4Q9PA

Crystal structure of c16t/k12v/c117v/p134v mutant of human acidic fibroblast growth factor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
YKKPVLLYTSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILFLVLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor 1
publication title Mutation choice to eliminate buried free cysteines in protein therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4q9pA00
3V79C 5DZUA 4A7YA 3PMEA 3O4CA 4GOVA 1SR4A 3NBCA 3N7LA 5D63A 1BASA 3FJAA 1S0FA 3P6JA 1TTUA 2BEAA 3O3QA 1K5VA 3ZC8A 1WBAA 5F8WA 2VUAA 1KNMA 1IRPA 5BXRA 3LLPA 2F8XC 2ET2A 3FUOA 1M16A 4I8MA 4X38A 3H6RA 1BFGA 4OUJA 2L5XA 4QD2C 3VUOA 3SNVA 1MC9A 2NYYA 4YOLA 4I6IA 4IZEA 4D0ZA 3F62B 1BFFA 4G9MA 4X37A 4I4OA 3OBTA 4I1BA 4XFUA 4JKXB 2MLLB 4G6MA 4QD2B 1FWUA 1RG8A 4G1RA 3QR5A 2GZBA 3CA3A 1FMMS 4D0TA 3C9ZA 1RY7A 2ERMA 5BVPI 5HPZA 3ZX7A 4LO2A 2ZQOA 1QXMA 3AJ6A 3BA4A 3Q7WA 4GOYA 1PWAA 1F31A 3QYDA 2NM1A 4G6JA 2VU9A 4AN7B 3P53A 1BFBA 3A07A 3AH4A 4H9WA 2ZQNA 3LTQA 4KEKA 5JMCA 4EFRA 4LO3C 1J0SA 4QBVA 1TIEA 1DJSB 1JY0A 2D22A 2Z49A 2Y9FA 3BB2A 1HWNB 4ZKTB 3T8SA 2KI6B 1E0OA 2WRYA 3O4DA 3NJ5A 41BIA 3V0AB 2UUSA 4Q9PA 1T9FA 3AH2A 4G9NA 2F2FA 1JLYA 3OGFA 1ISWA 1HIBA 1A8DA 3H6SE 2DRZA 2K8RA 3MALA 5F8SA 4I4RA 4Q91A 3NBNA 4I37A 1HWPB 5FZZA 1P63A 1VCLA 4QBCA 4IY9A 3RTJB 2D24A 4H04A 3OJVA 1TOOA 1ISVA 1I1BA 4QKSA 4P0JA 1Q03A 2IWTB 4I1EA 2RSTA 5B2HA 3VEQA 3RSJA 3N7MA 1G9DA 1ISZA 4HA2A 1PC8B 4Q9GA 2LIEA 1S0GA 3AJ5A 3Q7XA 1DZDA 3FJIA 4XFSA 5JLVA 2D7RA 4ZBVB 3RMXA 5BXTA 3FFZA 4ISQA 4LO1A 3AKGA 1TFMB 4LO2C 3VT1A 3BAVA 3OJMA 8I1BA 3WMVA 1GGPB 4ZFWB 1RMLA 3CA4A 3R4SA 3VSZA 1JQZA 2AAIB 2VXRA 1V6WA 1BLDA 1R8NA 3BRFA 3AKIA 1TWEA 4I4XA 1DQOA 5F90A 1G9AA 3FJEA 4EEEB 4OEFA 2ZR1B 4F34A 3BAQA 3NBDA 1K5UA 5FZYA 4HJJA 1G82A 2KH2A 4OWLA 4XKIA 1IOBA 2NTDA 3N0KA 1G9CA 2F2FC 3IM6A 4X39A 4I4QA 2Y9WC 3HALA 1Z0HA 3VT2A 4I3NA 3I29B 1FQ9A 1EV2A 4ZA3B 1V6XA 1Z2VA 4II0A 2DRYA 3CRGA 3PHZA 2MIBA 5D62A 3CA5A 4XFTA 4IZXA 4FVVA 1ABRB 1V6VA 1V6UA 2DS0A 2K43A 2VLCA 3RTIB 4J2XA 4I4VA 2Y9XE 3OJ2A 1FV2A 3CA0A 1UPSA 4OWKA 4R6UB 4CJMA 1FV3A 3ZC9A 1TP0A 2VXTI 3I2AA 3UD8A 1JT4A 3JUTA 2QN4A 5BXSA 4JAWA 2D1ZA 3A22A 4A7ZA 1EPWA 2IHOA 2J3PA 1IRAX 4I4UA 4LO1C 1JLXA 1YBIA 3ZXGA 1QQKA 1DFQA 3AZWA 1HCDA 1QQLA 1S0EA 1FGAA 3FJKA 4LO7C 2HWMA 3FGMA 3E8LC 3ZXDA 1SZ6B 1JT7A 3A23A 2X2TA 3AH1A 3A21A 1S0LA 4OW4A 3NBEA 1DLLA 3BA7A 4L4IA 4LO7B 2HZ9A 3UJ4A 4I96A 7I1BA 4X3AA 4OWJA 3HN1A 1N4KA 1DIWA 2VSAA 2Z48A 4P6AA 3WINA 2NP0A 3BA5A 3UD7A 4IONA 4L4HA 3BAUA 3BX1C 5D61A 2FFUA 3BTAA 1ILR1 1AVUA 3O44A 1YTOA 5BP5A 5BQUA 1HWOB 1XHBA 3BAGA 2GO2A 3H6RB 3HOMA 3FJ8A 3O4AA 3POKA 5E24E 3O4BA 1AF9A 2ESUA 4IY8A 4EFQA 1OQLB 3N7JA 1ISYA 2I1BA 1Q1UA 3OBRA 4DENA 1IT0A 4JP0A 3O4OA 1FMZA 3PG0A 4ISRA 2D7IA 3IM5A 3FJHA 5EC5A 2DREA 4A7KA 3BAHA 3AKFA 4ENDA 4QC4A 2D44A 1RZOB 4GAIA 5G00A 3WO3A 1AVWB 1IHKA 4I4PA 4Z9WB 5GAQA 4J2KA 3W9TA 2FDBM 2HWAA 4I4YA 2MC2A 2NVHA 4DEPA 1HCEA 1ITBA 4WBCA 2YUGA 4EKXB 1DZCA 5EHAA 3CA6A 3R4UA 4USPA 3UJ0A 1PUUB 3B9UA 3WA1A 4IYBA 2Y9GA 3IAGC 5F8YA 1M2TB 4GP0A 4HR6C 2BFHA 3KMVA 2KI4A 3FJDA 1AVAC 5FZUA 4EB2B 3O49A 2P23A 5DVHA 3VSFA 3WINC 2RG9B 2KKIA 3WMUA 3S8JA 3I2XA 1AVXB 2VSEA 4GP3A 3WO4A 2AFGA 3V0BA 4FGFA 2Q3NB 3VWCA 3RMYA 2WBCA 2D43A 3CRHA 4DCKC 5I1BA 1BA7A 1Z4SA 1EVTA 5DSSB 5BP5C 2FFVA 4JPZA 5BQUC 5BOWA 2P39A 9ILBA 4I2SA 1WBCA 3IIRA 4J2YA 4J23B 1S0CA 3FJJA 4IHZA 3BADA 1AXMA 3UDAA 1W3FA 3CQAA 3CAHA 1EYLA 3Q7YA 3VT0A 3F1RA 4ZGRB 3MPPG 4I0YA 4P0LA 4JRAA 1XG6A 1FN0A 3FJFA 3AKHA 1PZZA 2R9KB 4Z8SB 1WD3A 3D7WB 4LO0C 3N7KA 2BEBA 3P6IA 1HWMB 3HBWA 1R8OA 3AZVA 1W3AA 4JKQA 2AXMA 2HW9A 3UD9A 3BRGC 2AQZA 4I4SA 1YF8B 4KEJA 3PUBA 1BFCA 6I1BA 3HSMA 1PUMB 2XOAA 4IQPA 2D23A 1FWVA 1S0BA 4KEIA 5BXPA 1IILA 3FJ9A 3ILAA 4JQ0A 1DQGA 21BIA 1XZZA 2E4MC 2NZ9A 1NZKA 1G9BA 1JT5A 1SR4C 2K4AB 2Q9XA 1DFCA 1IJTA 1JT3A 3CA1A 4D8HA 4AN6A 3OGGA 2LIQA 4OEGA 5FNWA 1YXWA 1S0DA 3HMYA 1XYFA 4OEEA 4J2SA 1II4A 1I1EA 3EF2A 2RQ9A 3S8KA 4LO8B 4I7IA 5DUYA 4F83A 3V0BB 3H6QA 3WO2A 1BARA 4USOA 3TC2A 1AFCA 2M49A 2D20A 1L2HA 3O5WB 4QKRA 4EFPA 4KBBA 4GAFA 5FNXA 1ISXA 4P0KA 3CU1B 1YYNA 2X2SA 5EG6C 4PC4A 4TLPA 1T4QA 1TWMA 1Q04A 1CE7B 3BRDA 3CRIA 1JTCA 4LO0A 4KC3A 4QO3A 1BLAA 4ZFUB 2FGFA 3FUQA 1HKNA 1WD4A 3IM7A 1MD6A 3V0AA 3FJBA 1NUNA 4QALA 2FO1A 2QYIB 4LO3A 1W3GA 3JRRA 2KLLA 1ONKB 3FJCA 4ZFYB 4ZLBB 31BIA 3K1XA 2E4MA 1CVSA 1D0HA 4ZOTA 3BAOA
chains in the Genus database with same CATH superfamily
3V79C 5DZUA 4A7YA 3PMEA 3O4CA 4GOVA 1SR4A 3NBCA 3N7LA 5D63A 1BASA 3FJAA 1S0FA 3P6JA 1TTUA 2BEAA 3O3QA 1K5VA 3ZC8A 1WBAA 5F8WA 2VUAA 1KNMA 1IRPA 5BXRA 3LLPA 2F8XC 2ET2A 3FUOA 1M16A 4I8MA 4X38A 3H6RA 1BFGA 4OUJA 2L5XA 4QD2C 3VUOA 3SNVA 1MC9A 2NYYA 4YOLA 4I6IA 4IZEA 4D0ZA 3F62B 1BFFA 4G9MA 4X37A 4I4OA 3OBTA 4I1BA 4XFUA 4JKXB 2MLLB 4G6MA 4QD2B 1FWUA 1RG8A 4G1RA 3QR5A 2GZBA 3CA3A 1FMMS 4D0TA 3C9ZA 1RY7A 2ERMA 5BVPI 5HPZA 3ZX7A 4LO2A 2ZQOA 1QXMA 3AJ6A 3BA4A 3Q7WA 4GOYA 1PWAA 1F31A 3QYDA 2NM1A 4G6JA 2VU9A 4AN7B 3P53A 1BFBA 3A07A 3AH4A 4H9WA 2ZQNA 3LTQA 4KEKA 5JMCA 4EFRA 4LO3C 1J0SA 4QBVA 1TIEA 1DJSB 1JY0A 2D22A 2Z49A 2Y9FA 3BB2A 1HWNB 4ZKTB 3T8SA 2KI6B 1E0OA 2WRYA 3O4DA 3NJ5A 4MZHA 41BIA 3V0AB 2UUSA 4Q9PA 1T9FA 3AH2A 4G9NA 2F2FA 1JLYA 3OGFA 1ISWA 1HIBA 1A8DA 3H6SE 2DRZA 2K8RA 3MALA 5F8SA 4I4RA 4Q91A 3NBNA 4I37A 1HWPB 5FZZA 1P63A 1VCLA 4QBCA 4IY9A 3RTJB 2D24A 4H04A 3OJVA 1TOOA 1ISVA 1I1BA 4QKSA 4P0JA 1Q03A 2IWTB 4I1EA 2RSTA 5B2HA 3VEQA 3RSJA 3N7MA 1G9DA 1ISZA 4HA2A 1PC8B 4Q9GA 2LIEA 1S0GA 3AJ5A 3Q7XA 1DZDA 3FJIA 4XFSA 5JLVA 2D7RA 4ZBVB 3RMXA 5BXTA 3FFZA 4ISQA 4LO1A 3AKGA 1TFMB 4LO2C 3VT1A 3BAVA 3OJMA 8I1BA 3WMVA 1GGPB 4ZFWB 1RMLA 3CA4A 3R4SA 3VSZA 1JQZA 2AAIB 2VXRA 1V6WA 1BLDA 1R8NA 3BRFA 3AKIA 1TWEA 4I4XA 1DQOA 5F90A 1G9AA 3FJEA 4EEEB 4OEFA 2ZR1B 4F34A 3BAQA 3NBDA 1K5UA 5FZYA 4HJJA 1G82A 2KH2A 4OWLA 4XKIA 1IOBA 2NTDA 3N0KA 1G9CA 2F2FC 3IM6A 4X39A 4I4QA 2Y9WC 3HALA 1Z0HA 3VT2A 4I3NA 3I29B 1FQ9A 1EV2A 4ZA3B 1V6XA 1Z2VA 4II0A 2DRYA 3CRGA 3PHZA 2MIBA 5D62A 3CA5A 4XFTA 4IZXA 4FVVA 1ABRB 1V6VA 1V6UA 2DS0A 2K43A 2VLCA 3RTIB 4J2XA 4I4VA 2Y9XE 3OJ2A 1FV2A 3CA0A 1UPSA 4OWKA 4R6UB 4CJMA 1FV3A 3ZC9A 1TP0A 2VXTI 3I2AA 3UD8A 1JT4A 3JUTA 2QN4A 5BXSA 4JAWA 2D1ZA 3A22A 4A7ZA 1EPWA 2IHOA 2J3PA 1IRAX 4I4UA 4LO1C 1JLXA 1YBIA 3ZXGA 1QQKA 1DFQA 3AZWA 1HCDA 1QQLA 1S0EA 1FGAA 3FJKA 4LO7C 2HWMA 3FGMA 3E8LC 3ZXDA 1SZ6B 1JT7A 3A23A 2X2TA 3AH1A 3A21A 1S0LA 4OW4A 3NBEA 1DLLA 3BA7A 4L4IA 4LO7B 2HZ9A 4UY4A 3UJ4A 4I96A 7I1BA 4X3AA 4OWJA 3HN1A 1N4KA 1DIWA 2VSAA 2Z48A 4P6AA 3WINA 2NP0A 3BA5A 3UD7A 4IONA 4L4HA 3BAUA 3BX1C 5D61A 2FFUA 3BTAA 1ILR1 1AVUA 3O44A 1YTOA 5BP5A 5BQUA 1HWOB 1XHBA 3BAGA 2GO2A 3H6RB 3HOMA 3FJ8A 3O4AA 3POKA 5E24E 3O4BA 1AF9A 2ESUA 4IY8A 4EFQA 1OQLB 3N7JA 1ISYA 2I1BA 1Q1UA 3OBRA 4DENA 1IT0A 4JP0A 3O4OA 1FMZA 4H75A 3PG0A 4ISRA 2D7IA 3IM5A 3FJHA 5EC5A 2DREA 4A7KA 3BAHA 3AKFA 4ENDA 4QC4A 2D44A 1RZOB 4GAIA 5G00A 3WO3A 1AVWB 1IHKA 4I4PA 4Z9WB 5GAQA 4J2KA 3W9TA 2FDBM 2HWAA 4I4YA 2MC2A 2NVHA 4DEPA 1HCEA 1ITBA 4WBCA 2YUGA 4EKXB 1DZCA 5EHAA 3CA6A 3R4UA 4USPA 3UJ0A 1PUUB 3B9UA 3WA1A 4IYBA 2Y9GA 3IAGC 5F8YA 1M2TB 4GP0A 4HR6C 2BFHA 3KMVA 2KI4A 3FJDA 1AVAC 5FZUA 4EB2B 3O49A 2P23A 5DVHA 3VSFA 3WINC 2RG9B 2KKIA 3WMUA 3S8JA 3I2XA 1AVXB 2VSEA 4GP3A 3WO4A 2AFGA 3V0BA 4FGFA 2Q3NB 3VWCA 3RMYA 2WBCA 2D43A 3CRHA 4DCKC 5I1BA 1BA7A 1Z4SA 1EVTA 5DSSB 5BP5C 2FFVA 4JPZA 5BQUC 5BOWA 2P39A 9ILBA 4I2SA 1WBCA 3IIRA 4J2YA 4J23B 1S0CA 3FJJA 4IHZA 3BADA 1AXMA 3UDAA 1W3FA 3CQAA 3CAHA 1EYLA 3Q7YA 3VT0A 3F1RA 4ZGRB 3MPPG 4I0YA 4P0LA 4JRAA 1XG6A 1FN0A 3FJFA 3AKHA 4MZFB 1PZZA 2R9KB 4Z8SB 1WD3A 3D7WB 4LO0C 3N7KA 2BEBA 3P6IA 1HWMB 3HBWA 1R8OA 3AZVA 1W3AA 4JKQA 2AXMA 2HW9A 3UD9A 3BRGC 2AQZA 4I4SA 1YF8B 4KEJA 3PUBA 1BFCA 6I1BA 3HSMA 1PUMB 2XOAA 4IQPA 2D23A 1FWVA 4MZGB 1S0BA 4KEIA 5BXPA 1IILA 3FJ9A 3ILAA 4JQ0A 1DQGA 21BIA 1XZZA 2E4MC 2NZ9A 1NZKA 1G9BA 1JT5A 1SR4C 2K4AB 2Q9XA 1DFCA 1IJTA 1JT3A 3CA1A 4D8HA 4AN6A 3OGGA 2LIQA 4OEGA 5FNWA 1YXWA 1S0DA 3HMYA 1XYFA 4OEEA 4J2SA 1II4A 1I1EA 3EF2A 2RQ9A 3S8KA 4LO8B 4I7IA 5DUYA 4F83A 3V0BB 3H6QA 3WO2A 1BARA 4USOA 3TC2A 1AFCA 2M49A 2D20A 1L2HA 3O5WB 4QKRA 4EFPA 4KBBA 4GAFA 5FNXA 1ISXA 4P0KA 3CU1B 1YYNA 2X2SA 5EG6C 4PC4A 4TLPA 1T4QA 1TWMA 1Q04A 1CE7B 3BRDA 2NS2A 3CRIA 1JTCA 4LO0A 4KC3A 4QO3A 1BLAA 4ZFUB 2FGFA 3FUQA 1HKNA 1WD4A 3IM7A 1MD6A 3V0AA 3FJBA 1NUNA 4QALA 2FO1A 2QYIB 4LO3A 1W3GA 3JRRA 2KLLA 1ONKB 3FJCA 4ZFYB 4ZLBB 31BIA 3K1XA 2E4MA 1CVSA 1D0HA 4ZOTA 3BAOA
chains in the Genus database with same CATH topology
3V79C 5DZUA 4A7YA 3PMEA 3O4CA 4GOVA 1SR4A 3NBCA 3N7LA 5D63A 1BASA 3FJAA 1S0FA 3P6JA 1TTUA 2BEAA 3O3QA 1K5VA 3ZC8A 1WBAA 5F8WA 2VUAA 1KNMA 1IRPA 5BXRA 3LLPA 2F8XC 2ET2A 3FUOA 1M16A 4I8MA 4X38A 3H6RA 1BFGA 4OUJA 2L5XA 4QD2C 3VUOA 3SNVA 1MC9A 2NYYA 4YOLA 4I6IA 4IZEA 4D0ZA 3F62B 1BFFA 4G9MA 4X37A 4I4OA 3OBTA 4I1BA 4XFUA 4JKXB 2MLLB 4G6MA 4QD2B 1FWUA 1RG8A 4G1RA 3QR5A 2GZBA 3CA3A 1FMMS 4D0TA 3C9ZA 1RY7A 2ERMA 5BVPI 5HPZA 3ZX7A 4LO2A 2ZQOA 1QXMA 3AJ6A 3BA4A 3Q7WA 4GOYA 1PWAA 1F31A 3QYDA 2NM1A 4G6JA 2VU9A 4AN7B 3P53A 1BFBA 3A07A 3AH4A 4H9WA 2ZQNA 3LTQA 4KEKA 5JMCA 4EFRA 4LO3C 1J0SA 4QBVA 1TIEA 1DJSB 1JY0A 2D22A 2Z49A 2Y9FA 3BB2A 1HWNB 4ZKTB 3T8SA 2KI6B 1E0OA 2WRYA 3O4DA 3NJ5A 4MZHA 41BIA 3V0AB 2UUSA 4Q9PA 1T9FA 3AH2A 4G9NA 2F2FA 1JLYA 3OGFA 1ISWA 1HIBA 1A8DA 3H6SE 2DRZA 2K8RA 3MALA 5F8SA 4I4RA 4Q91A 3NBNA 4I37A 1HWPB 5FZZA 1P63A 1VCLA 4QBCA 4IY9A 3RTJB 2D24A 4H04A 3OJVA 1TOOA 1ISVA 1I1BA 4QKSA 4P0JA 1Q03A 2IWTB 4I1EA 2RSTA 5B2HA 3VEQA 3RSJA 3N7MA 1G9DA 1ISZA 4HA2A 1PC8B 4Q9GA 2LIEA 1S0GA 3AJ5A 3Q7XA 1DZDA 3FJIA 4XFSA 5JLVA 2D7RA 4ZBVB 3RMXA 5BXTA 3FFZA 4ISQA 4LO1A 3AKGA 1TFMB 4LO2C 3VT1A 3BAVA 3OJMA 8I1BA 3WMVA 1GGPB 4ZFWB 1RMLA 3CA4A 3R4SA 3VSZA 1JQZA 2AAIB 2VXRA 1V6WA 1BLDA 1R8NA 3BRFA 3AKIA 1TWEA 4I4XA 1DQOA 5F90A 1G9AA 3FJEA 4EEEB 4OEFA 2ZR1B 4F34A 3BAQA 3NBDA 1K5UA 5FZYA 4HJJA 1G82A 2KH2A 4OWLA 4XKIA 1IOBA 2NTDA 3N0KA 1G9CA 2F2FC 3IM6A 4X39A 4I4QA 2Y9WC 3HALA 1Z0HA 3VT2A 4I3NA 3I29B 1FQ9A 1EV2A 4ZA3B 1V6XA 1Z2VA 4II0A 2DRYA 3CRGA 3PHZA 2MIBA 5D62A 3CA5A 4XFTA 4IZXA 4FVVA 1ABRB 1V6VA 1V6UA 2DS0A 2K43A 2VLCA 3RTIB 4J2XA 4I4VA 2Y9XE 3OJ2A 1FV2A 3CA0A 1UPSA 4OWKA 4R6UB 4CJMA 1FV3A 3ZC9A 1TP0A 2VXTI 3I2AA 3UD8A 1JT4A 3JUTA 2QN4A 5BXSA 4JAWA 2D1ZA 3A22A 4A7ZA 1EPWA 2IHOA 2J3PA 1IRAX 4I4UA 4LO1C 1JLXA 1YBIA 3ZXGA 1QQKA 1DFQA 3AZWA 1HCDA 1QQLA 1S0EA 1FGAA 3FJKA 4LO7C 2HWMA 3FGMA 3E8LC 3ZXDA 1SZ6B 1JT7A 3A23A 2X2TA 3AH1A 3A21A 1S0LA 4OW4A 3NBEA 1DLLA 3BA7A 4L4IA 4LO7B 2HZ9A 4UY4A 3UJ4A 4I96A 7I1BA 4X3AA 4OWJA 3HN1A 1N4KA 1DIWA 2VSAA 2Z48A 4P6AA 3WINA 2NP0A 3BA5A 3UD7A 4IONA 4L4HA 3BAUA 3BX1C 5D61A 2FFUA 3BTAA 1ILR1 1AVUA 3O44A 1YTOA 5BP5A 5BQUA 1HWOB 1XHBA 3BAGA 2GO2A 3H6RB 3HOMA 3FJ8A 3O4AA 3POKA 5E24E 3O4BA 1AF9A 2ESUA 4IY8A 4EFQA 1OQLB 3N7JA 1ISYA 2I1BA 1Q1UA 3OBRA 4DENA 1IT0A 4JP0A 3O4OA 1FMZA 4H75A 3PG0A 4ISRA 2D7IA 3IM5A 3FJHA 5EC5A 2DREA 4A7KA 3BAHA 3AKFA 4ENDA 4QC4A 2D44A 1RZOB 4GAIA 5G00A 3WO3A 1AVWB 1IHKA 4I4PA 4Z9WB 5GAQA 4J2KA 3W9TA 2FDBM 2HWAA 4I4YA 2MC2A 2NVHA 4DEPA 1HCEA 1ITBA 4WBCA 2YUGA 4EKXB 1DZCA 5EHAA 3CA6A 3R4UA 4USPA 3UJ0A 1PUUB 3B9UA 3WA1A 4IYBA 2Y9GA 3IAGC 5F8YA 1M2TB 4GP0A 4HR6C 2BFHA 3KMVA 2KI4A 3FJDA 1AVAC 5FZUA 4EB2B 3O49A 2P23A 5DVHA 3VSFA 3WINC 2RG9B 2KKIA 3WMUA 3S8JA 3I2XA 1AVXB 2VSEA 4GP3A 3WO4A 2AFGA 3V0BA 4FGFA 2Q3NB 3VWCA 3RMYA 2WBCA 2D43A 3CRHA 4DCKC 5I1BA 1BA7A 1Z4SA 1EVTA 5DSSB 5BP5C 2FFVA 4JPZA 5BQUC 5BOWA 2P39A 9ILBA 4I2SA 1WBCA 3IIRA 4J2YA 4J23B 1S0CA 3FJJA 4IHZA 3BADA 1AXMA 3UDAA 1W3FA 3CQAA 3CAHA 1EYLA 3Q7YA 3VT0A 3F1RA 4ZGRB 3MPPG 4I0YA 4P0LA 4JRAA 1XG6A 1FN0A 3FJFA 3AKHA 4MZFB 1PZZA 2R9KB 4Z8SB 1WD3A 3D7WB 4LO0C 3N7KA 2BEBA 3P6IA 1HWMB 3HBWA 1R8OA 3AZVA 1W3AA 4JKQA 2AXMA 2HW9A 3UD9A 3BRGC 2AQZA 4I4SA 1YF8B 4KEJA 3PUBA 1BFCA 6I1BA 3HSMA 1PUMB 2XOAA 4IQPA 2D23A 1FWVA 4MZGB 1S0BA 4KEIA 5BXPA 1IILA 3FJ9A 3ILAA 4JQ0A 1DQGA 21BIA 1XZZA 2E4MC 2NZ9A 1NZKA 1G9BA 1JT5A 1SR4C 2K4AB 2Q9XA 1DFCA 1IJTA 1JT3A 3CA1A 4D8HA 4AN6A 3OGGA 2LIQA 4OEGA 5FNWA 1YXWA 1S0DA 3HMYA 1XYFA 4OEEA 4J2SA 1II4A 1I1EA 3EF2A 2RQ9A 3S8KA 4LO8B 4I7IA 5DUYA 4F83A 3V0BB 3H6QA 3WO2A 1BARA 4USOA 3TC2A 1AFCA 2M49A 2D20A 1L2HA 3O5WB 4QKRA 4EFPA 4KBBA 4GAFA 5FNXA 1ISXA 4P0KA 3CU1B 1YYNA 2X2SA 5EG6C 4PC4A 4TLPA 1T4QA 1TWMA 1Q04A 1CE7B 3BRDA 2NS2A 3CRIA 1JTCA 4LO0A 4KC3A 4QO3A 1BLAA 4ZFUB 2FGFA 3FUQA 1HKNA 1WD4A 3IM7A 1MD6A 3V0AA 3FJBA 1NUNA 4QALA 2FO1A 2QYIB 4LO3A 1W3GA 3JRRA 2KLLA 1ONKB 3FJCA 4ZFYB 4ZLBB 31BIA 3K1XA 2E4MA 1CVSA 1D0HA 4ZOTA 3BAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V79 C;  5DZU A;  4A7Y A;  3PME A;  3O4C A;  4GOV A;  1SR4 A;  3NBC A;  3N7L A;  5D63 A;  1BAS A;  3FJA A;  1S0F A;  3P6J A;  1TTU A;  2BEA A;  3O3Q A;  1K5V A;  3ZC8 A;  1WBA A;  5F8W A;  2VUA A;  1KNM A;  1IRP A;  5BXR A;  3LLP A;  2F8X C;  2ET2 A;  3FUO A;  1M16 A;  4I8M A;  4X38 A;  3H6R A;  1BFG A;  4OUJ A;  2L5X A;  4QD2 C;  3VUO A;  3SNV A;  1MC9 A;  2NYY A;  4YOL A;  4I6I A;  4IZE A;  4D0Z A;  3F62 B;  1BFF A;  4G9M A;  4X37 A;  4I4O A;  3OBT A;  4I1B A;  4XFU A;  4JKX B;  2MLL B;  4G6M A;  4QD2 B;  1FWU A;  1RG8 A;  4G1R A;  3QR5 A;  2GZB A;  3CA3 A;  1FMM S;  4D0T A;  3C9Z A;  1RY7 A;  2ERM A;  5BVP I;  5HPZ A;  3ZX7 A;  4LO2 A;  2ZQO A;  1QXM A;  3AJ6 A;  3BA4 A;  3Q7W A;  4GOY A;  1PWA A;  1F31 A;  3QYD A;  2NM1 A;  4G6J A;  2VU9 A;  4AN7 B;  3P53 A;  1BFB A;  3A07 A;  3AH4 A;  4H9W A;  2ZQN A;  3LTQ A;  4KEK A;  5JMC A;  4EFR A;  4LO3 C;  1J0S A;  4QBV A;  1TIE A;  1DJS B;  1JY0 A;  2D22 A;  2Z49 A;  2Y9F A;  3BB2 A;  1HWN B;  4ZKT B;  3T8S A;  2KI6 B;  1E0O A;  2WRY A;  3O4D A;  3NJ5 A;  41BI A;  3V0A B;  2UUS A;  4Q9P A;  1T9F A;  3AH2 A;  4G9N A;  2F2F A;  1JLY A;  3OGF A;  1ISW A;  1HIB A;  1A8D A;  3H6S E;  2DRZ A;  2K8R A;  3MAL A;  5F8S A;  4I4R A;  4Q91 A;  3NBN A;  4I37 A;  1HWP B;  5FZZ A;  1P63 A;  1VCL A;  4QBC A;  4IY9 A;  3RTJ B;  2D24 A;  4H04 A;  3OJV A;  1TOO A;  1ISV A;  1I1B A;  4QKS A;  4P0J A;  1Q03 A;  2IWT B;  4I1E A;  2RST A;  5B2H A;  3VEQ A;  3RSJ A;  3N7M A;  1G9D A;  1ISZ A;  4HA2 A;  1PC8 B;  4Q9G A;  2LIE A;  1S0G A;  3AJ5 A;  3Q7X A;  1DZD A;  3FJI A;  4XFS A;  5JLV A;  2D7R A;  4ZBV B;  3RMX A;  5BXT A;  3FFZ A;  4ISQ A;  4LO1 A;  3AKG A;  1TFM B;  4LO2 C;  3VT1 A;  3BAV A;  3OJM A;  8I1B A;  3WMV A;  1GGP B;  4ZFW B;  1RML A;  3CA4 A;  3R4S A;  3VSZ A;  1JQZ A;  2AAI B;  2VXR A;  1V6W A;  1BLD A;  1R8N A;  3BRF A;  3AKI A;  1TWE A;  4I4X A;  1DQO A;  5F90 A;  1G9A A;  3FJE A;  4EEE B;  4OEF A;  2ZR1 B;  4F34 A;  3BAQ A;  3NBD A;  1K5U A;  5FZY A;  4HJJ A;  1G82 A;  2KH2 A;  4OWL A;  4XKI A;  1IOB A;  2NTD A;  3N0K A;  1G9C A;  2F2F C;  3IM6 A;  4X39 A;  4I4Q A;  2Y9W C;  3HAL A;  1Z0H A;  3VT2 A;  4I3N A;  3I29 B;  1FQ9 A;  1EV2 A;  4ZA3 B;  1V6X A;  1Z2V A;  4II0 A;  2DRY A;  3CRG A;  3PHZ A;  2MIB A;  5D62 A;  3CA5 A;  4XFT A;  4IZX A;  4FVV A;  1ABR B;  1V6V A;  1V6U A;  2DS0 A;  2K43 A;  2VLC A;  3RTI B;  4J2X A;  4I4V A;  2Y9X E;  3OJ2 A;  1FV2 A;  3CA0 A;  1UPS A;  4OWK A;  4R6U B;  4CJM A;  1FV3 A;  3ZC9 A;  1TP0 A;  2VXT I;  3I2A A;  3UD8 A;  1JT4 A;  3JUT A;  2QN4 A;  5BXS A;  4JAW A;  2D1Z A;  3A22 A;  4A7Z A;  1EPW A;  2IHO A;  2J3P A;  1IRA X;  4I4U A;  4LO1 C;  1JLX A;  1YBI A;  3ZXG A;  1QQK A;  1DFQ A;  3AZW A;  1HCD A;  1QQL A;  1S0E A;  1FGA A;  3FJK A;  4LO7 C;  2HWM A;  3FGM A;  3E8L C;  3ZXD A;  1SZ6 B;  1JT7 A;  3A23 A;  2X2T A;  3AH1 A;  3A21 A;  1S0L A;  4OW4 A;  3NBE A;  1DLL A;  3BA7 A;  4L4I A;  4LO7 B;  2HZ9 A;  3UJ4 A;  4I96 A;  7I1B A;  4X3A A;  4OWJ A;  3HN1 A;  1N4K A;  1DIW A;  2VSA A;  2Z48 A;  4P6A A;  3WIN A;  2NP0 A;  3BA5 A;  3UD7 A;  4ION A;  4L4H A;  3BAU A;  3BX1 C;  5D61 A;  2FFU A;  3BTA A;  1ILR 1;  1AVU A;  3O44 A;  1YTO A;  5BP5 A;  5BQU A;  1HWO B;  1XHB A;  3BAG A;  2GO2 A;  3H6R B;  3HOM A;  3FJ8 A;  3O4A A;  3POK A;  5E24 E;  3O4B A;  1AF9 A;  2ESU A;  4IY8 A;  4EFQ A;  1OQL B;  3N7J A;  1ISY A;  2I1B A;  1Q1U A;  3OBR A;  4DEN A;  1IT0 A;  4JP0 A;  3O4O A;  1FMZ A;  3PG0 A;  4ISR A;  2D7I A;  3IM5 A;  3FJH A;  5EC5 A;  2DRE A;  4A7K A;  3BAH A;  3AKF A;  4END A;  4QC4 A;  2D44 A;  1RZO B;  4GAI A;  5G00 A;  3WO3 A;  1AVW B;  1IHK A;  4I4P A;  4Z9W B;  5GAQ A;  4J2K A;  3W9T A;  2FDB M;  2HWA A;  4I4Y A;  2MC2 A;  2NVH A;  4DEP A;  1HCE A;  1ITB A;  4WBC A;  2YUG A;  4EKX B;  1DZC A;  5EHA A;  3CA6 A;  3R4U A;  4USP A;  3UJ0 A;  1PUU B;  3B9U A;  3WA1 A;  4IYB A;  2Y9G A;  3IAG C;  5F8Y A;  1M2T B;  4GP0 A;  4HR6 C;  2BFH A;  3KMV A;  2KI4 A;  3FJD A;  1AVA C;  5FZU A;  4EB2 B;  3O49 A;  2P23 A;  5DVH A;  3VSF A;  3WIN C;  2RG9 B;  2KKI A;  3WMU A;  3S8J A;  3I2X A;  1AVX B;  2VSE A;  4GP3 A;  3WO4 A;  2AFG A;  3V0B A;  4FGF A;  2Q3N B;  3VWC A;  3RMY A;  2WBC A;  2D43 A;  3CRH A;  4DCK C;  5I1B A;  1BA7 A;  1Z4S A;  1EVT A;  5DSS B;  5BP5 C;  2FFV A;  4JPZ A;  5BQU C;  5BOW A;  2P39 A;  9ILB A;  4I2S A;  1WBC A;  3IIR A;  4J2Y A;  4J23 B;  1S0C A;  3FJJ A;  4IHZ A;  3BAD A;  1AXM A;  3UDA A;  1W3F A;  3CQA A;  3CAH A;  1EYL A;  3Q7Y A;  3VT0 A;  3F1R A;  4ZGR B;  3MPP G;  4I0Y A;  4P0L A;  4JRA A;  1XG6 A;  1FN0 A;  3FJF A;  3AKH A;  1PZZ A;  2R9K B;  4Z8S B;  1WD3 A;  3D7W B;  4LO0 C;  3N7K A;  2BEB A;  3P6I A;  1HWM B;  3HBW A;  1R8O A;  3AZV A;  1W3A A;  4JKQ A;  2AXM A;  2HW9 A;  3UD9 A;  3BRG C;  2AQZ A;  4I4S A;  1YF8 B;  4KEJ A;  3PUB A;  1BFC A;  6I1B A;  3HSM A;  1PUM B;  2XOA A;  4IQP A;  2D23 A;  1FWV A;  1S0B A;  4KEI A;  5BXP A;  1IIL A;  3FJ9 A;  3ILA A;  4JQ0 A;  1DQG A;  21BI A;  1XZZ A;  2E4M C;  2NZ9 A;  1NZK A;  1G9B A;  1JT5 A;  1SR4 C;  2K4A B;  2Q9X A;  1DFC A;  1IJT A;  1JT3 A;  3CA1 A;  4D8H A;  4AN6 A;  3OGG A;  2LIQ A;  4OEG A;  5FNW A;  1YXW A;  1S0D A;  3HMY A;  1XYF A;  4OEE A;  4J2S A;  1II4 A;  1I1E A;  3EF2 A;  2RQ9 A;  3S8K A;  4LO8 B;  4I7I A;  5DUY A;  4F83 A;  3V0B B;  3H6Q A;  3WO2 A;  1BAR A;  4USO A;  3TC2 A;  1AFC A;  2M49 A;  2D20 A;  1L2H A;  3O5W B;  4QKR A;  4EFP A;  4KBB A;  4GAF A;  5FNX A;  1ISX A;  4P0K A;  3CU1 B;  1YYN A;  2X2S A;  5EG6 C;  4PC4 A;  4TLP A;  1T4Q A;  1TWM A;  1Q04 A;  1CE7 B;  3BRD A;  3CRI A;  1JTC A;  4LO0 A;  4KC3 A;  4QO3 A;  1BLA A;  4ZFU B;  2FGF A;  3FUQ A;  1HKN A;  1WD4 A;  3IM7 A;  1MD6 A;  3V0A A;  3FJB A;  1NUN A;  4QAL A;  2FO1 A;  2QYI B;  4LO3 A;  1W3G A;  3JRR A;  2KLL A;  1ONK B;  3FJC A;  4ZFY B;  4ZLB B;  31BI A;  3K1X A;  2E4M A;  1CVS A;  1D0H A;  4ZOT A;  3BAO A; 
#chains in the Genus database with same CATH topology
 3V79 C;  5DZU A;  4A7Y A;  3PME A;  3O4C A;  4GOV A;  1SR4 A;  3NBC A;  3N7L A;  5D63 A;  1BAS A;  3FJA A;  1S0F A;  3P6J A;  1TTU A;  2BEA A;  3O3Q A;  1K5V A;  3ZC8 A;  1WBA A;  5F8W A;  2VUA A;  1KNM A;  1IRP A;  5BXR A;  3LLP A;  2F8X C;  2ET2 A;  3FUO A;  1M16 A;  4I8M A;  4X38 A;  3H6R A;  1BFG A;  4OUJ A;  2L5X A;  4QD2 C;  3VUO A;  3SNV A;  1MC9 A;  2NYY A;  4YOL A;  4I6I A;  4IZE A;  4D0Z A;  3F62 B;  1BFF A;  4G9M A;  4X37 A;  4I4O A;  3OBT A;  4I1B A;  4XFU A;  4JKX B;  2MLL B;  4G6M A;  4QD2 B;  1FWU A;  1RG8 A;  4G1R A;  3QR5 A;  2GZB A;  3CA3 A;  1FMM S;  4D0T A;  3C9Z A;  1RY7 A;  2ERM A;  5BVP I;  5HPZ A;  3ZX7 A;  4LO2 A;  2ZQO A;  1QXM A;  3AJ6 A;  3BA4 A;  3Q7W A;  4GOY A;  1PWA A;  1F31 A;  3QYD A;  2NM1 A;  4G6J A;  2VU9 A;  4AN7 B;  3P53 A;  1BFB A;  3A07 A;  3AH4 A;  4H9W A;  2ZQN A;  3LTQ A;  4KEK A;  5JMC A;  4EFR A;  4LO3 C;  1J0S A;  4QBV A;  1TIE A;  1DJS B;  1JY0 A;  2D22 A;  2Z49 A;  2Y9F A;  3BB2 A;  1HWN B;  4ZKT B;  3T8S A;  2KI6 B;  1E0O A;  2WRY A;  3O4D A;  3NJ5 A;  4MZH A;  41BI A;  3V0A B;  2UUS A;  4Q9P A;  1T9F A;  3AH2 A;  4G9N A;  2F2F A;  1JLY A;  3OGF A;  1ISW A;  1HIB A;  1A8D A;  3H6S E;  2DRZ A;  2K8R A;  3MAL A;  5F8S A;  4I4R A;  4Q91 A;  3NBN A;  4I37 A;  1HWP B;  5FZZ A;  1P63 A;  1VCL A;  4QBC A;  4IY9 A;  3RTJ B;  2D24 A;  4H04 A;  3OJV A;  1TOO A;  1ISV A;  1I1B A;  4QKS A;  4P0J A;  1Q03 A;  2IWT B;  4I1E A;  2RST A;  5B2H A;  3VEQ A;  3RSJ A;  3N7M A;  1G9D A;  1ISZ A;  4HA2 A;  1PC8 B;  4Q9G A;  2LIE A;  1S0G A;  3AJ5 A;  3Q7X A;  1DZD A;  3FJI A;  4XFS A;  5JLV A;  2D7R A;  4ZBV B;  3RMX A;  5BXT A;  3FFZ A;  4ISQ A;  4LO1 A;  3AKG A;  1TFM B;  4LO2 C;  3VT1 A;  3BAV A;  3OJM A;  8I1B A;  3WMV A;  1GGP B;  4ZFW B;  1RML A;  3CA4 A;  3R4S A;  3VSZ A;  1JQZ A;  2AAI B;  2VXR A;  1V6W A;  1BLD A;  1R8N A;  3BRF A;  3AKI A;  1TWE A;  4I4X A;  1DQO A;  5F90 A;  1G9A A;  3FJE A;  4EEE B;  4OEF A;  2ZR1 B;  4F34 A;  3BAQ A;  3NBD A;  1K5U A;  5FZY A;  4HJJ A;  1G82 A;  2KH2 A;  4OWL A;  4XKI A;  1IOB A;  2NTD A;  3N0K A;  1G9C A;  2F2F C;  3IM6 A;  4X39 A;  4I4Q A;  2Y9W C;  3HAL A;  1Z0H A;  3VT2 A;  4I3N A;  3I29 B;  1FQ9 A;  1EV2 A;  4ZA3 B;  1V6X A;  1Z2V A;  4II0 A;  2DRY A;  3CRG A;  3PHZ A;  2MIB A;  5D62 A;  3CA5 A;  4XFT A;  4IZX A;  4FVV A;  1ABR B;  1V6V A;  1V6U A;  2DS0 A;  2K43 A;  2VLC A;  3RTI B;  4J2X A;  4I4V A;  2Y9X E;  3OJ2 A;  1FV2 A;  3CA0 A;  1UPS A;  4OWK A;  4R6U B;  4CJM A;  1FV3 A;  3ZC9 A;  1TP0 A;  2VXT I;  3I2A A;  3UD8 A;  1JT4 A;  3JUT A;  2QN4 A;  5BXS A;  4JAW A;  2D1Z A;  3A22 A;  4A7Z A;  1EPW A;  2IHO A;  2J3P A;  1IRA X;  4I4U A;  4LO1 C;  1JLX A;  1YBI A;  3ZXG A;  1QQK A;  1DFQ A;  3AZW A;  1HCD A;  1QQL A;  1S0E A;  1FGA A;  3FJK A;  4LO7 C;  2HWM A;  3FGM A;  3E8L C;  3ZXD A;  1SZ6 B;  1JT7 A;  3A23 A;  2X2T A;  3AH1 A;  3A21 A;  1S0L A;  4OW4 A;  3NBE A;  1DLL A;  3BA7 A;  4L4I A;  4LO7 B;  2HZ9 A;  4UY4 A;  3UJ4 A;  4I96 A;  7I1B A;  4X3A A;  4OWJ A;  3HN1 A;  1N4K A;  1DIW A;  2VSA A;  2Z48 A;  4P6A A;  3WIN A;  2NP0 A;  3BA5 A;  3UD7 A;  4ION A;  4L4H A;  3BAU A;  3BX1 C;  5D61 A;  2FFU A;  3BTA A;  1ILR 1;  1AVU A;  3O44 A;  1YTO A;  5BP5 A;  5BQU A;  1HWO B;  1XHB A;  3BAG A;  2GO2 A;  3H6R B;  3HOM A;  3FJ8 A;  3O4A A;  3POK A;  5E24 E;  3O4B A;  1AF9 A;  2ESU A;  4IY8 A;  4EFQ A;  1OQL B;  3N7J A;  1ISY A;  2I1B A;  1Q1U A;  3OBR A;  4DEN A;  1IT0 A;  4JP0 A;  3O4O A;  1FMZ A;  4H75 A;  3PG0 A;  4ISR A;  2D7I A;  3IM5 A;  3FJH A;  5EC5 A;  2DRE A;  4A7K A;  3BAH A;  3AKF A;  4END A;  4QC4 A;  2D44 A;  1RZO B;  4GAI A;  5G00 A;  3WO3 A;  1AVW B;  1IHK A;  4I4P A;  4Z9W B;  5GAQ A;  4J2K A;  3W9T A;  2FDB M;  2HWA A;  4I4Y A;  2MC2 A;  2NVH A;  4DEP A;  1HCE A;  1ITB A;  4WBC A;  2YUG A;  4EKX B;  1DZC A;  5EHA A;  3CA6 A;  3R4U A;  4USP A;  3UJ0 A;  1PUU B;  3B9U A;  3WA1 A;  4IYB A;  2Y9G A;  3IAG C;  5F8Y A;  1M2T B;  4GP0 A;  4HR6 C;  2BFH A;  3KMV A;  2KI4 A;  3FJD A;  1AVA C;  5FZU A;  4EB2 B;  3O49 A;  2P23 A;  5DVH A;  3VSF A;  3WIN C;  2RG9 B;  2KKI A;  3WMU A;  3S8J A;  3I2X A;  1AVX B;  2VSE A;  4GP3 A;  3WO4 A;  2AFG A;  3V0B A;  4FGF A;  2Q3N B;  3VWC A;  3RMY A;  2WBC A;  2D43 A;  3CRH A;  4DCK C;  5I1B A;  1BA7 A;  1Z4S A;  1EVT A;  5DSS B;  5BP5 C;  2FFV A;  4JPZ A;  5BQU C;  5BOW A;  2P39 A;  9ILB A;  4I2S A;  1WBC A;  3IIR A;  4J2Y A;  4J23 B;  1S0C A;  3FJJ A;  4IHZ A;  3BAD A;  1AXM A;  3UDA A;  1W3F A;  3CQA A;  3CAH A;  1EYL A;  3Q7Y A;  3VT0 A;  3F1R A;  4ZGR B;  3MPP G;  4I0Y A;  4P0L A;  4JRA A;  1XG6 A;  1FN0 A;  3FJF A;  3AKH A;  4MZF B;  1PZZ A;  2R9K B;  4Z8S B;  1WD3 A;  3D7W B;  4LO0 C;  3N7K A;  2BEB A;  3P6I A;  1HWM B;  3HBW A;  1R8O A;  3AZV A;  1W3A A;  4JKQ A;  2AXM A;  2HW9 A;  3UD9 A;  3BRG C;  2AQZ A;  4I4S A;  1YF8 B;  4KEJ A;  3PUB A;  1BFC A;  6I1B A;  3HSM A;  1PUM B;  2XOA A;  4IQP A;  2D23 A;  1FWV A;  4MZG B;  1S0B A;  4KEI A;  5BXP A;  1IIL A;  3FJ9 A;  3ILA A;  4JQ0 A;  1DQG A;  21BI A;  1XZZ A;  2E4M C;  2NZ9 A;  1NZK A;  1G9B A;  1JT5 A;  1SR4 C;  2K4A B;  2Q9X A;  1DFC A;  1IJT A;  1JT3 A;  3CA1 A;  4D8H A;  4AN6 A;  3OGG A;  2LIQ A;  4OEG A;  5FNW A;  1YXW A;  1S0D A;  3HMY A;  1XYF A;  4OEE A;  4J2S A;  1II4 A;  1I1E A;  3EF2 A;  2RQ9 A;  3S8K A;  4LO8 B;  4I7I A;  5DUY A;  4F83 A;  3V0B B;  3H6Q A;  3WO2 A;  1BAR A;  4USO A;  3TC2 A;  1AFC A;  2M49 A;  2D20 A;  1L2H A;  3O5W B;  4QKR A;  4EFP A;  4KBB A;  4GAF A;  5FNX A;  1ISX A;  4P0K A;  3CU1 B;  1YYN A;  2X2S A;  5EG6 C;  4PC4 A;  4TLP A;  1T4Q A;  1TWM A;  1Q04 A;  1CE7 B;  3BRD A;  2NS2 A;  3CRI A;  1JTC A;  4LO0 A;  4KC3 A;  4QO3 A;  1BLA A;  4ZFU B;  2FGF A;  3FUQ A;  1HKN A;  1WD4 A;  3IM7 A;  1MD6 A;  3V0A A;  3FJB A;  1NUN A;  4QAL A;  2FO1 A;  2QYI B;  4LO3 A;  1W3G A;  3JRR A;  2KLL A;  1ONK B;  3FJC A;  4ZFY B;  4ZLB B;  31BI A;  3K1X A;  2E4M A;  1CVS A;  1D0H A;  4ZOT A;  3BAO A; 
#chains in the Genus database with same CATH homology
 3V79 C;  5DZU A;  4A7Y A;  3PME A;  3O4C A;  4GOV A;  1SR4 A;  3NBC A;  3N7L A;  5D63 A;  1BAS A;  3FJA A;  1S0F A;  3P6J A;  1TTU A;  2BEA A;  3O3Q A;  1K5V A;  3ZC8 A;  1WBA A;  5F8W A;  2VUA A;  1KNM A;  1IRP A;  5BXR A;  3LLP A;  2F8X C;  2ET2 A;  3FUO A;  1M16 A;  4I8M A;  4X38 A;  3H6R A;  1BFG A;  4OUJ A;  2L5X A;  4QD2 C;  3VUO A;  3SNV A;  1MC9 A;  2NYY A;  4YOL A;  4I6I A;  4IZE A;  4D0Z A;  3F62 B;  1BFF A;  4G9M A;  4X37 A;  4I4O A;  3OBT A;  4I1B A;  4XFU A;  4JKX B;  2MLL B;  4G6M A;  4QD2 B;  1FWU A;  1RG8 A;  4G1R A;  3QR5 A;  2GZB A;  3CA3 A;  1FMM S;  4D0T A;  3C9Z A;  1RY7 A;  2ERM A;  5BVP I;  5HPZ A;  3ZX7 A;  4LO2 A;  2ZQO A;  1QXM A;  3AJ6 A;  3BA4 A;  3Q7W A;  4GOY A;  1PWA A;  1F31 A;  3QYD A;  2NM1 A;  4G6J A;  2VU9 A;  4AN7 B;  3P53 A;  1BFB A;  3A07 A;  3AH4 A;  4H9W A;  2ZQN A;  3LTQ A;  4KEK A;  5JMC A;  4EFR A;  4LO3 C;  1J0S A;  4QBV A;  1TIE A;  1DJS B;  1JY0 A;  2D22 A;  2Z49 A;  2Y9F A;  3BB2 A;  1HWN B;  4ZKT B;  3T8S A;  2KI6 B;  1E0O A;  2WRY A;  3O4D A;  3NJ5 A;  4MZH A;  41BI A;  3V0A B;  2UUS A;  4Q9P A;  1T9F A;  3AH2 A;  4G9N A;  2F2F A;  1JLY A;  3OGF A;  1ISW A;  1HIB A;  1A8D A;  3H6S E;  2DRZ A;  2K8R A;  3MAL A;  5F8S A;  4I4R A;  4Q91 A;  3NBN A;  4I37 A;  1HWP B;  5FZZ A;  1P63 A;  1VCL A;  4QBC A;  4IY9 A;  3RTJ B;  2D24 A;  4H04 A;  3OJV A;  1TOO A;  1ISV A;  1I1B A;  4QKS A;  4P0J A;  1Q03 A;  2IWT B;  4I1E A;  2RST A;  5B2H A;  3VEQ A;  3RSJ A;  3N7M A;  1G9D A;  1ISZ A;  4HA2 A;  1PC8 B;  4Q9G A;  2LIE A;  1S0G A;  3AJ5 A;  3Q7X A;  1DZD A;  3FJI A;  4XFS A;  5JLV A;  2D7R A;  4ZBV B;  3RMX A;  5BXT A;  3FFZ A;  4ISQ A;  4LO1 A;  3AKG A;  1TFM B;  4LO2 C;  3VT1 A;  3BAV A;  3OJM A;  8I1B A;  3WMV A;  1GGP B;  4ZFW B;  1RML A;  3CA4 A;  3R4S A;  3VSZ A;  1JQZ A;  2AAI B;  2VXR A;  1V6W A;  1BLD A;  1R8N A;  3BRF A;  3AKI A;  1TWE A;  4I4X A;  1DQO A;  5F90 A;  1G9A A;  3FJE A;  4EEE B;  4OEF A;  2ZR1 B;  4F34 A;  3BAQ A;  3NBD A;  1K5U A;  5FZY A;  4HJJ A;  1G82 A;  2KH2 A;  4OWL A;  4XKI A;  1IOB A;  2NTD A;  3N0K A;  1G9C A;  2F2F C;  3IM6 A;  4X39 A;  4I4Q A;  2Y9W C;  3HAL A;  1Z0H A;  3VT2 A;  4I3N A;  3I29 B;  1FQ9 A;  1EV2 A;  4ZA3 B;  1V6X A;  1Z2V A;  4II0 A;  2DRY A;  3CRG A;  3PHZ A;  2MIB A;  5D62 A;  3CA5 A;  4XFT A;  4IZX A;  4FVV A;  1ABR B;  1V6V A;  1V6U A;  2DS0 A;  2K43 A;  2VLC A;  3RTI B;  4J2X A;  4I4V A;  2Y9X E;  3OJ2 A;  1FV2 A;  3CA0 A;  1UPS A;  4OWK A;  4R6U B;  4CJM A;  1FV3 A;  3ZC9 A;  1TP0 A;  2VXT I;  3I2A A;  3UD8 A;  1JT4 A;  3JUT A;  2QN4 A;  5BXS A;  4JAW A;  2D1Z A;  3A22 A;  4A7Z A;  1EPW A;  2IHO A;  2J3P A;  1IRA X;  4I4U A;  4LO1 C;  1JLX A;  1YBI A;  3ZXG A;  1QQK A;  1DFQ A;  3AZW A;  1HCD A;  1QQL A;  1S0E A;  1FGA A;  3FJK A;  4LO7 C;  2HWM A;  3FGM A;  3E8L C;  3ZXD A;  1SZ6 B;  1JT7 A;  3A23 A;  2X2T A;  3AH1 A;  3A21 A;  1S0L A;  4OW4 A;  3NBE A;  1DLL A;  3BA7 A;  4L4I A;  4LO7 B;  2HZ9 A;  4UY4 A;  3UJ4 A;  4I96 A;  7I1B A;  4X3A A;  4OWJ A;  3HN1 A;  1N4K A;  1DIW A;  2VSA A;  2Z48 A;  4P6A A;  3WIN A;  2NP0 A;  3BA5 A;  3UD7 A;  4ION A;  4L4H A;  3BAU A;  3BX1 C;  5D61 A;  2FFU A;  3BTA A;  1ILR 1;  1AVU A;  3O44 A;  1YTO A;  5BP5 A;  5BQU A;  1HWO B;  1XHB A;  3BAG A;  2GO2 A;  3H6R B;  3HOM A;  3FJ8 A;  3O4A A;  3POK A;  5E24 E;  3O4B A;  1AF9 A;  2ESU A;  4IY8 A;  4EFQ A;  1OQL B;  3N7J A;  1ISY A;  2I1B A;  1Q1U A;  3OBR A;  4DEN A;  1IT0 A;  4JP0 A;  3O4O A;  1FMZ A;  4H75 A;  3PG0 A;  4ISR A;  2D7I A;  3IM5 A;  3FJH A;  5EC5 A;  2DRE A;  4A7K A;  3BAH A;  3AKF A;  4END A;  4QC4 A;  2D44 A;  1RZO B;  4GAI A;  5G00 A;  3WO3 A;  1AVW B;  1IHK A;  4I4P A;  4Z9W B;  5GAQ A;  4J2K A;  3W9T A;  2FDB M;  2HWA A;  4I4Y A;  2MC2 A;  2NVH A;  4DEP A;  1HCE A;  1ITB A;  4WBC A;  2YUG A;  4EKX B;  1DZC A;  5EHA A;  3CA6 A;  3R4U A;  4USP A;  3UJ0 A;  1PUU B;  3B9U A;  3WA1 A;  4IYB A;  2Y9G A;  3IAG C;  5F8Y A;  1M2T B;  4GP0 A;  4HR6 C;  2BFH A;  3KMV A;  2KI4 A;  3FJD A;  1AVA C;  5FZU A;  4EB2 B;  3O49 A;  2P23 A;  5DVH A;  3VSF A;  3WIN C;  2RG9 B;  2KKI A;  3WMU A;  3S8J A;  3I2X A;  1AVX B;  2VSE A;  4GP3 A;  3WO4 A;  2AFG A;  3V0B A;  4FGF A;  2Q3N B;  3VWC A;  3RMY A;  2WBC A;  2D43 A;  3CRH A;  4DCK C;  5I1B A;  1BA7 A;  1Z4S A;  1EVT A;  5DSS B;  5BP5 C;  2FFV A;  4JPZ A;  5BQU C;  5BOW A;  2P39 A;  9ILB A;  4I2S A;  1WBC A;  3IIR A;  4J2Y A;  4J23 B;  1S0C A;  3FJJ A;  4IHZ A;  3BAD A;  1AXM A;  3UDA A;  1W3F A;  3CQA A;  3CAH A;  1EYL A;  3Q7Y A;  3VT0 A;  3F1R A;  4ZGR B;  3MPP G;  4I0Y A;  4P0L A;  4JRA A;  1XG6 A;  1FN0 A;  3FJF A;  3AKH A;  4MZF B;  1PZZ A;  2R9K B;  4Z8S B;  1WD3 A;  3D7W B;  4LO0 C;  3N7K A;  2BEB A;  3P6I A;  1HWM B;  3HBW A;  1R8O A;  3AZV A;  1W3A A;  4JKQ A;  2AXM A;  2HW9 A;  3UD9 A;  3BRG C;  2AQZ A;  4I4S A;  1YF8 B;  4KEJ A;  3PUB A;  1BFC A;  6I1B A;  3HSM A;  1PUM B;  2XOA A;  4IQP A;  2D23 A;  1FWV A;  4MZG B;  1S0B A;  4KEI A;  5BXP A;  1IIL A;  3FJ9 A;  3ILA A;  4JQ0 A;  1DQG A;  21BI A;  1XZZ A;  2E4M C;  2NZ9 A;  1NZK A;  1G9B A;  1JT5 A;  1SR4 C;  2K4A B;  2Q9X A;  1DFC A;  1IJT A;  1JT3 A;  3CA1 A;  4D8H A;  4AN6 A;  3OGG A;  2LIQ A;  4OEG A;  5FNW A;  1YXW A;  1S0D A;  3HMY A;  1XYF A;  4OEE A;  4J2S A;  1II4 A;  1I1E A;  3EF2 A;  2RQ9 A;  3S8K A;  4LO8 B;  4I7I A;  5DUY A;  4F83 A;  3V0B B;  3H6Q A;  3WO2 A;  1BAR A;  4USO A;  3TC2 A;  1AFC A;  2M49 A;  2D20 A;  1L2H A;  3O5W B;  4QKR A;  4EFP A;  4KBB A;  4GAF A;  5FNX A;  1ISX A;  4P0K A;  3CU1 B;  1YYN A;  2X2S A;  5EG6 C;  4PC4 A;  4TLP A;  1T4Q A;  1TWM A;  1Q04 A;  1CE7 B;  3BRD A;  2NS2 A;  3CRI A;  1JTC A;  4LO0 A;  4KC3 A;  4QO3 A;  1BLA A;  4ZFU B;  2FGF A;  3FUQ A;  1HKN A;  1WD4 A;  3IM7 A;  1MD6 A;  3V0A A;  3FJB A;  1NUN A;  4QAL A;  2FO1 A;  2QYI B;  4LO3 A;  1W3G A;  3JRR A;  2KLL A;  1ONK B;  3FJC A;  4ZFY B;  4ZLB B;  31BI A;  3K1X A;  2E4M A;  1CVS A;  1D0H A;  4ZOT A;  3BAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...