4QAMB

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
187
structure length
180
Chain Sequence
DSDDVIVPPMDSEKMCIEIVSLAFYPEAEVMSDENIKQVYVEYKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords X-linked retinitis pigmentosa GTPase regulator
total genus 39
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18111 RPGR1_C Retinitis pigmentosa G-protein regulator interacting C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4qamB00
3QR1A 4L1BA 4PS8A 4TS6A 2R83A 3L16A 4A55A 4MJJA 3HIZA 3P2BA 2EP6A 2CM6A 2ENPA 4NP9A 1E8WA 4F93B 4FHKA 4OVUA 2WXKA 3T8MA 2JQZA 1WFMA 2N1TE 4V11A 5H4ZA 4QJ3B 1V27A 5JHAA 1DJWA 1E7UA 4G11A 4LDCA 4QJ5B 3QR0A 4LT7A 4FHJA 2V4LA 2WXHA 4KZ0A 2WXRA 4L23A 1K5WA 2WXGA 3N5AA 1DJXA 2KI6A 2K45A 1HE8A 3PRZA 2UZPA 4GNKB 4PS7A 2RD0A 2K3HA 3TJPA 4ANWA 1DJYA 3HN8A 1DJIA 3ML9A 3ENEA 4L2YA 2CM5A 2ENQA 2BWQA 3L13A 3M7FB 4WWPA 2Q3XA 4BGDA 2ENJA 4NPKA 3RPBA 3QARA 2CHZA 2FK9A 4F92B 2Z0UA 3F01A 2CHWA 3ZW3A 2WXQA 2WXNA 1A25A 4FJZA 3B7YA 3NSJA 1YRKA 2QZ5A 5H4YA 3L17A 4IQHA 4TUUA 1CJYA 1E7VA 2FJUB 3MJWA 4IHBA 2NCEA 4ANUA 4FA6A 4PS3A 4URKA 3ZVVA 4LCVA 4DK5A 5EDSA 2NQ3A 2WXOA 3F04A 4NPJA 3R7RA 3TWYA 3W57A 1TJXA 4OVVA 3L9BA 2CHXA 4DNLA 5T8IA 5CCHE 4EZLA 4XX5A 4Y1TA 3GPEA 4QAMB 4F91B 1DSYA 3NZSA 2B3RA 3LJ3A 1E8XA 4FLHA 1E90A 2DMGA 3PS6A 4EZKA 3OAWA 4JPSA 2Y3AA 2YRBA 3L4CA 4WAFA 4XZ4A 5KJ7E 5CCJA 1BDYA 1UGKA 3OHMB 3ML8A 1DJGA 3DBSA 3PYCA 2DMHA 3FDWA 1RH8A 1W15A 5G55A 4EZJA 3FBKA 1TJMA 3KWUA 4KZCA 4FULA 4TV3A 5CCGE 2CJTA 3SD5A 3QJZA 4WWOA 3F00A 3QK0A 3NZUA 3APDA 3QAQA 4Y1SA 4AOFA 4BFRA 1DJHA 3DPDA 1UOWA 3R7QA 3IBEA 3W56A 2A5UA 1DQVA 2X38A 2YOAA 3CSFA 4FADA 2CJSA 3L08A 4WWNA 4ANVA 2A4ZA 1DJZA 1E8ZA 4NS0A 3APFA 3KWTA 4J6IA 2QZQA 2WXFA 3PREA 5JHBA 1GMIA 2Q0ZX 2NSQA 1RLWA 4HLEA 3S2AA 2WXIA 1RSYA 2CHDA 4FJYA 4ICXA 4XE0A 1BYNA 2WXPA 2D8KA 2WXMA 3IM1A 3L54A 3ZIMA 4L1LA 4QJ4B 3TL5A 4AJWA 3CSTA 1BCIA 1QASA 4GB9A 2ISDA 2ZKMX 1WFJA 3F05A 1E8YA 3HHMA 1QATA 3PFQA 4ICWA 4KITB 2WXLA 3JZYA 4WEEA 3APCA 5G2NA 4HVBA 2K8MA 2WXJA 3RDJA 4ANXA 2K4AA 2LHAA 1UOVA 4F1SA 1W16A
chains in the Genus database with same CATH superfamily
3ZDXB 1A3RH 1NLBH 5E8NA 1SOXA 5AAPA 4Q4EA 5E8EB 3ZOAA 1SBSL 4HS8H 3BPCB 3RX5A 5I30H 2QPSA 4GRMA 2Y6SC 5E1IA 4YHZL 4WENB 5HGBB 1A6AB 3GSOB 4I7ZC 4N0RA 1VGEH 2XVLA 3P3SA 4N25A 3UEZA 1QFOA 3C8KB 4FP8L 3U36B 3TX4A 5EHFA 4KZ0A 4ZO8A 2PR9A 2AJ3A 4AQ1C 5FFLA 1BZOA 4Z6AT 2VH5L 3QUMA 4ILDA 5IMKB 3ZDWA 1O7VA 4L5FL 3MNVB 5DRNB 1XGTB 4KRPD 2NY0D 5L2KB 2DWDA 3QFJB 5DJCB 3UGUA 1YDPB 1CI3M 1EEYB 1JF1A 1S7SB 4F7PA 4FZEH 4ONGH 3U0WL 5E5LA 2VDNL 2DJ4A 1GGBL 3ERXA 5HDQL 1RZPA 4RVBA 1WQVT 5DHYB 5IBUB 2O61B 1JWMA 2F1AA 1V7MH 4G6AC 1SHSA 4IOIB 1YMME 1IAKB 3FUKA 4G8EA 5K39A 5I73B 4WO4A 2GAZA 4K5PA 3V0HA 3A4FA 3DX4A 3OSKA 2Y5QA 3H2PA 4JRLA 4MZ2A 1LE9A 1Q0XL 4J8RB 3V6ZA 5GS1B 1N8ZA 1VRSA 3U82B 3LKQB 4M6MH 2YRLA 2ZXEB 3WY3A 3CXDL 1EAQA 1QPPA 2ARJB 3GRGA 3BRDA 3DBSA 1OCWH 5ITBH 2YBRB 1FPTL 2NYKA 3DX8A 3N1QC 3W2DL 4M7LT 4K3JL 3QDME 4PJ7A 1TQCB 2EEXA 1HIMH 2W60A 1DANT 3KLLA 4NN6C 2VQ1A 1T83A 3V0VA 1NANH 1JZ8A 1T2QL 2VZUA 2NRDA 4Y19B 1ZOXA 1CDIA 3IU3B 3QYMA 1KGCE 4BK8A 4CBZA 1UG9A 1Y18A 5DFAA 1WFNA 2WKLA 3TBYA 1MCSA 4AYEC 2X2JA 1JPTH 1GS8A 3EFOA 1CR9H 5AL0A 2WM0A 3REWA 4Y8DC 1YEDA 2Y4SA 4ONFL 3UTPD 1UACH 4PV1C 3NCCB 2H0JA 4MD5B 4MTMA 3NQKA 4JRFA 4X4YB 3DO7A 1LDPH 3L9YA 3F7YB 3NFPA 4EIUA 2J6EH 1KJ2L 2XDHA 3ARYA 5ICYB 2AJYL 1CFSA 1H9DA 1QLRA 1WIUA 8FABB 1IO4C 1NCDH 4RAUB 4WO0A 4MNGA 3VFSB 4CVUA 3ESNA 2CBTA 3HC2A 4OF8A 1MCDA 3T2QA 2V2TB 2JCCA 4WTWA 4QNPE 1YLBB 2F61A 1OF0A 4Y2OA 4RGNB 3RFZB 1OB1B 1H8LA 5L2KE 5C1MB 3LH8A 1KNOB 2HPOA 5E2TH 4FG4A 4GRLD 1N3NA 4XN1A 5HGGS 1VIWA 1IKNA 3QVAA 5E1QA 3RIKA 3PGDB 3HRZA 3MR9A 3GSXA 4Y4HD 4ZDHB 3MV01 2BHUA 4LHUA 5GS1A 3DUUA 4MNQD 4MKMA 1CZ8L 4AW4A 1XH1A 3CAFA 2RB8A 4J6RH 4D3CH 3O6ML 2XSKA 1OGAD 4ODVH 5C2UB 2ZP8A 3TJHC 4D7PA 5BVJA 5B8CA 3MLSL 4HOZA 1J5OL 4YDKL 4QOKB 3F01A 5HI3D 4NKIL 4D8OA 2AEWA 2DJMA 2P28B 2XVGA 2HT2C 2A6JA 3ULUL 3DTUB 4YHLH 3X12A 3GIZL 4BD4A 5J9PB 5EU3A 4XX1E 1J8SA 2I60L 4LBEA 2A9NL 3WL9A 1DLHB 5TK2A 3BE1L 3WIFA 1JDDA 1SDYA 2OS7A 3Q2WA 4FHBD 1QYGH 1MHHB 3LVTA 4U4BA 2FHCA 1JF1B 4ZS7H 3LJ3A 3QSKB 3NCFB 5FF6A 3SKNB 2X70B 4G9DA 3A6CL 3D4CA 1KYOK 2Y0SA 4FXGC 4N9OB 3PYCA 4XNMB 3PDOA 3L3IA 5D8JH 2ZXWB 4QI3A 2B2XH 2OL3H 4BHUA 4JFXA 2D0HA 4D8PA 3JWNG 3TYFB 1KEML 1NFAA 4S0TD 3D6GA 1UM4H 2C9PA 5ANHA 5EIIB 2GCYB 4NM4L 2E9WA 3EOTL 1WBYB 3CN1A 1R17A 1ZA3B 4NNXA 3ZGIA 43CAA 2YAEA 7CGTA 1UWGL 1C08A 4RX4A 2MCG1 4XGZA 4YC2C 3O81A 2VC2H 2HVJA 3PREA 4Q9BA 5ABDE 4PGBA 4E9XA 1XH3A 4R26H 5HHQB 1LO0H 2FUTA 3B9AA 4Z7VA 4UTAA 4PVBA 3FZUD 3VD1A 2J5LC 4KUCF 4ONOA 1V7NL 3UG3A 2ICWI 1MFAH 2ZOOA 4RRPG 4A6YA 5DA0B 1M2VA 4DP4X 3VE0A 1DQKA 3IXTA 2AXFB 1QW9A 2WXLA 4KDVA 1S7XB 5HHNB 1Z9MA 2EZ0C 3OX8A 4M8UA 2FBJL 1KIQA 1XCQB 3WENA 1HH9B 2Y2YA 4AH2A 5E2UL 1QNZL 3ZRSA 3DHPA 3SQRA 4W9HC 5FR3A 1QX1A 4FQCH 5FO9A 2YD8A 1YA5A 3MRMB 4JRYD 4MMZA 3FQTB 4PPTA 3GRWH 4PJAF 3ZT7A 4N2GA 4AEFA 2CXGA 3GINA 5K33A 3PE9A 1ZS8A 5E99L 3QA3B 4JZJA 2VE6A 1I8MB 5DD6A 1VFBB 2BNQA 5HPMB 1N18A 4PTUB 1JNNH 4AIZA 3SDDC 1BA9A 4JO1H 1BZ7A 2XPYA 3IMWA 1QSFA 2OXHA 3I3BA 1G1OA 3MRNB 2J8OA 4WCYL 3MNVA 5DRNA 5J56B 3GPSA 2WW8A 4HLZH 3M1BB 3GDBA 2YEZA 4JKPH 2VM3A 3UZQA 5DA4A 4X80H 4HFUL 1IC7H 4MRBA 4B27A 1X5YA 2K7QA 4QWWC 1H8NA 5ESQA 3U30B 2ZG3A 1OAKL 4U1MB 3QIUD 3M8OL 2ZPKL 3RE0A 3U9WA 2RJMA 4HKXB 4NB7A 2VN3A 3S8GB 1TDQA 2EDYA 1T7XA 4MD4A 3VGGA 5KVFE 4M9PA 4WU7B 1TG8A 5BO0D 3CTTA 2DL9A 3L45A 3K5RA 4P48A 4U6TA 2WJ5A 3RWGB 2HVJB 3TEZA 1O6VA 5JHLA 1XGPA 3NYKA 4MMXC 2GUYA 3VXSD 3GPEA 2DLFH 3MJ6A 3QDGE 4BZ1A 2DIAA 5GZOA 1W8NA 2HCZX 3QWOA 3FT9A 1NCOA 3MNZB 1RZFL 1U91A 5KJ7E 1IM9B 1AS6A 3QORA 3B5HA 5HDLA 2WTPA 2JVUA 2GT9A 4JQXC 1FNSH 3F12B 3GD1C 3NRFA 4K71B 4P2OD 3CZGA 5CLTA 5DMKA 5GRUL 2VISB 3VD9A 4GXUM 4HT1L 1X7TA 4R4NC 3S8FB 4AEHH 3HZMA 3A24A 3T3ME 5DVNA 3ROLB 1S7TA 4YHML 3V0JA 5J7CC 2WQXA 3UTQA 1FAIH 2VIRA 3S3BB 3HVDA 1OT4A 2R2BB 1KTRL 1W72A 2FX9H 2JXMA 2XX0A 4UQ3A 5I1AA 1I1CA 2Q7YA 3T1WA 1QSEE 4NKOA 4HIIA 3NAAL 4M7LL 3UMNA 3V4PA 4ZBJA 2XV2A 3CXHK 3OWEA 1IAIH 1T80A 3SDXE 4BA8A 5HDBB 1AACA 3GHBH 1ZWIA 4X6CA 4PG9B 1L9TA 1RJCA 5LJYH 3L48A 4J2QA 3UTTB 1S7UB 4UQCA 3IDNA 3FN0H 1GC1C 2ZNXA 1NAKH 5BQ7B 5FGBC 1C5CL 1C5DA 3IFOB 4WI6A 1OSZB 5DEFB 4BCZA 5K9KA 3O3AB 2PKDA 3QXTA 4HUWA 4OFDA 2FLMA 3QXAA 1W80A 3H7BA 1OAYL 3NPZB 1J87A 3C12A 3B1TA 1UT1A 25C8L 3QUYC 4CN4A 1WFIA 4Z78A 4A7SA 1SF3A 3L6FA 2VDQB 4TSCL 2UZXB 4IRSD 2CO7B 2OMWB 5C71A 1GY2A 1TIUA 3IAQA 4H26A 4L4TA 4HV8A 2YGQA 3HC0B 4OGXH 4ZRGA 2ITEA 5IREA 3NCEB 1SEBA 5D2LF 4O02A 1A9BA 3ECBA 4MSWB 1H6EA 5FGRA 3INUL 3QUXB 1MHCA 1MCCA 5IM7B 4MCZB 4KKLC 4LP8A 4S11A 1AVAA 3T3PB 3QUXA 2CQVA 1O6SB 3V6FA 1EZSA 1ZTXH 3AG4B 1TO4A 2W95A 2IQ9H 5EOQH 1SBBA 3V7MA 1W6WA 4UOJA 3D85B 4YSQA 4MZRA 4BQ9A 3TURA 4LGSB 2F18A 1X6NA 3MLVL 2V7NA 4EMZA 2VDPH 1AI1H 3WNOA 4LEOB 2QMKA 1U9KA 2CZNA 4R4FL 4GAFB 5I17B 5D7HA 1CGSL 2XRAH 4JFEA 2P24B 5EU6A 4JFDB 3CZEA 2QGDA 3FFCB 4FQHB 3NFNB 3RAJH 2W5PA 2LU7A 3B2DC 3MLUL 2P7TA 4FFYH 5CM1A 3UOAB 4ZXBC 4ZTEA 5D70L 1SBSH 4HS8L 3OMZA 4B9KC 2V5MA 4R7NA 4LSQH 3UIYA 2FWUA 4PJ5A 4AM0A 1N0LA 3MKKA 1J88A 2C9UA 3FT1A 4D9LL 3CE1A 4PLKC 3VRIA 1E43A 4WEBH 5ANMA 3RL1B 4JFZH 2ZWYA 3JSSA 4NIKB 3F00A 1MHCB 4O58L 5G4MA 3FCBA 3X14A 4FXGB 3NJGA 4NJAH 4BFRA 1FRGH 2DWEB 1DQVA 2FEEL 2R1WB 4Q9CA 5AZEL 3JVGC 4XMWA 4FZ8L 3CZSA 3RGVD 1PZDA 5C0NC 3Q01A 4C4KT 1J5HA 4OKVA 2BFVH 3BHBB 3FK3A 3CVCA 4ODTL 1TPXB 2WTRA 5KANG 4AGLA 1PLGH 1BGXH 3WTYA 2VMCA 2YD0A 4LHUB 5AW9B 1UZGA 4UOQA 4Z5RA 1FG2A 1ZJBA 1B9KA 3GBEA 2CKBA 4FMKA 1INQB 4LSVL 5I6LA 2BWDA 5FDWB 3FU7A 3MQIA 1QSEA 2E56A 3SKMB 4KKZA 1ZLSL 1J9CT 3T3PE 5GGRB 5JXED 2C3GA 3DNKA 3G7TA 3U36A 3L2LA 1FZOA 4PW4A 3FCGA 3KMDA 3D39A 3HBQA 4CKVX 2FX9L 1CF8H 1DVFA 3DGDA 4NNYB 3WLWC 1N68A 5CR8A 1XIWD 3NJKA 1HFUA 5K9JL 1BXXA 2WZ5A 5T3XH 3ARDB 4Y1AB 4NCC2 3VNZA 1HZLA 5C97A 4Y16C 4LEOA 4HULB 4J27A 5I1CH 5E4EB 3CQQA 4LVHB 4R5XA 3EGDB 3SDYL 3D5OF 4PQXA 2JCCE 3SO3B 3F83A 4OCYH 2FX7H 3O6LL 3EH5B 4JM2A 5DZAA 2VXUH 4IJTA 4G80A 4Z7UF 3AGWA 2HLFC 4A7GF 2X4OA 3BC9A 1IB5A 3WEXA 4Y1AE 5EU7C 1FYTA 2VXVH 1ECZA 1YPZF 4MXQC 1PFCA 2ZSVB 3FH7A 5TTRA 4X50A 4OFKA 5D93B 1L7TL 1ETZA 4IEFA 2PO6B 3RWIB 4EVNB 1CGXA 5F7DB 4OJEH 1CZ8H 2I9LB 4EI5C 3KL3A 1ZS2A 1SHWA 3ZZSA 1TEYA 2LU5A 5C0GB 3KBEA 3QFDB 3QYNA 2XA8L 3B4NA 3QIBA 4XTRC 1O5DT 1ODAA 3D51A 2IDCA 1XV8A 4NHUB 4HV8B 4YHKL 3LRKA 5FWRA 4G7RB 4MA8L 5C9KA 1HOCB 2PXYC 2FE0A 3KWWB 3WFBL 4BELD 5JQIB 1RULL 2XN9A 4QYOB 1T2JA 1E4XH 1F4AA 4F8LA 3BDYL 1G7QB 4KQ4H 4X6DB 2XT1B 5DD5L 5EOCL 3S35L 3MGTB 3TPKA 2MWCA 2I60H 2DLEA 1U3HB 2CJTA 2C4FU 1LEKB 2H26A 5EZIH 1TYEB 3D25B 2QQKH 1K8DB 2X89D 5IESH 3ILPA 2YLHA 1KULA 3MFFB 3R0NA 2GEQA 3TEXA 2FJFA 3HG4A 5SX4H 4HJGA 4X98B 5DRXB 3FQTA 4KI5D 4LPUA 2Q86B 3QNFA 1M05B 2GK2A 4X7SH 4OZ4A 1PKQB 1HINH 5DHEA 3UBXI 1UD3A 3QDJE 2W94A 5I26A 1F97A 1H5BA 1YQVL 5G4OA 5CJQL 1Y0LA 1F5WA 4N6RB 5TJWK 2OMUB 3IETA 1BOGA 1IC5H 2FIKB 4GXVL 2OTWA 4P23C 3TH2T 3ZDZE 4LHQB 1N7ML 2ZOLB 3CH8A 3JWDL 3WJLC 4RGOH 3D4GA 5JTWA 4KMLB 4JG0L 2R83A 4Q2ZB 2F8XC 4FGMA 4Y19D 4ELMF 5DJDA 1FVDA 4MBOA 3OKEB 4KKLD 4ALAC 1FRGL 2WKOA 5L4FA 4KQ4L 2GJPA 3ARVA 3I9GL 5MHSD 2WZAA 1XSJA 3V6OA 2W65A 2J8UA 3TPUA 2BMKB 5TE6H 2C3VA 5F7HA 1MRFH 3QUXD 1T7YA 2P1YA 4MBRA 4QRBA 3MRGA 2K3HA 3C60B 4F2MA 2XN9B 4TSAL 2NSMA 1KBWA 4KUCD 2X53A 4HJSA 5BJTB 4JB9L 1D7BA 5IROC 4KX9A 4NX0A 4PJXB 1MIEL 3ARSA 2Z8WC 5EBMA 2CHWA 1CURA 3KDPB 3I9GH 5BZWA 1A25A 2E75C 1GVIA 2IGTA 5CSZB 3DXAB 1DYZA 4CU8A 1MHHA 3FSVA 4BCYA 4QRPD 4M48L 1UJ3C 4MS8C 4TQEL 4UTBL 1PVHA 3GB7A 3NJIA 3P4MA 4QF1A 4FQIH 3PWNB 5ES4B 4GSDL 4N85A 4GKNA 1BM3H 1BZDA 2DQCL 4NFBA 3I75A 5FV2A 4OT1L 2XWTB 2BVPA 4QXUL 1VGEL 4UB0H 1CE6A 2V5TA 3RVTD 2NXYD 3BP6B 2ZWZA 4QRUB 5E56A 2NNXA 2XWRA 4JRXB 2I25N 5D7JB 1TZHB 1UGKA 2GYSA 2X0VA 4Z7OB 2NQCA 4JFDA 4TM9A 3H9YA 1U8LA 3EO9H 4D3CL 3NK4A 1QVOA 3VWJC 3RFRA 3L3DB 4X6FA 5CSGA 3VQ1C 2C9RA 2CLZA 1T1ZA 3H42H 2ICEC 4LDLB 3VFGH 2GC4C 3TLRA 4A04A 4OT1H 3A4DA 2FX8L 1FPTH 3CK0L 1T4WA 3O4LB 4OQTL 5HHOD 3K4DA 5I73C 5EO1B 1YEJH 4WV1C 5EO9B 2JJSA 1E5UI 1DO5A 4X99A 1U8JA 4ELDA 4XVUC 3SPCA 1MFNA 4K94C 1AXTH 1I8KB 4QEGA 1UTDA 3VSVA 5C0EA 2CU9A 2VZTA 4HKBB 3FL7A 4OJFL 1JPEA 3IF1B 4O5LL 2X1XR 5CEXA 1NUGA 4O02B 4YWGL 4Q52A 4GIPD 1BQLH 2OI9B 4MJ5A 5CUSL 4DGYL 4ZUWB 5B3SB 3WFBH 2DYPA 1A6WL 3LQZB 3BP7B 2VMJA 3IJHB 4JCLA 5F9OL 5CAYB 1BM7A 3WO4B 4H20H 3HIZA 1OF2B 1SLWA 1H8OA 2E7DA 4JFQB 3UG5A 3ZTJH 2PCFA 5IHWA 1KJ2A 3CQFA 3POCA 5E5MB 3BAIA 1K6QH 4AQOA 4H2AA 1G7MB 4FXGA 4DVBA 4FQQA 3EFFA 1ZT7A 4CGUB 3NA4A 4JMNA 1JSYA 1ZCRA 5E6ZA 3Q8FA 1N59B 2EE6A 5IW3A 4ELKA 5A2KH 3WXWL 4TPRH 3ZYIA 1T1XB 2F7RA 3ARWA 3EJPA 4DK3A 1SEQH 9CGTA 1XF2B 4R7DA 3MUZ1 3RA7L 2E4TA 3QUHA 3W81A 3NJVA 4X5XA 1KB5H 4G7VH 2GSGB 2RH0A 1A3ZA 3DHUA 4GSRA 3E1ZA 4GW4A 2X4UA 4P4RB 3BAEL 1ZSDA 5HYJA 1MVYA 3ZKXB 4UILH 1PU0A 1JRHH 4OY9A 2XZCL 1PD0A 4LVHC 4K3DL 4MHHI 5H4YA 1YRKA 3BYTA 3MA9H 4RGNC 4Z7NE 2YR3A 3WO3B 4TUJA 1OP5H 3SKOA 5TDOA 4PIRF 1N6QH 1FLTX 2AV7A 2BY3A 5CUSH 4DGYH 4PRHB 4NUGH 5GS0C 2ADGB 2P8MA 2V8LA 2GITA 2DDQH 2VM9A 3J2PA 4ANKA 4PJIF 5J11C 5E6YA 4UTAH 3ARFD 4XC1L 2CHXA 4KROC 1QAWA 1RP9A 12E8L 3I50L 2PO6C 2VERA 3QFJE 4OZFH 2WNWA 4KK5D 2ZWSA 4LLMA 5CZXC 5EO0A 3ZHLA 4APQA 4BFEA 3WY1A 4JFPB 1WC7A 1XB8A 5E6IB 3ZDYE 1SHXA 1BVLA 3KM1A 4PUBH 1PS3A 4FYTA 4OCXH 4W4OC 1A4BA 2P5WD 5JW4R 1JTTA 5JDSB 4ZNEE 3FB8A 4QTFA 3W3BA 3VWKB 3L9RB 4PJ9A 3CDYA 1EVTC 5D2NB 1S9VA 3CVHH 5LAXB 3HBZA 4DWHA 5KSBB 1A4JB 3EJZC 2XWTA 1E65A 4WWNA 5ESQB 5EZPA 1OTUC 2EEBA 1FDLH 4FNTA 4MASA 1J12A 4NKQB 1IBGH 4E9QA 1UQSA 1SFHA 1NC2D 3D69A 2DBLL 2D8KA 5K9KB 4RMVA 1LD9B 4C56B 2MTPA 4HBCL 2FYYB 3QUYB 2AJSH 4QXWA 5DVMA 1S9XB 5A2LH 4I8DA 2YK1L 1T0MB 1B88A 3PJLA 3KWWA 7TAAA 4NBXB 4DN3L 3U46B 3FUNA 3OHXB 5I6MA 3UTZB 5E0QA 3F62A 3LSOB 3RY5A 5L6YL 1JXKA 3TO4D 1L9OA 1OM3L 3FT0A 1T3FB 1NBVH 4DFIA 3F12A 2XA3A 2Q8AL 1HX0A 4FHKA 4ZOAA 1QBLH 4F15B 3ZZ1A 2XZZA 4I1PA 3B2XA 2KKQA 2VERN 2AJUH 2PF6A 1XF1A 4JQXA 4NQDD 4RLDA 1U6AL 5AW3B 2DWYA 1KYFA 4NC2B 1XO8A 5FW6A 1GCFA 2WSPA 3HFMH 2GT9B 2RAMA 4GG6E 3BZEB 3ISWA 4JFOB 1Z3RA 2AV7B 2V6HA 3LNIA 4AYGA 2OM5A 4JL1A 3FU8A 1LL1A 4GG6B 1FDLL 5AB9A 1P0SE 3ASNB 2HFEB 2ADFL 3O11A 2ROYA 2EYTA 5EA0H 4Y0GA 5GGSB 1KXTA 3B7YA 4X6BB 4B3VA 3UPAA 4CAGA 2NY6D 4JW3A 4ZXBB 4KTEH 3GHPA 4OR1A 4KKAC 5IF0A 2AI0H 1BZQK 1XF2A 3AS2A 4BZYA 3FN9A 4XNQB 4TUKL 5HSFA 2X2HA 5FYKE 4KGLA 4MB1A 3NZ8B 2YPVH 4J1UA 5I1DA 3CD4A 3BZFB 3QUYA 1R47A 3OKMA 3G6JF 2CUHA 2D31B 2V0AA 5MI0B 4UT9L 1I7RA 3KXFA 4YGVA 4HKJB 4A2DA 3C87A 1EDQA 2AGJH 4IKNA 2PP7A 4QUOA 4FKKA 1XCWA 4A2GA 3VXSE 2IPUK 1IE4A 1E3XA 2LGNA 4F7EA 4CMHC 4OKVB 4A2EA 1ML0A 1UZ8A 3WTTA 4QXTB 1ID5I 3VGAC 1CXKA 1FNSL 2XZCH 1KCLA 3P9LA 3O9WC 3O6LH 2WPGA 4GI6A 4F7CB 4CC4A 4Z76B 5KS9F 2HG5A 2B59B 5IJKC 1I8KA 4M4RB 2ZOTA 1YMHA 3EOAB 3Q48A 5KBPA 4S1DC 4LBAA 4GUPB 4HJ0D 3QDMB 3N44F 4PGBB 4EIZC 4ADIA 5IB4A 5EO1A 4LPYA 1GZHA 5AZUA 5CP7B 2DLFL 1HNYA 1T21B 2IADB 2YC1A 3JZYA 5CIPB 1C5BH 5DWUL 4PJ5E 1FNAA 5FYJL 1KJMA 4Q89A 3RGBA 3VXME 3L2MA 3LH2H 2H3KA 3KPQA 4M5YH 2JF1A 4ZUUA 2LT9A 3CHXA 2PO6D 3MLTA 4U6VH 3EDKA 3QPXH 2W9DH 1RZIB 4JDZB 4Y4FC 4MFHA 2OI9C 4PJ5B 4AM0B 1B0RA 3IDMB 4JFEB 4Z3EA 1KC5H 1RY7B 2BVQB 4FFWD 4M1CC 5SWSE 2D3VA 4ZFZA 4EDXB 4EI6B 5IB2B 2WJ7A 1N67A 4NFDA 1OARL 2J3SA 4M61B 5A2JH 1VENA 3NFNA 4NUMA 3W11D 4FXKA 4R3SA 3TYFA 2WUBH 4N28A 5ISZD 4LARL 1BEXA 1FO0H 1L9RA 4BK4A 5DUPL 1C1EL 1OVZA 4GNKB 3BVVA 2BH0A 2PR4L 5KJ4A 3VDBA 1LO2H 3ENEA 1C16A 4FP8H 4PGZA 1KEGL 3D2UA 5CZVH 3ZQWA 3FN0L 2JQAA 1E4JA 1NM4A 3JWNH 3ZDYF 1S9KC 4UM8A 3T4YB 3T65B 3SY6A 5D4JA 4X2UA 3Q2NA 1AR1D 4RFEA 4LSVH 3GJFA 1Z5LB 1AXIB 3ARTA 3JWOL 4GLRI 5EEYA 1XXFC 3C2AL 1GGUA 3FU5A 3R4RA 5KAQF 1ZHBB 3ZTCC 3ZVVA 1B0GA 4PRHA 2DQIH 4AMXA 3G5ZB 4ZFQA 1OSPL 2OJ1A 1CO1A 5LWYH 3UIZA 2C3VB 1KIUA 3V4LA 3FQRA 5F2FA 3N1MC 3QC6X 2HH0L 3QEQD 4H1LB 4HMCA 4FKHA 4QXTA 3WS6A 1U3HC 3HTLX 1AMXA 2G30A 3MSPA 1KELH 3NIDB 3TEUA 3IKCA 3OHMB 3IJSA 3RY4A 2OMZB 1KSRA 2GTZB 3BLPX 2WP3T 2WN3A 1ZRUA 3UBFA 2P5WA 1AE6L 4KNSA 1CCZA 3HC4H 1TITA 3PGFH 1I3VA 2VAJA 4GSDH 2Q8BL 1RU9H 4LCIH 3HE6D 4UIKL 4F7TB 2NNRA 3JV6B 3ZE0E 3FMGH 3B56A 1UOWA 5D1XA 2HJLA 4AL8C 5ITBL 1VERA 3GHEH 4K3GA 2UY6A 1E28A 5IQ7H 4K5MA 4LCUA 1RZ8B 5FO2A 4LO9A 4L8DA 1RLWA 2WZ0A 3AQXA 1I8AA 3G3LA 3S2AA 4KXAA 4HJJL 2WIIA 5KSBF 4M43H 4RGMB 5IV2A 1U8PA 5INDB 3OAYK 4TUKH 4K5NA 4A6YH 3AU1B 3HZVB 4MJIE 1JZ5A 4HLZG 3D9AL 1AY1L 3GI8L 1AO7B 1N6UA 3TOPA 4AMKH 3S34L 5CD3B 4M61A 1AZNA 3D39E 4ZFGH 5JNYA 4L8CA 2GTWB 4GBXD 4XR8C 5CGTA 1FH2A 4NQEE 3LZRA 4N2LA 3ELAT 4XZUB 5EH1A 1G9NH 4NHCL 1BPVA 1OCWL 2Z7UA 4D2NA 1DHKA 5ITFB 3RU8L 4LSSL 2XWJB 4L29A 5ICZA 2SEBB 3I2CL 1U91B 4MAUH 1HHJB 4LKXA 1RZJC 3SE4A 4UQIM 5CJOH 3MROB 2RQ8A 4M6NL 4AE1A 4UYQA 4AMKL 2C9QA 4JHAL 3WIAA 5E1AA 3LRHA 5FYLL 1RK0A 3EG9A 1BQHA 3A3YB 2CO2A 5EC1A 5IHZB 1I53A 5I1KH 1I9IL 2QJDA 4GS7B 3L5IA 4XOBA 5JW3H 1CBVH 2UZPA 1XGYH 3ILDA 4ORGA 1KGXA 4YK4B 4Y4KA 4WI7A 4I48A 3V9EA 2R51A 1J9SA 2X0UA 1ZKAA 5E2WH 3BH9A 5KSBE 4HUMB 2FHFA 1C5DB 3NEEA 3ULVC 1E2WA 3BP5A 3ESOA 1GCYA 3WMPA 4IRSB 3UTPE 1R24B 1NQBA 3HMXA 2KERA 3QULA 3ZXAC 2EH7H 4Z3HA 5IGXL 1OIOA 3I75B 2ATKB 3G6AA 5DSCB 2JLPA 2ZONA 1GIGL 4TPRL 4AX3A 1UJTA 1DEEA 4FQPA 2OXHB 3MNWA 1ZAGA 4IKJA 4O9HH 4NZUH 3V0AC 4ZMVA 5DJ2B 2YAMA 1I8LC 3RI5K 4YDIL 4YSOA 4ETQA 4KH2A 3ABZA 4N6RA 1E90A 1UUSA 3EO1B 3RDTC 3VWKA 3FB6A 3L4XA 1OAUL 2DLTA 3EHBB 3TFKC 1E9OA 3HI1B 1YNLL 2Z91A 5AAMC 4ODSL 4ONHA 5EZLA 3BRGC 3WUZA 2VZSA 2NY3B 5H35A 3TEWA 3PF2A 1J1OH 4RDBA 3O2DA 5F7NC 4AEIL 5FYLH 4LDEB 5EC1B 3RJOA 4GRLB 1IGYB 2FX7L 3GUTA 3OKOA 1P5UC 3B2MA 3SGJA 4HG4J 2VR7A 4LPTA 1AYRA 3SKUD 3ETBJ 4NNXB 3TZVB 43CAB 2EDBA 1BXAA 3FHAA 3MROA 3N0PB 3MJ9H 2NSQA 4FOMA 4OBRA 3TBVB 4Y4HA 1BWWA 5DMGC 3N9GH 3QZBA 4OCXL 1UXWA 5D4QA 1JGEB 1U3JA 4UYPA 5IOPB 2WBJC 4AEIH 3T0VA 2B15A 1DZ0A 5ENWA 4KAQH 4KDWA 4JFTA 5D1ZD 2CLVB 1LE5B 1DUZB 5BS0D 2BVUA 1JYNA 4XCEB 1MFBL 1P7KB 1S7RB 4K8RL 3SDXB 2X4RB 4JG9A 5F9WC 3AAZA 5B7MA 1U93B 4TVPH 3ZYOA 4PY8I 3DV4B 3SQOL 1WA1X 4KBPA 5J1SC 3CDZA 4NRXB 2JTYA 2WIIB 3CZJA 3SODB 4MXWL 2AMUA 2PW1B 4ELKB 4BK5C 1YY9C 1S78D 2J5WA 1YNLH 1ZHLA 4P3WA 3LH9A 4YL4A 3MBEC 4B5ZA 1B90A 1VFBA 2BNQB 5HPMA 1YC7A 3U7YL 1QO3B 4PP2B 2IPTL 3SDAC 4IYKA 3LPWA 3DSNB 5KS9B 4L23A 2G9HB 4KGJA 5EZOL 1RFDH 3QQ3A 5IR1A 4IS6A 4NEHB 5DTFB 2WD0A 4FQJL 3DIVA 4PJXF 1DL7L 3LPGA 1WZ1L 1CDYA 2YMXH 3DROA 4HJ1A 4YLBA 4YOKA 1DJIA 1MNUL 3J7HA 3BVNB 4L9DA 4WJG3 4ABQA 1GY1A 1NBVL 3IGAB 2VKWA 4U1GC 2PABA 4AE0A 3GI8H 1OK0A 3KPOB 4HOWA 2BP3A 5DJ8B 4ZDHA 2ILLA 3X1GA 3BLBA 2DBLH 5L88H 1EMTH 2EDMA 4KX8A 3WE6A 4QDGA 2CCLA 3ARPA 1U8KA 2QSCL 4F7KA 1WHPA 2XWZA 4URKA 4KMTH 4NAQA 2EDQA 1TZAA 5D7SH 1F1DA 3RBSA 4HD9A 5IM7A 1FUNA 2DL2A 4PY8J 1XMWA 3K4ZA 4G43B 5T33L 4P5RA 2HPTA 1DN0B 4N2KA 4L0YA 4HFWB 5C3LD 1I4FA 1P4UA 1AJ7L 5EIIG 3TF7C 4RFOH 3VFWA 1MQKL 1QRNB 3IDGB 3BHBA 1PX4A 1Q0YL 2G5BA 2JCCF 5GJSH 5F88B 2KDYA 4LGRB 3OR7A 5AD0A 3EH1A 3HE7D 1QQDB 4OGZA 1TVBB 1AMYA 3CWGA 5D7KE 3H3PL 3JUZA 4Y2LA 4MA7L 4JHVA 4OAWB 1BD2E 5L7XH 2D2OA 2BSBA 5SWSA 4FLRA 3EO9L 5F96L 1E28B 1HHGA 1PAZA 3RHWF 4L18A 2D4DA 1MOEA 1Y18B 4AYFA 1ETJA 3NP3A 2YRZA 1X5IA 5D6CB 1TZ8A 1N6QL 3BKML 4X6CB 2BO0A 2XY1A 3MBXL 3P0YH 2DDQL 4WSKA 3AACA 4G8GB 2UY6B 2Z0BA 4JO5A 1NCBL 3VGDA 3O2WH 1B4TA 2UY7B 5TDNA 3I6LD 3APCA 2DKMA 4DVRL 5ACZB 4EZMA 3JWNC 4PJ7F 3QR1A 3LEYL 5CEZD 2VUYA 1SVBA 1YNTA 2CDFA 4GUPA 3N43B 2LVCA 4F2MB 4P2QD 1L6ZA 1S5HA 4KFMA 3CDGB 3P77A 3FRPA 4JRYB 2VISA 1NANI 3JTTA 5GGUB 2EILB 4XN7A 4HT1H 3QEGL 2BZ7A 1X5KA 2EINB 3S37H 1ZEAL 5DHVA 3GJFB 2WLLB 1GC1H 4M8QB 2AZAA 1HWHB 2BP0A 1MVUB 4PJFF 3VFTB 3TBSA 3FUMA 4N22A 3VMNA 3LPPA 1OHZA 5A6MA 3E38A 3KEHA 4WRLA 1JYVA 3FAXA 1IGCL 3FCSB 2XWDA 5ECJE 4Z7UB 4N1CA 4C56D 5IVNA 4UT7L 5B3NA 3OR6B 2ZUSA 3QUZB 2FIKA 2X12A 3BWUC 3HLAB 3K2IA 2W1NA 2CJ3A 1Z7JA 3E6FB 1CFBA 3ARBA 2F54E 2WLNA 3TO4B 4D9RE 2XG4B 4TULL 4U1JA 3ZL4L 3BQUC 4ZO6A 5IK3A 1A21A 4X8JB 3H7LA 3M1BA 5AVTB 3O2WL 5IMKA 25C8H 3UTOA 5LVEA 1MFMA 4AGNA 3OZ9L 4IRSC 5DVPA 1SF5A 3CFBA 1T6WA 4KNUA 2AMGA 1X6LA 4FTVD 4X0NA 1QI3A 2V7NB 1RZJL 4K5OA 2Q76A 4D94A 3S3PA 4NWTH 5BW7C 3C09B 1BQKA 4AJ0A 5JZ7C 3FO9B 5CO1A 4JN1L 3TO2A 3N06B 4GRWB 2DN7A 3Q05A 3EHBD 1D5MA 4HIEB 3KPLA 1WISA 3BDBA 4KJPC 5IBLD 3JYCA 5BUGA 1I82A 1FGNH 1CLYH 3AU0A 3HNSL 3KBFA 1NGXA 3HZKB 1NGWA 4NO0A 4XAKD 5DC0A 1SJXA 3DJTA 3APDA 4EN3A 3RWEA 3NJFA 2BHFA 4G70B 1F1AA 4ANVA 1JGIA 3LPOA 1KBPA 3MBED 3EOAA 5KN5B 1CU4L 3GK8H 4L0ZA 4A6YB 3II2A 5DMKB 2OMWA 5IQMA 4KTEL 1RURH 3VI3E 4NO2A 1A22B 1T3FA 3JTSA 1J1XL 2B9BA 2NY4C 4XMZA 2R0ZL 2X4NB 3ZLQC 4AG4H 4GQQA 1CFVL 2Q87A 1KPVB 5JPMB 1QEXA 4QY8A 4UNIA 5ENWB 2CK0H 1TOXA 4FJ6A 2DQJL 5E94B 3BJLA 2OL3L 1FVEA 2N4IA 4W6YB 4DETA 4H5SB 2WXJA 1CLVA 1AR1C 4PHZA 5LWYL 3FO0H 1TQCC 4YEFA 5L2KA 2WBJB 3VXUD 1F8TH 3L3JA 1RV6X 3VXMB 4P2RE 1AGCA 4CN6A 3KLAA 5DMGD 4X8JA 2A9DA 5IFJA 3ABGA 1YAIA 1A0QH 5IEKB 3NZ8A 2EABA 1TTGA 3WHXA 3L1OH 3QDJA 5IFJB 3T4AC 1IARB 1LO0L 1MZYA 3E6FA 1M9WA 5MEND 1Y0LB 1UD6A 3S3JA 4WHYG 1IL1B 3QUKB 4WWKD 3P02A 2WXGA 2A38A 3PNWA 4G71B 5GGRA 1ZV9A 3UAFA 2VDLL 4BH8B 1DCLA 3UO1H 5DS8B 5F9JB 2L7QA 4FNPA 5TD4A 4CL7A 4POYA 4RDQF 2XXFA 1XH2A 3UBXA 2WK2A 2K8QA 3EO1A 2CBOA 4NQTA 4NQDE 5F1OB 4IMLA 4G1MA 3PL6D 4PJCB 1NGZB 1RPUA 1J18A 4MB3A 2R8SH 5KVEL 3BAKA 1EBPA 3KHOA 5DJ2A 3EF4A 4XP4H 3OB0K 5DEGB 4B95C 3RFZC 3KPMA 2NT0A 1ZA6A 4N24A 1WG3A 2RCSL 2GITB 2H0FA 1YYCA 3D9AH 3MNDA 4QT5A 2XN9E 4LMQI 1A14H 2XOTA 1TLMA 3CHOA 3EYSL 5IJVA 2NW2B 3FFCD 4NLAA 2ATPB 2UYLA 4PB0L 2XWXA 2A9CA 3ZE2E 4LQFH 4TUJB 4MGXA 3AVEA 2R15A 4H0HB 1IC4H 3O3DA 4FTVE 2ZKWA 3RWEB 1XR8A 2MQ0A 4OZGF 3BWAA 2DQDH 1BD2A 2FJHA 1RERA 1RIUL 1WJ3A 3QDHA 4JKPL 5FUOH 1CLCA 1ED3A 4XPTH 2BSRA 2NY5L 3MLRL 5F0MB 5AZ2H 5K9QG 1NIDA 3FRUB 2QR0A 4Y2OB 5B21A 5I19L 4KV5F 3RX8A 1M71A 1SOQA 3ZE2B 5FYLE 5K9OA 4PRAA 1E4WH 1U36A 1A3QA 2WV3A 3R7QA 1F00I 4GH7B 2DJSA 4R7XA 2X9YA 2WIMA 3DX1A 3WS3A 4U1KB 2FEDD 4WJ5B 2A74B 3RGVB 4DVBB 3BZ4B 1U8QB 2VO8A 4FFYA 3RNKA 4U05A 5AD0B 1ZD6A 2IGFH 2OMTA 2M2DA 2IWEA 1F56A 4KXBA 4X7FC 2Z31B 5JNYB 1FFRA 5DFWH 4LCWD 5IMMB 1TVHB 3APMA 2D3JA 1BLNA 4OUUA 3FOMB 4QRQB 2CUAA 1WC7B 2HRPH 3MI6A 1J0HA 5KAQG 2GI0A 2YPVL 5E03A 3DECA 3AY4C 3SBQA 1NIFA 4N2MA 1B4LA 1JFQL 2NY0C 2W60B 3ULAB 3LX9A 1PTZA 2WQAA 4Z7VB 1DQQB 1U8JB 4JFPA 3PG2A 3UYRH 2BJML 3S36L 4QGYA 5F44A 5T1LA 2ESVA 3FT3A 3ZRCC 1YEEH 1U92A 1NICA 3LDBB 3QHZL 1DLFH 2BSED 5G5DA 2IFFL 1CFQB 4YBLB 5IUCA 2W0LA 4OV5B 3WD5L 1CU4H 2OAAA 1WZMA 2Y6SD 4G8GE 5DZ9A 1DBBH 3JTTB 1NWPA 2J5LB 1CMOA 1JI2A 2ZUWA 2ZCKL 2WQWA 2AERT 1E6JL 4A2FA 1OARH 5F21B 5J5EA 1AZCA 1H8SA 1SM3L 1H6FA 5TDPB 2ZG2A 2PETA 4X7SL 3TJHD 3H9SA 3QS2A 4HCFA 1JZ2A 1AQKL 4QNPF 4F80A 1MFEH 3K71B 1NWOA 2FGWH 5DVLA 3QUMH 5F1NB 3N9GL 3TIEB 3WTUA 2PR4H 3G08B 5T3ZE 4Y4FB 3WN5C 3FPYA 4W9CC 1J1PL 3F5WB 3BUQA 1UWYA 1MEXL 1WA0X 2HKHL 4Y8AA 3VJ6B 3F5WA 2XN9D 1S7QA 2DH3A 3LKNB 2H8PB 1G7HB 3L9BA 1E50A 4RDQG 1TQBC 5CSZA 2IV9A 4QAMB 1R5VA 1FLRL 3RLSA 4EZKA 1TVHA 4RMTA 1I1AA 1E6OH 2G2NA 3T0EA 1TVBA 1CBJA 4RQQA 5IB1B 2F54B 3FZUC 1MW3A 2AJXL 4J39A 5EU5B 2WBKA 3ALWA 4I3GA 1OGSA 1XT5A 5F7AA 1YPZB 2WSKA 2ZUQC 1GGBH 1Q0EA 3CUPB 2D0GA 4ZSOE 3L3OC 5E2WL 3OF6D 3HCVB 3SYPA 2GSIB 3QAQA 4BZ2H 4UNVA 1DJHA 1X5AA 2YKLL 3ULVE 1B4JL 1DL7H 3VB8A 5B4MC 2IWFA 3AROA 4PJ7B 5GRJL 4DGUA 5LN4A 1UH2A 1GIGH 4DUWA 1RU9L 3MZGB 4X99B 1HCZA 2BDNH 3MA7B 5T1JA 3ETTA 2VRAA 1BREA 3VD0A 2R29L 2BRRL 5T5NG 5TE7H 1Q9OB 5IFHH 1WFJA 2GY7B 4HS3B 2FAUA 2RTTA 3DURB 1OE2A 2V17L 1XMEB 3MRCA 2J6EL 1EJ6A 5DZLA 4FYQA 2I24N 2DOCA 2F53A 1JD9A 3KPRD 3ZUCA 3Q13A 3SGDI 1TJIH 2XTJB 3I3EA 4W9ZA 4ZX6A 3HBGA 2HT2D 2D7TH 1G7LA 1JCKA 4WKXA 2OMTB 1MCJA 2AQ2A 1CDGA 1LNUB 1S7WB 2WXKA 4LIQL 4CSZA 4U6YB 3WJMA 3V0WH 2M26A 3ULVL 3O6FC 4PJHB 4KHXH 2P5WE 1EEYA 2VITA 2V17H 4ZUTB 4E9YA 1UC6A 4YN3A 5IQLA 1AQDA 3MJ9L 1J8HA 4ZMZA 4DZ8A 1JZHA 2Y2TA 4H25B 2AXGB 2PMZA 2CXKA 1XZWA 5DS8A 5F9JA 4PG9A 2XQYA 1P5UA 1I7RB 3LY6A 1AKJA 1DJYA 1FCGA 3QWNA 1D9KB 5IG7B 5GGRY 3UTSD 4B5EA 2VH5H 1PW3A 5IFAH 1YECL 3OKLB 3QDJB 3T71A 1TKWA 2HX9A 2YQGA 4XB7A 4Y4KD 5ABZA 3BT0A 3GF8A 1FNFA 2LQRA 2BSTA 3C5SA 2VR9A 3MCKA 1W72B 2JXMB 3LKQA 1O9WA 4Q9QL 4XCCL 4HIQA 4K8RH 4J5VA 3A47A 2FSEA 3MCLL 3RWDB 5EBGA 1NEZB 4B96A 4EI5A 4MJIA 1SMOA 2WBJA 2H32H 2D9CA 1T0PB 1LWRA 4H20L 4N0UA 4N8VG 4AQEA 3FTZA 3TPUB 5GGVY 3TN0D 3BUYB 1FYTE 1SJEA 5T3ZL 2E7BA 3G6JA 4G8GD 1E67A 4JO8A 5AVSB 1WS7A 4DNLA 5IB5B 4XRCA 4AVKA 5CR1A 5DEGA 3I6KA 3ABLB 4G8IB 3D1MC 2NR6D 4KVNL 3T2NL 3QHTC 1FFTB 3GSRB 2X4NA 3NIFE 3WFHA 3EUDA 1AP2A 1H5BB 1AIFB 4PJCE 3IMRA 5INCB 3X1NA 5EWIH 1U8PB 3D06A 4U1HA 4WU5B 3D2UD 1GKEA 4RRPM 4JDTH 3FTGA 2HJFB 5MEOB 2ZOKB 5IHBA 2OTWB 4PIBA 2KLTA 1WZKA 1P2CA 3X1FA 5C08E 2Y7MA 4X98A 5BXFB 4NWUH 3I3DA 3N42B 1XQ4A 2FO8A 3V4UH 3MMEB 3DLQR 4LCUB 3QUML 2GJRA 2D3NA 2GIXA 5FFOA 1FA4A 2O5ZL 1AC6A 2D03H 2ENYA 3DHJA 4JBSA 1K8DA 1FZJB 3OKLA 2MKWA 4F7TA 2ZIDA 1K4DA 4HUUB 3SDDD 1OT1A 1UOLA 2ZYSA 5I15H 5D1XD 5AYUH 4RZKA 1JPTL 3O2DL 2ZUVA 4HJGB 1FNHA 4N2BA 5C7ZA 2WQSA 3TO2B 2J6EA 1KDJA 4UNUA 2VR6A 3X13A 4MDRA 5EEVA 3EAKA 5IMLB 1X5ZA 4KJPD 4MDIA 3FO1A 4K55A 1A1MA 1RUAH 4LHJB 1DSFL 1WAAF 2OV0A 1U95A 1C12B 4WTQA 5EF2A 2GB2A 2YQBA 1FVCB 2XIDA 2EIKB 3U6XS 4ZMLA 1L0QA 1N2RA 1OPGH 5PCYA 3T1FA 1VEPA 3WSQH 2DQGL 1RURL 3QCVL 3L95B 3MJGX 4TQHA 4JFFD 5HGHA 4CVZB 2R9HD 3UCQA 1DQDL 3ZKNC 3PAVA 5FC9A 1ITCA 5F7BA 5GHWL 1DJWA 1DSFH 2FJGB 3FTGB 3OMNB 4HPYH 1M2VB 1HHJA 1QPKA 4LKXB 5GRJH 3AG1B 3GMPA 3MBWA 3VXOA 4DEUA 4E36A 2K45A 3F8UB 4FMFA 3HN3A 3FC8A 2Z3FA 2ZX9A 4YSUA 3RVWC 3BFWA 4KOCA 2VDNH 1E5BA 1A1OA 2YGPA 4APQB 1HYSC 3GSQB 1F3DH 3HAEG 2BXZA 2CRYA 2OP4H 5I8EA 4MRCA 3L1FA 5FO7A 4DW2H 4FQJH 4W93A 2A6IB 1FC1A 2DYSB 1JP5A 2CGRH 1TZIB 2MQGA 4IKIA 2RA1A 2XTSA 3FN3A 4KUZH 4F2FA 5CBEB 3P3UA 1HEZB 2DV6A 3CLWA 4Q6KA 1T7WA 3P3RA 2R1YB 3MGOB 2G4GA 2CLRA 3SB3A 1REIA 1ZLUH 2PYEA 4GQZA 1JN6B 2QADD 1FIGH 4XX5A 5HYJB 4CGTA 5L2JA 2AK4D 4GEJA 4EUPB 1QWNA 5HHOE 1L7IH 1Y1DA 2P8LB 2Y7SA 4KMTL 4CKQA 3JV4B 1V54B 1AKPA 2OW6A 2NXZC 3RDTA 2FBRA 3RG1C 2D7MA 1KXQE 4PHXA 4MAYB 4LRNL 1EHNA 4GBXB 4PEEA 5FA4B 4GP4B 3FU7B 1KIRA 4U0RC 2EVJA 5J06A 5TFSH 4HPYL 1SLUA 4Z76A 2ZUXA 1OCRB 1WYJA 3LV3A 1OO2A 1X5FA 3U9PL 3BFQG 4NZDA 2X38A 3O0LA 2DRUA 3EFDL 4CDHA 3LIZL 1DQJA 2OJEB 3GLDA 3ISYA 3MCYA 4KDTA 1RZKH 1TTCA 2AEQL 3KLHD 4BZ1L 1YEJL 3VXPA 1URZA 2ZYHA 3D50A 4ISVA 4E42B 4PJ8C 3QPQC 3FOLA 2NY5H 4EPSA 4YX2H 2DAVA 3ZIMA 2GY5A 2W9EH 4RSVA 1I4FB 2O6DA 4M1DL 4CVXA 3F05A 3Q8AA 4Y5XA 4R90H 5FKPB 1AH1A 4R7NB 1NFDB 3IF1A 3NTCH 2QVKA 4HZAA 4KITB 3QNYB 3GMQA 3FT3B 3PU7A 1PG7L 4MXQD 1KY6A 3E0GA 4PB0H 4NERA 2PYEB 4AJYV 1Q94A 1JPSH 4U1IA 1MSPA 2O93L 4A55A 2JFCA 4XNQA 3P11L 5CEZH 3WFCH 1QACA 5DFVD 2GJ6A 2YRPA 3D0AA 3LN9A 4JNXA 2XZQL 1PZCA 1UWEH 1GGIL 5DJ8A 5JIKA 3IMBA 2VQTA 1TR7A 3LH2L 4LRNH 3VFOB 2XX1A 1FO0A 1QR1A 2CJUH 5D7LA 4JK0D 2L7UA 3BW9A 1AGFA 1T7ZA 3PJNA 4GMTH 3T77B 4ZS6C 4J28A 3L7EA 4AZ8A 1PZUB 3PAYA 3ZL2A 1EZVY 2AJZA 2EIZA 4JPIB 5C0RL 3OLGA 2JQMA 1I1AD 3SZKC 3T0ED 5LNDA 3ULUC 5CBEA 3S37L 1AO7E 2MNJB 3D3VA 3LEXA 3O6FB 3LYRA 4RNRA 2FCBA 2GJZB 2J25A 3CVDA 3OXSA 4AL8L 4CC4C 4CBPA 3C5XA 4XBEH 3THMH 3EJRA 4P23B 1FIEA 3BDXA 4HISA 1IGCH 1KXVA 1NOFA 1ESOA 1DSWA 1ZLWH 4H26B 3VXUB 1GTFA 5I1EH 1SY6H 5BRZA 2BY2A 4YDZA 4Y5YC 4UF7C 4Z1PA 2EIBA 3PWVA 1MDAA 2LTQB 4OCRH 3D39D 2V7HB 4FQLH 1ADQH 4DK5A 1F4WH 2OJZL 3D30A 1VZIA 1KN4H 2XXMB 3IWUA 5JPNC 4TVPE 4LLQA 4PR5A 4P2QB 4PV9A 3PS6A 2OX5A 1PIGA 4W9GC 4LSRH 3VI3B 5JHDA 4PGCB 1FNGA 2M1KA 5LGHL 3GBNL 3GKWH 2YFNA 4D7BA 1EIBA 5A2FA 3MRGB 2APXA 3QB7C 4C56A 4E0RA 5I2IB 2Y5EA 3NEXA 3TBVA 2EUXA 5I1IL 3D4ZA 2FUQA 4NM4H 3CX5K 4JHWH 3WN6A 2VL5B 3PUUA 1J5IA 2IANB 3MRRB 2HLAB 5JXEA 3FB7A 3BZFA 1EVUA 4L3AA 3DX0A 1FVDB 5C2BH 1TETL 1WUZA 3CDCA 1KTLB 3LN5B 4Z7WA 1WH0A 3BQUB 1UJ3B 2OTUA 5DD3L 4EN3D 2H2SD 4KTDH 1E8ZA 4X6EA 2ZXAA 1FGNL 4W81A 5I1LB 4W6XB 2ED7A 4IBZA 1E9OB 5I1LA 2DM4A 4KVCH 1UB5A 3ARGB 1I3RB 3GHBL 2LVEA 4M93B 3QCTH 4X5PA 4DPRA 5E1GA 1CDJA 4HDIA 1I3RA 1RZJH 1DBAL 1S7XA 4PG2A 1KLGA 4G7SB 1NDTA 1RVFL 2ZCHL 2G60H 5EUOB 1CDCA 3VWJB 4ANXA 1CUOA 4LRIC 1ND0B 1U3HA 3G6JE 3L16A 4X7CC 5FYKU 5I74C 5IVXE 4S10A 1BEYL 1IVTA 2FNWA 1ZVHA 2WZPA 4KI5C 2WVTA 4MA1C 4QOKD 2OTPA 1N70A 1JVLA 2O6CA 2X1WL 2NCMA 3PGCB 5T1KB 1JYWA 1IBGL 3FUHA 3D4YA 2X3BA 5EBLA 1CE1H 1RJZB 1ANUA 3E8UL 1XR9B 3S4SG 1ED3B 2DKUA 2H45A 2CPCA 3OVUB 4IGBB 1FNGB 2AK4A 3JXAA 4RIRB 3M8OH 2NXYC 3MV11 2H2PD 1I1FB 3EDDA 3O3DB 3TA3C 4U1MA 1OT2A 4NI6A 5KUKA 1QWHA 4YMPA 3TNMA 3UBGA 4N5EC 3F84A 5C08A 3ARBC 5F0PB 1HCYA 1MJ7H 4Q9RL 2HVKB 3TESA 3ZKSD 2X7LB 4J8QA 5CILH 4OI7A 4KJQC 4G72B 3GTNA 1JV2B 2KZKA 5BS0E 4AI7A 4POZC 4M00A 1BSIA 2AVGA 3ARDA 4Y1AA 3W57A 2ZCHH 4ZW8A 4WUKH 5CD3A 4OD2A 3GBDA 1W8EA 3DKHA 5I28A 4U1NB 2DLHA 2ZF9A 2B3RA 1ZGLP 4KZEH 4LSTH 3L3OB 1JXGA 3BPNB 4ZUWA 4U1LB 4YHYC 1FHNA 3AITA 1U2YA 4DKFL 3EJZD 3PIQA 1HYRC 1HJCA 4HK0A 1CN4A 4HKBA 1CBVL 3FTWA 3P2TA 1A5FL 2HT4D 1KTJA 5GGVH 1ZLVK 1AQKH 2F1EA 2W92A 4P57B 1CGVA 2EH8H 2WNXA 1M6OB 1VEOA 3GMOB 4UOZA 3JBG7 3L1EA 4Y1SA 2FT6A 1RJLA 4JG1L 1A2YB 3TU6A 3IFNH 4Y2DA 4XPTL 4EDWH 3SGEI 1NIEA 3HE7A 2PCPA 1ICTA 1A7RL 1JK9B 2E8ZA 2ROXA 3OC8A 1QFPA 1UWXK 1YEWA 1MW1A 3QZWG 3NIFB 5IHHA 3C5ZC 4GP8B 2F68X 1INQA 1IJNA 3BN9D 3UROR 1Y6NR 3B83A 1GYVA 1Q9KB 3VFRA 2APBA 4LLQB 5AKVA 4KV5E 2CD0A 3MV8D 3U0PB 2X4UB 1YEHH 2VNCA 3ETBF 4F7MA 4QXGL 2Z93A 5FYKL 2MCMA 1I8LA 1OV8A 1R5VB 1S78C 2IV8A 2LHAA 2ZXQA 2HRLA 3U83A 5CZKA 4M5SA 4WW1A 1PZ2A 3FHEA 5IV2B 2DICA 3VWKC 4PJBA 5I15L 4CNIB 2Y1VA 3GLEA 2CO6B 3X1EA 3KVPA 5AAMA 1YNKL 2BCKA 2DLGA 3ZE2F 1PYWA 3V5DB 3LV3B 4E5XA 3FONB 1BIHA 1KGJA 4FXKC 4OTXH 3ZZLA 2XWCA 1VF5C 4NENB 4HWNA 3MV7A 1SLVA 5BS0B 1FZMA 3VQLA 2NR6A 3AREC 4YL9A 3AXIA 3BPLB 3NA9L 3QRGL 4IDJL 4J3OG 1NBCA 4O2CA 3WJJA 1D7DA 1F4XL 1GYUA 1NCWH 3IFNL 4ACTA 4S0HA 1IC5L 1E2ZA 4EOWH 3AT0A 5AYQA 5CFHA 2DQHL 1NMBH 2GUOB 3IJSB 4NYLA 1FZKA 1ADQA 5A40E 1S6NA 1AI1L 1Z5YD 4NC0B 2CLRB 2IH3B 2NY0B 5L2KD 3HRZB 3LHPH 3MR9B 3ZTNH 1NPNA 1BVOA 4HYTB 4YBQC 5ID1A 1DBML 2IDQA 4JGJA 1SRDA 4X6CE 4ANUA 2DIEA 4ZUUB 4M62H 1RIHL 4PI0A 4GAJL 5FO7B 4ZUSA 3DGGA 1KZYA 2EVHA 2WNGA 4DIXA 1I7TA 1SFDA 3GMMB 5JYLA 4ABVA 1L0XA 1BM3L 1LLAA 1VGKA 2C3XA 1R3KB 4YJZL 1D2OA 1OAJA 3OKDB 3SOBL 5DC2A 1NBZA 3TM6A 4BHUI 4NQEA 4P4KC 3FU3A 1IGIL 1F3DJ 3ZTNL 5HHXL 3ZSSA 5GJTL 1B2WL 5CLZA 4G9FD 1W15A 2Z31A 1JPGA 3FBKA 3RVWD 3STLB 5AVVB 2NUTB 5TE4L 1GW0A 1GSMA 1PY4A 1JHTB 3FCUB 4L4TE 2WUCL 2AJ3B 4JGUA 5D7JA 3UZVA 5EU7E 1J0ZA 4FZ8H 3W37A 1SQMA 3GYRA 1QBML 4GLRH 4JQIA 4YHOH 2AQRA 2YSSB 4F57H 3RWHB 5E9DE 4MAZA 2GI7A 4KRLB 5A7BA 1LDPL 2A99A 5DXWA 1NLDH 3KYMB 3TFBA 5J89A 5ESVA 5T3ZH 2FECL 1FZMB 3TL5A 1XF5B 4GB9A 1ZHKB 1MI5A 1JNJA 3KW7A 5CLWA 4AVIA 2HWZH 3IDNB 4PYHA 2YMTA 4PWIA 1VJSA 1W0VB 5ICXB 1RK1A 1RZGA 5CMAB 4DSYA 2B1AH 5JR1L 2IH9A 3V4VL 4DQOL 1MCHA 3C6SB 5DQJB 1LK3L 4MQTB 1VPOL 1GYCA 5INCA 3H55A 3CK0H 4LCYB 5KYWB 2W9EL 3UBXG 2HFEA 1F6AA 1LE5A 4HGMA 1MCRA 5E2VL 2XU9A 1G1CA 4AUJA 3KW8A 5KVEE 3U0PA 2D7TL 3HE6A 5E4OA 3DYOA 1KOAA 5DK2B 3N5AA 1AIFA 2N01B 1AP2B 4XVOA 4GI9A 5H2BB 5DK2A 3ESMA 2W0KA 1KPUA 1XVSA 1F1GA 5I6NA 4MB5A 4XC3H 3HG1B 3UPRB 4XNUL 3M7FB 3QUMB 3Q43A 5IVOA 1KB5L 4G7VL 3E9TA 3SCMC 5IFHL 3ZW3A 3EYQD 1RL1A 2XTJC 1V7ML 4KK6D 4UV7H 5E2VH 3BGFC 3LOWA 4D0BB 1JRHL 2NXYB 1PKQA 2H5UA 5HHMD 4ZT1A 3LPFA 1K4CB 4NZTL 3WIIH 5CD5C 2Z91B 5I9QB 1MFUA 1UYWL 4DKTA 1YNKH 4JL2A 4LGPB 1FI8C 4LIQH 3AABA 2BIPA 4UZUA 3WXWH 5DHXB 4QRSB 1W6LA 1OSEA 3L3HB 5GSVB 3TYGH 5C09B 2IANA 3MV9E 3A0OA 1D9KA 2XPGA 5IG7A 3UAJC 1URIA 3IFLH 4KK9C 2NTFA 3QO1B 2XQYK 2R2CA 4FEMA 5CEYB 4C59B 3OXRA 4PRBB 1TJMA 3N40P 2J44A 3MRKB 1IEBB 5KVMC 1X5JA 1NMBL 4LCCC 3VI3A 5JHDB 4DAGH 5KYNA 2FO4A 1P84J 3OX8B 4TNVK 2LW3A 4GINA 4NZRL 1HQ4A 1VCAA 1BIIB 4FFZA 5JO5A 4NZUL 1IBBA 5JDSA 1WTGT 3EJQA 3OLIA 2LAGB 1GL4B 2EE0A 4BA0A 1ZLWK 3BWZA 4UIMB 4ZTOH 4L4TD 4HUVB 3GSNH 4TLTA 4GQRA 2H7WA 1A66A 5FW8A 2IALB 3ZKMC 1U4EA 3MYZA 3SDCA 5EBLB 3QH3B 1OY3B 1OD9A 1OGPA 3P4NA 4XOAA 4A67A 2BOBA 2EZ0D 4PREB 3L3GA 4DZBB 1HSBA 4G42A 1CFNB 4HWBL 3T6VA 1A9VA 1KTKE 4P04A 4UUJB 4YEEA 5EF0A 3KZ8A 4CVWA 2AXWA 5BW7A 3UYPB 1F3JA 1MWAH 3W9DA 3KYNB 2AF2A 3GJEA 2NZ9C 3V8CA 3SQOH 5KYXB 1EEZA 5T5FL 1UT2A 3MLZL 4YXLH 2EC9U 4KXZH 5F89A 4UI2A 4CC0A 1CGUA 5JQHC 4GW4B 4WO4D 5GIRB 4I0KA 2HN7B 3IGUA 3QCVH 1JG9A 1KCUH 3IRZA 4JHWL 3ZO9A 1AYOA 1MG3C 4XH2A 4HOMA 4D9QE 4GG8B 4OGXL 4YQXH 3ZGHA 4AIXA 1G9HA 5C2BL 1H3TA 2CM5A 2MFNA 2BOCB 2IXQB 4RFNB 4OM0L 4HK3J 3CQPA 4BJLA 5BV7B 3CFDA 4OW6A 3POHA 5LCVL 5KYUB 5BOPA 3UABA 3QWRD 4AYBA 5L6YH 3TBSB 3MPCA 4PJ8A 5D1XB 4HAFA 1CLZL 2EC8A 4X9IA 1R34A 2R69H 2XBDA 3E8VA 4XXWC 1MIMH 5B8CB 5JDJA 4P46A 5DUJA 5EIQA 5GZOD 3B7UX 5EZJB 5EFIB 1U3HD 4ZMAT 2NQ3A 2AJUL 2YUVA 3WEBA 1UUNA 4JPWL 4YSSA 2G3MA 5SWZE 4OFVA 5I8KH 4OBSA 2GVYA 5DK0A 1KJVB 1NDGB 4JLRB 4XAWH 2Q3AA 3DPBA 2NY7H 4ZZKA 1TQUA 3G5VA 1C8QA 2F53E 5AYTA 4JDEB 4HQQH 3CC5A 1NUFA 1T4KB 4P07A 3RAJL 1MNUH 3FQRB 2NNAB 3DVIA 1ZK9A 4Q6IA 3L8QA 4HUCA 1FAIL 4G1EA 2Z7ZA 3FT2A 4WFHD 4N4YB 3GLAA 1T03H 3NJXA 4KKQA 2JCCB 4XWOC 5D6CA 5ACZA 3PHQB 5I24A 4DT2A 4OQTH 4JZNA 3TV8A 3WIHL 4XAWL 5FUOL 3IU4L 4YE0A 4P5MB 2NSXA 4FL4B 1QRND 1CFSB 4G6JL 4PP1D 3ATEA 4QRQA 3PWJA 2EDTA 1FFNB 2J55A 2KLSA 3UGEA 4KZDH 1KB9J 3L2NA 4WKZB 1M1SA 1QVOB 4TSBH 3WFEH 5CGMA 2J88L 3DETC 3RVUD 3D3VB 3HFFA 1A7OH 3LXCA 4CSSA 1F2QA 5KSAD 2W0PA 4GG8A 3B2PA 3MBXH 3P0YL 2YPLE 1H15B 2LFGA 3FOMA 4PTTB 3T6ZA 4ZPTA 3IE4A 5D7LB 2YJQA 4X9HA 3ZKQD 3TYGL 2DYPB 2NQDA 3GLZA 3FUIA 3BN9C 4Z18A 1S9WA 1QNZH 1P7HL 1KLUB 5F1SA 5A16B 3EKCA 3L4YA 2BP8B 4PWHA 2DQDL 2ZPKH 4K4KA 3BH8A 1RIUH 2ADJB 1HHIA 4H1LH 3H3PH 3CLEH 3QI9C 4QCIA 2HJKA 1JWUA 2K6WA 4R90L 2P80D 2BIOA 1SGKA 1HNGA 3P9MA 4GAYB 4R96B 3KPRA 3HI5L 2AQSA 4WHTB 2OZNA 1KJMB 4FA8A 3VI4F 4Y88A 2EJ1A 1U30A 4B7IA 1DCEA 3MLYH 4BSWA 2FLRT 4F9LC 2H0PA 4LSUL 3U2JA 3V4VA 1AD9A 1AZVA 1WBZA 1PSKH 3EYVB 1QPXA 2YBRA 2DM2A 5MP6L 1QUNA 3S2CA 2C4XA 5JHMA 1YEEL 1T4KA 3IU4H 2IGFL 4L9LB 5EFIA 3HFML 4L2YA 4NSKA 5GS0L 3SDAD 4A2HA 3KPNA 1C5BL 3UTSA 1QSFB 3OMAB 2X05A 1JAEA 1E4XI 1KJVA 1NDGA 2ZWLT 4AEHL 3F64A 4M1GH 4LASH 1GOFA 4D0CA 1E5CA 1GR7A 3BAWA 3LKPA 1CJYA 2OSLB 2HT3D 5D2LE 4G5ZH 3I74A 4XBEL 4ZW3A 1IAII 4FLQA 4G6FD 1RXLA 4XHQA 32C2B 1C7TA 2DI8A 4HKZA 4JJOA 1BYOA 1DE4B 4R2GC 4TF4A 4YHYB 5JUEH 2DWXA 5A2AA 1QKZH 4N2DA 2AI0L 3JV4A 3M7OA 5GSVA 1NOLA 4ZMQA 1MI5D 4Y5VC 1MFDH 4XVJH 4Z8FH 4A66A 2CJUL 3UP1A 1TTUA 4QHKI 1JV5B 1BOYA 1D7CA 5TGBA 1XWVA 1UD5A 1TCMA 2RMNA 3ZHKA 1HILB 4AK2A 4UT9H 4DPAX 3U6RA 4K8RD 5CZRA 1QHPA 1FH5L 1JGDA 3RI5F 1E6OL 1OZUA 3MNZA 2P52A 2ZX6A 3HB3C 2OMBA 5EEUA 5FGCB 2IBGA 2E7HA 4XRCB 3G6JB 3MUHL 5L0QB 4KDTC 1IGYA 2EADA 5D1QD 4C57C 3AS0A 1KCBA 3GK8L 1BGXL 5C9JB 4P23D 1CVSC 1NC4A 1ZVSB 2HMID 4HUVA 4YLQT 4HPOL 4BWWA 4LCWB 4F1ZA 4JR9H 1FVEB 1BZEA 3NACL 4UOW1 5K59E 1F4YL 4KKBC 1WIOA 3CSTA 5AG8A 2VXTH 1T89C 4HXAH 3ESVF 3VXNA 4DHLA 1BIIA 3FB6B 4MLSA 4FDWA 3ECVA 3VM5A 1BG1A 2IQ9L 5EOQL 4F8NA 5CJQH 3GMNA 1T66C 1ASQA 2Y06H 3VI3F 4F1SA 4ODUA 3SE9H 3UG4A 1FFOA 5ADOH 5J6HA 2WLJA 3P73A 4P49A 3DJZA 4PRBA 3VSQA 4DZ8B 5GXBB 2Q86A 4NDMA 2CM6A 2MCPH 1BFVL 2LLGA 2WINA 3QJFB 2OR7A 3QPXL 4WWID 5D4HA 3X3GH 3QEHB 3WIHH 3STBA 4UT9A 3FQNB 3CPLA 3AB0B 1YYML 4GAGL 1U33A 4N0YL 4ZAKD 3UBXB 1ZHKA 3RTQC 2YD2A 4HWUA 1IUZA 4ALAH 1U8MB 1NCIA 1OL0A 1TJGL 5DEZA 4FFYL 1CFVH 4MD0B 1YCSA 4AENA 5C6PB 3ARGC 3UC0L 4L4VA 3QJQB 3UO1L 1GZQA 4AH2B 3QP3A 3T77A 1JNLH 3MRHB 2XTLA 1FL6A 3HE7C 1T5WB 1RMFL 2QLYA 4K3JH 5F7UA 4BDVA 4F58H 4K9EL 2G3NA 3VFVB 1NLDL 4IHOA 2PCYA 1H3VA 2IQAB 3DARA 4FQ1H 3CZUB 1HEHC 4IQHA 4MYPA 4RISH 4EBQL 2XA8H 1N3NB 1AXSB 1IIIA 4TNVF 4BXSV 4NN6B 1WBZB 3EYVA 3P9MB 4R96A 2XIBA 1BQHB 1VFMA 2WXOA 4RMWA 3HNTH 4OD3H 3K46A 1FHGA 2Y06L 4ABWA 4MCYB 1LP9F 1CXEA 5T8IA 4ONFH 1A6TB 4G8AC 1EFXA 3QUZA 1I9IH 4JHUA 4AXWB 3HG1A 3MLYL 2X9WA 4JFOA 4QXUH 2AV1A 1LP9E 4JKWA 4GQ9H 3QZWA 5HI4D 2VLLA 4YFEA 1EXHA 3LMJL 3DO7B 4LKCA 3RIFF 3U2SB 4Z3TA 4WEMB 4B9JA 4X4YA 2YO3A 3ZKMD 5CJ5A 1NGPL 4MS8D 4HHGA 1MAML 3W9EA 1PMYA 2LU3A 3VD2A 5C0AB 5FF6B 4IW4C 4GKZA 3FTSA 3HA0A 2C7FA 4AOFA 1USQA 3DPDA 4UV4L 3RBGA 3PXHA 2AS5M 3RX7A 2JV6A 3NIDF 3LKNA 3WTSA 4N2OA 3VRIB 2WXFA 3CDGA 3P77B 4BFIB 1R9FA 1W72H 2OCCB 1D5MB 5D1ZA 4MAYA 4O2CB 3RWCA 1P4LA 4Z7NF 3FU6A 3EIFA 4JGNA 1D2PA 3SJVD 1ZJAA 4N8CL 4YSRA 3X11A 1CD9B 5AVRB 5BRZE 4Y7OC 1YC8A 4MVBD 1QHQA 3GIVA 3RWJB 1FFPB 3O3EB 2VRKA 4UU9A 2XNAB 3VXMD 5H37G 5B39A 4UM9D 2VSMB 3QPQD 3HUJB 1JPST 3WHE0 3QCUH 5F6IC 4FAAB 2PLTA 2Y23A 1A6WH 2AK4E 4N8UA 5DEJA 5LXVA 1CGYA 1FNLA 2AAVA 2DD8H 3QAZC 4E42A 3CFEA 1GAFH 5ICUA 4OV5A 1L4IA 3SYOA 5D1QE 2NY1B 5C86A 1F2XK 1JHTA 3H8NA 1MRFL 2ESVB 2P3YA 1EFXB 3QS3A 2DMKA 4OH2A 1P6FA 2HX7A 4XXCA 3FSWA 4GKSB 4MA8H 5FDYA 1A9EA 5LUMA 5J8OA 4JS7A 3OGCA 5FHBL 1DQLL 4J3OF 3ZDXE 4GPVA 4ZNCD 1GYAA 4K2UL 1QLRB 8FABA 3VH8B 4LU5L 3BXNB 4YGAB 2BW4A 4TN9A 3VXQA 4XN2A 3PJSB 4DK6A 1I3GH 3QXDA 5C0CB 4BKLB 2CR0A 5F7FA 1L3NA 1XZ0A 4F20A 4LOUD 4JRYA 5A2CA 1SYSB 2Z1PA 3IGAA 4XXDA 5IB2A 1JS4A 1N6VA 3BE1H 1JHKH 1UZ6E 3BSZH 2EIZB 2XQYG 5SX4I 1UHVA 1J1PH 2YAFA 4NOBA 4UB0L 4XMXA 3WSQL 5I5JA 1W8OA 5EU5A 4FXKB 4R3SB 3II3A 1R3HA 1U95B 2EE3A 3MODL 3N1FC 5ILTH 5F8RC 5BQ7A 3HNVL 3MOAL 1MWAB 1RULH 2GSGA 2VLRD 3VFUB 4J2XA 1HKFA 5F1IA 3I50H 3BD5A 1BFOB 2QHLA 2WVVA 2Q9OA 3QDMA 3MLZH 3V4PL 3VWJD 4BBWA 4YXLL 1QTSA 3CU7A 3F7KA 1OAUH 3ARZA 3CFUA 1T0NB 4PJHF 3C5JA 3T8XA 3MRBB 4JFFB 4OI8A 3AAZB 2Y3NA 4I89A 3T6XA 2DQHH 3K7UA 1YUHB 3DRQB 3MODH 5ILTL 5E8PA 2CCVA 3GXPA 5CJ8A 3IBEA 3ELQA 3I02A 1N8ZB 1SHMA 3MHZA 5T1KD 4ZMYA 2FNBA 2MTAA 2LE9A 1KDIA 4XPHH 2I9TA 3DIDA 5F3FA 2KHAA 3LZNA 4H88H 4RMBA 3A6BL 5KEZA 4AQ8A 4IBTA 5HDOA 3WFHB 1IEAB 1I3GL 3BT2L 3QO0B 3O8XC 4URTB 2BIIA 1IRAY 1JTPA 4RGNE 3KYOA 2JJTC 2VXSH 2AEQH 4APXB 1NGZA 3BEWA 3E9UA 4ENED 2EYRB 1U2CA 1KCWA 5I8KL 5J6SA 2N0MA 4RETB 3CZFA 1S7UA 1UEMA 2Z34A 3BVUA 5F93C 2O26U 5DJAA 2MOVA 1EERB 3PL6C 5BVPH 2AC0A 3MOBL 2X4PB 4U33A 4ZW7A 3BT2H 1J0JA 2Y1ZA 3B2VL 3NCBB 2QFPA 4FD0A 2Z65C 3IFPA 4UZGA 2BDNL 3IGLA 4LDCA 4U1NA 7PAZA 3VU2A 1T03L 1NCAH 2IWGA 3HC3H 1N4XH 3SE8H 3W2DH 1G7JA 1P1ZA 4AENB 4IS6B 2RHEA 4G82A 1J8HB 3WJJC 2Y5TB 1RJYB 2FQGA 5B8CC 5IY5B 5DFVC 4XMVA 4HS6B 3RTQB 4DH2A 5A2BA 3GSRA 3L4UA 5CEZE 2EXWD 3ES6A 4XPHL 2X1OA 1A64A 3A23A 2DWTA 2WLKA 3DX9A 1R24A 4NXSA 3SDCB 4YS4A 4OLXH 4DP8X 1QI5A 2FJSA 5IB5A 4BYHA 3PWNA 2ADFH 2GBAA 2TSBA 3CC1A 3MXVL 4NRZB 1IU1A 4Y4KB 4HUNB 4LNVA 3P11H 4FS0A 3TF4A 3AT8A 5HVHB 2O72A 2EXYD 3INOA 2NY4D 5HY9B 2WVUA 1IGTB 5KSAA 4QRRE 1AXTL 5AVYB 1I1FA 4FLHA 3F85A 4P2QA 1YUHA 3DRQA 3NJJA 4PR5B 4PV9B 1SDDB 4JPSA 3N3EA 5DLMH 4JFWA 4LCWA 6FABH 5DR5H 1NGYB 2NZ1A 4PN6A 2YEZB 4XHJD 4JPVL 5AW1B 4PV8A 1JDCA 4P5KA 5KYYA 3OM3B 4AIEA 4XMTA 3VFGL 1K5NB 1KZQA 4JDVA 2V2XB 1AHWC 1BZ7B 3MRNA 3VRLE 5GZNA 3RWHA 1I7ZB 2XBZA 5EIIA 2EXTA 4HHAA 1Z9NA 3X13B 1D5BA 5DD6B 1U3ZA 3RL2B 1MREL 5GRXG 4LFHG 5JHBA 3K6IA 4OLYH 1BF2A 5FM5O 1ACCA 5DHMC 3RGHA 2R0KL 3PDOB 2AJSL 4XE0A 2EEAA 1OOAA 1G7JB 1P1ZB 1BVKB 4DJMA 2YSSA 1I31A 3L5WB 3QISA 4WFED 1E8YA 1Z9LA 3J27A 3Q1SH 4PRHD 4Z0XB 4Z7WF 1AAJA 3FUFA 4G5ZL 4Z7NB 2CK0L 1MF2H 4TVPL 4O2FA 4GS7C 5EO0B 5A7EA 5T1LD 1D5ZA 3B6SB 3FB5B 2EDLA 2UWEA 4YK4C 5GGTA 1AGBB 4H8WC 4PRDB 3COOA 5AFAA 4NWUL 5I18H 2FJFB 2OULB 1FG9C 1X9RA 4BFNA 3BUTA 3U7YH 1MCFA 5LAPA 1HH6A 5TQ0H 2EYSB 3FB7B 1LO5B 3QEUA 1P9MC 4PGCA 5I0ZA 1VEMA 4M8QA 4JFYA 1BHGA 1LEKA 3GMMA 1MW0A 1CPUA 1CIDA 1MY5A 2X42A 5FEBA 1T83C 5JPMA 2XBTA 1BF8A 5JXEC 3PWLA 4DO5A 1EUUA 3HE6C 5LGYA 3CBJB 4YDLB 4AQ1A 1R3IL 3PWPB 4P5TB 3SE9L 4B41A 1KCSL 3IMSA 3JUYA 2GKIA 2XYBA 4ANWA 5IHZA 2Z1KA 4L5FE 5D7IA 4XPAH 1HKLH 4OLUL 5DUML 4X5QA 3DJRA 2VDKH 4E2OA 3OG4B 1ZTMA 2MJWA 2CKNA 2NYZA 1IAOA 3O3EA 3ZMEA 3B9KC 3SKNA 4P2OB 3O41A 4P3DA 2QKIA 4YSDA 4Z3FA 4FJZA 4HPOH 1P7BA 4X5XB 4A38A 3LVEA 2NY3C 1PY9A 5CGYC 1KBGH 5C0DA 2A73B 3FRPG 3IDXH 1FYTD 2PPAA 4ZPVB 4NC1E 5L8LB 12E8H 3EJJX 5TF1H 3HI6H 3EYFA 4PJHA 2UVEA 3ZR6A 3TONA 2UWEE 1Z0MA 4LB8A 5ETUA 2A6DB 2XZAL 1KV7A 2ZX7A 3Q6FA 2HUHA 4ACPA 3EGDA 3WNKA 1CTOA 3IDIA 1MFVA 1D9KC 5CJBA 3DVGA 3KM2A 2FEEI 4EBQH 4A7UA 4ZG1A 4GXUN 5D7LE 1ZANH 1DUYB 4X7TA 4ZUVA 3EDFA 1RZIA 4QRRD 5F6HI 4FNLH 4HH9A 1BD2D 3VYOA 4NI3A 5C0FB 2X1PA 1NFDE 5GISL 5IHUL 1H19A 1B3JA 2B1HH 3W56A 1DFXA 3GS7A 5BUAA 1Q9KA 1WWAX 2CKBL 5D5MF 5B3JE 3FRUA 1OHQA 2Q0ZX 3SEPA 4M1CD 4JY6A 5IROA 4M3KB 5CP3H 3WNMA 3TS8A 3ARED 3GUFA 4B0MB 1H3PH 4F33B 1HSAB 5T3XL 1U8LB 4Y5XC 1Z1WA 1CTNA 3KG5A 2OMYB 5IBTL 4HJEA 4PJGE 4RAUA 1KBGL 3RPIA 3VDCA 3EGXB 2WNKA 3ARDC 4MCNA 3BP6A 1F0LA 4K0OA 5FM5M 2AABH 5E4EC 3K74B 1DVXA 1PG7H 2VXVL 3CN2A 1D3CA 3BH4A 3PHOB 1VACB 1X9UA 2EP6A 3ALPA 1O0VA 4RQQB 2DBJA 1BPLB 2BHYA 3KXFB 3GC3A 4FL4C 3HUJA 5H37A 1CE6B 2Z92B 4XCFL 1F3RB 4DP7X 2VW6A 3EYFB 3TVMC 4G1MB 5DUPH 1U8NB 5ANMB 2D9QB 4O51A 3GTVA 4NKMB 3AG2B 4EIBA 4M1DH 1M53A 2OR9H 3DJ9A 3EJYC 2FTAA 1V05A 1G9ML 2CR6A 4F5CE 2VZ1A 4MA3A 2R39A 1E9PB 2I5YL 3QFJD 1AGEB 3Q2VA 4PVNA 1I8IB 1XF4B 3MUGB 4NQED 4N0FB 1OPOA 1KXTB 3F2LA 2WWOA 1P69B 1JFQH 2CO3A 4QO1A 1VAHA 5GSRB 2EIJB 3PPSA 5EU6B 4K7PL 5C07B 4X9BA 4DTGL 4TRPH 4PJGA 3A6OA 1EO5A 2WQRA 1CYXA 3DX6A 4WK0B 2QDVA 3MLTB 3E2HC 2QPDB 5HBBA 4XN9A 4KO7A 2ICES 2HH0H 1OP4A 1JGLL 2ZZUT 4TLSA 3ARUA 3VAEA 4AEEA 1DQLH 2D7NA 1I9RL 4IBLT 5E94A 3GMLA 2AABL 3HEIB 3VTAA 3RILA 3QWQB 2XQBH 3NFSL 1KLFA 4CN1A 5EU6E 4JE0A 4OZIF 3TCTA 1Q9WA 4F7PB 2YUZA 3PGFL 3QQ4B 5C0JB 2FL5A 4PLJD 2HTKD 1IGML 3UC0H 2F5BH 2ZNWA 4J7RA 5EN3A 1PKOA 1B2YA 2F58H 4J3OD 4XPBL 3SOBH 4M7JL 1R0AL 3LSOA 2IF7A 2NR6C 2R4RH 5KVDH 4BXVA 3MLRH 2JJWA 3IETB 4PJ8D 5EUOE 3D3VD 2X4SB 2Y7NA 1BLNB 1S46A 4U6HA 5IMMA 4J3XA 3ARGA 1T0MA 3FQWA 3J8F7 1EO7A 1MXDA 4LXFA 4UMGA 1DE4A 2QZQA 1UATA 2V33A 4LSPL 5FLUA 5EUOF 1NGQL 1VA9A 3LZFL 3APNA 5B1JA 3N41F 2CRZA 3UTZA 2DYPD 3NIGF 1WDAA 2NTFB 1ZTXL 1JZ6A 4ZMPA 1TYJA 1IJ9A 5DJ0A 3NZHL 4TVSa 1RIHH 2NOYA 3CZFB 2CIIA 2ITDA 4XB3A 3U1SH 1KF9B 1UB6B 2UZIL 4PG2C 1P4BL 4W6WB 5DRWA 4ZYKA 4FC3E 4JFDD 4P2YA 4WK4B 2GFBA 4B9YA 2QPUA 5AUMB 2NY1C 5IWLA 3NACH 3R06B 4OB5L 5KW9H 2G60L 3FQ2A 4MAUL 4ORGB 3H2WA 4IOFD 2HJFA 5HHXH 5MEOA 1CL7I 1BAFH 3S3SA 3QUZC 2V7HA 5AVUB 4UIMA 1WO2A 1N19A 3QQ4A 2B0SL 3DOIA 5E5RB 2B1HL 4OF6A 1F02I 1M4KA 1VZHA 2UX6A 3O6FD 5GRVK 2L8AA 2ZP9A 3I6GA 5BMFL 3FS9A 3FSOA 4H13C 1DFBH 2M8XA 2WLZA 4S1SH 3S5ZA 4Y16A 1MLCB 4NUJB 4ZUSB 1II4E 3KR3H 4HW6A 1S9YA 2YQ2A 4KWUA 1Q9WB 1CTMA 1EXUA 5F7YC 5I76B 4JM2C 2ZCKH 4O58H 5TDOB 4PJGF 3U30C 3T0DA 3MRFA 4LVNC 4LSPH 4BGDA 3SSGA 3H3BC 2X4QA 2Y69B 1UASA 1AO7A 2GIMA 3UZEA 2J57A 4OLWH 3CHPA 1DVFB 4NIYE 4JPKH 4Q4IA 3NK3A 1BAGA 2Y5TA 4HCIA 1NKRA 4UQ9A 3FMGL 1R3HB 3CNKA 3QHFL 3SKOB 4ODHH 2OQJA 1NCAL 4FI8A 4IK7A 5D70H 2YGOA 3U6RB 4JPIA 2KL6A 2WZ6A 4LEXL 1B4RA 5GQBA 2ZE0A 4HJTA 4I0PD 3ZTJG 5JW4Q 1X7SA 3MCKB 1F90L 2X5PA 2E7MA 3G5XB 3MJ8A 1NMAH 4EZLA 1N59A