3V2HA 4AJOA 1CF2O 3GDOA 1KC1A 4WCFA 1OZAA 3UXYA 5KVCA 2NVWA 3KZVA 3I4FA 3WNQA 4AICA 1PWZA 1I0ZA 1HDRA 2IXBA 1IB6A 4JQCA 3KRTA 1VJTA 5H81A 3I23A 1IPEA 1R4NA 3PWSA 5JSFA 2EWMA 3I5MA 3OQ6A 2RH4A 2C2XA 2VUSA 3OEYA 5IN4A 1U7HA 4HFNA 4AJLA 5KKCA 1KVSA 3RQSA 3RUCA 4DBZA 3U5TA 5CEJA 1H6DA 1VJ0A 4YJDA 4NQZA 1EK5A 2EIHA 2SCUA 4DQUA 1MG0A 2WDZA 1DIAA 2FRDA 3AU8A 3PZRA 1YO6A 4AFNA 1U7TA 4FC6A 2DTDA 4YAGA 2DVMA 3L9WA 1P77A 1HZZA 3HZZA 1C1XA 3B1FA 3GDFA 4WNCA 3V1TC 4FGSA 1F12A 3JQ7A 2HMVA 4DIOA 4IGEA 4NBVA 4B4VA 1WZEA 2NU9A 2G1UA 1CQJA 1LLUA 3TSCA 1OC4A 3JSAA 4IDBA 4ILKA 3VDRA 5A04A 3BTVA 2BELA 1EBUA 5K6AA 4I5DA 3HDYA 1KBZA 2P9EA 5COAA 4GKVA 4D79A 1V3VA 2D4AA 1LSOA 1BXZA 2G0TA 4N7RA 1NFRA 1DC4A 3QP9A 3IP1A 4YQYA 1X15A 3JQ7B 3TOZA 4CMCA 4A0SA 1XIVA 3CXRA 3PYXA 4DA9A 1ENOA 4XA8A 3KVOA 4TROA 1BMDA 1DFHA 5MDHA 2VTEA 4B3IA 4R4JA 5T8KA 2B4TO 1V8BA 3GN2A 2NU6A 3Q6IA 4CL8A 5COBA 3VZPA 3RKUA 1YXMA 4BO0A 2XF8A 4J9VA 4UAGA 5F1KA 1JTVA 2A9FA 3EMKA 2NTNA 2QYSA 1I2BA 1C3VA 2QYTA 1QLJA 2AQHA 1PR3A 1TI7A 1RM3A 1E6UA 4D44A 4BO3A 5A9SB 2ZCUA 4EJ0A 3S2IA 1NQAO 3FHLA 5L51A 1WNTA 5HRUA 3C3XA 2HMTA 2IE0A 3NDRA 5K0ZA 1IY8A 4J9UE 1Q2XA 4CQMB 3AY3A 5I7SA 4BO9A 3ABIA 5CHEA 3ADOA 5LC1A 3U0BA 4GX2A 2YHIB 5JAMA 1PS8A 1LDNA 2D8AA 3DZHA 1H2BA 2VWGA 1H9AA 2VYVD 4XZ3A 2HK8A 1OMOA 2O23A 3KEOA 4K6FA 4CM8B 1T26A 3WGZA 3FWNA 3ON5A 3PIDA 2QZ9A 2BH9A 1ISFA 5EINA 3RFVA 1F8GA 1F0YA 1E3LA 4B7CA 4I9UA 2F00A 3TZCA 3KETA 1HLDA 2A4KA 3OIFA 4OH1A 1SNYA 1K6XA 1KIFA 1WXDA 2YV2A 4TSKA 4UVIA 4ND5A 2B5WA 2O3UA 2FSSA 2P4QA 4J6FA 3FNFA 4YACA 4LCJA 4MVJF 5T6BA 4J4BA 4D46A 4NR0A 5CDGA 1UXGA 3GT0A 3DWFA 4M54A 3RUFA 1NR7A 5F1PA 2R6JA 4C7KA 1PX0A 2FMUA 1Z73A 1ZNQO 3ZU2A 1NWCA 4KP7A 1GDHA 2Y99A 4WLFA 1ZK2A 3JQAD 2XPCA 1B15A 1BW9B 2AXQA 1MLDA 1NPDA 2BKAA 3F4LA 4HADA 4KTVE 2H6EA 3WOHA 1ZK1A 1DRWA 3KTDA 1KVQA 3OECA 4FN4A 2VYND 5EMHA 2E48A 3P2YA 2YY7A 2YFHA 2DTEA 4OL9A 3SLKA 1KY4A 3DOOA 1E1MA 4CM6A 3Q9NA 1KEUA 1GV1A 2J3IA 4ALMA 4C7JA 5L53A 4JLWA 3H9JA 4Y8VA 2ZKLA 3AM3A 4CM1A 2I66A 4WEOA 2RBEA 1HWYA 2I65A 3BTUA 1YJQA 3O4RA 3M2TA 3R3JA 3PYLA 4WECA 3RUHA 4PN3A 1UR5A 3T7CA 3FBTA 1YWGO 1O6ZA 2ZATA 4J2HA 3KSDO 1E7WA 1JAXA 3NT4A 3KSZO 5BR7A 3WNVA 1GUZA 2AEMA 4EZBA 4OOFA 2I67A 1J49A 4MIEA 1YDWA 2X9VA 1E7QA 4BO7A 4CV1A 2OL4A 3GZNA 4R68A 2OP1A 4DMLA 1IHYA 3I3OA 1JN0A 1TEHA 3QE3A 5G0SA 3TQHA 1EVIA 4CMAA 2Y93A 3ORFA 3DEYX 3VPHA 2HK9A 4D0RA 4Y6SA 4E5MA 3GZNB 3GK3A 4JNKA 5FFFA 3Q2KA 2BI7A 1CRWG 1NTOA 1ZMTA 4BMVA 4WLUA 3NAQA 3PVZA 5T8KC 4Y6RA 4OQZA 4YRBA 1YKFA 3MJEA 1LDYA 3M6IA 4IDCA 4I08A 5FYDA 2WYVA 1IZ9A 3LQFA 3H7AA 4J7XA 5ICSA 1Y6JA 5DN9A 3TZKA 1D1SA 1PS9A 1K6IA 2FHSA 2Q2VA 4QO8A 4BNIA 3DXFA 3ETDA 3Q11A 1DPGA 1E7RA 3OMLA 4PLFA 1AHHA 2DUUA 4CPDA 1GYPA 5C7IO 1XLTA 3X2EA 2OXIA 2PZKA 2C0CA 4RLSA 4MVJH 3I6QA 4LW8A 2VHZA 5DCWA 3JD4A 3OF2A 4OXYA 4TKLA 3D5TA 1PL8A 5IDWA 5DP2A 3KYDA 3RI3A 4UEKA 5A9SA 4CMGA 5JDIC 4BVAA 1A4UA 1Z7BA 1CYDA 3BTSA 3ETGA 3F1KA 4ZRMA 5MGBA 1BXGB 1QYVA 3QVOA 4IBOA 4E3ZA 2VHVA 4YCAA 4UREA 2V7PA 3WG9A 1YE3A 3E48A 4ZQEA 1I8TA 5THKA 4J1SA 3WS7A 2Q2WA 2GERA 5T64A 4YT8A 2IYOA 3U09A 4JK3A 1BXGA 3SJUA 2R00C 4Z9FA 3WBBA 2VWPA 1XDWA 1DHTA 3B1KA 4NG5A 1NXQA 4RPHA 3UCXA 5A3JA 4YRAA 1EQUA 4BNFA 4D42A 3FTNA 1YQXA 3WQQA 2P4HX 3JQ8B 4XRRA 4OHUA 2Q1TA 3L77A 2QX7A 4QO7A 5TSDA 3BIOA 1YL6A 3JYPA 2GDZA 2VUTA 3FRJA 3H5AA 4IDFA 1RYEA 1B3RA 4XWYA 1I33A 2C5AA 4WPGA 2PNFA 3WB9A 3JQ8A 2VUUA 5EESA 3C7DB 3RC7A 1HT0A 2X6TA 1DB3A 4BGUA 2JKVA 3ZV6A 3E1KA 3DHNA 4AJEA 1X1EA 4BKQA 4XQCA 2ZJ1A 3NT2A 4GQAA 4TZTA 5JCJA 3QSGA 1GPDG 1QMGA 3FWZA 4B7UA 2J3JA 5A02A 1EE2A 1GFSA 1PGQA 1VM6A 1PS0A 1R16A 4WKGA 1E7SA 5JO0A 3H5NA 5IG2A 4YAEA 5B37A 1U3UA 3PYMA 2AQKA 4FFMA 4FQ8A 4IDEA 5BQFA 3I52A 2P68A 3BMNA 4CLEA 1QV6A 1YJ8A 3HQ4O 3NTQA 2DPHA 2W2LA 3ZN2A 4TVBA 1I5RA 2NVUB 5IF3A 2PH3A 1X0XA 4IINA 3WFIA 4CR7A 1YONA 2QRKA 2WYUA 4OIMA 3VPGA 1YRLA 4Y98A 3TL3A 3ZV3A 1OBFO 4YT4A 4ZGWA 1PZEA 1R6DA 3JYNA 3O03A 2PD4A 1M76A 3PLRA 4CM3A 2WJPA 1IZ0A 3L4SO 3O26A 3PWZA 1MGOA 1HEUA 4BO4A 4J1NA 3WDSA 2VTDA 5G4LA 1XEAA 3GVIA 4CQLB 5I9MA 3KO8A 3GUYA 1B8UA 5BSHA 1T2EA 4N18A 4EGFA 1J5PA 2I6TA 2BF7A 1MFZA 1WVGA 1U5CA 2WYWA 2C5EA 4NDNE 4IQGA 1ONOA 1L1FA 4DQVA 3IL2A 4R51A 3FPCA 4ZA2A 1ENZA 5I8WA 5DCYA 3IIEA 4XQGA 4CMEA 1LRJA 3S8MA 3JQFC 3HB5X 4KUGA 4GAEA 1ISIA 2QIOA 4H3VA 5DP1A 1ISGA 5C5IA 3PHHA 3TF5A 1NX6A 2W2KA 3PDUA 5CG1A 1ADGA 1OOEA 1LQUA 1WDLA 4MINA 1CETA 1WMBA 1KVRA 3DAFA 4O1MA 3T4XA 2NLOA 1KETA 3GZ4A 3OIGA 3JQ9A 4GSKA 1QYCA 1ZXBA 1HRDA 1LNQA 3DBLB 4PZEA 5DCUA 4QX6A 5ER6A 1Q0HA 3ICCA 4DPKA 5FWNA 4AJKA 1TT5A 3I83A 2H1SA 3INTA 3F46A 1E0DA 2EG9A 2JAHA 2VRBA 2YV1A 3Q2IA 4I8XA 3H65A 4JJGA 5EL0A 3GN1A 4FD3A 2EEZA 3BYZA 5AYVA 1NAIA 2CZCA 5AXAA 1SC6A 3A28A 4NZ9A 4NIMA 4WJZA 3LF2A 4X54A 3V8BA 5ENVA 4BKOA 1V6AA 2WE8A 3UW3A 4PLHA 1D8AA 2WE7A 3OA2A 1GADO 4WNIA 3CMCO 4BL5A 4CM4B 1NVGA 3VZSA 2JCYA 1U28A 4BHTA 4PG6A 3INRA 4W4TA 4YAJA 4YXFA 4ND1A 4BB5A 4CUKA 4UULA 5L7TA 2DFDA 4F45A 1MV8A 1PJSA 2BFOA 3NUGA 4J4HA 4KOAA 5L4SA 2IEDA 5KJCA 2CF5A 2RHRA 5AQ1A 1H6AA 2HLPA 1JVSA 1W8DA 3GMDA 4W99A 2VQ3A 4A2CA 1VRWA 3AFMA 4GVXA 1I2ZA 4DIBA 1UDBA 2PFGA 4M87A 3SC4A 5EQFA 8LDHA 1LLCA 2EHDA 2B37A 5HWSA 2OHXA 4PGFA 3K2EA 3ZHZA 2VZ0A 1T2CA 2JD2A 5AXDA 5JAIA 1BXKA 3C24A 5I9LA 4WCFC 4S1VA 1M66A 4LSWA 4KMSA 3K31A 1YOVB 3RIHA 1XA0A 4XYLA 1HDXA 1LX6A 1H6BA 1P45A 1UP6A 3MWDB 4QT0A 5BNFA 4CM7A 4IMPA 1GUFA 4ZHSA 3K8ZA 1BGVA 3AM5A 1JKJA 4J49A 3ONEA 2AE2A 4P8RA 5L9AA 5KVVA 1I32A 2VN8A 1YQGA 3ZV5A 1N9GA 4L4SA 3BTOA 3BMNB 1ZEJA 1ADBA 2FZWA 3E9QA 4GH5A 1OI7A 1YH3A 4NPCA 4CM9A 3QV1A 4GMGA 4PLTA 3PIIA 3MJSA 2HMUA 2CSUA 4XYMA 5C37A 3JYLA 5I7FA 3N7UA 3L6DA 1IYZA 3JQDA 4E13A 3RBZA 3VAZA 4OSPA 1U3VA 1IPFA 3JYQA 3MTGA 4TRNA 1LC3A 2IZ0A 4CQLA 5LCXA 2EJWA 3S2GA 2NQ8A 4YJGB 3U49A 1T4BA 1XGKA 4XIJA 2BFAA 5TRTA 3Q3CA 1YB5A 4PLPA 5A4DA 2HQ1A 5J23A 4UVEA 4XYEA 1WPQA 1V0JA 2IYPA 1LRKA 1H6CA 1ENYA 1T1RA 1DDOA 1MX3A 4AL4A 1RJWA 4GL4A 4JCOA 3HN7A 1LC0A 2ZQYA 2PK3A 1V9LA 1Z7EA 1GCUA 2ZCVA 4FW8A 3PGXA 3RUEA 2OBNA 2UYYA 3W4IA 2ZK7A 1Q1NA 4ZD6A 2CF6A 5IDQA 3OFSA 5THQA 3VOSA 2PGLA 1C0PA 1HE3A 1NR1A 4R9RA 2YHUA 1YBMA 3R3SA 4RF4A 3G1TA 1XHLA 4LK3A 4GSLA 4Q3CA 4TRMA 4AJPA 3NDJA 2X5KO 4DRYA 1HYEA 3ETEA 1Q7BA 2ZTUA 4FDAA 1DIRA 2B36A 4HP8A 2OORA 5F1OA 2IEBA 1NFQA 4ALIA 3HUDA 1MC4A 3GG9A 5HM8A 5DF1A 4DPLA 4LRTB 1O5IA 3ANMA 1AXEA 1R37A 4J7UA 3ROQA 4KUEA 1HSZA 4A03A 4PLCA 2IDZA 3G3EA 2W4QA 1ZK0A 3DZGA 4XYBA 3TZ6A 3AUTA 4CM4A 3LDHA 1C14A 1UXJA 4ID9A 1Y8RB 4Z6KA 3JD0A 2YDXA 1K5HA 1LXCA 1UXHA 5H82A 1XWFA 4LSMA 2A35A 1PJLA 3EGOA 1MB4A 4RPLA 4WASA 3PWKA 1ML3A 4I5FA 5BSFA 4BNYA 2V6MA 3HN2A 3GVPA 3QW2A 3SLGA 1V3TA 3UAGA 1S7CA 5COQA 3H9QA 3W1VA 1DLJA 4EW6A 4PZDA 2OOSA 5A9TA 1KY5A 3EC7A 4BNTA 2O7SA 1I3MA 3KYCA 4P4GA 4R1TA 1ZVMA 1DFGA 1YGYA 3C1OA 3BXXA 3I9KA 1EE9A 4Q3DA 3NJ8A 3GNQA 5CPFA 1LUAA 3GPDG 2HUNA 3PGJA 4K6CA 4Z0HO 1B3BA 3ULKA 4GX1A 3VH2A 1U2DA 1YVEI 4R3NA 2OMEA 3ZU4A 2IODA 1SB9A 3CE6A 4QQRA 5KCZA 4DTIA 5EERA 2O50A 2YZ7A 1DIHA 2PZJA 4R01A 4JXKA 1F17A 4FFLA 3S55A 1LA2A 2ZB8A 1YOVA 1F06A 1U4SA 4CV0A 3GEDA 3PHGA 1E3SA 3L6EA 3O9ZA 5G2OA 4U5QA 1Y5MA 4HY3A 1UAGA 1SBYA 3LT2A 2HAEA 4IJKA 4BNUA 2D5CA 4KZPA 2R2GA 4ZVVA 1UP7A 5L3ZA 2O3TA 1IL0A 3FSRA 3I9LA 1UAYA 1BTOA 4BKPA 1LTHR 1GTMA 2W98A 1PJ2A 4HFRA 5IJZA 5JNLA 3CZRA 2NV6A 2OZPA 3E03A 1E7MA 4OKNA 1T2DA 2H63A 2Q1UA 4HWKA 3RFXA 4P22A 1E3IA 4UUMA 1TLTA 1XU9A 3KXDA 1DAOA 4U0JA 1PJQA 1E1NA 1YBAA 2V6BA 4FJ1A 4JJIA 1T4DA 5L95A 3EW7A 2I3GA 4ROSA 4EDFA 5ER9A 5A1TA 4NJMA 3NEPX 1B14A 4BKUA 2GSDA 2FOIA 2V6FA 3DMTA 1RYDA 4TRRA 3Q0EA 2AEJA 4DQXA 1HXHA 1K2WA 1VKOA 4MIYA 4WOKA 1Y1PA 3PK0A 4ZU3A 5FEUA 1VL6A 4ITUA 3VKUA 3H3FA 5L45A 4DIFA 1H93A 3RAJA 4TKMA 1IE3A 4G81A 1I3KA 3DBHB 2E6UX 1NPYA 2H5LA 1UDCA 4OO3A 1O0SA 2YDYA 1DAPA 4IS3A 1VI2A 2Y67A 5JMWA 1R0KA 1U9JA 2BI8A 2I5PO 3JTMA 4CLOB 4TWRA 3E82A 3V2UA 4CLDA 1RWBA 4RF3A 2NADA 3H2SA 2I9PA 1LSSA 4M1QA 3KV3O 4H16A 1HKUA 4NU6A 4OSOA 3RSHA 5KOIA 1SEPA 3DQPA 2LDXA 1VE9A 3K92A 4YPOA 4MKRA 1E6WA 1LLQA 2O48X 2PD3A 3ITKA 2OO5A 2IRWA 5GZ6A 3AM4A 2RAFA 4MIOA 1DXYA 3L0DA 3IDSA 4GX0A 1VC2A 1ISJA 4BGVA 3GEMA 1KOLA 4RF5A 3H9GA 4XQEA 1V35A 4N5LA 5EIOA 5TLSA 1ISMA 1EDZA 1UZMA 4E30A 4J91A 2QHXA 1N8KA 1O8CA 5JPIA 2CNBA 1LLDA 3H4VA 4DYDA 1RM5A 4ZQBA 1BHSA 4UVHA 4WLOA 3K6JA 1WDMA 4GX5A 1FDTA 2Q2QA 5BSEA 4RPJA 4GVLA 4BQRA 1RM0A 1PQWA 2EGGA 1L7EA 4HNHA 3WXBA 1R4MB 3RWBA 3G49A 4RVSA 4M89A 3UGKA 4F3YA 2JFGA 4M8SA 1B2LA 2AQIA 4B7XA 4B3JA 2HK7A 4GMFA 4LVCA 3GGPA 3GQVA 4IMRA 3GDGA 4AJJA 1JKIA 2QW8A 1PGJA 2AQ8A 2GPTA 3T7EA 3ZWBA 2NQTA 3PJDA 3KLMX 3KYCB 4GLLA 1Z74A 2O3JA 1H94A 4PCVA 2C59A 4O59O 2B69A 4NBWA 4L8VA 3QWFA 1MXFA 2FWMX 1QV7A 3LYLA 1KEVA 4A10A 1EZ4A 1Y5RA 4RPGA 4TMFA 3FN4A 4QTZA 4MPDA 2D59A 2EF1A 3C8MA 4CUJA 3GGOA 1JAYA 3ZI0A 6ADHA 1R12A 4S3MA 5DBGA 3EZYA 3DONA 4RVUA 3TL2A 4R5MA 1XELA 1SMKA 3GGGA 4TQGA 1Z6ZA 2CFCA 1FJHA 3BMOA 1P1FA 4NFHA 3PFFA 2NU7A 4YA6A 2LDBA 3D0OA 1MG5A 1Y8QB 5IXSA 2YYYA 2PGJA 2FR0A 3ZDFA 3L4BA 5JY6A 1Z45A 4CMKA 1BRMA 3VHRA 4AJ4A 3DTYA 4O63O 4W82A 3WX0A 3EY4A 2C7GA 4YWJA 3PEFA 3I9MA 3OJ0A 3P7MA 3PDJA 5ENDA 3IUPA 2ZYAA 4U6SA 1GQYA 2GZ2A 3TRIA 2O3QA 4U0KA 2VRCD 1PSDA 3HFGA 1LDBA 3GRPA 2J5KA 2I76A 1K3TA 2CUKA 3VZQA 4ZICA 2I99A 3R6DA 4I5GA 3H8VA 1E6EA 3M1LA 1QKIA 4NJMB 3M1AA 2ZB3A 3OH8A 4QFDA 3C1TA 4D0SA 3UICA 3BHIA 4QXMA 1DFIA 1N5DA 1AUPA 1VL8A 4L74A 4YJHA 4YAIA 3I9OA 4JROA 1UP4A 2B4QA 1SPXA 1G1AA 1BW9A 4A7PA 5JYDA 1U3TA 2B0JA 4L9RA 5G0UA 1MXHA 2BHLA 4EYEA 2AMFA 1E3WB 5JBIA 3ZCXA 4J3FA 2QZZA 4YJFB 1Z82A 2DBRA 3CTMA 3JQGA 3PJGA 3CIFA 4GLOA 3E9MA 2VOEA 2CDCA 2O4UX 1E3WA 4GI2A 3WMXA 2VWHA 3PI7A 3PLNA 2W90A 4MVJA 3W6UA 3PXXA 4XD2A 5DBIA 3E9NA 1DOHA 4CLOA 3VKVA 3VVBA 2RH8A 1D7OA 4OM8A 1PZFA 4DVJA 1U8XX 1I3NA 3GMSA 3RVDA 3X2FA 3D4OA 4XJSA 5FI5A 4B79A 3D64A 5L7WA 3PHIA 1YS4A 3GFGA 5FF9A 4MO2A 3WGGA 1LSUA 1ZK3A 2C7VA 4E6PA 4WGGA 4BO1A 4DPMA 4F6CA 3UUWA 3WWZA 4D43A 3SBOA 3WGQA 5DNAA 3EVNA 4CR8A 3AUUA 2JCVA 4CLXA 1PR9A 1HLPA 4HKTA 3L6OO 1GZ4A 4GKBA 4XX0A 1U3WA 1VJ1A 1PGPA 2Y1FA 1VLLA 2HMSA 4YAKA 3JQCA 4XGIA 2OBYA 4DLBA 2GN9A 4Z9XA 3B6ZA 4E33A 2EGHA 1C1XB 4BMNA 3OEWA 3DOCA 4FFPA 4IJWA 4NFSA 4JX8A 3ZWNA 4E31A 2IXAA 1UXIA 2GCGA 4H7PA 1KVTA 4AJIA 3KB6A 5JMPA 2EKLA 1U8FO 4PG5A 1SOWA 1ZO8A 3ANNA 3ZHBA 5JY1A 1PJCA 3N74A 2BFPA 4HX5A 5T57A 1Q0QA 1SCUA 3GFBA 1I24A 2Q50A 2Z1NA 3MJ4A 4QEDA 3KHUA 3NGXA 3UN1A 3ZNOA 1B0AA 4FSHA 1AN9A 4CJXA 1U1IA 3RUAA 3ZHXA 4NBUA 5JAQA 4XRGA 3M2PA 2Y0CA 4OMUA 1N7GA 2C54A 3DZJA 1KS9A 3HHPA 4KQWA 1UZLA 3PQEA 3QLJA 4ZQGA 2PKQO 1ZEMA 3JQEA 1C1DB 2ZYGA 3H3JA 1KVUA 1PWXA 2VHXA 1PZGA 1EUZA 2JFHA 2W2LD 5IN5A 4EJMA 5ITWA 3CUKA 5JDIA 3GR6A 2GN4A 2GRAA 2Q4EA 1HDOA 1XQ1A 3BAZA 4MP3A 1QYDA 3BMOB 3F3SA 4W9NC 4B3HA 2HSDA 5BSGA 3ZNPA 4J1QA 5CFZA 1DIBA 2BFMA 1CDOA 1U2GA 1YB1A 4HV4A 1PGNA 4GGOA 5ILOA 1NVMB 5CDYA 3NTRA 3ENNA 1ARZA 2NU8A 2B5VA 3FI9A 2P9CA 3WLFA 1XYGA 2D3TA 4D41A 1K89A 3UCEA 3WFJA 4WOJA 4RQTA 5JCJD 2GYYA 5TNXA 5U4QA 2JCXA 4BGIA 2ZB4A 4N5MA 8ADHA 3U9LA 4D45A 3DAPA 4BNLA 3DBVO 4Y9DA 3U4HA 2HMWA 1HE4A 1IOLA 3F5SA 4W9NA 1P1KA 2CMDA 3HSKA 4JBGA 1QLHA 1O95A 2EW2A 2GUGA 3TN7A 3ZWWA 1EVJA 3C1AA 2X5OA 3QY9A 1FMCA 2GN6A 2GZ3A 2HKIA 2PA3A 4DGSA 4EBFA 5KJEA 4RGBA 4RZHA 4OAQA 4WEQA 4E5PA 2CD9A 4GPD1 4YJHB 1Q0LA 1Q7CA 1LU9A 3RUDA 5DBFA 3ROKA 1DIGA 5CG2A 2DT5A 3DO5A 4O6VA 2GN8A 1AGNA 3WGTA 2NWQA 1FF9A 4B4OA 4FOSA 3JCZA 4CV3A 3JQGB 4ALKA 5TJHA 1PQPA 2X7HA 1JQBA 4BKRA 3V5NA 4CMBA 3ZNQA 4WCFB 2X0IA 1VKNA 3IOYA 3IP3A 4QSMA 1E1KA 3O8QA 4RL6A 3VPSA 1MFPA 3PZBA 3A14A 4WK6A 3NKLA 4YRDA 1X1TA 3EYWA 4FFRA 1I3LA 4PIVA 1VSVA 4PLYA 2VT2A 5HS6A 4CMIB 3AY6A 1R0SA 3C85A 2X23A 2JFFA 4E21A 1XKQA 4IXTA 4J1TA 4XB1A 3KM0A 3K73O 4N54A 3KBOA 1A27A 4LRSB 1K0UA 3E5MA 4CLHA 5CEFA 1AE1A 3QA9A 3QJ5A 4UEJA 3UFXA 1SZJG 2HO5A 3WYBA 1QYXA 3ZH2A 5T5QA 2V65A 5JDCC 1BDMA 4CMIA 3W6ZA 2FPIA 1T2AA 4HNGA 1E3JA 5ILGA 1P74A 4RVGA 5A9RA 1ZBQA 7ADHA 3HFSA 3WGHA 1EMDA 2W2KB 5KJ1A 1GAEO 1EK6A 2QQ5A 2HDHA 3FD8A 4MKZA 4BNVA 1H2HA 2PZLA 4EJ6A 4K9DA 1EQ2A 1XG5A 2C82A 2PKRA 1DLIA 3BMQB 4YEDA 2Q1WA 1DC6A 1QXSA 2E4AA 1D3AA 2C07A 5IDYA 2PR2A 4OGWA 1UDAA 3BHJA 3K5PA 4L4RA 4XB2A 4UUNA 3F9IA 4BNJA 4CM5A 4ZN6A 3DZBA 1ZXLA 1Z75A 3PHLA 3QRWA 3LK7A 5L7YA 3Q9UA 2Y05A 3OIDA 1ZW1A 4ND4A 3W4JA 2HRBA 3D3WA 4R9SA 3O38A 3W4KA 2JL1A 1WWKA 3ONFA 1PJ3A 3LLSA 5IAAA 3H9UA 5IZ4A 3VDQA 4DYVA 4QUKA 6LDHA 1EUCA 3EZLA 4WLEA 1E3EA 3FCOA 2P9GA 2Q1SA 3MJVA 3P19A 4AJ2A 1T1SA 5JE8A 3ZU3A 3NYWA 1SB8A 3AOEC 3F47A 5A05A 2CDBA 1X7DA 2CVZA 1OAAA 2AA3A 4W6ZA 1D4FA 4R54A 3JQAA 1NQ5A 5JC1A 1HDYA 4ND2A 2VNSA 1KEWA 1PJTA 2WD7A 3LC2O 4GWKA 5AXBA 2D1YA 4HFJA 1PEDA 3GHHA 3QVTA 4N5NA 3EDMA 3UH1A 4E2WA 3MJTA 2HCTA 2VCYA 4L75A 1F8FA 4PVCA 3JQAB 3PQDA 2JD0A 1M6WA 2UVDA 3PRJA 2VT3A 4J0FA 3RBXA 1N7HA 3TFQA 5JS6A 1N2SA 1QR6A 1CEQA 4F6LA 1K6JA 1UZNA 3A4VA 2Q49A 2QRJA 2FY8A 5DOZA 4ALLA 3RJ9A 1SEVA 4H15A 4E5KA 4YBZA 1E77A 3KYBA 3WR5A 4BNWA 4RLHA 1ZSVA 4EI2A 3GAZA 1ZK4A 2WTBA 3IC5A 1DJQA 4Z3KA 3ITDA 4EUEA 4G5HA 4HBGA 1P44A 2X9GA 1IULA 3OQ1A 1DSSG 2HJRA 1PJ4A 1JA9A 2YQ4A 5TX7A 2D0IA 1NHGA 4IPTA 3ZNNA 4M55A 3RC9A 4CR6A 1B7GO 2DPGA 3DZIA 4DMMA 2PD6A 3DR3A 4NBTA 5CDTA 2X4GA 3OBBA 1IHXA 4IJUA 4IDAA 5KTKA 2DQ4A 1A7KA 3CPSA 1HE5A 1LDMA 3O8QB 1F14A 2O2SA 4LCEA 1DJNA 1BG6A 1HYHA 3ANLA 2NVUA 4ONEA 1GQQA 2OP0A 3S2FA 2YUTA 1W6UA 4BNHA 2PGDA 3L4BC 2GF2A 4Z9YA 2G76A 4FIZA 3L9XA 3JYOA 1BWSA 1NNUA 5GMOA 1ZFNA 1LEHA 3IQDB 5B12A 1H9BA 2GLXA 1GEEA 2VHWA 3LU1A 1D1TA 1T25A 3NT5A 5DT9A 3ZWPA 3S2EA 3ZWCA 3SJ7A 3QHAA 3RBVA 2X1HA 5B1YA 4ZRNA 3QWHA 2BMAA 3RFTA 1P3DA 4L73A 4R1NA 4IDDA 2ILTA 3K9QO 4MJLA 3ZWOA 1ZSNA 1LDEA 3B20A 1JU9A 1NVTA 3I9JA 3JQFA 4Z3DA 4RV9A 2BD0A 1PQUA 4LISA 2J8ZA 4RVFA 4RZIA 3ZGYA 1S6YA 3BZUA 2G17A 4AG3A 3KSUA 4OXKA 2E49A 3P5SA 3RU9A 3D5QA 4R1SA 5CAEA 3ZHYA 3HNPA 3WTCA 4BNMA 2UAGA 1J0XO 2Y1GA 3ZWVA 2NVBA 4R5HA 4XGKA 3A06A 2UV8A 3G0OA 4ALJA 3QWAA 2Y68A 4JBHA 4MVJP 1I30A 2RIRA 4ZJUA 3DBLA 3DMTC 3WICA 5BT9A 2RHCA 5KJFA 3K30A 4E32A 1YL5A 2J3KA 2Z1MA 4A73A 4FJ0A 2A94A 1RKXA 5BNIA 2XOXA 1Y81A 4E2ZA 1JDJA 2RCYA 3DB2A 3I4CA 1ZCJA 1DEHA 3GH3A 3QWBA 4KWIA 4J16A 3VH1A 1EVYA 3AI3A 1OFGA 4PFJA 2J3HA 3GVCA 3GVXA 5L4NA 1PU2A 2DBZA 4R1UA 2B4RO 3MCVA 4DWVA 1FXSA 1Y8RA 2C2YA 1EDOA 1LJ8A 4D7AA 3VH4A 2O4CA 5F3RA 2EKPA 4MOWA 1DBVO 2YV3A 4UUPA 4BMSA 2GD1O 4I9NA 3PP8A 3IS3A 7MDHA 3CMMA 4E4YA 3PQFA 3CH6A 2WM3A 1W4ZA 4CQMA 3ZW8A 4B4WA 4RF2A 3AOGA 1NBOA 4E5YA 2FN7A 4I5EA 1U4OA 2EJVA 2NTJA 3DMYA 3F5QA 4JGBA 3K2BA 3WQSB 4D3DA 1UH5A 2J5RA 3D3EA 3OICA 1B8VA
chains in the Genus database with same CATH superfamily
1RD4A 1RQPA 3VVCA 1M8JA 4K03A 2C20A 3OM8A 2GJKA 5ITVA 1DT3A 5TMEA 3U4GA 3FRIA 2QIPA 2ZSFA 3DYBA 4OYLA 1EP1B 2ERCA 3NLLA 3TOXA 5H4GA 1E1QD 3P71T 4NF2A 4JJEA 2O2GA 5J4KA 3ECAA 1EVLA 4XLZA 2ACKA 3EXIB 4LKOA 4LDRA 1CDEA 5DOVA 5JVDB 3SF8A 3URKA 4MWDA 3PNLA 1ZQ9A 1SC9A 3BGOS 5AJUA 3A9SA 4AMZA 2OTCA 3A6DA 3CINA 3LFHA 4A82A 2GZMA 1N5KA 1QHIA 3IE1A 2X0RA 2HA6A 1VE7A 3GJ6A 4IDNA 2QMEA 4TVKA 1C8VB 5B30A 2YMQA 4PXSA 2VA8A 2C2ZA 3NALA 3ENKA 5J5CA 4MP8A 3F7OA 1KP2A 3OY7A 4LRUA 1BMQA 3PXUA 1M6VA 3G9ZA 4TUYA 3ZKWA 5IYZB 1AKVA 3G0IA 1GLNA 3D81A 3NIBA 3RJZA 2NO7A 3C6YA 1USKA 1KGSA 2GRJA 3ONVA 4XCVA 3O8OB 2AXNA 3WQRA 4LDAA 1VE6A 3KELA 3QQPA 3CH4B 1BGXT 2Z9DA 2LV8A 4FBMA 1Y33E 4H7IA 4WCDA 1N0IA 3O4JA 5E7QA 2JD1A 4BQQA 2A0XA 4U9HS 2RGGA 3Q10A 4DNOA 3FUTA 1RXEA 2FQXA 1T5TA 2V7UA 2JIZD 3EEFA 2RG7A 1IJEA 4WSOA 2JJYA 4G85A 1E9DA 2GK6A 2CHVA 2C8KA 2D5BA 1A5SB 3CLRC 2YFQA 3LX8A 3LX6A 2W6NA 5IVDA 3TVTA 5LOVB 1J6UA 3DFIA 1K75A 5LMNB 3NHYA 3CLVA 2QUZA 1BFDA 2NM0A 3HI4A 4GKAA 2OQIA 3TLGB 2JFPA 5LU8A 3WA7A 3QBJA 1NNEA 3TGWA 4FDLA 1DKOA 3KPWA 4G89A 2ZTLA 4PG8A 3RT9A 2F6RA 4RDXA 1Z2PX 3RD5A 4ZQHA 1TA4A 3H0CA 4L02A 3VO8A 3OEED 3NV9A 4Y1RB 4Q5IA 4K6GA 1PVDA 3BA1A 3UAWA 3NZEA 2J0SA 1SHUX 3T7DA 1QH8A 2A4MA 1X7GA 1DUIA 1PDOA 1A5ZA 1GGJA 4MLCA 4XIFA 1Q3TA 2QM8A 4U2FA 3RG2A 2Z5LA 4LMPA 4HS4A 4RVDA 5DE3A 4JYAB 1JEAA 1ELOA 3OE5A 4IV5A 4MAFA 3BRSA 3EJ6A 4PRKA 5DDIP 3FTEA 2CDAA 5EMNA 5IH3A 4EG8A 1N2JA 4CNBA 3RJ5A 2E85A 4WVFA 4P4SA 2BUAA 3VI4B 1JFFB 4B44A 1ZH4A 3GCZA 2R65A 1W34A 3JRNA 1PFGA 1TJNA 1HF3A 4I50B 3JAKB 4WK4B 3TBKA 2DWOA 2HWKA 1GZSA 1V8OA 4PVDA 4NCBA 2YMPA 4CEHB 3KALA 1SH7A 1ZAKA 4BJ1A 4J07A 4ZHQB 5BW6B 3K70C 2HJSA 2UXBB 2ZM6B 5EKXA 2FLKA 2LD4A 3ORYA 4GOKA 1H4TA 1HL3A 1M3SA 3AX6A 1C4OA 3T41A 1ZIDA 3IKLA 3AF6A 4S2EA 2XDAA 3WE7A 1MKYA 1GCGA 1EVZA 1H69A 2F43B 2OB2A 2HXGA 4F2DA 5AW8A 2YWJA 1KTVA 3B78A 3RVBA 5IM4F 1GXSA 5ES3A 4PR0A 3QU7A 1LQTA 3EA5A 3GW8A 4WRRA 5EA2A 1UPTA 3QXXA 4KR3A 4UVDA 5KSYA 4R3WA 4Z86A 3OQIB 4C0BA 2KI5A 2VJMA 3F9RA 1NWHA 2EP8A 1DO8A 4NKRA 5CJJA 3A9VA 3MZ0A 4Q3EA 1SKYE 3QVLA 2JHCA 2ZT7A 3LPAA 1RWOA 1KERA 1T34A 3C6BA 2OD9A 4NI5A 2IS2A 1QMPA 2WF7A 3D2AA 4MSUA 3BULA 1T2NA 2IU6A 3F4BA 1Y7TA 3WO0A 4JWKA 1VKRA 3U60B 1CQPA 1YZKA 3WIDA 3TFOA 1SUBA 2ZDQA 4YUYA 1UMDB 4MCJA 4WE3A 2IZOA 5JXWA 1ZR4A 2O3RA 1URPA 2DBVO 2V6JA 4MDHA 2KM1A 1W9MA 5H9VA 1FU8A 5AW4A 3AHHA 4CT0A 2CY0A 2ZRBA 2YVLA 5JW6A 1G6KA 5U1PA 1HDGO 3T1OA 1F2TB 3U6KA 4RK4A 2EV9A 2FR1A 4Q3KA 4RSGA 4D8WA 4HLDA 2RGAA 3LSYA 4BIIA 1MB9A 3HJNA 3BGDA 4BO5A 4HPXB 4KXYA 5K9ZA 1YJ5A 1T5SA 2QRLA 5F51A 4GXRA 3R3UA 1SUDA 5IFLA 5TE9A 1TJ4A 4PHGA 4JY7A 3LWZA 4RK6A 3B70A 1CJSA 1OV4A 3KHSA 3WB0A 1VIVA 4MGKR 1MA0A 1Y6ZA 3MA0A 4RA6B 4Y1FA 4AZ3B 4UFOA 2AMYA 1QP8A 1VB3A 4MCAA 1WXXA 1PG2A 4IIUA 3U9SA 2FPOA 4HT3B 1L5OA 3SZ3A 4CDNA 4ES6A 1ZD8A 4FDTA 2ZYRA 4GLBA 4FNAA 2D74A 1KFEB 3FVQA 2YY6A 1UK6A 1XMJA 1Y9DA 2CBZA 3IT0A 3IILA 4Y2UA 2TMYA 1XCBA 5D86A 1FDUA 2YOHA 1W73A 2ZWIA 4Z9AA 3GJ8A 4W7IA 3WYEA 1GGEA 4EYQA 1Z39A 3HYNA 1IN8A 4HQLA 4YGYA 1EBFA 3QPDA 3LKBA 4FLMA 4MX8A 4QICA 4QASA 1UMCA 1C3OA 3O92A 3ZIUA 1YDGA 4TMKA 1ZJZA 3ANTA 4UTXA 2WILA 5BN3A 3QE9Y 3GGJA 4KRXA 2V1UA 2XXBA 2Q2OA 3L05A 3O8OA 1X7HA 4I1VA 1WU7A 4K86A 4YMIA 1KSFX 3ILHA 1ZGHA 3NETA 4DSZA 2JVIA 1GYRA 5FNVF 3HJAA 1NAHA 3X2SA 3C7CB 4FEGA 2ECPA 1TB4A 3N58A 3OZUA 5FNVB 4B47A 4EGQA 4YMLA 3QMVA 1K6MA 4IX1A 5KVQA 3P2OA 1U3CA 4R1LA 4DM3A 2FWRA 1GPJA 2WG0A 3AEQB 3N5CA 4EFNA 1QO9A 2N1MA 5GZ3A 4JBNA 5ECWA 1KYXA 4NBNA 4U8GA 3CVVA 3UJ7A 3X1JA 4NFYA 3P97A 2CE7A 1A5BB 2HZ7A 3RYTC 4FR0A 2VQEB 3LBAA 3RTCA 4MEBA 2G8NA 3FNIA 5IARA 4GKJB 1N4AA 5JTUA 1AHIA 1UEJA 1EVQA 1M34E 2JAQA 3I64A 4JVMA 4BGEA 5LA6B 3QVUA 4FFNA 1N1GA 2OUIA 2ZT6A 4BQPA 5J63A 3DP9A 1L4HA 5JAZA 2X0EA 3O94A 1DIOB 4A5OA 2XSZD 2GYVA 1R00A 4B0PA 3PC4A 4BNGA 1KSGA 4JDPA 5ES4B 3NGMA 2IOFK 4PZCA 1X9GA 3EXHC 2Z8YA 3TJRA 1GFIA 4YJFA 5TQ0A 1HETA 2QS9A 5FI0B 1QIIA 1BHJA 3TDMA 2YJZA 3UVEA 1GZ6A 4JVLA 5AW0A 1GPH1 3C87A 2D2IA 1UJMA 2ZTHA 2QQFA 3ELDA 1ZU5A 3Q7SA 4PV7A 3M6UA 4MJ7A 3U4IA 5F3DA 4NMWA 4X6YA 4Y0AA 5FLKA 4B3SB 2BGGA 2FHPA 1Y3CE 2A30A 4I4TA 4OHKA 1ODSA 4OI4A 1XZBA 4I14A 3MTJA 2CK3A 4MKXA 3LCUA 1QF7A 2ID4A 1KE2A 5IWCA 4KO2S 2O5EA 3D8SA 1PK8A 2PBLA 1BYUA 3IJRA 3JATB 4KN8A 3ZVRA 1GQSA 3MBOA 4D3FA 4ZZ1A 9LDTA 3O2JA 2XXJA 1J8MF 1Q0UA 4MVJG 4PC7A 4YXWD 4L8GA 3IB3A 5KI6A 4OP1A 2PA0A 4B8WA 4I4TB 4D3XA 1Q7GA 3BM5A 1VL2A 4HGOA 5KSPA 2Q5EA 1W1IA 4WK2B 3H8WA 4B3DA 4X6LA 2P11A 4BE9A 2A0WA 2BY4A 3T5PA 2QT9A 2AKEA 3DZKA 2KPOA 3A0UA 3HO6A 3K70D 5EN4A 2XE8A 1CP2A 3UCFA 4EFKA 5DN6D 2VJLA 1D2NA 2IUTA 3DV0B 2R8BA 2Y4OA 4FFVA 4O2AB 5DLQC 3FUWA 5FPQA 5JTTA 1FDVA 3STTA 1H1LB 3MD0A 2BIFA 2X86A 4OY3A 2YIVX 2DP4E 3G1UA 3OQIA 1FBNA 2JI4A 3P9NA 4CFYA 2UYQA 3IQEA 5EJ2A 3VM6A 1U0LA 1IRXA 2FP4A 2D7JA 3P9ZA 1M10A 3IKMB 3P9KA 1ZVQA 3V4RA 3EWAA 1QUFA 2PTGA 1FFXA 3GF4A 3PUWA 1G8MA 2PMFA 1CZNA 3R5JA 2QORA 5ADWA 1H3NA 5D3MA 1O58A 3EVTA 3C8DA 3KJEA 2QVGA 5ALZA 2G4LA 5HRCA 1E5LA 1O89A 2LBPA 4F3KA 5H3HA 1ODCA 4C7XA 5HFJA 4HDMB 5KVAA 1UMDA 2DMRA 2P5YA 2QMHA 3EFHA 3U4DA 1XAHA 4Z4HA 3VA7A 4IMIB 2CXTA 3HUFA 2PBFA 2PS0A 3UY4A 2ACVA 2AJTA 2ES4A 4X97A 1VIAA 5GPBA 3V34A 4DREA 3JV7A 5ELXA 2BGMA 3ZGOA 4NYMQ 5CDSA 4ZO6A 5DO9A 3X1MA 2EP7A 4PLZA 1JG2A 3ECSA 4GC5A 4DR4B 2IPMA 4CODB 3PFWO 4OIFA 5AJTA 3SEFA 4B17A 4FT4A 2AWOA 5E2BA 1H8HA 1NQTA 3RYCB 4XEHA 1TQ8A 1KQOA 1ZM3A 3ZW9A 1C1DA 2ZJBA 3BIXA 3HBFA 1T3LA 2WHYA 4BJ6A 4DY4A 3LL4A 2R86A 4Q3BA 3WOVA 3UKDA 1M34A 1U8EA 1K7CA 2IVZA 1T8PA 3IURA 3S28A 3UJ6A 3W2EA 5GGYA 1XI2A 5A6SA 4C0SA 1WAMA 3DDCA 2JGAA 4BXOB 4UE6A 1OAOC 1X7YA 1UXKA 5F98A 1NN5A 1AGYA 2QP9X 5IZCA 3I1FA 3LY8A 3KKEA 4EMSA 3IIJA 4QQ8A 1ESDA 1Y9EA 4JASB 4REQB 1R10A 1YSCA 4WKBA 1CUVA 2WNIA 2NO5A 3EPPA 1AMUA 2PO5A 3KLOA 4RO0A 4UFNA 3RNOA 4GP9A 1QQAA 3WO1A 1S8OA 1C0IA 3OC0A 3PGA1 1JNXX 1WY5A 2QXUA 3AFNA 4L8YA 3I0ZA 1PJ8A 1E1LA 3CZMA 3QUAA 1DPFA 3S0JA 2E5LB 3V7NA 3LH5A 4KFUA 1W4RA 2H9AA 3JQQA 1XL1A 3L07A 2W6OA 3U7QB 4X7PA 4A0FA 2R47A 3U7FB 1XRNA 4U39A 2ONYA 4IJVA 3BHMA 4F3CA 1R6AA 5LXTB 4GGPA 2G1KA 2X0NA 4JJ7A 4MJ3A 5B4UA 3LC1O 3MJCA 5FLXA 3IAEA 4KXQA 1GT6A 1LNSA 3D4PA 4QU5A 4RXMA 4OQYA 5K0NA 3ZOKA 3DBRB 2VJDA 5ICFA 1A71A 2YYSA 3ESQA 2XKAA 1KK0A 1LX7A 1VGVA 2B1IA 3ZU5A 3H2ZA 1DC3A 2A1UB 3KQNA 3O8DA 3RWMB 2OCBA 1P1JA 1JJ7A 1KSHA 3B7GA 1IG3A 5T6MA 3AI2A 4DABA 1ADJA 1HTTA 2FMXA 2YOFA 3CZ5A 3JD1A 2KE5A 4RMGA 2FJPA 5G4KA 1DKMA 4JIMA 4TTAA 1BOFA 4R8LA 2XGMA 2QM0A 5KYWB 1FTWA 1I2CA 1CWUA 3CUTA 4N03A 5C4MA 1LD3A 1RPZA 4TLLB 2DC1A 3WZMA 5DH9A 4EHBA 3H13A 3MS4A 4IXWA 4K81B 1X0VA 4N6NA 1JLLA 3FF4A 1J5EB 1AKNA 4MK4A 4YYZA 4X7BA 4TXHA 1YDMA 2PKYX 3RS8A 5CCXA 3SS7X 4DLSA 4F8JA 4CE6A 3DTVA 3FCEA 1M2WA 1WBBA 5BR4A 5A5VA 1RJDA 3GA0A 1ATIA 2ZJFA 2XCRB 1FVFA 3KEMA 1TJPB 3R4CA 4UPEA 4ZXFA 1KXJA 3TVYA 4II7A 3SYKA 4S0ZA 4JXZA 1RQ7A 1ZDMA 1O96A 3KKQA 4DFDA 4DCTA 3GNSA 4EZEA 2H1OA 4UKDA 4JR1A 1V7CA 2RDMA 3BBPA 4LUCA 1TKRA 3CLHA 5IXYA 1IU9A 1P1RA 2P62A 3AGQA 3DWGA 3BDIA 4R8RA 4LSGA 5I3CA 3M6AA 4M0MA 9GPBA 5L40A 5C7LO 4HX2A 3KQUA 4AVYA 4MUYA 5DM2A 2B9EA 2QVLA 4IH4A 5CPBA 4DB4A 2CSXA 5DGIA 3OU2A 4X84A 1VA4A 1XDUA 2JCGA 2GETA 4CKBA 2CL6X 3RU7A 1A9TA 4KUHA 5IBQA 4J2OA 3JX9A 3HJFA 4LGCA 2QZJA 3OJLA 1E3QA 4FPXA 4AKEA 2JRCA 4FCCA 1G3UA 4OHPA 5IW8A 3SXUA 4EP1A 2O19A 4P84A 4JXJA 2XMQA 3D0QA 5JV5A 2UZ1B 1B76A 3W8FA 1K7YA 4U2KA 4IIBA 4K9MA 1UM8A 2DTXA 2HOQA 2R00A 3QPBA 4QBFA 1WABA 3ZZNA 3FFTA 3GNTA 3OX3A 3PXDA 4JJKA 4K9OA 4EITA 5C8DA 2JGEA 3AF3A 4UEOA 3OT5A 1G7TA 2MTBA 621PA 2MSLA 2R1UA 4MR8A 4D80A 5JH7B 4FR5A 2AZMA 2BUBA 3KBBA 2RKBA 5ERXA 3ZY2A 3WLMA 5M29A 2D1QA 1HQCA 3KV1A 3EVGA 4I55A 4OHCA 2VYFA 1EG7A 4HZUA 3T0IA 4G8BA 4IDGA 3UK7A 2DHQA 5KQMA 5LQCA 3VJRA 4XJTA 4XR4A 5LB2A 2WD8A 3RRBA 1DRJA 2H59A 5TC4A 1UPXA 2QNBA 3MIIA 4QTUB 4C43A 1RPNA 4BS9A 5AI0A 5H80A 1QTRA 1T9HA 2OXFA 1XWWA 5AHXA 4RD1A 1TZJA 3A2NA 4WV3A 1MW8X 1P81A 3O0DA 3D3WB 4GOJA 4IQ0A 4BV8A 1XV5A 3VPDA 1SC1A 1A69A 1PYGA 4ND6A 4P32A 5DNYB 3UMSA 5L3SB 4IIFA 4QOSA 5FLEX 1K2VN 4PNPA 4FZ5A 3BGVA 3ZGVA 3UYKA 3BL5A 4K40A 3OZCA 3FCSB 2UYGA 5C4GB 3N8DA 1TT7A 2F3SA 4UHCA 3WLEA 5KNLA 5J2TF 2EKDA 3ZE8A 5M04A 2XMBA 3H2HA 2GLTA 3HYTA 4EEXA 3GIWA 2ZIUB 2Q3MA 3OESA 3P2IA 2PX2A 5CH5A 1ZH6A 1JKFA 3IJPA 3B1WA 2TMDA 3M6MD 2JJ2D 4RMHA 4DA4A 1XVVA 2BGUA 1TIPA 3VYTB 2K2WA 4R2IA 1GU1A 3INGA 2OFWA 2H1CA 2XVZA 3UAOA 2HU2A 2RAUA 2UZ4A 4PTYA 3TRDA 4BUZA 2FWBA 4M36A 1DJMA 3AOEA 1BVUA 2R68A 1PO7A 3O8NA 1Y9AA 2X6QA 2FFJA 3R7DA 3QKUA 4Y9TA 2BRUA 1TQHA 3ZW7A 3EGWA 2VTKA 3CWZA 4DV0B 2X3YA 1ODFA 1YF3A 4DIEA 1WR8A 1H22A 1DQSA 1EJ0A 1PIWA 2MR5A 2OQRA 2B2CA 4O08A 1SVWA 4WUVA 4ZC1A 1L4FA 4CM8A 5REQA 5ICCA 5BMVB 2FZLA 3OQHA 1HDCA 4HWSA 2WHXA 2XOKD 2ZIZA 2RC5A 3OY2A 5EGSA 5B57C 1QQBA 2FRXA 2VPIA 3TCXB 4ZYWA 2J09A 3ZYZA 5C3MA 4DLLA 3WWYA 7REQB 1X8LA 4GS5A 4LF4B 2WFLA 2ZXEA 5CFNA 3CF4G 2NUPB 3MT8A 1RT9A 2RONA 2AD5A 1VL0A 4CUZA 1Z0JA 1DAEA 1NN0A 2AE1A 3RH0A 3RHZA 1EKXA 5AXCA 4UM9D 4GWGA 2CNOA 2AF3C 5HKAA 3SKVA 4FHCA 1NQOA 4MWGA 5IWAB 1QORA 3AEXA 2WFLB 3WGYA 1TECE 2DULA 3KVYA 3D7LA 4AY6A 4QREA 1T0JB 2NUPA 2VRCA 2GZAA 4KWCA 2FV8A 1YHYA 2Y0DA 3H6KA 4F4DA 4YRZA 3TR0A 5KYVA 2VZLA 3GGDA 3JARB 4PZAA 5AO9A 4Q66C 5KWEA 1JT9A 2QD5A 3Q3VA 5IT9A 3D6MA 1XQVA 1KDOA 4Q4AA 5IHPA 2IYZA 4TMXA 5CB4F 5FWYB 2C29D 1TVCA 1Z6PA 2UZ0A 4WBSA 5DM1A 5T67A 4FFSA 4Q37A 1M0SA 2GAAA 5JROA 4FLFA 1CF2O 3HY6A 4MITA 1YKSA 4WCFA 4R1OA 3ROTA 3HCWA 4ZMRA 5AFSA 3K0SA 1TRKA 1SFRA 3WNQA 3R5KA 1V1RB 4FHFA 1I0ZA 2WWTA 4W9MC 1RZUA 3OIVA 1R4NA 3PWSA 4EELA 4CQMB 3K0CA 4WH0A 1NLYA 1SD1A 3I5MA 4RU1A 3ER8A 1M2OB 4K3VA 2WG1A 3DKIA 1QPBA 3ZI4A 3HU3A 3PF9A 4ZCMA 4BWGA 3NYRA 5CMLA 3WGKA 4HYEA 1DRKA 1U7HA 4ASUA 4B6FA 4HFNA 4AJLA 3RQSA 4DBZA 2ORIA 1VJ0A 3V9AA 4NQZA 2DXIA 1QIKA 3TMKA 1TYDE 2SCUA 5K4HA 1E69A 3EEQA 5J4LA 2ZE6A 1TUBB 1AUQA 1WSAA 4LXXA 1PT9A 4AFNA 1OH7A 1U7TA 4FC6A 4YAGA 3IO3A 2F67A 4WD3A 1C1XA 3B1FA 2FEOA 3GDFA 1XMSA 5LIPA 1F12A 1FS6A 3UAYA 1MOSA 1DOAA 1SVSA 1WE2A 4FMPA 2ZREA 2ZW9A 4NBVA 4RM2A 2JCSA 3DM9B 3S8YA 4ILKA 5EXDA 1H5NA 3GUVA 4D56A 5F52A 2BELA 4UD2A 1EBUA 1R27A 5K6AA 3NWBA 3DD5A 5EYPA 5IKOA 3A36A 5EIHA 2VR1A 2IKSA 3HZOA 4GKVA 2R2AA 3ZKAA 1N2ZA 1COWA 1NBMD 1RW4A 2A9OA 1DC4A 3IH5A 2PLFA 3QP9A 4YQYA 1T3TA 1QFZA 2OCPA 4NZOA 4D82A 4L7QA 2OBMA 4A0SA 1XIVA 2I4TA 1NP6A 1X94A 1AS2A 1G3QA 4ZYXA 4XA8A 1Z5NA 4AQYB 2J45A 2O0KA 2AFVA 4OVKA 1BMDA 5JSUA 2VTEA 3O1IC 3E22A 4R4JA 1W44A 3IE2A 2IH5A 2Z2YA 5TIIA 2AYXA 5FD8A 2PMWB 2B4TO 1V8BA 1XXHB 2NU6A 4RELA 4LFCB 1GZUA 2CLIB 2DR3A 4EY6A 5LSAA 3VZPA 3PT9A 4MJXA 3TZLA 5NULA 4EA6A 2XF8A 5CB4B 3MN1A 5LXTF 2KX7A 3WL7A 5JISA 1CE8B 3RLFA 1FZQA 1P6UA 1QLJA 1RXCA 2BMVA 2PZGA 2QYTA 4ER0A 2PUFA 4X94A 3JS5A 2RGNC 3W77A 4Z54A 4BO3A 3TTSA 2VAMA 4MLPA 3U7RA 4C04A 4ER3A 2JH9A 3F97A 5LU9A 4MHTA 1WNTA 1HG1A 1I1OA 3NG1A 1F51E 1C4WA 1QB7A 2PSJA 3C3XA 3CZCA 1J90A 1PR2A 3KCNA 2DQKA 2HMTA 1KAMA 4FIDA 4J9UE 1QCCA 4QOFA 4FB4A 1Q2XA 2W0MA 3AY3A 2PT9A 3EXHB 3PDCA 4OHRA 3G6WA 4KEAA 3T3HA 4A1OA 5EJ7A 1BQEA 1PF7E 2BJWA 2IE8A 3ABIA 3L5KA 4Z8XA 3N0RA 3TGPA 1CHNA 1P3Y1 1NONA 1ND5A 1DZ3A 1VDMA 2WF5A 1LDNA 1T4GA 4OFWA 3ZE6A 6GPBA 4ENTA 1H9AA 1O1YA 1WB5A 4L4ZA 1YIAA 4UM9B 3KEOA 3C14C 5J5AA 2WT9A 1B0UA 2APJA 2F3UA 2C95A 4QYSA 2QZ9A 3OO1A 4UBOA 4BGDA 1XROA 1O9GA 1JECA 2JW5A 4O8ZA 1ISFA 1NI5A 3A9TA 5H8WA 3R7BA 3O0TA 5ULLA 3G23A 3L8CA 3MWLA 4GRIA 1VHTA 3INYA 3TRKA 3A10A 5IBCA 1B93A 1HLDA 3OIFA 4C78A 1YS7A 1AUVA 1D6JA 1WXDA 2GNOA 2OO5C 5AK0A 4UVIA 3QH4A 3NV7A 4ND5A 2O3UA 5JQGF 1A8IA 2ZCJA 1QAOA 2FSSA 1CS4C 2NZXA 3RVMA 4J6FA 1FRFS 4YACA 2OV8A 2XUJA 4H77A 5CJPA 3RJTA 4J4BA 4IAOA 4LIPD 4E03A 2R0QC 2XQGA 4AUEA 4F84A 4M54A 3ZPXA 3L0ZA 2VZEA 5CYPA 1XLVA 1ZNQO 5SY4A 2HJ9A 2YMMA 4LXQA 2VDWB 3R7WA 1GDHA 3F8WA 1ZN2A 1C9YA 3ESRA 4MWCA 4O4HF 4WLFA 1ZK2A 2I4IA 5EE0A 3OPNA 5FA8A 1UBMS 1P0PA 2J7PD 3F4LA 4KTVE 1YIOA 1B8OA 1DRWA 4IIGA 4TX1A 1KVQA 5F23A 3WV5A 1NKVA 2OENG 2O8NA 2H2FA 4J8PA 4J1TC 1JDNA 5A4AA 2E48A 1KI8A 4KLRA 2YY7A 2YFHA 4X1IB 1PEYA 4BPBA 2HADA 2JPDA 3SLKA 3DOOA 2PAAA 2J3IA 4L0MA 1K8ZB 1Z07A 4N0DA 1QK4A 2W37A 4GSYA 4MV1A 1RVV1 4Y8VA 2JJ2A 3RU2A 3ZC3A 2WHQA 3JVDA 4CM1A 3TLGA 5K8LA 2IUFA 1T2VA 4L50A 1RE0A 3AVTA 2D0DA 1E99A 3FPSA 5C31A 3C6XA 1IONA 1HWYA 2ZR0A 4QHTA 4OFXA 4PN3A 3RUHA 2HU5A 2QTVA 4W1QA 1FSSA 1O6ZA 2AH5A 4GPTA 2ZATA 2AS0A 4J2HA 3SZLA 4OX9Y 5EEHA 3ZXYA 3B6IA 3QLTA 2VSFA 3KSZO 4K0RA 5A5GA 1NUHA 4ZI7A 1QU2A 4OOFA 4MIEA 1K5PA 3WYNA 5JQWA 4Q7KA 2GXQA 2QN6A 3GZNA 4R68A 5D84A 3B36A 2X8JA 3HVIA 3WB1A 3X3HA 2FWAA 4JU8A 1YE5A 4JQOA 5G0SA 1D2GA 3UV7A 3SR0A 4CMAA 2Q29A 3ORFA 4K8OA 5KYYB 3H2GA 3NHMA 1RZVA 3NC0C 3CPEA 2P75A 2MJLA 4KXLA 4Y6SA 4HGNA 3W7VA 2WJ4A 4LJ9A 5K7SA 1F7UA 2BI7A 1NTOA 4LYDA 2ID7A 4UE2A 5CLIA 2BE9A 4FHZA 3RVPA 4OHBA 2FMIA 5T8KC 1U0RA 2YXDA 4OQZA 4YRBA 5CBPB 1XMVA 2C9OA 3MWYW 3R3ZA 2JFVA 2REQA 4LQ4A 3TJZA 2OB1A 3JAWB 3M6IA 4I08A 5FYDA 1WD5A 4J7XA 4TLCA 1Q0TA 1ABEA 4P3YA 3P52A 4LRQA 1VPEA 2DSNA 2OC4A 1L5YA 4FGLA 2HR1A 2GN0A 2FHSA 2Q2VA 4OU5A 3ETDA 2PIDA 5KMGB 4AW9A 4C76A 1E7RA 1FLDA 4PLFA 4ACAA 5K51A 1GYPA 4KGVA 1CUYA 2RGUA 2OXIA 3O84A 1CJKC 3LHDA 3QI2A 2B4KA 1OPRA 1C9MA 3WKBA 2OCLA 3ETCA 2BTQA 2Q8PA 1S4MA 3AINA 3ETHA 3JD4A 3OF2A 3HDTA 4OXYA 4XASA 3T8YA 3EPLA 1E1YA 5K4AA 3RIXA 2RI1A 3RI3A 3KKLA 4BVAA 4EVIA 2HJVA 4QUEA 1S0UA 1YUNA 2P41A 2IOQA 1BXGB 2VHVA 1R6UA 4UREA 4HJRA 4FFWA 3LVQE 1UF9A 3TG8A 1K8XB 5CX1A 4ZAWA 3SS9X 3BT7A 3H3XA 2R60A 2K4MA 2Q2WA 3FUXA 3RS4A 3SM9A 1F38A 3V4VB 4LV6A 5IFKA 1TYCA 1P2VA 2AX4A 3QYAA 5K5EA 1WCIA 3U09A 1BXGA 3IBCA 3QPUA 3WBBA 3E1GA 5K0LA 5FOQA 4NG5A 4WOPA 4NATA 3ZIAA 4YRAA 3U16A 1JMYA 1E6KA 1YKGA 3HJGA 3UH0A 3WQQA 4QYWA 5HKKA 2P4HX 5LOVF 4KGXA 4TUYF 2OV2A 2XUHA 2R87A 3JQ8B 1YRBA 4I4CA 3DP7A 2Q1TA 4LZOA 2ZZKA 4O8CA 1UADA 1ZOOA 2ZT5A 4MYDA 2HU7A 5LYJA 1P2DA 4DA7A 4MWOA 1RAGA 1RC8A 3KJHA 4KE7A 3PDIB 2PWYA 4C7OA 4OJMX 5I9IA 3M4NA 3TE7A 1ZLYA 2ZTSA 3I2YX 1B3RA 1YTLA 3Q72A 4IF4A 4JSRA 4CL0A 5CFLA 2C8VA 3FCXA 4LXGA 4F72A 3A2KA 2V9CA 4C6SA 2Y1XA 2VUUA 5EESA 2B9VA 2CMKA 4V0NA 3IPLA 3HCNA 4M0KA 1HT0A 4F12A 4RK5A 1A8UA 1SA0A 2X6TA 2AJLI 3MVEA 4XM2A 1BE6A 3EEOA 1NC1A 5HJ2A 3LA8A 1EFHA 1X1EA 1UMKA 2NO0A 4DQKA 5E7MA 4JB0A 2P69A 2BEWB 4HMOA 4B7UA 4X8LA 1GRNA 1AX9A 1EE2A 3OTIA 5A02A 1EINA 4YRCA 3RQIA 1PS0A 5C2JB 3WRYA 1NJ2A 3LXMA 5BOSA 3TOVA 3G82C 1PW7A 1TM3E 1XQXA 1YRQA 2AN9A 3A4MA 5IJWA 2CEKA 3N2EA 2D3WA 4YRRA 2AQKA 3OFND 3D3JA 3HL0A 4P98A 5FNVA 2QJOA 5BQFA 2RHJA 1RI4A 1U6IA 2JGIA 1H1TA 3BMNA 4HEA1 4R0VA 4XD7D 1QRTA 1P19A 1Q7RA 1QV6A 1UQTA 5FOTA 4DDKA 1S2DA 2MINB 2ZKIA 3HV0A 1RLMA 3RYIB 2WTMA 3ZN2A 2NTEA 4EG7A 4G6ZA 4CIDA 4LPKA 3S7ZA 4WFJA 3WFIA 1UKZA 2QRMA 4OIMA 2HD4A 4RKWA 4EX7A 1XCJA 1YRLA 4U2BA 5CJ2A 2G83A 1T8RA 5DX0A 4PZUA 5F2OA 2CNDA 2OCKA 4KAAA 1Y8CA 4CM3A 2WJPA 2GILA 4DLUA 4FE4A 4JVNA 3ZHTA 4WBNB 1F3OA 3O26A 3ASYA 3BXZA 5J4VA 1MGOA 3HVKA 4J1NA 4IUBS 4TQ9A 1FSGA 4JL6A 1OI3A 4JUIA 3GJ5A 5CBPA 4E15A 3VR3A 3R7SA 1EGAA 1T6NA 2N75A 3HBAA 4I55F 5BSHA 1MZPA 4KYUA 1MJ5A 1J5PA 1QQ6A 5TQ0B 1MFZA 1WVGA 3AFIA 1KPIA 1H8HD 2C5EA 3C70A 4XAQA 4B3BA 1U0NA 2CEAA 2AFHB 3IL2A 4R51A 1W49A 2ZSIA 3GFTA 1HOTA 3JTEA 2X8JB 5I8WA 3IIEA 4XQGA 2J9XB 1FX0A 3BXOA 3A7DA 3CRZA 3E4DA 3PQ6A 4FHEA 4KQ2A 4N0EA 3S8MA 3JQFC 4P7JA 5K0CA 4BN5A 3OLCX 4Y9UA 1DT5A 5BVHB 2H8GA 3ZV7A 2QB5A 4B32A 1ISIA 3R3XA 4LHSA 3IJ5A 1JEQA 1ISGA 5LZ9A 3L0PA 3DLTA 5D85A 4DCJA 4YASA 4K8RB 4EJSB 4GDMA 4DDHA 3PDUA 4PZ0A 1J2YA 1WDLA 1E5VA 2PL9A 2H5JA 1I9CA 4JLDA 4MINA 4O4IF 4EG3A 1YZUA 1KVRA 2P1RA 3NHSA 4MWZA 2ZUSA 3T94A 3MUOA 3OIGA 3JAWA 1PDWA 1QYCA 3KS9A 3QOXA 3GCWA 4C3UA 4O1HA 1QR2A 3MMXA 3BH0A 4WZBB 3UMCA 3VC1A 1WU8A 3KOMA 2QUIA 2ZI4A 3DDUA 3EC1A 4NH0A 4EAAA 3HMQA 3W9UA 1NDQA 2A5LA 1JB1A 2PMDA 2QZ4A 3ESBA 3HJHA 3QA3E 2NSLA 4UPVA 4ZPXA 4KXVA 2H1SA 5IC5A 4DT1A 1LTKA 2NT4A 3MNFA 3FOEC 5HQTA 2HQSA 2QLBA 3DLAA 1IN1A 1OFUA 1JE0A 2X9QA 2PJUA 1CVRA 5CA0F 1USGA 1VG1A 4G86A 2VJCA 5JSFA 1BOOA 1C7IA 1SC6A 1GL6A 5BQPA 2CLHB 1ICEA 1XDZA 4TWZA 4HYYA 1G18A 2I9KA 4ZP1A 1V6AA 5A7HA 1P61B 3DS8A 3RTGA 3ZHCA 1GKLA 3U3ZA 3AYZB 4HVTA 4PLHA 3KQWA 4YAFA 5CIYA 2VF4X 3QF4A 4V0QA 3OE1A 4BLUA 4CZ2A 5JAUA 2CVPA 5CX1B 1CSEE 3R3VA 3OQOA 5DYYA 5EJ6A 1G9XA 3G8AA 1U28A 2G9NA 1XDBA 4FZVA 3Q8WA 4AG6A 4AZTA 4F71A 1NF2A 5IANA 5J1TB 2ZU6A 3L18A 4RIHA 4YAJA 2E9SA 5IT0A 2GCNA 3O1HB 1J9ZA 4UULA 3PUVA 2VDVE 2PHZA 5L7TA 1V2HE 3TBFA 1FJXA 4AX4A 3SDBA 1AGPA 3F6BX 2BGRA 2H3EA 1A4XA 4TLMB 2IT1A 1XZJA 2BFOA 3GT3A 1E79A 3C74A 4RADA 4GNRA 5EJEA 5JMOA 2IEDA 1Z4JA 3IPCA 4ZYUA 4XX1A 3TCNA 2NXNA 1F2TA 2XCIA 5KJCA 4R2LA 5AQ1A 4XUEA 2ZIAA 1P7WA 2HLPA 2YRWA 4UOZA 5IH7A 2RK3A 2PJZA 5JVDA 1NVAA 2FPMA 1BD4A 3H1TA 3WGLA 1IJBA 2CL7X 3BJMA 1LJLA 4EYKA 4OJQA 3MWKA 4A8JA 2BFCB 3IUMA 4M87A 1A9XB 5CVEA 4C4AA 3A4TA 2B37A 5BSMA 2OHXA 3GLHB 3BCUA 5M34A 3UBTA 1ZYUA 3U4QB 1BH2A 1ADYA 3DF7A 4TMWA 3AT1A 2VZ0A 2JD2A 4NOMA 3TS1A 3C24A 5BWMA 3K31A 1YOVB 3RIHA 4XYLA 3IDZA 1NC3A 1Y5NA 3FAZA 3GJSA 3NIFB 4B84A 1SCIA 2ZB2A 1P45A 3U61B 2GBCA 5AQEA 5HKBA 4YYEA 1GQRA 1A8PA 1AF7A 3C3PA 4DQ0A 1QPGA 4G8CA 3VDXA 1JKJA 3DE0X 3H83A 1C3OB 1GO2A 3HWWA 3ONEA 4P8RA 4YRLA 5KVVA 1PE0A 1FMTA 3BTOA 3BMNB 3GJ4A 3U4AA 2ESRA 1SWWA 5SV2A 2ODPA 5A0TA 1QFSA 1QOQB 1ZC4A 2WJVA 1QGZA 3FZQA 4UBMA 3SIWA 4XUGB 1RWWA 2HHLA 1QIDA 5I7FA 3AHIA 2WFMA 2J0UB 3KR1A 4E13A 4QE3A 3RBZA 3GX1A 3MTDA 4JLBA 4UU1A 3VAZA 2W6ID 3NBZC 1G9TA 3QUQA 4K2AA 1U3VA 1IPFA 3JYQA 4W5HA 5J5VA 1XEXB 1OKKD 5EJ8A 1W0JA 1LC3A 4ZVQA 3OLVA 4QIHA 2IZ0A 3EZXA 1SXGA 2LIPA 4L2IA 5BW5A 1NG9A 3KPJA 3M4XA 4YJGB 1F0NA 2FAXA 4O4HB 1I0IA 1S8NA 4WY5A 4XVHA 3UMJA 4AROA 4DQUA 1YTUA 2BFAA 3RSFA 1TA0A 3TOZA 1J1UA 1TCCA 3Q3CA 4PLPA 2XIJA 4F9GA 2PQ0A 3L3BA 3BREA 1WVIA 2ST1A 5EWJB 3CNNA 1N6IA 4JEMA 5HZGA 1SD2A 2E7ZA 2W9XA 1NF3A 1Z83A 2C9ZA 2HREA 1IZZA 2H7VA 2VJYA 4D9MA 2Y3IA 4MV7A 1MABB 1RJWA 2GQ0A 3G8YA 2QPOA 4CYMA 2ZQYA 4Z1MA 3B2NA 4EB6B 3PCXA 4YCCA 1NZDA 2W42A 2Q21A 3GDHA 2W7TA 1KO5A 2QTRA 2QVYX 2KLBA 3KQVA 3RUEA 1CTQA 2OBNA 2OWEA 5FH9A 5KTRA 3W4IA 5GJWC 5B55A 1Q1NA 5KYUB 2O0JA 3GPBA 4F4CA 2RARA 4KSBA 3IVAA 1EFRA 5FBZA 2GMWA 4LDPA 1I7PA 2PGLA 1NR1A 3K9BA 3WIBA 4O02B 1A2QA 3ZUPA 3F6EX 3QTLA 4Q9AA 5CIQA 1RWQA 5EIWA 4KWTA 1M2VA 2BM0A 5K3SA 4OBEA 3RVJA 3UKJA 2WUGA 3E81A 1AZSC 5BN4A 2VTBB 1Z6YA 3IAFA 1O5OA 4I1OA 5MN4A 4YMUA 3U13A 3PFHA 1FCJA 3SXUB 1OLSB 4DRYA 2NPFA 3L93A 4CIBA 1DIRA 1VHJA 4LZAA 1LVHA 4YFVA 1NFQA 2B4YA 3AIMA 4P92A 3HUDA 1DTWA 6REQB 3F5DA 4P5PA 1YB2A 1WHSA 1RABA 2A9PA 1KJ9A 2IYFA 3DV0A 3K4PA 3ANMA 2A7XA 1C7QA 1TM7E 1WUTA 4DLWA 1ZLXA 2JIDA 2BISA 4L22A 1P4JA 5PNTA 3ROQA 1E1RA 1K9SA 1CLUA 2X7JA 2W6JA 2XAUA 2JGNA 3H86A 1TC2A 1ZUHA 2O2IA 2W4QA 3DZGA 3G3EA 4JELA 3STXA 1LWNA 2V5AA 2E4WA 3U31A 1R6XA 1P9OA 4BMXA 4Z6KA 3AF4A 4H0CA 3UGTA 3Q3GE 3OIWA 3AUYA 1XWFA 3PFIA 1VJCA 4TTIA 4DUGD 4WASA 3DKPA 5G1OA 3WJ2A 5BSFA 1WXFA 1CF9A 2Y76A 2ORVA 2WZBA 5FUWA 4BNYA 2HFKA 3C3JA 2QN3A 2F8SA 1EHYA 3H9QA 3W1VA 1V8ZA 5LLDA 2QGZA 4AU1A 1DBIA 4IP0A 4BNTA 1RI3A 2O7SA 1I3MA 5FHRA 3MAJA 4RE5A 3P9XA 1JWLA 3VKVA 2JB9A 4POAA 1QQTA 4MR9A 1DAFA 1RS0A 1AC5A 1N9KA 2DFPA 2QY9A 4RVNA 2FFQA 1UC9A 3NJ8A 4HQ6A 3V7YA 3VR5H 1KY2A 4ZO4A 3ZDQA 1EJ2A 2A0YA 3NKFA 2XB2A 2ILVA 4EMUA 1FXUA 1OXXK 1B3BA 5FWXB 2IYEA 3O3NB 4GX1A 1DBRA 1Z4NA 1GQOA 1YVEI 3NBYC 1AS3A 2BTOA 2FPUA 1RKQA 2GEDA 2OMEA 3LWBA 2HF9A 3MCZA 4QQRA 3CE6A 4H1TA 4RHTA