4Q9NA

Crystal structure of chlamydia trachomatis enoyl-acp reductase (fabi) in complex with nadh and afn-1252
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
295
structure length
295
Chain Sequence
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSLELGKFNASRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKDLSGYTVSEVVEQVKKHFGHIDILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNAGASTISLTYLASMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERMVDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Type II Fatty Acid Synthesis Is Essential for the Replication of Chlamydia trachomatis.
pubmed doi rcsb
source organism Chlamydia trachomatis f/11-96
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 102
structure length 295
sequence length 295
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2014-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4q9nA00
4I9HA 4IDCA 3INRA 2SCUA 4I8XA 4ND5A 1KVRA 3ONDA 4R1TA 3IDSA 3HQ4O 5F1KA 5L9AA 1T1SA 2Q2WA 3MTJA 4EJ0A 1XHLA 1Y9EA 2ZB7A 4J2OA 5JPIA 3WOHA 2IYPA 2J6IA 3FWZA 3AJRA 1DC5A 3KYCB 3OF2A 4RPGA 3JQAD 4Y6SA 2EF1A 3GFGA 1BXKA 4RDHA 3WGHA 2IEDA 2HDHA 3M1AA 4Y9DA 2PWZA 1N5DA 2DBRA 4IJKA 5DCYA 1ADGA 5GZ1A 2G17A 1YGYA 3KVOA 4L73A 3BMCA 3W8DA 3ANMA 3GHYA 1WP4A 3FRJA 3GZ4A 4Q3CA 2JD1A 1BSVA 4PCVA 1S7CA 4E30A 1R37A 3FNGA 4KDFA 1I32A 2X9VA 1DRUA 3ETGA 4MVJE 3QY9A 4HBGA 4E31A 4AJ2A 3AUUA 3PFFA 1PTJA 5EQDA 2W8ZA 1EVZA 2G0TA 3VH4A 4QTZA 1NAHA 2IYOA 2OUIA 5JDCC 3WMXA 4FFPA 5TJ9A 3EAGA 2VWPA 1IPEA 1M76A 4M1QA 4OL9A 2I66A 1YB1A 4QX6A 1M67A 2BGKA 4LK3A 4S1VA 4WLEA 1AHIA 1JAYA 4WEQA 1G0OA 4W7IA 4AJIA 3PRJA 5JAMA 3KTDA 4NZ9A 3UAGA 3QVSA 3IL2A 4CQLB 1P3DA 3HZZA 2C29D 4IJWA 2HK8A 2PGJA 4YPOA 5A06A 4Z6KA 3ORFA 4F46A 3QWBA 4I5GA 4MP8A 3LLSA 3NRCA 1WXDA 1F14A 3P2OA 4H15A 4OAQA 2G5CA 3CXRA 3FBTA 1BW9A 2DKNA 3LC2O 4WLNA 1C14A 5DZSA 3VZPA 2OOSA 1NQAO 3T7EA 3TFOA 5BNTA 2B4RO 4J4HA 4IGEA 3LSYA 1ZEMA 3KEQA 3C1AA 4I9NA 4BIIA 2Y05A 1Y8RB 4UVDA 3SLGA 1HYHA 5COAA 3F1LA 4F45A 2VOJA 3GFBA 5F3RA 3NYWA 3JQBC 4N7RA 4BNLA 4CM9A 4BNZA 2VZ0A 4BNYA 1EFKA 4CM4A 1F12A 4FGSA 1M6WA 1MFZA 3WGQA 1RM3A 2UV8A 1XEAA 1DO8A 2EWMA 4FFLA 2JD2A 3JSAA 2BD0A 5JY6A 3N74A 3Q0EA 5DCWA 3TSCA 3UICA 1IPFA 2JFGA 1MXFA 1UXHA 3LZ6A 1QSGA 2PD6A 2VNSA 4GSLA 3H5RA 2RCYA 4CJXA 3F47A 1PZHA 2H6EA 1AN9A 1SB9A 1H9AA 3PHJA 5KJ1A 4WPGA 1GCUA 1SNYA 4TKMA 3WLFA 2VQ3A 1XGKA 1X0XA 1EEHA 4NG5A 4AJEA 2EERA 4NPCA 1PSDA 1ADBA 2ZJ1A 4MKRA 1NQ5A 3AY6A 1KVTA 3DBLB 1T2FA 3WGGA 3F1KA 2CZCA 3PGXA 2GN6A 1ZJZA 1W4ZA 5BR7A 2ZTUA 1LI4A 4WLFA 4FOOA 1Z74A 5LC1A 1ONOA 2OP1A 2B69A 5JAQA 2FSVA 1RYEA 1E1KA 4E5NA 2W98A 4ZU3A 1N7HA 1V3UA 4GGPA 1VJ0A 2H9IA 3TF5A 1JAXA 4DXHA 3LK7A 1PS0A 3D4NA 2HQ1A 3HDQA 4QFDA 1ZO8A 4TQGA 4E21A 1IZ0A 2V7PA 3H5AA 3WTCA 5IDWA 3L4BA 1HDXA 2HMTA 2C54A 1XCBA 3A4VA 5DNAA 2PZMA 4BNKA 1P31A 3LT4A 3Q9NA 1ZCJA 3ZCXA 3H9UA 1BG6A 1N92A 1RM0A 2P4QA 4BUCA 4B7CA 3DR3A 2NTVA 1MC5A 1NYTA 2C82A 2DUWA 3OQBA 1BXGB 5B4TA 1I36A 4NBVA 4WASA 3WJAA 5HA5A 5FI3A 3BAZA 4LRTB 1XG5A 1O0SA 2C5AA 3O8QB 2VHYA 4NBUA 2IE0A 5JLAA 1TVEA 1NPTO 2VOEA 3GT0A 4YTEA 4GWKA 3CKYA 1DC4A 4JQCA 3VZQA 4D44A 2I6TA 4CLDA 3QW2A 4Q3BA 4BNHA 2FWMX 4ALMA 4D3SA 3OJ0A 4GMFA 4YAEA 1R16A 3B70A 2VN8A 1E7RA 4CM1A 1B16A 1GYQA 1IUKA 1QYCA 3GNQA 2B5WA 4RQTA 2Y1OA 1D1TA 2NQTA 1O5IA 1HYEA 1I3LA 1VC2A 2IXBA 4DMMA 2EP7A 1HYGA 1PWXA 4E13A 1E6WA 3LLVA 1PJCA 2Q3EA 1RM4A 2CMDA 4BQPA 4N5MA 1ARZA 3DAPA 5A1TA 4JN6B 4BNTA 3I9OA 3QQPA 5C7OO 4BS9A 1NFRA 3CSDA 3UCXA 2VYVA 2XXBA 1GPDG 5DT9A 4E2XA 2X6TA 1M66A 1HSZA 2JL1A 3CE6A 4Z9XA 3EUWA 1MGOA 3GEDA 3GG2A 1N9GB 3GAFA 4KUEA 8ADHA 2GYYA 3AY7A 3IAHA 5EQFA 3RJ5A 1LLDA 3HADA 4BO2A 2EP5A 3MJEA 4RQUA 4AG3A 1B2LA 1DLIA 2NU7A 4AJ1A 2XPCA 1FDTA 4U5QA 5THKA 2DAPA 2J3JA 4ND4A 5K6AC 1XDWA 3L6OO 3VKUA 4FD3A 2WYVA 3IKTA 1I33A 3GVIA 4CV1A 3ZN2A 3H3FA 4B4VA 4U6QA 4BNGA 4IM7A 3RWBA 1N8KA 1BVRA 2Q4EA 3TZQA 3TFQA 1ONPA 1G0NA 1PR3A 3WGOA 4CR7A 4PN3A 4AJ4A 3JCZA 1PJ2A 2ZTLA 2DM6A 4MVJH 2UYYA 3ZGYA 1DIRA 5AXDA 3UHAA 1MLDA 1GEEA 2J3HA 2R00A 1YS4A 1VJ1A 3E9MA 1FDSA 2C59A 2P9EA 1GTMA 4B4OA 4BKRA 1JVSA 4GX1A 1IZ9A 2CFCA 3GNTA 3OHSX 5A04A 2BI7A 5HS4A 1HDYA 4ROSA 4AJJA 4U6SA 3DBRB 5DP1A 4Q3NA 2G1UA 5L7TA 5F21A 2POQX 4CLOB 4GLOA 4MVJP 2HMWA 3MTGA 5I7EA 1ZK4A 2ZYGA 3KYCA 4OKNA 4QO7A 3SXPA 3V5NA 1DFHA 1PQPA 1QKIA 2Z5LA 4N18A 1JN0A 1TEHA 1WDLA 2HUNA 3KV3O 4K9DA 3PPIA 1KEWA 2P2SA 3AU9A 1OAAA 3DDNA 3F5SA 1HE2A 4YDRA 4AJPA 3C1TA 2Q1UA 1Q7CA 3R3SA 4PFJA 2D3TA 2EIHA 2R00C 4J43A 1QR6A 4M49A 5JMPA 4ND1A 5DOZA 5KVSA 2OL4A 4QSMA 4FGWA 4XQCA 4YEDA 4M87A 2Z1MA 5TQVA 2DBVO 1Y7TA 4MKZA 3HB4X 3NJ8A 5TRTA 2EKPA 3KOUA 4NK4A 4TRNA 5HWSA 1O6ZA 3NX4A 4TKLA 3ROMA 2O4UX 2B37A 5B37A 2EEZA 1Y81A 3VVBA 5TT1A 2QZ9A 1B7GO 3NT4A 1UH5A 3C24A 3GVPA 4BV9A 1QV6A 4RF5A 3G79A 3GGGA 2NM0A 4IMRA 4EI2A 1E3IA 3PZBA 4LMRA 4YAGA 2Y1DA 3F4BA 3QVOA 5JY1A 3UN1A 3WSVA 3ZV5A 4D41A 3IOYA 5JYDA 2FY8A 1O89A 1DEHA 2V6MA 3ETDA 4UVGA 2I3GA 3GOHA 2NV6A 4OM8A 3GEGA 2Y68A 4OXYA 3ZNQA 4OQZA 1YJQA 4FPXA 4XYEA 4QXMA 3WGTA 4PGFA 2VRCA 1LSUA 1VRWA 3WSWA 2DUUA 1PGNA 1Y8QB 4II3A 1X1EA 4YQYA 4QT0A 2AW5A 5FI5A 5I7VA 1BXZA 5CDTA 2NACA 3GRPA 4XYMA 4DYDA 2X0JA 2E49A 3JD0A 2BF7A 3PQEA 5HBRA 3ADOA 1SMKA 3F4LA 3S2IA 1VPDA 3BA1A 5KNLA 5JBIA 4D3DA 3SJ7A 4E5YA 4WECA 2JAHA 4XQGA 2VHWA 1F17A 4E2YA 1V6AA 4R68A 5A9SA 4OQYA 4EUEA 1DSSG 5JNLA 3DHEA 4DLLA 3EHEA 5FEUA 2FHSA 3LT1A 1BXGA 1PJ3A 1QLHA 3PWKA 4NHEA 4W7HA 2YHIB 1YO6A 3JD4A 4W9NC 1BDBA 3BMNB 4YAKA 3HDYA 4Y98A 1WNTA 3F6YA 1CEQA 2RH4A 4DL9A 1SOVA 1LX6A 4HXYA 4ALLA 3D5TA 1C0IA 4CM5A 4A7PA 4NFYA 2H63A 4G5HA 3MJVA 5L4LA 1P45A 2GR9A 4XGNA 1PJTA 2X8LA 4KWHA 4HV4A 1WW8A 3QSGA 3S2EA 1NAIA 4R9RA 1CIVA 5JO0A 3WIDA 4BV8A 1H6BA 1KEUA 1QV7A 2Y0DA 3FI9A 1GDHA 3WFJA 4CUJA 1ZJYA 2YJZA 7ADHA 5GMOA 3WB9A 4JIGA 4PIVA 2GN8A 5G0VA 4HUJA 5CDSA 1HDCA 3JQ9A 2OMEA 2QIOA 4Y8VA 5I7FA 4MP6A 2DFVA 2JAPA 2J5QA 3JQ8B 4MINA 4R51A 4NJMB 4ND2A 3OQ1A 1WMAA 4L0QA 1SBYA 3K6JA 4XB1A 4J0EA 4AJNA 5G4KA 1E5LA 1ZSVA 1YL7A 3IUPA 1VKOA 3TZ6A 3VDQA 1A7AA 3BMQA 1U7TA 4CMIB 2BFPA 3DMYA 4Z9YA 1SC6A 4CQMB 3H9JA 1KC3A 1GL3A 3BHMA 3BMOB 1QMGA 4K6FA 3PWSA 2VWGA 1X0VA 4DC0A 4QUKA 2OBNA 2FZEA 4PRLA 4IY1A 3NUGA 4CR8A 5C3MA 1ISMA 4O1MA 4DLAA 3FNEA 4WGGA 3OIFA 5BSEA 3E9NA 1YOVA 1CRWG 1MG5A 4A0SA 4CM4B 1PJ4A 1D8AA 4WE3A 4NFHA 1KVQA 1O9BA 2V6BA 3E48A 2EV9A 4L4SA 4YRAA 3KZVA 4P22A 6LDHA 3DZJA 1NPYA 2AEFA 3TL2A 2PGLA 4C4OA 4IXWA 5FWNA 4AVYA 5L45A 4RPJA 1YDWA 4D7AA 2PZKA 3JQEA 3QWIA 3I4FA 4JGBA 4NU5A 5GZ3A 3KSZO 5A5EA 3OQ6A 3ST7A 4CMBA 1UP6A 1YXMA 3DEYX 1SPXA 3K5PA 4KUHA 2ZB8A 2NTJA 1OZAA 5IZCC 1MX3A 4XX0A 3GY0A 1V3TA 2HMSA 4ZRNA 5CAEA 1ML3A 4GKBA 4ZN6A 2YHIA 3W4IA 3L6EA 4BB6A 1FXSA 1I8TA 1P77A 2PD4A 3HWRA 8LDHA 4IINA 1YE3A 3O4RA 3K92A 3PEFA 4LVCA 3GC6A 4XB2A 2V6FA 4WOJA 3RUEA 1GPJA 4CMJA 4H7PA 2IZ0A 3WYEA 4IDGA 3V1YA 3ZNOA 3ENNA 5I8WA 2O4CA 3NDJA 3OEWA 3TZCA 3FF4A 4OSPA 9LDTA 2AA3A 2ZQYA 3LT2A 4JCOA 4NJMA 1MFPA 2JD0A 4UUNA 4OIMA 2X5JO 3RFXA 4ZD6A 4YA6A 3GAZA 2QRKA 4W4TA 1U3UA 3EZLA 1BHSA 1R0KA 1X13A 5BSFA 3DB2A 3IP3A 3VPGA 4TVOA 3WDSA 3VPFA 3SEFA 4DQVA 4MIEA 3D64A 1HZJA 4Z0HO 5EPOA 2DTXA 1HL3A 3K96A 5CEEA 3WNVA 1C0PA 1HDRA 1WMBA 3L07A 2CDCA 1I3MA 4BGUA 2TMGA 2WYUA 3S8MA 5ENVA 1CDOA 2ILTA 1V35A 5AXBA 2C7GA 3FR8A 2JFHA 3KLMX 3VPSA 1ZXBA 4TZTA 1LA2A 4FJ0A 4WCDA 3AWDA 3V2GA 1DBVO 4KQXA 4MIOA 4PG8A 4EUHA 1J5PA 3L4SO 2X22A 4LCEA 3LVFO 1ZK0A 3C85A 3ONFA 4L4RA 4RCVA 1SO8A 5CDGA 1AHHA 4RDIA 4PLTA 4PLCA 1HSOA 1P0FA 4KDEA 4B7UA 4BMNA 3I5MA 1T4BA 5KVCA 1RPNA 1DIGA 4EZBA 1XIVA 1RYDA 3P7MA 3H9EO 3STHA 4LGVA 3IKVA 5TS3A 3GRKA 3H9QA 4FFMA 3RJ9A 4O59O 5JDIA 1GCOA 3DZKA 4IQ8A 4Z0TA 4IIUA 5JC8A 3L0DA 3UCFA 4I5EA 1M6HA 1SEPA 1E3EA 1P33A 1GV0A 2NVUB 3ETEA 2FPGA 4J91A 1PZGA 4YJHB 1PS8A 2PD3A 5I9MA 3CZRA 3G1TA 1D7OA 2Z1NA 2FOIA 2GD1O 5EMHA 4D0SA 1XSEA 4HFMA 1EDOA 1O8CA 4WLUA 4PVDA 3PQFA 4ZICA 2CVOA 4NK5A 1K2WA 4YJHA 4C7JA 5TGDA 1V0JA 4L4XA 4PG6A 1FDWA 4DBZA 3VOSA 3WG9A 3BHJA 1LBEA 4FFNA 3RC9A 4JJFA 4FBGA 4ONEA 7MDHA 5H83A 5BQFA 4N5LA 3N7UA 3FBGA 3V1UA 5CP8A 2FR1A 1I0ZA 4UVHA 5I9LA 5KJFA 1Q1NA 4UEJA 3H5NA 3UF0A 4R1UA 4PG7A 2CDBA 1LLUA 5ENDA 2WTBA 3GGPA 4RPLA 3VDRA 3PJEA 4FDAA 4LCJA 3QIVA 3WQRA 5T6BA 2VZ8A 4YT5A 3L9XA 4XDYA 4INAA 1IYZA 1EDZA 2PNFA 2DPGA 4R4JA 3D1LA 2J8ZA 2BKAA 2HAEA 3OICA 4JBIA 1BDMA 2UUOA 3PI7A 4U7WA 4J1TA 2ZKLA 3BIOA 4I08A 4AJHA 5JCXA 1NWHA 2QYSA 3UFXA 1PIWA 1A4IA 1PL8A 3OJLA 4KMSA 1NR7A 3E1KA 3QP9A 3PIIA 3ZH2A 3KYDB 1N1EA 2DBZA 3QE3A 1NXQA 2CF5A 3PLRA 4ZA2A 3OETA 3WJ7A 4B8WA 4PG5A 3NKLA 3VTFA 4Q39A 2BGMA 4GI2A 3WFIA 3R3JA 3UKOA 1HLDA 4FFOA 3X2FA 4FR5A 4BGIA 4YAIA 2ZJ0A 2J3IA 4OH1A 3TQHA 5ICMA 3ZU2A 2A35A 5ADHA 2Q1SA 2BI8A 1OOEA 1M2WA 3SLKA 4TMFA 4R01A 3HSKA 2NU8A 3U62A 3PK0A 4UULA 2HLPA 4RZIA 1N9GA 5I8ZA 1ZNQO 1BVUA 4CLRA 1E3JA 2OBYA 3E82A 9LDBA 1GUYA 1KY4A 2PV7A 4EW6A 1X7GA 1XWFA 2HK9A 1LDGA 3I6QA 4MVJF 2RBEA 1HTBA 3DWFA 2HMVA 4E4YA 3HHPA 3FTNA 3G3EA 5JDCA 4MPDA 5KJCA 3EVNA 4GMGA 2DC1A 1FJHA 5BT9A 1YB5A 2H5LA 4XYGA 4CLEA 1HXHA 4JBGA 1LDYA 4MVJA 2RIRA 3JV7A 2HJRA 1ISFA 1P1JA 3GUCA 1K5HA 1YWGO 2RHCA 4GWGA 5EIOA 1Q7BA 4R54A 4JLWA 1UAGA 1HF3A 4EJ6A 1NPDA 2WMDA 1VKNA 1VL0A 5U1PA 4D46A 3VC7A 5L4SA 1T2AA 2EJWA 4UUOA 3F46A 1I2CA 4BO4A 4J90A 2XF8A 3QLJA 3JQBA 1ZK1A 3AW9A 4AL4A 1R12A 4ZQGA 2AXQA 4KOAA 4TRJA 1GQ2A 4M8SA 1W8DA 2YZ7A 1U2DA 2B83A 3LF1A 4A2CA 2BH9A 3A14A 3WGYA 2GCGA 2QW8A 1Z73A 5KVVA 4ID9A 4R5HA 1U3VA 1NVMB 1T26A 4BMVA 5TSDA 5ILGA 1LEHA 4GVLA 3LC1O 3ABIA 1RJWA 4YJDA 1ZMTA 2DTEA 4R1SA 1YQXA 2E82A 3SX2A 1ZVMA 4URFA 3KYBA 5EESA 3TL3A 5H81A 2EW8A 5A5FA 1H5QA 2BMAA 1EVJA 1A4UA 2X9GA 3Q9UA 3U9LA 4YT8A 1UDBA 3R1IA 4P4LA 3BMOA 4R41A 1MA0A 1XU7A 4IDEA 4KTVE 2IZ1A 3RCBA 3ZV4A 5CEFA 4EEZA 2W2LA 4J1SA 4DIFA 3IP1A 1R4MB 1DJQA 4RLSA 2AQIA 1L7EA 3WR5A 1Z45A 4CM8A 2ZIZA 4NU6A 1EUZA 2FPIA 4IPTA 4IMPA 3DTYA 3JQGB 1YONA 1ZIDA 3G1UA 2I65A 2WD8A 4GX2A 3LYLA 2JFFA 2ZB3A 3FSRA 4CM6A 2X23A 3FCOA 3RC2A 2CNBA 1E7MA 2QX7A 3PTZA 3JQDA 4PZDA 1HWYA 1OI7A 1YJ8A 2AHRA 3KO8A 3RIHA 2BHLA 1JTVA 1JWBB 3O03A 2X0NA 2B35A 2B4QA 1PZEA 3NT2A 5K0ZA 1PR9A 1P9LA 2YQ4A 3JQAB 3OJOA 5DDIP 1Q2XA 3MZ0A 3E5MA 3ITDA 5TX7A 3I9MA 2NNLD 1UDCA 1YL5A 1CERA 2QZZA 4ILKA 2VYND 4OHUA 2VTDA 3NT5A 1QXSA 2DPHA 4BNMA 5JAIA 3KHUA 3PYXA 3KM0A 3LT0A 4WLVA 3UUWA 2NSDA 4CM8B 2NTNA 2D1YA 5ER6A 4A03A 4ALNA 4EITA 3L4BC 4YRDA 1PGPA 1QYXA 3CIFA 1LSSA 3FHLA 1UZNA 2OGUA 3BZUA 1PS9A 4FFRA 4UREA 4RPKA 5T67A 1F8FA 4IDDA 5BNFA 1E6UA 1KOLA 3ZWPA 2AQKA 4ALIA 1T2DA 2I3AA 4TZKA 1G1AA 3EVTA 2IEBA 1UDAA 3KEOA 3PJFA 3PHLA 4KZPA 2B4TO 1B3BA 1E7WA 4BOYA 2Y93A 1FK8A 4ZQFA 2HK7A 2ZATA 4XR4A 4LW8A 1E7YA 5A9TA 2PA3A 1ZKMA 4I5FA 4FJ1A 2XOXA 4RZHA 4DREA 2BFAA 2PLAA 4DPLA 5HM8A 5IFLA 2D5AA 3B6ZA 4BKOA 2E48A 5CG1A 3GEMA 4FC7A 1ID1A 4GLLA 4YJGA 3GH3A 3ON5A 5KJEA 5KJ6A 1ULSA 4W9NA 5KCZA 4KP7A 1XQ1A 3M6IA 2O2YA 4BB5A 3ZWOA 2DU8A 2Z95A 1X1TA 3SVTA 1ZEJA 2ZYAA 2OZPA 4J16A 1LQUA 1ZZEA 1ONNA 4E5PA 1TT5B 3OA0A 2AQHA 4BKPA 3AU8A 1DOHA 4IQGA 4BVAA 4TROA 1MC4A 2AEMA 4F3YA 3DTTA 2VWHA 3DHNA 4MDHA 3ROPA 4OXNA 1W0CA 4A5OA 3S55A 1IL0A 4RVDA 3KB6A 2IXAA 2VNAA 2Y1EA 1U3TA 3RUCA 3IC5A 4IUYA 4UUMA 4WCFB 3KYDA 4PLZA 5MGBA 2Y1CA 5KIAA 4J4BA 1U5AA 1LJ8A 3OIGA 4ZGWA 4BO3A 1GYRA 1PGJA 3KLPX 4DYVA 3MJSA 4R5MA 5DBGA 1V8BA 3RFVA 2ZTMA 2ZCUA 4MOWA 3RROA 1VSVA 3ZWNA 1KETA 5GY7A 4BNJA 1FF9A 2D4AA 1I30A 1BTOA 1A71A 4K6CA 2I76A 1X7HA 1HEUA 3D7LA 3QA9A 5IDYA 4B3IA 1HETA 2WM3A 3BMCB 3BYZA 1XU9A 3QHAA 2O23A 4IZIA 4DGSA 1EK6A 3U3XA 2QHXA 5IZ4A 4PLYA 1HE3A 4E0BA 1SEVA 1YH3A 1ZK2A 3BTVA 3WBBA 2IDZA 5FYDA 4FC6A 1DRWA 4IJVA 1YDEA 1QRRA 2FN7A 2RH8A 3QWFA 3MOIA 2AE1A 2D2IA 2VRCD 4UEOA 4CODB 3DZFA 3FD8A 3TJRA 2X4GA 1LQTA 3AM4A 2ZTVA 2PY6A 3MEQA 4J1QA 2Q49A 4BNWA 4FQ8A 2GRAA 3GZNB 5FF9A 4XJSA 4BKUA 4HKTA 3WX0A 4DBVO 3DL2A 2D59A 4OOFA 4L74A 3T4XA 2GNAA 2X0RA 2WYWA 4ALKA 1JKIA 1MP0A 3OM9A 4BNNA 4XR9A 3EZYA 3K8ZA 1I2ZA 2CDAA 3JTMA 4GAEA 1OC4A 3VKVA 2AEJA 5TT0A 4B79A 4CL8A 1GFSA 1NNUA 3TZKA 2BFOA 1A7KA 3TRIA 4WCFA 1P74A 4HADA 3RQSA 2D5CA 5IN5A 4JNKA 3WWYA 3JYOA 3CMCO 1E92A 4LRSB 4BNUA 4B4WA 4B3HA 1LC3A 4AICA 1B8VA 3A06A 3I9JA 1TI7A 2FSSA 3ROKA 2DTDA 3PLNA 4XD2A 4U0KA 4BO7A 3JQ6A 3PYLA 2GSDA 1HZZA 3RUAA 2PZLA 3VPHA 3CINA 2P5YA 1J0XO 3CH6A 1LDEA 3U4IA 4TRMA 5K9ZA 3UOGA 4GSKA 1YVEI 1E77A 2WSBA 3ZU3A 2Y1FA 4GX5A 2FZWA 1QORA 2YQ5A 2YYYA 1ZUD1 2UVDA 3INGA 5DULA 3PWZA 4YJGB 2E6UX 5KKCA 4IDAA 3CPSA 1ENOA 3PHIA 4J9VA 5DBFA 2YDYA 3OIDA 3R0IA 3PJGA 2HRZA 2OFPA 3HB5X 1U28A 4RVFA 4TWRA 3RASA 1JU9A 1UXIA 1E0DA 4BO1A 3WYCA 3ANNA 3GK3A 3AI2A 1TT5A 4CLHA 2UAGA 4D3FA 4DIBA 4KWIA 4BKQA 5BNIA 1PQWA 1LNQA 3NEPX 3I3OA 3NJ4A 1N7GA 4FOSA 4WCFC 1R0LA 2G82A 4J0FA 2HJSA 3NAQA 3WICA 4D43A 5ES3A 3AFNA 3G17A 3ZWVA 4LN1A 2O3TA 1HLPA 2A92A 5HRUA 2B36A 3DZGA 3BTSA 1DHTA 3GVCA 2OXIA 4M86A 4BO8A 1C1XB 4FSHA 1A5ZA 1U1IA 4R3WA 4R3NA 3WYBA 1LLCA 2C2YA 1EFLA 1QYVA 4CV0A 3W1VA 1ORRA 3HNPA 3H9GA 1RM5A 1IY8A 3GN1A 3PXXA 1D3AA 4O5OA 3VH3A 4F6LA 5BSHA 4E2ZA 2C2XA 5ILOA 2GDZA 1EZ4A 2NU6A 1MG0A 3HUDA 4MVJG 5AYVA 2FMUA 1MXHA 3AM3A 2LDBA 3DAGA 2EKLA 2HKIA 5IXSA 1EE2A 1GAEO 3W4JA 3TDKA 3PIDA 3Q6IA 4BGVA 2AG8A 3MCVA 3X2EA 3M2PA 1GD1O 2JHFA 4FJ2A 4CPDA 1UP7A 5AVOA 1W6UA 2X0IA 2LDXA 3OJFA 3DFUA 5KVQA 3WS7A 3QVWA 4PLGA 3GMSA 4BO0A 3KSDO 4OKIA 2Q4BA 4WUVA 5CPFA 4E32A 4YT4A 5C7LO 1U8FO 1O95A 3GDOA 1ZSNA 4QEDA 2P9GA 1H2BA 1AUPA 3IUSA 3F9IA 4O63O 3BTUA 1WDMA 2VYVD 4CM7A 2QRLA 4BO5A 4XIJA 2GO1A 2ET6A 4YBZA 4CM9D 3HG7A 2X7HA 5A9RA 5C5IA 2FR0A 4LMPA 5U4QA 1MV8A 4AJKA 1PGOA 1GEGA 2DQ4A 4L8VA 4JP3A 2PZJA 4WJZA 4ZRMA 4MVJI 4IS2A 4KTTE 1TXGA 2C20A 2EGGA 2UDPA 2TMDA 3GQVA 4YCAA 3ZHBA 3O38A 2ZB4A 4WNCA 1H2HA 1LRKA 5JCJD 3GUYA 2W2KB 2RAFA 4M55A 1KERA 2X9NA 4DC1A 4IGFA 4D42A 1C1DA 1T2CA 5AXAA 4FS3A 5IDXA 3ASVA 3K2EA 2O2SA 1UUFA 5DBIA 5JC1A 3ZWCA 1ISHA 2GPTA 1DFIA 1H6AA 4L76A 5JS6A 3CEAA 4J7XA 3W8EA 2HCTA 3H2SA 3EW7A 4J7CA 3JYQA 1R4MA 5LCXA 1LRLA 1U3WA 3RVDA 4RF4A 4GQAA 4AJOA 1GZ6A 1RKXA 1UAYA 5T57A 2C7VA 1MUUA 4RVGA 1ISJA 3M1LA 2Q1TA 4B7XA 2EXXA 3GN2A 5CDYA 3EYWA 4XCVA 3W8FA 3PHGA 4E2WA 1GQYA 4G2NA 4H16A 4MO2A 3RUDA 3A28A 1X15A 3P2YA 4RGBA 3VZSA 3OA2A 3HJAA 3IMFA 3W6ZA 1E3WB 1UJMA 3HFGA 1JWAB 1P1FA 1Y6JA 4HNGA 4NH4A 1ZW1A 3EY4A 3RKRA 4ZHSA 1DDOA 5LDHA 3MJTA 3NV9A 1O94A 1I3NA 3U4HA 5ITWA 4DPMA 1Y8RA 3UCEA 1UP4A 4JBHA 1UZMA 3JQAA 4YT2A 1IB6A 1ADCA 1B8UA 4RJTA 5KWEA 1A9YA 3JQFC 3DMTA 3JYNA 4YJFB 3V2HA 2IODA 3F5QA 1NX6A 3A1NA 1BW9B 4OYRA 2VZ9A 2QRJA 4IXTA 3KSUA 3OEYA 4PLFA 1NR1A 5IZCA 3JYPA 4KQWA 4CQLA 3VAZA 5DOVA 5B12A 3RI3A 5L4NA 1PU2A 4Y67A 3LDHA 4BNXA 4CQMA 1I2BA 1PL6A 1F0YA 1PEDA 1SOWA 4E5MA 1LC0A 3RU9A 3VZRA 3VH2A 2Q46A 1P1HA 2O48X 4XA8A 3LU1A 5JMWA 3L6DA 3BMNA 2VHXA 1R4NA 1H94A 1V3VA 3TN7A 2D0IA 2V6GA 1UXKA 4WNIA 2O3UA 4ZQHA 3S1LA 1L7DA 1PGQA 3HN2A 4A73A 3ZWBA 3WLEA 2AMFA 1DRVA 1T2EA 1LDMA 1RWBA 1XLTA 4K28A 1E7QA 4RV9A 4ZQBA 1BMDA 3WGIA 1GUFA 4A10A 4EDFA 4BO9A 5EN4A 1XA0A 4E33A 3ICCA 1R15A 4N5NA 3AOEC 3NDRA 3SC6A 3ZZNA 5A3VA 3E6AA 3TOZA 3OJEA 1OFGA 3ANLA 5AOVA 4I9UA 1X14A 1EQ2A 1U2GA 3ENKA 2QG4A 1H6CA 2VCYA 4WOKA 5JSFA 4YRBA 1E3SA 3AUAA 3ZWMA 3JYLA 3C7DB 1B3RA 2NWQA 3E5RA 5G0TA 3U5TA 3M2TA 3QVTA 3GG9A 3NTRA 2P4HX 1NFQA 1R0SA 1OC2A 1U7HA 3NGXA 3TZHA 1QLJA 3WIEA 5FFFA 4BNFA 1B15A 4XGKA 5LDGA 1VL6A 3T4EA 4BL5A 2PFGA 4UVEA 1YBAA 3OBBA 1KVUA 4H3VA 4JJIA 1PJSA 1LDBA 1IHYA 3TNLA 4II2A 1GZ4A 1S6YA 4Z3KA 2BLLA 3AOEA 2JJYA 4YWJA 2CY0A 4XIYA 2X5KO 4P38A 4RF2A 4XYLA 1Q0LA 1IULA 4J7UA 2Y0EA 1CETA 1LTHR 1U8XX 4Z3DA 3UXYA 3PGJA 5JCJA 3K73O 3V8BA 2ZQZA 4G65A 4ZQEA 3JD3A 4BQRA 5IF3A 3H8VA 5JE8A 4DMLA 1IE3A 5L95A 3GF4A 4G81A 5L51A 2OORA 3AM5A 1DIBA 2E37A 5J23A 3FPLA 2EJVA 4EUFA 4E5KA 4RVHA 3V1TC 5B4VA 1T4DA 2Y67A 2Y1GA 2ZYDA 1LSJA 4HWKA 1E1MA 2CUKA 4Q3DA 4YACA 4W99A 4CMGA 1HDOA 2PKQP 3I1JA 5L7WA 1NVGA 5JO9A 4DA9A 4EEXA 1ZMOA 3AI3A 4MVJD 3RU7A 2FPPA 1EK5A 1DLJA 4N54A 4CUKA 5L3ZA 4M89A 1BWSA 2JKVA 3H65A 4NBWA 2YY7A 4IBOA 4NMHA 2UUPA 3I6IA 3H4VA 3Q3CA 4QECA 3ZW8A 4MJLA 3WQQA 1EBFA 3L77A 4DQXA 3ZI0A 2O50A 4U0JA 1AXGA 5GZ6A 4I1IA 4ND3A 1Z7BA 5CFZA 3BTOA 2NLOA 4GGOA 4PLHA 4CQMD 4RF3A 2O3RA 2O3SA 4HX5A 3JD1A 3ULKA 2J3KA 4OOEA 2W90A 3VPXA 5KOIA 4HFNA 4XRGA 1LUAA 1C1DB 1CQJA 3C3XA 1DAPA 3E9QA 4AFNA 4W6ZA 2DVMA 3DBRA 2ZCVA 4CV3A 3K30A 3K2BA 1XKQA 3AI1A 4DTIA 3RUFA 4TVBA 4FN4A 3E8XA 1DB3A 3D4OA 3I52A 5COBA 3MJCA 3WWZA 1J4AA 5DN9A 3I9NA 1FDVA 3W6UA 2NUAA 2Q50A 3EMKA 2IZZA 3FNHA 4P4NA 1VLLA 1YBMA 5CEJA 2OP0A 4XRRA 1K0UA 4HNHA 5IN4A 4FW8A 4QQRA 1WDKA 2GN9A 2R2GA 4CMKA 4E12A 1KVSA 2AE2A 1I01A 5DF1A 2WE7A 1AGNA 3NTQA 3C7AA 4EJMA 5TNXA 1HE4A 1W73A 3BXXA 3W4KA 5F1OA 4IS3A 1K6XA 3GGOA 2GZ1A 3PYMA 4OJNA 4NR0A 5TLSA 1HDZA 4ZVVA 3U49A 4GVXA 2GN4A 1ISGA 3DZHA 4NI5A 3DBHA 1GADO 4OXKA 4CM3A 3EC7A 4GBJA 4DIOA 2J5RA 3I9KA 4QFCA 4LISA 3WNQA 2GERA 2Q1WA 2A94A 3AUSA 1CWUA 2FRDA 2P68A 4OGWA 4EYEA 3ZWAA 2W4QA 2P91A 3K9QO 2PGDA 1XYGA 2PH3A 5KKAA 1H0KA 1JVBA 4D45A 3OFSA 3AK4A 1P0CA 1Z75A 2Y66A 3PP8A 1T1RA 3UW3A 1WAMA 4J6FA 4RVUA 4WEOA 3QVXA 3D0OA 4MIYA 2WE8A 2HO5A 1HRDA 4E3ZA 2Y0CA 1TT7A 1DC3A 3GHHA 4FIZA 4ALJA 5AXCA 3D4PA 1DXYA 1C1XA 4HFJA 5C7IO 2VT2A 3S2FA 1UZLA 2JCXA 2CSUA 4EBFA 1U4SA 3Q1LA 5AQ1A 1K6JA 4J4TA 5ITVA 1XQ6A 2YW9A 1VL8A 5CPBA 1QYWA 2WEKA 3B1FA 3B1JA 2VUSA 3GVHA 5A4DA 2EHDA 4YB8A 3RBZA 3ZWYA 3GPDG 2C5EA 1Y5MA 4ESOA 3BMQB 1ZSYA 2GASA 1LU9A 3QRWA 2PKRA 4D0RA 2VUUA 4HFRA 2VHZA 1YQDA 4ITUA 5A05A 4JP2A 4RPHA 4CL3A 5K6AA 1VI2A 2YV1A 4YVFA 3ASUA 3IS3A 1B14A 1EVIA 3JQGA 4CLRB 1ADFA 1L1FA 4CUZA 4RVSA 3GVXA 2AQ8A 5T5QA 3FR7A 3C8MA 5A3JA 4B3JA 2E4AA 4Q3EA 4XEHA 3ZHXA 2I67A 4OMUA 4S3MA 1I3KA 4XQEA 3FTPA 2F1KA 3L9WA 3RC7A 1U9JA 1FDUA 4ZJUA 3DFZA 1D1SA 3LF2A 4HP8A 1EE9A 3RUIA 1NM5A 1T25A 3ZWWA 1GV1A 1NWCA 4U8GA 1E3LA 4K26A 4CLOA 2R6JA 1SAYA 1HKUA 1ZH8A 1SB8A 1KBZA 2GUGA 4CMAA 1GQQA 3ZU5A 3DAFA 1JLLA 4BMSA 4M54A 3VH1A 3CTMA 5JFOA 1R6DA 4YAJA 4YR9A 5TIIA 4F6CA 1HE5A 2PR2A 4LSMA 2DFDA 3F3SA 4E6PA 1Z6ZA 2FP4A 3T7CA 5DP2A 3ZNPA 5F1PA 3I4CA 1U4OA 3G0OA 3INTA 2G76A 4XQ9A 4DUPA 1VSUA 4XDZA 2A9FA 1R4NB 2JCVA 2CVZA 2AG5A 1ZXLA 4B8ZA 3PFWO 3AOGA 3MJ4A 4IDFA 1VE9A 5IXYA 4MKXA 3D3WB 3RBVA 1EBUA 4BO6A 4HY3A 2O7SA 3DOCA 3AUTA 4GX0A 4XGIA 2YUTA 5G4LA 1YKFA 3TOXA 5A03A 1Q0HA 3MWEB 2X58A 2HSDA 3PVZA 4R69A 4Y6RA 1PJLA 1LSOA 3BHIA 2C07A 1UXJA 4NFSA 3H6KA 5TC4A 1LRJA 3UGKA 5IG2A 5L40A 1I10A 3GDFA 1C0LA 4AJLA 2A4KA 2NVUA 3ADPA 3IQDB 4DLBA 1DIHA 4J2HA 4BGEA 4OO3A 2BGLA 2VWQA 4D79A 3B20A 1E1NA 1P1KA 5EJ2A 1LDNA 2PK3A 4MP3A 1N2SA 1HDGO 1ENYA 3ICPA 3COSA 3NTOA 3KETA 3HFSA 3MWDB 3G49A 2VHVA 5BSGA 1DIAA 4GH5A 3TPCA 4TSKA 1PWZA 3ZW9A 1QP8A 4TRRA 5L53A 1DJNA 3TWOA 5TF4A 4PLVA 2D8AA 5JYEA 3KBOA 4PVCA 1E1LA 4FB5A 1WWKA 3RUHA 1YB4A 4K1LA 4CLXA 1KEPA 1ENPA 3EDMA 1T24A 2Q99A 4QO8A 3WTBA 3WQSB 4JK3A 1CYDA 2QYTA 3D3EA 3ZHYA 4PG4A 4GL4A 4L9RA 3U4DA 2NADA 3ZWXA 1X7DA 3KRTA 4W82A 4A27A 1R66A 2WDZA 4DPKA 1P1RA 2HU2A 3DOJA 4GPD1 4WKGA 2NQ8A 1KIFA 5JW6A 5ER9A 2IRWA 3AY3A 2BRUA 3RKUA 2O3QA 3GPIA 1KEVA 4J3FA 1NHGA 4J9UE 2VTEA 4UVIA 2CF6A 2HRBA 3JD2A 2PTGA 1GYPA 3OECA 5I7SA 3Q2KA 2BELA 3RBXA 1ISIA 3D5QA 1BGVA 1H93A 2B0JA 1G6KA 4R9SA 1EUCA 3C7CB 5G2OA 5IDQA 3KUXA 2I5PO 1WPQA 5C37A 5U9CA 3RAJA 1UXGA 2GZ2A 2X1HA 3VHRA 1SCUA 1CF2O 1DC6A 1Q7GA 2QQ5A 3K31A 1PJQA 1B8PA 5G0SA 3SC4A 1EUDA 3GNSA 4RO0A 3U4CA 4DWVA 1ZFNA 2XXJA 4CMCA 5B4UA 4YQZA 3RD5A 3ZV3A 3CZMA 3HN7A 1GZ3A 2V65A 3PZRA 2EKQA 4BHTA 5JXWA 4P8RA 4Q9NA 1F06A 1N1GA 2Q45A 1DHRA 1ZK3A 4J1NA 3JQFA 1ZBQA 3DMTC 1TA4A 4R16A 3OMLA 2X5OA 4L75A 4XWYA 3ONEA 1GR0A 3PDUA 4Y6PA 2YV3A 1FMCA 3RC1A 2HMUA 3LQFA 4YJFA 1PX0A 1D4FA 3DOOA 3UVEA 3O26A 1K6IA 1TB4A 2XAAA 2GGSA 3RSHA 3S2GA 1C3VA 1CJCA 1GUZA 1Z82A 5DCUA 3N58A 1NASA 2WJPA 3PQDA 1WVGA 1JKJA 2OO5A 5F5NA 4Q3AA 4DVJA 1TLTA 3O9ZA 4JXKA 5CDUA 4R1NA 2WD7B 4IZHA 2F00A 1YBVA 4GKVA 1NVTA 3VVCA 2P9CA 3GMDA 4PLPA 3PHHA 2YDXA 2NU9A 2PKQO 3QWAA 1A9ZA 3FN4A 3DO5A 1NBOA 3U09A 2RHRA 2GZ3A 3QWHA 4CMHA 2YFQA 1SZJG 1YRLA 4PZEA 1Y5RA 1YOVB 1Y9AA 4Z9FA 1KS9A 3U0BA 3E18A 3DBHB 5IJZA 1DFGA 3JQ7B 5HS6A 3WBFA 5ICSA 3H2ZA 4IDBA 1MB4A 5HTOA 1A27A 4Z0PA 4PRKA 1K3TA 4EGFA 3ZHZA 2W2KA 4JX8A 2JHGA 5T8KA 2X86A 4XZ3A 4P4GA 4NDNE 1HT0A 3I83A 1IHXA 3VTZA 1NP3A 3PJDA 4CR6A 1PJBA 2ZK7A 3CMMA 1QG6A 3GR6A 3KXDA 5THQA 1WLYA 4WLOA 3WGZA 3HDJA 1DPGA 4IJUA 3RFTA 3NDIA 1M75A 2P5UA 4J49A 4O0LA 5EL0A 1NTOA 5I9NA 1IOLA 4XKJA 1PZFA 4XYBA 1J49A 3DONA 1JA9A 3DXFA 3ZU4A 2EG9A 1QYDA 2B5VA 2I9PA 1J6UA 1OBFO 1LXCA 1U5CA 1WZEA 2NVWA 2OHXA 3NGLA 3QV1A 5EERA 4DRYA 5B1YA 2GF2A 5H82A 2Q2VA 1GY8A 1LLQA 3SJUA 3H7AA 1B26A 1OMOA 4NJOA 3E03A 5KTKA 4UAGA 1JW9B 1AXEA 3DZBA 1Z7EA 3OP4A 4I5DA 1BRMA 5IAAA 5T8KC 1ULUA 1WZIA 2WD7A 2VYNA 2GLXA 3IIEA 2C0CA 4NQZA 5T64A 4C7KA 1E3WA 4YYZA 3I9LA 4UUPA 3OH8A 2YFHA 2H1SA 2YHUA 4PZCA 1V9LA 3EGOA 1ENZA 2YV2A 3GDGA 5G0UA 3DBLA 1P44A 2VUTA 4NNJA 3JQCA 2VT3A 5CHEA 3CUKA 1C0KA 5COQA 1EVYA 4BNIA 4CV2A 3PDJA 3FPCA 5TJHA 4IQ0A 4NIMA 4B4UA 4PLWA 4UEKA 3A9WA 3JQ7A 5A9SB 1AE1A 1YQGA 3C1OA 5F5LA 2NVBA 3ITKA 3SBOA 3OSUA 1JKFA 3O8QA 3QJ5A 2CD9A 4CMEA 3B1KA 3WXBA 3DQPA 1EMDA 3AFMA 3IJRA 4A26A 4WK6A 1XELA 1NQTA 3JQ9C 5G0WA 1PL7A 5L7YA 1H9BA 1A72A 2JCYA 1PQUA 4LSWA 1NFFA 3WMWA 2W2LD 3I23A 4X54A 4XJTA 3P19A 3MOGA 1NQOA 3FNFA 4JJGA 3ZDFA 3GLQA 1E6EA 3EK2A 1KYQA 1CQIA 4DQUA 3IJPA 3DZIA 1Y8QA 5JDIC 1B0AA 3R6DA 4LVUA 2EW2A 2Q2QA 4CMIA 4KUGA 4YXFA 4JROA 1EQUA 3DHYA 2PH5A 1P1IA 4NBTA 4NBRA 2DBQA 2DT5A 2VRBA 1DAOA 1NHWA 2WWRA 5G4KB 3V2UA 2Y99A 1Y1PA 1KC1A 2I99A 4RL6A 6ADHA 2BFMA 1GU7A 2J5KA 3UH1A 2CVQA 5EINA 3GA0A 3JQ8A 4OSOA 4FCCA 1H6DA 3Q2IA 3DC2A 3H3JA 4MVJM 3ZV6A 1UR5A 1E5QA 1K89A 2O3JA 1E7SA 3GZNA 4RORA 4CMEC 5MDHA 4IIVA 1YL6A 2O7QA 3Q11A 5CG2A 3ROQA 1KY5A 1JDJA 1VJTA 5A02A 2EGHA 1I5RA 3HE3A 1JQBA 3ZNNA 1F8GA 2DLDA 3LC7O 3FWNA 2FR8A 3D3WA 4RLHA 5JAZA 4O6VA 1VM6A 4BNVA 3HDHA 1I24A 3DBVO 3P5SA 1XR3A 1Q0QA
chains in the Genus database with same CATH superfamily
4I9HA 4IDCA 2SCUA 1P0QA 3IDSA 2Q8NA 2PBRA 3HVIA 4XASA 5ALIA 5F1KA 3BFJA 2Q2WA 3MTJA 3PEEA 5L9AA 1XHLA 1XVTA 4M60A 2ZB7A 4J2OA 5DLPA 5J59A 5CNJA 5TPWA 1EFAA 2X40A 3AJRA 1DC5A 1UFKA 4YRKA 1HGXA 3N2GA 3VHQA 4DAEA 1VYVA 4RPGA 3K0HA 4AY6A 3I30X 4GPAA 3X1YA 1FP4B 2XA1A 4BLQA 4UFNA 1KAHA 2QVYX 1JQLB 2XZTA 3DM9B 3GFGA 4OLFA 5F35A 4EQZA 4YQFA 1RJGA 2CXUA 2F3RA 4IGAA 3R7LA 2X5NA 4D9EA 1IU9A 3ZDRA 2RAVA 1R9MA 1N5DA 1NUTA 2DBRA 2WK1A 4K9QA 4HPJB 3KB2A 3W8DA 4IV0A 4X90A 1W1UA 1NVUQ 2VA9A 3GHYA 4RLFA 1V6SA 3V8PA 3WNDA 2Y2VA 1BSVA 1BFKA 4PCVA 1DEAA 4GF5A 4QDJA 5EP1A 4E30A 2EFEB 5JQGF 2R25B 2OCBA 2W2NA 4KN9S 2F1IA 2FWNA 2PSHA 2NAPA 3THOA 4CU5A 5K0JA 4DLVA 5DTIA 9ATCA 5CLLA 4E15A 3BKWA 1FSFA 3GRVA 1V2HE 2P69A 2X9VA 3DXXA 1GZVA 4U8HA 1O08A 2B98A 4ZKDA 4CKBA 4L2IA 1LJLA 2VT7A 4BLTA 1Y3IA 1NDHA 3DMFA 2H1OA 3IVRA 2DMRA 1KFBB 5HNKA 1EK1A 3JWPA 2P2NA 2QLNA 3MQ2A 4HZGA 4L0CA 3VH4A 2PUVA 1NAHA 1NJFA 2IYOA 2QP4A 4K9SA 3WMXA 4HATA 5FX2A 2J9ZB 2PIAA 4QGHA 2GCPA 2VTBA 3KNZA 1GGMA 1CZNA 4MVCA 1ZITA 1M76A 4ZPJA 5E3IA 5ARBA 2PUCA 2O14A 3RF6A 1W2HA 2DPYA 4JI4B 5KTNA 2F9LA 2FWAA 2WUEA 1JAYA 4WEQA 1AS3A 2R7NA 2DFLA 3PRJA 4G9BA 3KTDA 4UZFA 5JAMA 2QAIA 1KRHA 3RABA 2ZRKA 3AVYA 1KO8A 2HHAA 2HCBA 3ABZA 2C2HA 1L3CA 1ZGAA 4R1LA 4AIIA 2HK8A 2ZDHA 2QMZA 2XTAA 4YPOA 3HJGA 1T3ZA 1SCIA 3QWBA 3K9WA 5HQ3B 4MP8A 1FVOA 1XZHA 2BF4A 3PITA 2OWEA 2G5CA 3JVEA 3CXRA 3FBTA 3FMVA 2DKNA 2FWPA 1TC1A 3EIXA 5LUBA 4B31A 2WP0A 1QIMA 3E22B 4N3GA 3L0BA 1EX1A 2PSFA 3ZLBA 5I3CA 3HXOA 3OPVA 2I7DA 2LKDA 5GOZA 1YE8A 2WHPB 4RZ2A 5AJTA 4FLMA 5AD1A 4JODA 4UVDA 2C8JA 2Y8EA 1JFVA 2P9HA 4IICA 5GWXA 3F1LA 3H04A 4INPA 2D2EA 4MZDA 4B3TB 3JQBC 1NVWQ 2AMYA 4KVGA 3PU6A 3FSGA 5B1SA 4CM9A 2VZ0A 4BNYA 5LQNA 2WHQA 1C8LA 1F12A 3KTOA 4FGSA 1MFZA 3D8RA 3DMHA 3WGQA 3O9MA 2ACVA 3FDJA 3HB0A 5DX1A 2FDCA 3L5KA 1P0MA 1R0RE 2EWMA 2JD2A 4YCBA 1VG1A 3A1DA 4B0OA 1MOZA 3TL6A 1OX5A 3WNZA 3NBYC 2J45A 4N41A 5DCWA 2V4ZA 1KEEB 3V8MA 4L4YA 3V4VB 2ZR0A 3IUEA 1MXFA 1EFVB 1UXHA 3ZDEA 4DDMA 5A4AA 2CHGA 5FD8A 5HVNA 2PD6A 2PGIA 4RTSA 3J7AC 3QEKA 1YZYA 4F9EA 4EQ6A 1II8B 3OU7A 5IBPA 1SB9A 5GVRA 2X1VA 5IVIA 1W25A 4DCCA 4IHJF 2IOYA 5AI9A 1VJDA 1G9SA 1JDNA 2M1ZA 1YR9A 3KU1A 3QMPA 3WLFA 5ICCA 2OC4A 3L0IB 2VP9A 5GOTA 3KOZA 2PA0A 1VP3A 2VQSA 5D01A 4NG5A 3Q8KA 1M0EA 3EH2A 2QROA 3K0AB 2X8WA 3KJNA 4NPAA 3R8XA 4EEKA 1IAVA 3B6MA 3EXEB 3O3NB 5HFJA 4ZYTA 1GKUB 2OQ2A 3Q8MA 4DUYB 5EMLA 3LBIA 3F1KA 4BLRA 1S5PA 3CLVA 5LVAA 4N65A 4I4NA 1UODA 2XQIA 2F9FA 4UNIA 1EFRA 3G89A 4O2AF 1LI4A 4FOOA 4MQFA 3DT9A 1ONOA 2FQWA 5JAQA 4Z3OA 2FSVA 5A4FS 1RYEA 3KZCA 4MAAA 4ZU3A 3UK1A 1C9EA 3WHKA 1JIXA 5IS2A 1HUQA 1LS1A 3I2HA 1VJ0A 1JQEA 2ZRNA 3TF5A 1STOA 3DZCA 1JXQA 3ROZA 3HDQA 3O2JA 4WNYA 2V7PA 5KTMA 3CIOA 5B53A 3GEPA 3KD3A 2O1WA 2UYQA 1HDXA 2ZAIA 3IQEA 2ONYA 1E2BA 1XCBA 2A5JA 2HHLA 2JFWA 4OK6A 3I58A 4V3CA 5EXPA 1TA9A 5B1HA 2GB4A 3ZGVA 6Q21A 4EJ2A 3T3EA 5MN5A 3ZCXA 2ZSEA 2VSFA 1GLGA 1RM0A 1YS1X 3VJRA 4QU9A 1IJEA 3RIGA 3EPRA 2B1JA 2BWJA 2NYRA 4RH0A 1XAHA 2PU5A 1NYTA 2C82A 3KR9A 4JKOA 5B4TA 4DCVA 4NBVA 4MHTA 4NCKA 4JSRA 3H84A 4D8WA 4JD5A 4IW3B 4C20A 1D8TA 1F7VA 2ZS8A 1JE0A 1O0SA 5HGXA 3P8ZA 3D5EA 2UYCA 5CLFA 1G98A 1TVEA 4HTAA 2CJPA 5B2ZA 1XA3A 2L0XA 4YTEA 1E2HA 3GRRA 4ZTBA 2WQ7A 2FRDC 2WF9A 1ULZA 1CUEA 3MYRA 4D44A 4U02A 3DOEA 1DTWB 3PX2A 4D3SA 4HWGA 1WB5A 1H0RA 1E3QA 3HCPA 4X1YB 3VO1A 4RQTA 1SHZA 2B5WA 4BLOA 3DYVA 2QPTA 3UGQA 4GM4A 1HYEA 1I3LA 2IXBA 3T4UA 1X94A 2HO4A 4Q4AB 1HYGA 2Q3EA 2IYUA 4UHFA 2XSZD 5CHYA 1ARZA 1G21E 1SOMA 2DHCA 3E7PA 4G8CA 5IH7A 1V43A 4YRLA 5TMPA 2GI4A 4Q21A 2JHPA 3A6ZA 5SYAA 4UMVA 3CSDA 4JHLA 4ZEWA 3UCXA 2BR4A 1V1RA 4XWOA 1K6EA 2XMQA 5F76A 5BP7A 2G4LA 4E2XA 2NSYA 3DNPA 3E35A 2R5WA 1E3TA 1HSZA 1RS0A 1RZVA 1DKUA 1M9NA 1UBHS 2J59A 3OZ7A 3KOMA 3GEDA 1QP7A 4KIUA 1Q7TA 2IK8A 1E2JA 2EZ8A 2GVNA 2C9MA 2XUPA 4KUEA 1UQUA 3GLGA 4LF9B 3KYJB 2J0VA 3ELUA 1N2HA 3EVBA 4R7GA 3WAGA 4ND7A 4FLFA 2NU7A 2XPCA 2I4IA 3W2TA 3I37X 4ER0A 4U5QA 4PANA 2QSUA 5AHWA 5K6AC 4JVNA 4BEVA 2MINB 3MTDA 1VLQA 4HAIA 4MW2A 2VDWB 1HFEL 1I33A 3GVIA 1VGRA 3TUIC 2JGNA 3ZN2A 4CE6A 2Z3VA 1DU4A 3R09A 3AETA 4BNGA 4GP7A 1CUCA 2QR5A 2JEZA 4F5YA 4XJXA 1V7CA 1UBRS 4GKKB 3TVTA 3TZQA 2V7QD 3SHTA 3TFQA 1Y33E 4H08A 1ONPA 4NQRA 5F7ZA 1NW9B 1PR3A 4AYTA 3SYRA 2BFDA 2IJGX 5ALFA 1JZSA 3JCZA 3IR5A 1Q7EA 3ONVA 4FE3A 1CS0B 4AJ4A 1F3LA 1QFMA 2DM6A 4RX1A 1V8DA 3ZGYA 5AXDA 2E2WA 3OZIA 3LDUA 3RLFA 3TNFA 1Z6AA 4YP1A 3UHAA 2B8NA 2AI3A 5ITZB 1ZM3A 3PR2B 4U9HS 1FDSA 4NICA 4URHA 1SVSA 2IXTA 2NT4A 1JVSA 4RFSB 2C3MA 4N3NA 4BKRA 1ZJJA 3GNTA 4LXGA 2QBYB 3FBWA 1YA4A 1ECJA 4AKGA 2O1XA 3PNYA 4IFBA 4AJJA 2B8WA 2RB4A 4LHSA 3OCUA 1U1FA 4KGDA 2XODA 2CGEA 4MUNA 5FADA 2ZI6A 4JU8A 5F51A 4D6PA 3GFPA 3DF9A 3LKBA 2VPTA 4Y6LA 4HUTA 4QPDA 3F73A 4F21A 1GA1A 2G1UA 2R6AA 2ZAOA 3OO0A 2WKWA 4TWIA 4G4SP 2HMWA 3MTGA 3EEFA 5E4FA 1UFVA 1ZK4A 2ZYGA 3KYCA 3RO7A 4QO7A 3PQ2A 3QTLA 4KIWA 1CY4A 4HWTA 4H0FA 1N6IA 2Z5LA 1ODFA 2ZRJA 3L8ZA 4QUEA 4XWWA 1ZKDA 4K9DA 1WDLA 2G1AA 4E5VA 4CDNA 4ZK2A 3DT6A 3LPAA 1SUDA 2P2SA 1VIAA 5CM9C 2CHVA 3C8ZA 1GXSB 2P2YA 1E4OA 3KXLA 4AJPA 5EYPA 3SSNA 1ZOPA 3TTVA 1MO5A 1N9ZA 3OD1A 4EYQA 4PFJA 4YREA 2IS4A 2ZP1A 1HT3A 1HFJA 2C97A 5B6JA 3M6FA 2HU5A 5AUQA 1A82A 4M49A 5JMPA 3CZ4A 3GUHA 5IWCA 1S3SA 1OXVA 1P2BA 3LQYA 4M9CA 3BFVA 1EFTA 5J2TB 3LFTA 4RSRA 2JATA 3MD9A 4M87A 5ALSA 2Z1MA 1RWNA 1N5KA 4JWTA 3OLYA 3WNBA 2GZRA 4MKZA 1QS0A 4DHEA 1F2UB 1WEKA 3KLOA 1CUBA 1KR5A 3MQ4A 4NK4A 3O1HB 4U7PB 2FU5C 2ZIWB 2X7JA 3FYCA 5K3DA 1RLIA 3VX4A 1Y81A 1PEYA 1XU4A 1YQTA 4HQOA 5K3FA 3WBKA 4G4SO 1KYYA 1N78A 1UH5A 4FS8A 3C24A 3GVPA 4BV9A 1XPUA 2BL4A 3AINA 3G79A 4QOGA 1GSOA 2V9ZA 2NM0A 4QAQA 5CXSA 1QH9A 4ZQIA 3W9YA 2XZOA 4LF8B 2ATXA 1QIGA 3B78A 2C98A 1BU8A 4MRAA 1RJ9A 3IOYA 4DV2B 4HJXA 3G0HA 1KJZA 1HZZC 3HBNA 2XMBA 4N03A 1XZMA 3ETDA 1ZM7A 2VPWA 2H1VA 2NV6A 4OM8A 4OF4A 1E1RD 2Y68A 3ZNQA 1H5NA 4NFLA 4MQFB 5BV7A 2QN7A 4FPXA 4OXXA 3QUTA 3WGTA 7ABPA 1P9RA 2LTAA 3FYHA 3SQDA 1S01A 1LSUA 2RJ3A 1RZRD 3HBJA 1PGNA 1Y8QB 2XB4A 4GEGA 4YQYA 4QT0A 4PICA 1NKTA 1ZH0A 2AW5A 4XFKA 1GPMA 3A4NA 3GRPA 4FEAA 2AWOA 4GOKA 5HBRA 3REGA 3KJIA 4L28A 3QXSA 1ZGZA 2H1FA 2P3QA 2HWYA 5IMBA 2DWCA 2XOEA 1KFKB 3ZX4A 4BFXA 4XQGA 4E2YA 2YMMA 1E0SA 1JECA 3OOSA 5CH8A 4Y9UA 5CFQA 1BZYA 1TU3A 1YJCA 2QL6A 2DECA 1EXDA 4ISBA 4C3UA 4DLKA 2QLMA 3IXMA 3P9SA 3MINB 4PHGA 4QIHA 1DSSG 5JNLA 4L5YA 5EQJB 1DQYA 5E4TA 4A2PA 3QXXA 1N6PA 2FHSA 3HFJA 1W9MA 2VJMA 2XIQA 1BXGA 1ODTC 1PJ3A 1ZI9A 1ZBDA 3NEJA 1QLHA 1MEOA 1NDUA 1ZOIA 4W7HA 3G9UA 1YO6A 3FGZA 4JT9A 4GYWA 4WGFA 1BDBA 3HYNA 1PR6A 3G9QA 1BIFA 3K5IA 2FFAA 1NVAA 1Y9JA 3U7IA 1R6UA 1WNTA 2OBLA 2OVBA 2VQDA 4N3AA 1UJ5A 4D81A 1EXNA 4DL9A 3LY9A 4BV3A 3W90A 9ABPA 1XZGA 4H1WA 3HR7A 4ALLA 1RWOA 1J09A 2JLZA 2DEUA 1S89A 3BB1A 4IZOA 1KQ3A 3AEXA 2P65A 4UNPA 2H63A 5DSXA 3FLMA 2NUTA 5BV0A 1B23P 5JZSA 3WVNA 4LZAA 5K0ZA 3RRXA 2BW0A 4XGNA 1PJTA 3B2NA 2NV2B 3GLFB 3ETHA 1QO0A 3QX9A 4P4SA 2L17A 3QSGA 4LYJA 3KT3A 4R9RA 4TLLB 5LQUA 4BV8A 3HL4A 3PDIB 1QV7A 1BCRA 3GFOA 2Y0DA 3ZY4A 4F8JA 3RSLA 1C7FA 2PSDA 4OHYA 1RYHA 1ZJYA 2Z08A 3STTA 3WB9A 1YE5A 5CDSA 3LGXA 4EPVA 3EPLA 2IE8A 1U9ZA 5I7FA 5ITSA 2O8FA 4GFDA 2DFVA 3D6NB 2D5IA 3A4LA 2FPGB 3R9KA 4R51A 5M3BA 5GJWC 4HGNA 4ATNA 3KSMA 3OM0A 1Y3AA 1EXWA 2HWXA 3W8NA 1E0AA 4JZYA 2RK6A 3ER8A 3H7IA 4LC1A 3BMQA 4LHXA 4PBRA 4XQ0A 3WK8A 1NUAA 3IEVA 2AT1A 3TFWA 1BJTA 3S2YA 1SD2A 1A8SA 4M46A 2EF0A 5K45A 4N7JA 4NEQA 1JA1A 1RZ3A 1Z38A 3H9JA 2FF7A 4NDAA 2OZKA 1INLA 5A6SB 2YZGA 1XF1A 4ZZ1A 3NETA 4FYWA 3O2SB 3OAAA 1CUYA 5LNK6 3E0QA 5JFTA 4PRLA 1L4LA 4Q05A 3NUGA 2YFYA 3EH1A 4P7FA 1J1IA 1FSZA 2AIRA 1CVIA 1XAIA 4M6WB 1BGWA 1ZL0A 1E8NA 1RADA 2O9JA 5AKGA 5K99A 1XCPA 4X3OA 2I7CA 4X91A 4ZAFA 1MG5A 4A0SA 4CM4B 2DETA 4HAOA 5FPSA 3NWEA 4KQ6A 2I29A 3MRVA 1KVQA 2BZ0A 1Z88A 3QTBA 4RJ2A 5K6TA 1WXXA 1YZQA 2BHTA 1KEZA 3BDVA 3KKPA 3HUEA 4P22A 4V1CB 4ZPXA 3MPUA 3NHKA 1EBBA 4I19A 3TL2A 3GAAA 1BQEA 1Q0ZA 3PNOA 4P7JA 5A71A 5FWNA 3E9CA 1NBEA 2I3ZA 2P79A 3BWYA 3N1UA 3PWTA 4HDAA 4CTMA 5JV5A 1JLKA 1T1GA 2DFPA 3U7RA 5L45A 2O8BB 4N6NA 1NA5A 3QWIA 2GH1A 3LAWA 4S0XA 4YBRA 4CGYA 2RC5A 4IP0A 3F9RA 4TZ6A 4K6OA 4JQOA 5A5EA 3OQ6A 4GLJA 2HU7A 3ST7A 3TE7A 1UP6A 1YXMA 3BWEA 4HDCA 4L6CA 3WV5A 3DEYX 5BR4A 1SPXA 3D0KA 3WA7A 3QU7A 3N6XA 2NTJA 1QZUA 3I8OA 4TTIA 4YUWA 2O2XA 2XVXA 1O94C 2BGNA 3BOSA 3SE7A 1C9YA 1IBKB 1EH5A 1NLMA 1Z4MA 2XVAA 3IAUA 3GLHE 2R7KA 4R0MA 5CAEA 3EPKA 2ZYRA 4ZN6A 3W4IA 5BXQC 4BB6A 1FXSA 1P77A 2PD4A 5SY4A 1K6MA 2RAPA 8LDHA 2I6FA 3PEFA 5H70A 1Z4KA 4F3RA 3D0QA 4M1WA 3HCNA 5F33A 4EA9A 4F4FA 4OSEA 5KSWB 3EEOA 2C9YA 5FLYA 4JI2B 3WYEA 3C3JA 5A5VA 5AUNB 4GPEA 2GCIA 4NNPA 4V39A 2VF7A 4DW8A 3TZCA 3CRMA 2D7JA 3ESAA 4WMLA 2G9VA 3IEXA 1X8JA 9LDTA 3LT2A 4IIJF 4NJMA 4B85A 3A58B 4UUNA 4X8HA 4OIMA 4F1WA 1LTQA 5KOHA 4G5YA 2CSXA 3RRMA 2R5FA 1OZ0A 2BKEA 3KVRA 2VHCA 3DO8A 1GIAA 3A9UA 3GAZA 1VPVA 3WP1B 5BVGB 4W4TA 4BP3A 3K0SA 3SZRA 4R8LA 3EZLA 2FW8A 3E81A 1R0KA 4I3FA 5A7FA 2AG0A 1B6SA 1E79A 3CN9A 4QYTA 5DNWA 3I8SA 4K86A 1GFIA 3HI6A 1WXHA 3M3PA 2ZVQX 3QU4A 1P4JA 1KMIY 2W2PA 1YU6A 1GXSA 4FKBA 1W5AA 3IA7A 4O0MA 5E6SB 2P0EA 1EWKA 1PQYA 4ADSG 1CF4A 1SVIA 3AF6A 3HL0A 4DQVA 4MIEA 1TYZA 1HZJA 1SQFA 4YRNA 3C3EA 1SUBA 5K0CA 4M83A 2FQYA 3EE6A 2Z04A 3WNVA 6ABPA 1HDRA 2GEVA 3SICE 1I3MA 1QDUA 4U2EA 2ZIUB 4TS4A 4AWAA 3FNRA 4NV0A 4O1IA 2P4UA 3VNBA 5HZGA 3BILA 3TLEA 4OREX 3VU9A 1GPYA 3LIPA 4Q3LA 4BJ6A 2PMDA 2C7GA 4G1MB 4GBED 3RK4A 4EA6A 1QRDA 1K8QA 1RAHA 3E61A 4MRMB 5EHXA 5EMKA 1N7JA 2H4JA 1LA2A 4Q9IA 1FP4A 1KPIA 4ZOCA 1NC1A 3MYYA 1DBVO 4PG8A 3JAKB 1PNQA 3KWLA 3T5TA 3ZGXA 2FEKA 5AIAA 1J5PA 2FDXA 5IP5A 1P3Y1 3LVFO 5KEIA 1GARA 1UEXC 4L4RA 1OYOA 1U7DA 4L15A 3A6FA 1K9VF 1U1GA 4TUYF 1ECGA 2J6BA 4B5KA 1CLUA 1YQQA 4MWTA 4FGKA 1Q1BA 5KVCA 1P7CA 3AUXA 5K5EA 4LC9A 3M1YA 3O2QB 2XQGA 2RH9B 1XIVA 3J81k 3ZDCA 1RI2A 3EFBA 5CLGA 3STHA 1B41A 1Q15A 3MFQA 4G1UC 5TS3A 4FOLA 1MCZA 3H9QA 3U3DA 3MOSA 3RJ9A 5H3LA 1TQHA 3I72A 4AN0A 3OT5A 3DZKA 3EQ8A 5JAHA 4IIUA 5JC8A 2BYTA 1OXSC 3GXOA 4NC9A 1JFFB 1VKJA 3H5LA 1H85A 4H59A 5HM6A 4I5EA 3OEHA 5E2BA 3BRWA 4WXHA 1VMAA 1SKMA 3EZNA 521PA 1GV0A 1A9RA 3SIRA 1W49A 3HK2A 2FPGA 1TYDE 2PT7A 4P83A 4UJ5A 5JECA 1K5DA 1R0WA 1WVMA 3GFTA 2YYAA 1G4UR 5I9MA 3ZKAA 2Z1NA 2ZJ3A 2GD1O 4ZC8A 4DQ0A 1PG0A 2QT1A 1SN7A 2VJQA 4PVDA 1UT8A 4CKEB 5I45A 1P8JA 4NK5A 4E6EA 2WJ4A 3CRZA 4HDNA 3ESYA 5TGDA 4L4XA 4LRXA 3MAAC 3WISA 3BVPA 2RIPA 1YZVA 5FBHA 4ZZ2A 1VTKA 4V2IA 1OIWA 1USWA 2AJLI 1WPRA 3IE0A 3QUSA 4JJFA 2VBCA 5BSTA 4A1FA 3LTNC 2R1TA 4HHEA 4G6ZA 7MDHA 3Q8LA 2XBMA 4MWZA 3N7UA 5KNBA 1I51A 3FUWA 3RARA 1NF3A 1QTNA 1XTJA 2OXTA 5I8PA 2WINI 3T1TA 1NVXQ 1NVBA 3H5NA 3NP9A 3UF0A 2F4VB 3EGXA 4QUBA 1BA3A 1LLUA 1RWWA 3I6YA 3IO5A 1NJ5A 3GGPA 3A3PA 4Q6WA 5ENDA 4DC9A 1Z62A 3M4NA 1OROA 3GGCA 4YQEA 4R3UC 3CF4A 5IHXA 1DBQA 5T6BA 2EU8A 2CCGA 1H8HD 4RE6A 3UKDA 1TUGA 1Y9ZA 3S7ZA 2AXNA 3FJ1A 4G0XA 4XDYA 3AIIA 2PNFA 4I1OA 1JXMA 1G18A 3D1LA 4PC1A 5I9SA 4ETMA 3NXSA 2HAEA 4F7DA 3GJ4A 3HEMA 2PLWA 3PI7A 2V3VA 2KW5A 3DLTA 1EDBA 2QLFA 4AJHA 3I04A 4I08A 1EGQA 1G21B 1NWHA 4Y2QA 1G6HA 2QYSA 3I73A 4UFOA 1U0EA 4LYYA 2PX8A 1PIWA 1A4IA 1PL8A 4KMSA 1I7SB 3RW9A 2OQIA 2JFNA 4MRNA 4TWAA 3QP9A 3WAKA 1KJ9A 2UXBB 3KYDB 1P5RA 1Q1GA 5CK4A 4M9ZA 2ERXA 4Q93A 4DWJA 2J9FA 2CF5A 2I6GA 3F5DA 2ZI4A 1AV7A 1ZA1A 4ZA2A 2LE0A 4WXRA 4KE8A 1SVUA 4E5PA 3NKLA 1GVNB 4ARZA 2VXBA 4C0LA 1MW9X 3IALA 1SOUA 4Q39A 1MAVA 3CR8A 1O9GA 5L6LB 4LQCA 1M83A 1UINA 1ZD5A 2BGMA 3AEYA 1GPBA 4GI2A 3RYIB 3UKOA 1A3CA 3H11A 3DD1A 2EWVA 2ZRPA 3DMDA 3QE0A 4FFOA 4HWSA 4YAIA 5AM3A 5ICMA 4KSYA 1GSIA 2QYHA 2YIMA 3IQWA 3VV2A 2BI8A 4UHDA 4L5AA 2CB9A 1Y6RA 2A5LA 2P90A 3U62A 4OVKA 3PK0A 2OKCA 4UULA 4HLUC 3DXYA 4RZIA 4A8JB 3KJXA 4M0MA 5E9AA 1W59A 1VE1A 1Q0SA 1T2VA 2A59A 4R71A 2IHNA 3E82A 5HKKA 1EB9A 2JANA 1XWFA 2PV7A 5FPHA 2RBEA 1HTBA 3DWFA 3Q4GA 4HVAA 1X39A 1J99A 4DKXA 4CJXA 1NI5A 4DMHA 3EFOB 3AO0B 4J3NA 2HIHA 3DPSA 3RIYA 3L40A 4DILA 2PKCA 3AP2A 4MPPA 4Y9SA 4YMWA 2ETVA 1N57A 2OG2A 4RK4A 5BT9A 4ENQA 2JLSA 4CQJA 1YB5A 2H5LA 5EJ9A 3QYJA 3Q0TA 1HXHA 5JNRA 4ZEVA 4MVJA 3R74A 3U60B 4OIFA 3RSGA 3GUCA 4Z4EA 1DBPA 3FMFA 5MN4A 2RHCA 3HPQA 4H7EA 5AM4A 1EUCB 1BYIA 2B25A 4JLWA 4R54A 3ASYA 3GUZA 4EJ6A 2WMDA 3N2LA 4QVGA 1MU0A 5U1PA 4Q7KA 1RRVA 1T2AA 2HZBA 3CTPA 3AT1A 2JGDB 3BSFA 4UUOA 1XPJA 3F46A 3F7OA 5HIAA 2XF8A 3IAAA 3VNRA 2QTFA 3I1IA 4QOHA 4PYIA 4KIFA 4NABA 3I04M 3SEAA 5AM5A 1TO2E 4JJ7A 1NVFA 1DL5A 4TRJA 2R47A 2PFKA 5ISMA 1UEIA 1U2DA 1N2ZA 1RXSA 3BSSA 3JW8A 1CPYA 4G2TA 2XBUA 4CN9A 4GE3A 3Q15C 4FWBA 1Z73A 5EJ4A 1OLSB 3PNPA 4E08A 4ID9A 3RHTA 4R5HA 3LQRA 2ZM6B 1E5XA 1JDVA 1I6LA 5I5GA 5GVSA 2DF8A 2VJDA 2CDRA 2PX0A 2ZJYA 4IH9A 5K4AA 1GZ7A 2IUSA 5ILGA 3SJBA 3UPTA 2DGDA 4DDUA 3HM9A 4D25A 5FUBA 2H9YA 4R1SA 2RHMA 2R44A 3ZWKA 1ZVMA 1SXJA 1T9CA 2CEAA 3DKKA 3FPFA 4ON9A 4AMGA 3ICWA 3WYFA 2X9GA 5E0KB 4JR0A 4F60A 4D80A 4N49A 1UDBA 4BVHA 3KQNA 3ZXYA 2HT1A 3L92A 2QN3A 1QFSA 3MC1A 3ZV4A 5EJ6A 5DW3A 3PFGA 1AN0A 5K05A 2B1IA 4JUAA 4DMFA 1DJQA 4PGMA 3O75A 1BMFD 1ESNA 3NHMA 5EEGA 4K6GA 4CM8A 4D74A 5A4JA 2DLNA 3LSTA 4NU6A 4MAFA 1V47A 1OILA 2IDMA 3DTYA 3ASZA 4FCTA 2GM3A 5KDDA 1H8HA 1YZLA 4MKIA 4BYGA 3ZWQA 3CBQA 4CM6A 2Y3IA 2ZPUA 4M7WA 1FLNA 1HC7A 1LK5A 4EFLA 2BFCB 4ZCTA 4YP0A 1E7MA 4P3NA 2VKQA 3FY4A 3JQDA 5AJXA 2DULA 1OI7A 2Q62A 1SULA 1YJ8A 3ANXA 3UEOA 2VDPB 5CT9A 4H7JA 3TQQA 5EJFA 1MTZA 3F6CA 4UAJA 1VSBA 1GG5A 1JWBB 3O03A 1XUOA 1IZYA 1HLGA 2FJ0A 2B4QA 1D2EA 3OY2A 1PR9A 2YQ4A 3PGVA 4FXOA 4PXYA 5GV8A 3OJOA 5DDIP 5J47A 3GLFA 4CEHB 3E7FA 4HN9A 4OX9Y 1QFZA 1UDCA 1YL5A 2QZZA 3ORRA 1E4YA 4NATA 3RR2A 4BMDA 3ZY2A 2VTDA 1FNNA 1E2MA 2HU8A 2MYTA 3FWHA 4KIGA 3HWWA 3VU0A 4EO7A 3JPYA 1WXQA 2PM8A 3KM0A 3LT0A 1KE2A 1BWRA 2IHYA 3K09A 1R18A 4CM8B 5IX8A 2D1YA 3LK6A 3BXHA 4BTVA 3PF9A 3L4BC 2WFZA 3RAFC 2QU7A 3MUFA 5KQGA 3FHLA 3N07A 1UZNA 4CDMA 2H4XA 1K7XB 4KLZA 1C9JA 2OGWA 1RLMA 4Q37A 1G8HA 3FPSA 1E6UA 1KOLA 3TBKA 4RNCA 3DWEX 2V7QA 4UNQA 2C9DA 3S68A 4WA8A 3SGLA 4KZPA 4BLUA 4EB0A 3PHLA 1G3RA 2B4TO 3EQ6A 1B3BA 1Z5GA 1EK0A 1WZCA 2C77A 1ZIYA 1E1YA 2JFPA 1YS7A 3MINA 2RJOA 4UARA 1ECLA 2Y93A 3RAEC 3B1XA 3IBGA 2PGXA 1YTUA 1YRYE 4WZ6A 1LPMA 1T0JB 2G4VA 4UCFA 4G56A 3VR6H 3W7AA 4FQ7A 4Z51A 1OQAA 5A9TA 1ECCA 2IDJA 3E3NA 3SMVA 1EM8B 3KUCA 1EVLA 1Q12A 3E3AA 4QYIB 4RZHA 1CXZA 2PLAA 2ZWVA 3GIWA 3UJHA 1L7QA 2YCLA 3B6ZA 4RXMA 3ZOZA 4MUIA 1Q83A 4LBZA 5BYJA 4J03A 1FXWA 2A9KA 1T8WA 1WHTB 5TQ2B 2JH8A 4C43A 1ID1A 5FWDA 4Z86A 1EFPA 1W93A 1CUUA 1A77A 4D8UA 5HQJA 5HR5A 4U00A 1OXTA 3PQ5A 221PA 4QUDA 4W9NA 5KCZA 3Q0IA 2NTYC 5F7XA 3PFIA 1ADYA 4IWYA 2Z95A 3BWCA 1X1TA 3KB8A 1JR3A 2ZYAA 2OZPA 2WZDA 3U9SA 1ZJ5A 1TT5B 1YS2X 2WICA 4OYLA 4UMFA 2P2CA 3AV0B 5K0TA 2OD2A 4INOA 1QUEA 5TARA 3QE2A 4Q4JB 2VWHA 1ZM9A 2A5GA 2FTKE 3FJYA 4MDHA 1W0CA 3KT6A 4X45A 3MJHA 1SKYE 4M8IA 4NZYA 4ZV7A 4PFKA 2VNAA 4EHNA 1U11A 1U8UA 2FHPA 2VYCA 3CLUC 1Z29A 3KELA 3IC5A 3MRXA 3NYIA 4KX5A 3GEEA 4JR2A 4P4TA 5JJIA 5IVHA 1K7YA 4KI0A 3EFOA 1A8QA 5GJBA 1QTQA 3IUYA 5KB3A 1AK9A 1WHTA 2H18A 1KAMA 2A3RA 5K3SA 3TOVA 3DEZA 1IVSA 1V71A 4E14A 5AKLA 3Q3VA 5DNCA 2CYBA 2VDJA 1DUSA 4WWHA 4QASA 3MJSA 4DYVA 4EI7A 4IG4A 2OB2A 2VA8A 3ILHA 5DBGA 4ABYA 4ZMBA 1EM8A 4MUKA 3RFVA 3A2KA 3KDSE 1ZC4A 3Q9LA 1IONA 3F6EX 1KMMA 2D4AA 1WP9A 4N12A 1N3LA 3CV3A 5JDCA 1DWUA 1G3UA 1PR0A 2OV2A 3TMAA 5JH7B 3QA9A 3UO8B 2FEMA 2JW5A 2OFXA 1HETA 4K6KA 2WM3A 3BMCB 3BYZA 3H11B 4BUZA 4WJLA 4I5IA 3LBHA 5KNCH 1I2MA 1E9BA 3H83A 1QVAA 3D8NA 2VDRB 2ZE5A 2QXTA 3R6GA 4AB1A 2QHXA 4PRYA 4MW7A 1H3FA 4PLYA 1SEVA 3BTVA 3ETCA 4UDOA 1GPUA 1YI1A 1QANA 3EG5A 1D1QA 1MENA 3BCUA 3EXHC 5DK4A 1C3LA 1IBSA 3N0XA 4R8RA 2H11A 2QW0X 1AKRA 1QRRA 2RH8A 5F9MA 3CVWA 2D2IA 3PUJA 3V1MA 4PHCA 4U2GA 2RGWA 3DS8A 1HH4A 4NYIR 1YA8A 4IL5A 3HLYA 4EJSA 3L7BA 5ECWA 3QKRB 2XA2A 4FQ8A 1K08A 2ID4A 1YIDA 4FYHA 1TX4B 1QO0D 1SZDA 2G72A 3O73A 1NIPA 4HKTA 4LHEA 5E2AA 2CFOA 2D59A 2LVBA 2Z6AA 4EMTA 3RFFA 2AOUA 3T4XA 1ZGJA 3EOBI 5D7BA 2GNAA 2X0RA 1JKIA 1MP0A 4BLWA 4BNNA 3EXG2 2DY0A 3JQPA 4O4LA 3THYA 3JTMA 3PRYA 1OC4A 2G1KA 2XEDA 5C8YB 3VYUB 5IJXA 5CVDA 2QPLA 5I51A 1DNPA 3DLHA 4GI5A 3HLTA 3NOOA 4PEVA 1ZVKA 3HP1A 4B79A 4DT1B 3P4YA 1DBWA 2BFOA 3PPVA 1CZRA 1O5TA 3IPXA 3V00A 1KMCA 3C3DA 4WZBA 1AKVA 1GSAA 2CZGA 3RBXA 2CL0X 1JZTA 4KKXB 4NP6A 1E92A 3B5IA 2IXDA 3WA6A 3BJZA 1FFDA 4NENB 4AICA 1QVZA 2FJPA 5KOYA 1FVFA 2G1JA 3ROKA 1IRXA 2O1SA 4U0KA 1EWYA 2GSDA 1U2TA 5LIPA 3CINA 2P5YA 3T5CA 1R0CA 2M2IA 2F1RA 2OHHA 3CH6A 2JCGA 3GJ6A 4TUYB 3CW2A 3DD5A 3SHVA 3TQCA 4B83A 3KEGA 1DQZA 3BIJA 2QSZA 3UOGA 5IKEA 3KWJA 4GSKA 3KHKA 2D13A 1YVEI 4JOSA 2WSBA 3GEBA 4KMMA 3QU5A 4MV5A 4Q1EA 2FZWA 2UVDA 2E4VA 1T9KA 3HUFA 2E6UX 3CPSA 1ENOA 1T4CA 3NIFB 5AVKA 3T3PB 1ST3A 2B34A 1CULC 1NY5A 2P8SA 3PJGA 3R3XA 4F2GA 3N86A 4RVFA 3G0DA 2NU6B 3RASA 5EFOA 3OE7A 1JU9A 1UXIA 3QHQA 4DLYA 3WYCA 3GK3A 2HZ7A 3AI2A 2VJCA 2J08A 3U1TA 4CLHA 2UAGA 3NHPA 4KWIA 4M1ZA 4GDFA 1BA2A 1PQWA 4FOSA 3EXIB 4WCFC 1XALA 2G82A 3L1JA 2HJSA 2PX2A 2JGDA 4J0DA 4LK2A 3OFKA 1TM7E 2YXDA 3WICA 5K8LA 1K75A 3AFNA 3QVGB 4GRIA 4EY6A 1HLPA 5DH9A 3OZCA 4F11A 4W5JA 3EDRA 3GVCA 2HNBA 2OQRA 3JY6A 4K3UA 4P3PA 1C1XB 3KR2A 1JDBB 5DT2A 2ID9A 1A5ZA 2FSPA 4FSHA 1U1IA 2V4UA 1CUVA 4KK4A 4KO1S 2X0DA 1Z0FA 2ODWA 3TUJC 1DJLA 1LLCA 3OU6A 1FTYA 2C2YA 1QYVA 4QNMA 5EZQA 3BAFA 3S99A 2JVKA 3TR6A 2G1PA 4CV0A 1O0BA 4F3KA 1ORRA 2ZYHA 3T5PA 4P3OA 1K1EA 2N1MA 2Q7XA 5I9TA 3TW8B 1DBIA 3FFXA 3LCRA 2PJZA 1DBRA 1M8KA 1PD1A 1Y3CE 2NU6A 2BY4A 2W00A 3KXKA 4AZ0A 5C53B 1PEAA 4LNUB 1G5TA 2CW5A 3ZK9A 1MXHA 2HIMA 2LDBA 3DAGA 3OX1A 4M0EA 3M34A 1TAUA 3TDMA 4Y2TA 3G1WA 4DM7A 5J4VA 2XYHA 2D7DA 5ERXA 4BGVA 2AG8A 1WXGA 3MCVA 1BAPA 5ALDA 2V7WA 4Z7JA 2I4MA 1QHNA 2GEUA 4FDTA 4B3CA 2YOHA 1UMBB 2HB6A 3O93A 3A25A 4FJ2A 5FJIA 5AVOA 2RH5A 3A36A 1Z0JA 3CG4A 2WV9A 1Z7WA 4EZIA 5CJJA 3AC0A 1Q19A 4R0NA 1KBOA 1LNSA 3TOSA 5DSZA 1CBUA 5K0LA 2BEUB 1NUSA 4BO0A 4MQBA 4TLAA 4JYZA 2ECOA 2DH6A 2Q0QA 3AZOA 4L22A 2QXUA 1ST2A 1ZGBA 2CK3D 2Y0PA 1O95A 4P36A 4TS3A 4V0SA 4JDUA 4WD3A 3DDZX 4Z0NA 1HNNA 1NQVA 4EW1A 3F9IA 4Z8YA 2XMSA 2GPJA 2VYVD 3GPCA 2QRLA 2PVSA 2ADOA 4AZ3A 2GO1A 5EAIA 2RGCA 3ET5A 4NMXB 4RL4A 1EDDA 3TX2A 2CWDA 2FCRA 3FZGA 3LW8A 5SV2A 1QG4A 1P29A 1Y7LA 4LJ6A 4LMPA 3S44A 2QTLA 1MV8A 3H0CA 3AVTA 4UDNA 4BP1A 3LQ1A 3QHPA 1XTTA 4ZRMA 4C04A 1IAQA 4IS2A 2O2GA 5DWQA 4ESHA 2EGGA 2TMDA 3L1UA 2RK3A 4QUHA 1H2HA 2AYXA 4FONA 4DRXA 3KAQA 3LXXA 4M55A 2X9NA 1XL1A 1T2CA 5EPEA 4FS3A 1U80A 3KVNA 4IQ4A 4ND6A 1TM1E 5A0FA 1NQWA 2O2SA 3DMPA 1O87A 2C8VA 1AC5A 3P2EA 3R5FA 2GYUA 3RS2A 5JC1A 4Q19A 3H1TA 3OOYA 5JS6A 5J2TA 1RMQA 1X1AA 1E9CA 4DSOA 2OCXA 2GCNA 3H2SA 3EW7A 3S27A 1GQRA 3VYRB 2UZ1B 2W4IA 3IDOA 1Z63A 1PT6A 4M6WA 1SKQA 4RF4A 2YBEA 3CHYA 5I7UA 4HQFA 3OSZA 3K35A 4MR9B 2C7VA 3K0FA 2AOXA 2Q1TA 2EXXA 4V3BA 1P4SA 3V55A 3D6JA 3NYRA 1YSCA 5CIYA 3ND8A 3EULA 3Q3JB 3W8FA 3WMGA 3RYFB 4E2WA 1C29B 4ZI3A 3F96A 1NTRA 2AFIE 2NO5A 2CE7A 4H16A 2IIBA 2VF5X 1X15A 5T41A 3F2VA 3PXDA 3IAM1 2FFQA 2GPWA 2NO1A 1Y1KE 3M81A 1SWWA 3IMFA 1T8TA 3B6KA 3QVJA 4N82A 5LMZA 1JWAB 4H6PA 1P1FA 1CUDA 4HNGA 4NH4A 3KHTA 1EXMA 2QWXA 3HCAA 3QENA 4AWXA 3QX3A 2QQFA 5M29A 3WGJA 5LDHA 3U4HA 1Z22A 1JIKA 4YPFA 2G8NA 3A1TA 4JBHA 1CJVC 2SECE 1TW2A 3JQAA 3CR7A 2NUPB 4LOHA 1ADCA 5JARA 2JI4A 4RAOA 3Q7SA 1T3SA 2W6ID 2J87A 2W7TA 3F5QA 5DFAA 3V1KA 1EFRD 1NX6A 4OYRA 2DKFA 2PXXA 3FCCA 4DCMA 3L7NA 2I6QA 3VQTA 1SD5A 3KSUA 1MO6A 3LX4A 3PDIA 5C8VA