4QAMB

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
187
structure length
180
Chain Sequence
DSDDVIVPPMDSEKMCIEIVSLAFYPEAEVMSDENIKQVYVEYKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords X-linked retinitis pigmentosa GTPase regulator
total genus 39
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18111 RPGR1_C Retinitis pigmentosa G-protein regulator interacting C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4qamB00
3L17A 4NS0A 4FJYA 2WXHA 2WXOA 2WXRA 1W15A 4ICXA 3W57A 3L08A 3F05A 1TJXA 2WXKA 1W16A 2K3HA 1DJHA 3R7RA 4FHJA 2WXLA 3QARA 1RLWA 4L23A 2UZPA 2R83A 3NZSA 3PRZA 3QK0A 2NQ3A 3OHMB 5T8IA 3SD5A 4NPKA 1BYNA 1DJIA 2K8MA 4HVBA 3IBEA 4PS7A 2QZ5A 3QAQA 4FHKA 2ISDA 2EP6A 3MJWA 5KJ7E 3NSJA 2ENPA 4XX5A 4L2YA 2WXJA 4TUUA 3ENEA 4ANXA 3DPDA 4WWPA 4BGDA 3RPBA 4XZ4A 3KWUA 4OVUA 4A55A 4JPSA 3T8MA 4L1LA 1E7VA 4NPJA 3QJZA 4ANVA 3CSTA 5CCHE 2CJSA 3FDWA 3PS6A 1A25A 3L4CA 4Y1TA 2RD0A 2QZQA 5EDSA 3DBSA 2WXNA 3L16A 4KITB 1WFMA 4QJ5B 3TWYA 4AOFA 2FJUB 4G11A 5JHAA 4F1SA 3M7FB 3FBKA 3QR0A 3HN8A 4FADA 4F92B 1E8ZA 4IQHA 3GPEA 3APCA 4FLHA 4F93B 4AJWA 3B7YA 1UOVA 1DSYA 3L13A 2Q0ZX 3LJ3A 1K5WA 3HHMA 3NZUA 4PS3A 4F91B 2A4ZA 1HE8A 1YRKA 2LHAA 4DNLA 5G55A 2YRBA 3HIZA 5JHBA 2WXMA 3ZIMA 1BDYA 1V27A 4J6IA 1E8XA 2WXIA 4TV3A 2B3RA 4NP9A 1GMIA 1E8WA 4Y1SA 5H4YA 3PREA 2X38A 1BCIA 4FJZA 2Q3XA 2JQZA 1DJZA 1RH8A 4DK5A 2N1TE 2ENQA 3CSFA 2A5UA 3RDJA 2KI6A 1E7UA 1E90A 3PYCA 3JZYA 4QJ4B 2WXGA 3APDA 3OAWA 4IHBA 3F00A 4ANUA 4ICWA 2WXQA 3IM1A 3TL5A 3KWTA 4WAFA 4GB9A 2NSQA 2Y3AA 3L9BA 5G2NA 4URKA 4LCVA 2DMGA 1DJWA 2YOAA 4EZKA 3S2AA 5H4ZA 2CHZA 2V4LA 3TJPA 5CCJA 1RSYA 4LDCA 2CHWA 1DJYA 4BFRA 4LT7A 4QJ3B 4XE0A 2CM5A 3ML9A 5CCGE 3APFA 4EZLA 1UGKA 1WFJA 4WWNA 3QR1A 2BWQA 1E8YA 2DMHA 2ZKMX 4TS6A 3PFQA 4MJJA 4FULA 1QATA 1DJGA 4QAMB 4FA6A 4GNKB 3ZVVA 3F01A 4PS8A 3ZW3A 4WWOA 4V11A 2K45A 3F04A 2K4AA 2NCEA 1DJXA 2CJTA 1QASA 2D8KA 3L54A 2CHXA 1CJYA 4OVVA 4KZ0A 1DQVA 2CHDA 4KZCA 4L1BA 4WEEA 2FK9A 3P2BA 2WXPA 4HLEA 1UOWA 2WXFA 3R7QA 2Z0UA 2CM6A 3W56A 3ML8A 2ENJA 4EZJA 3N5AA 1TJMA 4ANWA
chains in the Genus database with same CATH superfamily
1RCYA 4F7TA 5C0CA 1EDQA 3UDWC 4GG8B 1C16B 5I1EH 3OKDB 4HIIA 3SGDH 5G4OA 4UINH 5D7IB 1MRFH 2A6KB 2IH1A 1DBAH 3OZ9H 1B0GA 3PJSA 4OV5A 1LD9B 1LK3H 3V4UH 5J1TC 1KGXA 4FZ8L 2R0ZL 3IETB 3BPOB 4UBDD 2ZCKL 4JFDD 3UBGA 5KJ7E 5KVFH 2OX5A 5DMJB 3FSZA 1ND0B 4O2CB 2BSBA 4P2QE 5I8CA 1TQUA 2I7OA 1ANUA 3PHQA 2XZQL 1U8IA 4S1SL 2UZIL 3WUWG 1R3JB 3HE6D 1C7TA 5IF0A 1VGEH 3QJUB 2R0KL 4AMKH 3MREA 3WXWH 1RUPH 3SY6A 3NIDE 4FQQB 2HVKA 4ZFFA 2BXYA 2MCPH 3F8UB 4FLRA 2VL5B 4PGCB 2XWTB 2Q2LA 3BT2H 4KTEL 4LESA 2J56A 2ZCKH 1F3DH 2ICEB 1U95A 4HWZB 2CALA 5IJCC 5EORL 5F7YC 4ODWB 5JW3H 1C08A 1RPKA 2IDSA 3KPPA 4AM0Q 4HEMA 1NC2D 1E4WL 3CDGB 1YMHA 3HE6C 4UT7L 3CN3A 3IU4L 5KSAC 1GAFL 2EDXA 1RH8A 2O6EA 4JMNA 5I6OA 1OARH 1FNSH 4MZIA 4JKNA 3UX9B 4PJDA 3E9TA 4ZUTA 2UY7B 4G43A 1CGTA 3L6FB 2NNCA 4BRVA 4GS7B 2GSGA 2QT6A 3VAEA 4HWBA 4PJDE 3EJSA 4OKVB 5J11B 3QZMA 4KK6C 1F6LL 3JWOC 4I18C 1TQBB 1Q9OB 2PCXA 1DLFL 3B9EA 3X1BA 1E4KA 1JF6A 2VT0A 1S7QB 3TFKD 1DYZA 3TP4A 4PCYA 2NNAB 3KG5A 4GSXA 2A6DB 5I1GH 3O3DA 4R0LC 2FQDA 2HKAA 4ZMPA 3G04B 4BK8A 5J6SA 2EVFA 1Z0NA 1GGCL 2QKIA 4J3TA 4OZIE 4W93A 3QDGB 2A99A 3F7QA 3LN5A 1OAZL 2W1NA 3FS9A 3DSFH 1XFPA 3NFPA 3NDYE 2YJLA 4AT6A 1HVXA 2AJSH 3NCYP 35C8H 5FYJD 3SDDB 5J11C 2HKHH 1UJTA 3V4PA 2AMUA 2XQYA 1A21A 1H6UA 4HWNA 2WKOA 4ZODA 5E7BA 3O41A 2EDEA 3DOSB 4TXVB 4QTHB 2FECL 5CEZE 3ROOA 4YEEA 3EUDA 5KSAB 4JB9H 4DCQA 3QJSB 1FL5B 3ME0A 4WGWB 5LLIC 4PWJA 1HEJC 2B9BA 4MNHB 2HTLD 5T1MB 5ITFA 4BFNA 2UZPA 5C6WH 1H19A 1GR7A 4DIXA 4OJFL 3RVWD 5D2LF 3T08A 3EH5B 3NEXA 1QLEL 4IBSA 2EC9U 2P80D 2A77L 3MO1B 4NQVB 1YEHL 4NQCE 4RAUB 3VVWA 5CEZH 4ANXA 4H1LB 3RWFB 4DUXA 1LO5A 3T65A 3HN3A 1HWHB 3TF7C 4NUJA 2YHGA 2P44B 3U0PA 3VRJB 3U0WL 3IDMA 3CZNA 4HSAC 4IHOA 1T21B 5EZOH 4ZFOA 3GHBL 2MQCA 3SOTA 4XN7A 4U1SB 1FYTA 4HHAB 4G7VH 3AWFA 3NSCA 2B1HL 3NBNA 3HN8A 5K93A 3UBHA 1BLNB 2IQ9H 2X7LB 3L9EA 2GJ6D 1XZWA 2XY1A 4POYA 2YMTA 3LJ3A 3DETD 3K6NA 4HBCH 2K6ZA 4HPYL 5HHQA 3MV8A 3O9WB 4FQXC 5EUOB 2GEEA 1UWXK 4PPTA 4WLCA 3M17B 4KO5A 3U6RA 3SDDD 3OKEB 2VRKA 3MR9B 2LLNA 3I02B 1CG9A 2VZ1A 4NQSB 5AENA 4BWUA 4PBXA 4J4PC 2VM4A 4I8DA 1C9SA 4FN0A 5D7SL 3L2NA 1G7QA 1XF3A 2WSKA 2J3SA 5JYLA 3VCLA 3Q2NA 1U8JA 5L2KB 4RMVA 5HYJE 4M5YL 3U25A 3Q5TA 4P46D 2WAQA 1NMBL 1ZHBA 2X7LA 1BLNA 2FX9L 4UZGA 3AUWB 1JIBA 4HXAH 5EFIA 1XSIA 3ASNB 2VR5A 4OQTL 1S7UA 3GJEA 1OXYA 2WYTA 3IPEA 5L8LB 1VDGA 3GS7A 3TBTB 3N40P 3IDMB 1ZVNA 5DLLA 4Q4IA 4FXGC 4D7PA 1N26A 4N24A 3B83A 3BGFB 4FQIL 2DS4A 2Z0BA 3QZWG 1E4HA 2QSVA 4KVCH 1FQ9C 4NGHH 4NZFA 2CU9A 5ISZE 1D5ZA 5IGXH 2GT9B 2NY3C 3V4VL 5HY9B 3MOAL 5AD0B 1I7RB 3EGDA 3SCMD 4HALA 1AYOA 3PGCB 4U1IB 1R3IH 4MNGB 4WFFD 4WHCA 4UILL 2Q10A 1CVRA 2C9XA 4GY4A 4GINA 4KKPA 4U1GC 2ZXAA 3CFNA 1OT4A 3ATDA 3D2UA 4JO8A 3H7LA 4OQTH 2J1KA 5C1MB 3ARSA 4F9PC 3CMOH 1SOQA 4GXVH 4L29B 2VO8A 3SBRA 3BQUD 5JYMA 4HU8A 1Z66A 3WMPA 3K0YA 3UO1L 3Q48A 4L23A 4Z6AT 3MA9L 4NRXA 1J8HE 4LHJB 4P5KB 1AP2A 1HHGA 3VSTA 5I71B 1K5NB 2ZWKA 4R0LB 5J5EA 3TN0D 5B38G 1OLLA 1PYWB 3FXIC 4MA8L 2C8NA 4P9HL 3WHXA 3FCBA 2XWZA 4XZ4A 3G6AB 2CIIA 2H26A 1GZQB 1A7QL 3H9ZA 2VMEA 2I5YH 1QRNA 1L7TL 3HC4L 5EZOL 3CMGA 3LN5B 1KB9J 4TVUA 2XV3A 1T1XB 1YG9A 4AG4L 4NQEE 1BG9A 1WICA 2OKMA 4LQFH 1T7ZA 3MUJA 4NZRH 5BCAA 5F9OL 2B7DT 3F58H 1S7QA 5IT2L 4OM0H 1AXTH 2CRIA 4DPBX 1KMGA 1BM7A 1AI1H 1ID2A 5EIIB 4PRNA 3LS5H 4I4WB 2BJML 3SDAC 2JJTC 3OAZK 3MRFA 2R0WH 3BUQA 2GITA 4B6ZA 3WLWC 4EKXA 1Q9WB 2AQTA 1X5GA 2VISB 1NBYB 3II1A 4OD3L 4Z7NB 2PETA 3IKCB 2ZONA 3NCJH 4P2QB 2VDNB 3RDJA 2Y2TA 2ADFL 2VKXA 2WWNA 4OCMC 1A4CA 2VN7A 4QHLB 2LT9A 1MQKL 1F6AA 3EOAA 4RSVA 4BRJA 3DUUA 3U6XA 4JM2A 4U1LB 4U1LA 1HAUA 4M8QA 3TYGL 5EPMA 2DV6A 1MFDH 4QRSA 4WJKB 2YOAA 4DKEH 4GIOA 2J71A 3IWVA 4UQ2B 1OTTC 3QHFH 5DQ9A 4YSDA 1XD1A 2OK0H 2XA8H 1DJYA 4JHWL 4DGIH 3IKCA 4P2QA 4FQQA 4ZFFB 4GI8A 3SE3C 1CGSL 3MREB 1SZNA 4X5WA 5F88A 5I6KA 3FTSA 2VLME 1BF5A 2AQ2A 5E4OA 2DQEL 1M6UA 2WCSA 2G3XA 3DX4A 1J1PH 3E6FB 5L7XL 2OTPA 3EJZD 2DJUA 2BSRB 5D1XB 3VXUA 1D5MA 1KCUL 2OCCB 4LDOB 4PYHA 1KJVB 1OEZW 4EXPX 4XX1G 3CJJA 3TPUA 1PD6A 4LRNL 3Q9QA 4FCHA 4JRWA 4L9LB 4WUUE 2EKSA 1PG7W 1JNNH 3WIHL 2VR3A 1L9QA 4F8PA 4N2AA 1I8MB 1E2ZA 1J1OH 1DCEA 1FVEA 1ORQB 2H5UA 3DJ9A 2WANA 3QDJE 4ZFZB 1EO7A 1QRNB 1MCJA 4K8RH 1M71B 4NDMB 1FNSL 2CKBB 1D6EA 4ZSOB 3SBWC 4TNWF 3EFDH 1IBYA 1R5VA 3CVBA 3WIIH 5C0CB 4F7TB 2PW2B 1UXSB 5D1ZA 4X6CF 2WXLA 4YDMA 1K5NA 1XCQA 1T4WA 1HWGB 4P46A 4P5KA 4KKBD 3SE4C 4NRXB 3PWJA 1KDIA 2OTWB 4E0RB 1CDUA 4C56E 1CLYL 1AS7A 1JXJA 2NY2C 4NZRL 4N22A 3PIQB 2Q86B 1AC6A 5D7JA 4AH2A 2OZNA 4AG4H 2OL3A 5BRPA 4GUPB 4LSRL 4JPIB 4PY8J 2ZXBA 2ZUQC 1E65A 4L3AA 4B9YA 3RURA 5IIEB 3T6QC 5HYSA 4ONFL 5I1LA 1BZQK 1UEYA 3BWSA 8CGTA 3VB9A 1SOSA 2X05A 4N2CA 5KYYA 1KGUA 4N5UA 5J13C 5GHWH 3SPIA 4G1MB 2XZAH 4XPFL 2VLLB 3PL6C 1DUZA 1IFRA 4QRRD 5HDQH 4MA3A 1AVAA 3QFGA 1IGYB 2VM9A 3VG0H 2EDBA 3UG4A 3MUUA 1AQHA 4JPQA 3KWWB 5EEYA 1IAOB 1RZFH 4FTDA 3WLBB 5BOPA 3NN8B 3E2HB 5DMGC 3GF8A 4LO9A 3MBEC 3PQYE 4OLEA 1Q9KB 1KGCE 4J39A 3HNVL 3B2UD 1DQTA 3DOIA 3B9AA 4GEJA 4L4TB 5I18H 4XVJH 1F1GA 3PAZA 5DFWH 2J1WA 5FHAL 2R1WA 1NCHA 1CG9B 1XBDA 2EDKA 2JE8A 3Q8BA 1BVKA 1WIUA 3OKEA 4KJWD 3RL2B 2IADA 3WTSA 4X4XA 5K39B 2DQ6A 5LG6A 4NQXA 1ACYL 3L4YA 4H1LH 5KSUB 1OVZA 4DW2H 1JGVH 1I1AA 1U8MA 4WRLA 2QJDA 3BMWA 3U7YH 1C5DB 2DQJL 3NK3A 2VRAA 4PRIA 2V6HA 3JQOB 2DYPD 4PFEA 3SDXA 3O6LL 3DX6B 4Z7QB 5TE6L 3UAJA 4AXWA 1M3IA 1MHCB 2XVKA 3GMQA 3HPLA 3OMZA 4KAQH 4WO4B 4WUKH 1WFNA 1TO4A 2JSFA 3FF7A 3LY6A 5B1JA 3ZTJG 5I8OH 5GSRB 4JEGB 2B0SH 2DYPB 4IEFB 1AXIB 2ENJA 3GSWB 3VRJA 3V55A 4FHBD 3MLRH 1OP3H 5GGSA 4MJ6A 3PDOA 4MZ3A 4OF3A 1HX0A 1HCFX 3N1QC 1T2QH 3FQ1A 1NGZB 2X6AA 1A6VH 3WJLA 4ZPVB 1NGYA 3HZMB 5JHLH 3LIUA 4K7PX 3RVTC 1TDQA 3NK4A 3P3UA 1BYNA 1MPAH 1XAUA 5E8OA 2ISDA 3EHBD 4CVWA 1GJWA 3FQYA 4GXUN 5DK0A 1BWWA 2XDHA 4E42B 1HEZA 3GXDA 4WU7A 3ARRA 4XPAL 3MPCA 4ZNCD 3BLPX 3CH1A 3SDYH 4FQJL 3F3HA 2WXNA 4APQB 3CHPA 2NY2B 1I85C 2VOTA 4KWUA 2ICWI 1QSFB 2GTQA 5IVOA 4NENA 4FXLA 1H6TA 5HBBA 1H3PH 4AGOA 3MRKA 4L37B 2AGJH 4PSPA 1N64H 3OG6B 3WL9A 3WS3B 3FU7A 2ZWNA 1ZLEA 1QR4A 2I9TB 3T1WA 1VCAA 3LAFA 3DPBB 1XGYL 1JF1A 1YRKA 3OJDA 3S96A 4AIZB 4Q0XL 4LL9A 3PXLA 4Z3IA 1KEML 4MVBD 1E8WA 5J89A 1YO4A 4KJWC 5F7FA 2ZWZA 4A2GA 1CFQA 3BSHA 5DHYB 3ZTJH 5KBNC 1BQSA 5T5FL 2X9WA 4KK9D 2BX5A 4GB9A 4FYQA 2AQ1A 1NFAA 4Y16D 3DVNB 4KK8C 1PZ5B 4HULB 4L4VD 3FK3A 4GG6A 5D1XD 4PJ5D 4XB8A 4L18A 1BIHA 3RUGE 2VR7A 3FB6B 1NFDF 3BQVA 2YQ2A 4P5TD 1A1OB 4L4VB 3A6OA 3CZFB 3TCLB 4DW2L 1GC1H 2HPOA 2Z8WC 2VB5A 2WNXA 1IGMH 5C9JB 1AR1D 3VX0A 2B0SL 2X0VA 5DYFA 1WZMA 1KTRL 2JJSC 1J0JA 1NBQA 5F1SA 4QRRE 2H3NB 4L37A 4KZ0A 4AWJC 1IBGL 2IOOA 1SYSB 2MIZA 4G1EB 3QXDA 1GCYA 2VQ1B 3RX5A 2O61A 4LSPL 2FJSA 2NXZB 5E2UH 3G9VA 1BEYH 4V1DA 3GMOA 5SWZB 4ANWA 2W9LA 2LABA 2AJXL 2ZNWA 3RZWA 2DWDA 3DXAE 3MROA 1CXEA 3VMOA 3ETBF 1MJ7L 4ZTPH 3QDJA 1OK0A 3SDAB 3PWUB 1EHLL 2G4EA 2X09A 1ZHNA 4WFHD 2AQRA 3I2CL 1HDMA 4G9DB 1E4KC 3X12B 1FRGH 5T3XH 2E7HA 1QTSA 3TFBA 2Z92A 1NJ9B 3S5YA 2ZNXA 4QXWA 2QSCH 1VZHA 1UUNA 2BS8A 3G5XB 4FI6A 4EUPB 4HK3J 3RPBA 3HRZB 3J7HA 3U1QA 4WUUB 5DQDH 4QRRA 5KVMC 4FQJH 4X9HA 2R4SL 3GMPA 4WNSA 3MRBA 4N0UE 2XWCA 1A3ZA 4HPYH 1O9ZA 3VACA 2Y06L 4BK5C 1AIFB 1IFHL 5IESL 3E2HC 1IGIL 1EJOH 4U3XA 3HUJE 1MCQA 4S1QL 3QWRA 1ICTA 2TRHA 1G4RA 4K0OA 2C5DC 1XR9B 2L4OA 4I13B 4DP7X 1H3VA 3NRFA 1ZWIB 2O4EA 4N0CD 3BYTA 2G9HB 3NH7H 2VLRB 2WM0A 3U1PA 1SVCP 4OZHE 2WZ5A 3QFJD 4N2MA 4PWHA 4Y5YA 5AVRB 4NZUL 4ZO8A 3EFDL 4PLOB 1I3GL 1OM9A 3W9DA 2OR8A 3G3LA 3KLQA 2QMJA 2GJ6E 2FJFB 4JREB 3EJCA 3P9MA 2R1WB 4KY1L 5A40E 4D0BB 3L3OC 1YNKL 2DD8H 2VDLH 4M56A 1WVZA 3HS0C 3GSQA 3BIBX 3QJXA 4S0TD 4JNXA 5I16B 1TQCB 3S37L 5A6LA 2YSSA 1I7TB 3JWDH 4XNBA 4HVBA 3HZYA 2W5PA 4H2CA 3FT9A 2N59A 1Z0MA 4PP2B 1T22B 3VXRD 2F61A 5KSVA 5C0BE 1OAZH 3I9IA 3V95A 1BFSA 7FABL 1NBVL 4NQEA 4IOFC 3LXCA 5DEGA 2WTOA 2NYYD 1W0VA 3DUSB 2A9DA 1ZCRA 3IS1X 2YD3A 3LEXA 1L0XA 1KTBA 2WLIA 5A2BA 4PS8A 5K69A 1TEYA 3DI3B 3FFOA 4K3JL 3WTUA 1XSKA 3BQUC 3SPGA 4WDIB 1BGXL 4MLIA 5D2NE 4UOZA 5LGYA 3PQYB 1RK1A 2APBA 2NT0A 4NQDB 4NZ8A 2DQIL 2IPUG 2AXGB 1IC7H 2FO8A 2PPEA 1OPGH 5IVXE 4L2LA 2F5BH 1M7DB 4ZT1A 2E9WA 1UC6A 3L08A 4AEIH 4GI6A 2ALWA 4L4VE 5AW8B 4B9GA 2FJHB 2RTTA 1YYMH 1RV6X 3DC0A 2P8PA 3EF4A 2IALB 4KZDL 1S9XA 1LTXA 5I18L 4JFZH 1QLFB 4IBLT 3FO2A 5F9OH 1RZKC 3FPXA 5DJ2B 2CGYA 3L5WB 5J1AA 1JZ5A 5IEHB 1IAKB 5BZZA 1DVYA 3PJNA 1QLRB 4N0CC 1AY1L 2E9BA 3OAUL 4Z95H 1MCHA 3FC8A 4G8EA 2AITA 5SWZE 2RALA 2RD0A 5I1JL 1JPST 2KZKA 4XNYH 1NANH 3BAYA 4X4KA 2Y5EA 1M53A 1A5FL 2LLGA 3WEMA 4L9LA 5KW9H 1DBML 4X7TB 2BNRE 4LPXA 4M93C 5E1AA 5GRUL 5H35B 3V6FA 4G9FE 4DPRA 2XZZA 4FF9A 5F3HA 5DWUH 1BX2A 2COQA 4P5MA 4A1RA 3PXHA 4JFQA 5D1XA 4YO0A 3VXUB 5B8CB 2MCPL 1WLHA 3GNMH 2AQPA 3DMMA 1FCGA 5HYQB 4F7EB 4TV3A 4E5XG 2Y7MA 1YVLA 1QNZL 4FJZA 2JQZA 3HPJA 3MLXH 4NFBA 4ES9A 3CSFA 3MRGA 4GO8A 4K8RC 4OAWB 3WEXB 3OKNA 3OR7B 1OP3K 5KN5B 3MLUH 2IAND 3BEVB 3QT2A 4CILA 1CLOL 4YXKL 3D51A 3RVXC 4H8PA 4BH8A 4QHMB 3OR6A 3LNGA 1QSFE 1MHPH 5I24A 4TKWA 3RWGA 2JIXD 5FDWA 2IAMC 4RVBA 1FSKC 3FOMB 5F9AC 1PX4A 4JG9A 4ADGA 1JK9B 2X2JA 2LU4A 4BFEA 3VU1A 1EUTA 3CCHA 4V2CB 4DN4L 4EI6B 4BCZA 4FXKB 2GITB 2WUBH 4UILH 4LCUB 4TUOB 4K7PL 3U1SH 5HD8C 3IWUA 1QOKA 1MREL 4XNQB 3OX8B 5CD3B 2MOGA 4GKZB 4ZS6C 4AYDC 1DE4B 4QXTB 4FG6D 4WEEA 1E28A 4PJFE 3VFNA 4JUSA 2O6CA 1OQXA 3QXTA 1O5PA 3DECA 3S34L 2G5BB 5FB8B 1OGSA 4DTGL 4X4YA 3FCUB 1TZIB 4I88A 1SN5A 5FC9A 4JPKH 3DO7A 1UOKA 4JFHE 1CIDA 3LB6C 5EZPA 1UWFA 3L3DA 4BWWA 1U8OB 3LXUX 3QCVL 4M5ZL 5EO1B 4KJQC 5FM8A 1NPUA 1FGVH 3C6SB 3B56A 3L1FA 5C7XL 4BKLA 4NEHB 3RVWC 4EQ2A 1OCCB 2Y7NA 3OL2A 1AZBA 1DL7L 4JFDB 4KJYB 4MNQE 1I9IH 3O2WH 1G0XA 1GKOA 5CP3H 4X0NA 3S88L 4PLJC 4QOKB 5GJSL 1G7MB 1SJEA 3EZJB 4LQFL 4U31A 5FKPA 2DKUA 3UPRA 1V05A 5F7WC 4G8FA 4P49A 2WN2A 4HA1A 2APWA 4R26H 5E8EB 3V8OA 2X28A 2Y36H 2YAHA 5SX4I 2DYSB 3BGMA 2OMTA 1PY0A 1QVOB 5GGQH 3A0OA 3EGDB 3MRMA 1YLBB 1JGDA 2QSCL 2ZSVB 1ZLVH 3H54A 2Z31C 3B2VL 2YD4A 3D4ZA 5DZVA 1LMIA 5MEPB 3MKGA 4G9FA 3LYRA 4G8GA 3GRBA 1TQSA 2B1HH 2DWTA 3C9NB 5BXFA 3QNZA 3ECVA 3HC0A 3GHBH 5GGTH 3Q9PA 1UB6A 3BIKB 1IGTA 1KFAL 3LEVL 2MFNA 3R06B 3MRDA 3RWEA 2OL3L 2X1OA 3MU3A 3SGKA 2DEYX 5INDA 3HTLX 1BXUA 2EJ1A 4NAJA 4YSTA 2Y69B 4HKXA 4UCFA 4R7DA 3TA4D 4MQ7A 3BH8A 2ZOKA 3DI2B 5FW7A 5I8OL 4AUJA 4G9FB 3ZDXF 3SPJA 1MCDA 5TQ2H 4OGYH 3EDDA 1OHZA 1ZLWH 4OCWL 1KV7A 2RR3A 1Z5YD 3HZVA 2EDYA 4LASL 4ZW7A 2G5RA 2WUBL 4G9FD 4OF8A 3U9WA 1J11A 3DIVA 3FU3A 4WV1C 1T89C 3MACL 4M7JH 3BAEL 4K71B 4U6VH 2QQNL 3HRPA 4A2LA 5IHUL 3UXFA 2YEZB 4Z7OF 2DN7A 2SEBA 4U1NA 5F2FA 4N3TA 5HHVL 5C7ZA 2DL2A 3BZ5A 3MV9D 1QPPA 2N7SA 3LQMA 2IG2L 3L3OB 5BO1H 4JFDA 4KJYA 3C5JB 3ZL4L 1KLUA 3DROA 3EHBC 1OQOA 3MLUL 4RQQB 4ECNA 3MV9B 2E86A 3SKJL 3EH1A 5B3SB 3MJ7A 1U8OA 2WQWA 1Y6MR 1A9BB 5BUAA 5HI5D 2VXQH 4HJGA 3K72A 1W2KT 1WAEA 1ZXQA 1D7BA 1FDLL 3MV01 2VDPL 2W0FA 5C0FB 1XB3A 3JT2A 2GJZA 3KYNB 3H2PA 4NCC1 2UXFA 5C0GA 2BHYA 3FT3A 3VFNB 5DRXB 3WEOA 1EFQA 5FKAB 4J8RA 2QQKL 1DE4A 4LBAA 1WZ1L 5CJBA 1INEL 3EYUH 3ENEA 4LF3A 3RPIB 5ID1B 4LP5A 3SHSA 1F4YH 5CCHE 5B39G 1SNRA 1WQVT 2PYFA 2KLSA 1JI1A 4YHPA 4HPHA 5DJYA 2CLVB 4XBPA 2CO7B 2CO3A 3OPUA 3CFJA 1I75A 2CA3A 3QCTL 2EKJA 2Q6WB 1HSAA 1MF2L 2QL1A 3RVUD 1MIMH 5HHMD 3FOMA 3R0MA 3SY0A 1YY8A 5D1QE 4UQCA 4PB0L 1SEQH 3HMXA 4F91B 3SE6A 4OT1H 5I6LA 5HVWA 1JL8A 3BH4A 4XOEA 1CFSA 4YHMH 5K59F 3S5ZA 3SIKA 3LZPA 5KYNA 5E2TH 2Q2EB 3EFOB 4JUTA 5I1EL 3ILEA 4M93B 1CI5A 4RFOL 5C3IA 1IEHA 1NL0L 2AEIT 1OALA 3PGDB 1HQRB 1A66A 5B1BB 3HZKB 2IBBA 1NCUA 4CKVX 1P5UB 4OF6A 3ARZA 3A23A 3V9FA 5GS0H 2K7QA 4QTFA 3V4LA 4ZXBD 3CH8A 5IB5A 4HMDA 3MUHL 1SF5A 4KTDL 4YHZH 2LFEA 5DURD 4FLQA 4RAVB 1TVBB 4YZFE 1WC7B 4JFEA 3EBAA 3PAUA 1JZGA 3VXUE 1F90L 1NUGA 4Q89A 1NIDA 2XKNB 2GK0B 3KXFA 2RACA 4HIQA 1G7PA 3FRPB 3RZCC 5M7QA 5G4NA 4GRWH 1QATA 3KNBA 4JHWH 2ZT9C 1Y18B 2LOEA 3K2IA 2K8QA 2ZKYA 1A8JH 4DGIL 3P77B 2Y07H 1M42A 5I17B 1J5HA 5C0CD 1NAMA 4IRSD 4R3SB 3BSZH 1U95B 3NFSL 1Z1WA 2YJQA 5I75C 2DL9A 2Q87A 5CGBA 5I2IA 1NUNB 2R23B 1I7ZA 1JV2B 3MA7B 5GS0L 2WXFA 4FX5A 5BRZB 3NA9H 4TQIA 1AHWB 4F7MA 2JCCA 2GTWA 3IEAA 1Q9LB 1BAWA 1KBVA 4FKKA 4WHTA 5ILTH 2XUWA 2ZICA 4P5SA 4YVNA 1EAJA 2WXOA 5E9DB 4L3CA 3GSNH 1HZLA 1H3WM 2R39A 2JCCE 4N26A 4PJ9B 3T9WA 1L0PA 4H8VA 3MBWA 2HLEB 5D7HA 3IETA 4G5ZL 3WCYA 2AXGA 3QK0A 4H8WL 2WQXA 1KJMB 2DJSA 1FVDA 3TYGH 3S36H 5E6YA 3CZJA 1HIMH 2QZ5A 2A6KA 3ZN6A 1R5WB 3G08A 3SBWA 1QHQA 5MEQA 3BT2L 1INDL 4YR6A 2WHVA 2BS9A 1TJIH 4RGNE 2X3BA 4GG8A 1S9KC 5JPNA 3QPKA 4XGZA 5E08H 1QSEE 4Q52A 2AF2A 4HSQA 3ZSTA 2H0JA 2O72A 1LWRA 4QCIA 5EDSA 1LQBC 1MFCH 1MFMA 1E6JL 1PVHA 3VRLE 1CICB 2AANA 4WI7A 5HGAB 3CVCA 4D8OA 2RH0A 3O8XD 3WNOA 3AC0A 3FBKA 2B1OA 4MZ2A 1Q4NX 1PNDA 4BA0A 1KG0A 3OKMB 1J0ZA 1U9KA 5K9OB 1LE9A 1SMDA 4DN3H 1S3RA 1BFOB 3TA3D 5AW3B 5E2WH 1XGUA 1KPVB 3Q1SL 2JELL 4N20A 5H4YA 3VE0B 5KBKA 2EYSB 5ACLA 3UTQB 3A47A 3EOTH 4UB0L 3QUYD 1BYPA 2ZIDA 4MB4A 3UEZA 2P5WB 3UZQB 5C0IB 5C0IA 4MXVF 5FA4B 3BAWA 2L7JA 4IYKA 4GKSB 2A4CA 3APDA 3I6LE 5C0DA 5SWSA 1KXQE 4AYBA 4BFJA 4F15C 3IM1A 4PM1A 2HRPH 3TL5A 1OTUC 1I8KA 4FS0A 3V4UL 2CO1A 5L88H 3P9LB 3S2CA 1CIUA 2OBGA 3O4LA 4PP1D 5H4ZA 1KG0B 3HRZC 1U8KA 5E9DD 1PLGL 3KYAA 3QUXC 4CW1A 3QC6X 4D2NA 5TDOB 2YRLA 2XKSA 4CC4C 1SRDA 4AE1A 2OMUB 2P42B 4AM0A 3N44F 4PRHE 3FFCA 4AEIL 4FCAA 1CICA 1WFJA 1A47A 2RJMA 3TT3H 4HKJA 4N28A 4R2GB 2VLKA 5D1QD 1ZLUH 3LXBA 5FO8A 4MMXB 1E9PA 5C3TA 3WE1A 1JWSB 1WISA 3GZQA 2FUQA 4KOBA 5D93B 4F58H 3GINA 2K45A 1JZ3A 4TNGA 5CHNA 5JMOC 5C0BD 4KZCA 3VFOB 2FT7A 2ID5A 4LVHB 3U9PL 1FVDB 1RJYB 4J3OC 3UG3A 1HDMB 1KTLB 3PABA 4G9DA 3X1GA 2A4EA 3VXSA 4EN2A 1FC1A 3UZEC 3KE0A 1IE4A 4P06A 4HYTB 3MZTA 5FA3B 3SDCB 1NEPA 1IGCH 1LXMA 2ZXEB 1ZANL 4OTXH 4A39A 2CGZA 4S2SA 2DM7A 2XBDA 1J8HB 4AVJA 4L3CB 1E5AA 3DARA 5E9DA 2X4NB 3P4MA 1G6RA 4EVNB 1P84J 5FWRA 4PRPE 3JWNH 2BJMH 4O02A 1GYUA 1IM9A 4K4KA 3PUCA 4NT6B 4JCLA 3MOQA 5KJ4A 3DYMA 4O2FA 3O6FD 1QWNA 3QAQA 5EU6E 1DANT 3V4PH 3PNWB 4YHLH 2ATPA 4Y19A 1WFUA 4LMQE 2BMKB 3P77A 5I17A 4JANA 4M62H 3GGWB 3T77A 4BQ9A 3CSTA 1CU4H 3K74B 5EU5A 1AS6A 4JKWA 3AQDA 2Y5TB 1WZLA 2Z7WA 4JO4H 4OD3H 1DN2A 2YARA 1LWHA 2OMWB 4X6DE 2AI0L 3BE1H 3RTQD 3AZUA 1NIAA 4FQ1L 3BPLB 1C5BH 1KCRL 1S7SA 5D9SA 3T09A 3H7BB 3BGAA 4FADA 3CTTA 2AHIA 2UXVA 2RFXA 1OAUL 5E2VL 4TSCH 1HHIB 2QVKA 4K23H 3ARED 1DN0A 1REIA 3MJGX 3CK0L 3K6SA 3QCTH 2AXHA 3GK8H 1WUNT 3EJPA 1MHHA 4IOSD 4YDJA 1NEZA 3LH9A 2E56A 4G7YH 4L05A 3MGOB 4TUJB 4UQEA 3D0VB 1OB1B 3VJ6B 1PAZA 5C0EB 4PGEB 3HHSB 3B4NA 5I8EB 2VN4A 4B7IA 1E3XA 4WO0A 3IGFA 3Q3GB 4APQC 2WXQA 3BT0A 1M6OB 5F7LB 4KK8D 1IC4H 3QQDA 2VDPH 1K4DB 3R8BB 3UG5A 5BZWA 3WL9B 3WS3A 4OGXL 1JPFA 3TFKC 4Y9FA 2YPLD 4KVCL 3LH2H 5D70H 5FGRA 1X4ZA 4JPWL 1AFVL 3MGOA 4RA3A 5LCVL 3PP3H 4RISH 1TETL 3PG2A 3O3AA 4CC1A 3JVFC 3LH8A 1N12A 2FL5B 2KT6A 4JKPL 2C9PA 1BPLB 3F64A 2IFFH 4LOFA 4Z7WF 1P7HL 3IJYB 2BC4A 1BOGB 5DYOB 4ALAL 3EXLA 4PJXF 2Y22A 3I3EA 1OOWA 4JO1H 4QT5A 5FDYA 1P5UC 2HJFB 1OOAA 5B38B 2O5XH 4R7XA 4NQQA 1WEJL 1D7CA 4JN2A 2GUOB 5LAXA 4WEUD 2Y5TA 3DV6B 5D7JC 4OJCA 4GSDH 2YXMA 1NCOA 4OLZL 1M57B 1U91A 2YLKA 1F58L 4XZUA 4XN1A 3T4YB 4JANB 1QTYT 4DUVA 1P9MA 4UYQA 4BBWA 1X7QA 5BW7A 3DKHA 4AIEA 4IS6A 4N8CH 5AQ0A 3WJMA 4S1DC 2ZKHL 4BCXA 2OSYA 3GMQB 1OCWL 4B3VA 4ZG1A 1X7TA 2SEBB 3EFFB 4HWBH 1U36A 3RB5A 4J2QA 1JMXA 4XZUB 4GJTB 4K9EH 4NPJA 3LEVH 4NUMA 1LK2B 3REVA 1KIPB 4FFYL 3FDWA 2EIEA 5AB9A 4WKZB 2Y6TE 3RGVC 1IEBA 1RUAH 1RJYA 4KX9A 2V0AA 3IGAA 2ZYHA 3W37A 2J8OA 3D3VD 5DHVH 3ISWA 1ITBB 1CF8L 4GSUA 4Y5XC 5KVFL 1CT8B 3MNDA 1AKJA 1EEQA 3AITA 5ANHA 3KMDA 1EZVY 4F5CE 4JRXB 3V0WH 3FO1B 3FSOA 4POZD 4S1RH 5C8JB 1KTDA 5LB1A 1GZHC 5FV2A 1MUJA 1PPIA 2YRPA 1GH7A 1IRAY 1X9QA 2XG4B 2XV6B 3GEFA 5AVXB 4A38A 2GCYB 3B3BA 5LQBH 2O26U 2PCFB 1DFBL 4M62L 2ENQA 4NOBA 1UJ3B 2BCKB 4FEIA 4MA3B 2W80C 2EACA 3KPNB 1U8KB 1YN6B 3CLFL 1EERB 4HUVA 3QQDB 2EILB 2WQ8A 3ZUCA 4DQOL 1UG9A 1BZEA 3TO4A 1DVUA 2PWHA 4ZUSA 1B0IA 2QTVA 1AGBB 2HT4C 1ZA3A 1NMCC 4YBLC 4AUYA 4C4KT 3RB7A 2HKHL 4HIXH 1Q94B 5D7LB 3QQ9C 3II3A 3KW8A 1EDHA 1A3RL 4KI5E 3O6MH 1T2QL 2P5WA 5IVXF 1TMCB 3KLSA 1U92A 4LCWA 5FGBC 3ULVD 4D8PB 4JFXA 3RJDA 4G8FB 5DDHA 1J1OL 1I82A 5FCUL 1N6QH 4JG1H 1XCWA 4JFSA 1TEGA 3ZW3A 5K9OA 5HI5C 1SJEB 2D7PA 1FYTE 2YKLL 2QELA 1P4BH 4F37K 2RBLA 2OTWA 3H3PL 3H7BA 5FF6A 5IB1A 3FU9A 3ZX1A 2W0KA 2XQYK 1A7RH 3MRQB 3S0PA 3BMVA 5F8RC 3SDXE 1TTFA 4OLXL 2AEPH 2OMWA 4UTBH 5JNYA 1JPSL 3FUEA 2PW2A 1N5AB 3OAYH 1I3GH 1OGTA 3NCJL 2AK1H 2B9AA 4G5AA 1SOXA 1DDHB 2GJRA 1CE6B 1GZPA 3D9AH 5I5JA 3CVHA 3B43A 2EDJA 3FH7A 4NN7B 3ISRA 3B1UA 2PXYB 4JM0A 3HNVH 4GAGL 2EKSB 1FLRH 2YFOA 1ILUA 1OSZA 2GY5A 2FB4L 2YIHA 4DETA 1TZAA 4OLUL 4QGTA 1NC4A 1MQKH 2X4NA 3JVGA 4Z0XB 4GKZA 4G6JL 5ALBL 4YWGH 3IPBA 1QUNB 4ZMTA 5JIDA 5KZCD 3N6YA 3BI9X 1GA2A 4XBGB 2UWEB 3CSBA 3LPOA 4KKRA 4Z7UE 4EIBA 1MEXH 5F70A 1J86A 1R0AH 4YDVB 3B7SA 1NCDL 4PI2A 1VFMA 2PYED 4F37F 4ENED 4JFFD 1GL4B 3AY4C 3VI4A 2D73A 4PJCB 1KYOK 1S5HA 4Z9KB 2YZ8A 2IPTH 2BNQE 1IQWL 2N3JA 4MCMA 3EOAB 4Q7DA 4QO1A 2D0HA 5GZOC 3LD8C 3WLWD 5EEVA 5E1GA 5HDLA 2PMZA 2NUTA 1P2CB 3LZNA 3J2PA 5D8JL 3ZY7A 2KI6A 1E90A 3BZ4A 2VDKH 2WXGA 5K33A 4DGVL 1F8TH 2XQYG 2KC0A 3RVXD 1F97A 5HYQA 2R0ZH 1YEDB 3UTTD 4DZ8A 4PGBA 4YO0B 1BBJA 4HUXB 2FJGB 4PP1C 1MI5A 3M6DA 5EIIA 3CXDH 4XH2A 2ESVA 5F3HB 1COBA 5IHBA 1VFBA 5EF0A 2EE2A 2CBPA 2NR6C 4RWHA 4LSUL 5EO9A 1A3LL 2GC4C 3QQNA 2Y23A 3SQOH 5DUPL 1G7LA 4NKOA 4OSUL 4WKXA 2K1MA 2YD5A 4FXKC 3NA4A 1MJJA 3V79C 1IFGA 1FZKB 2AJXH 3VE0A 2YPVH 2ICCA 2WZ6A 4G8EB 4M7ZC 3TEXA 2A9BA 3WN5B 3HC3H 4N2IA 4R4BA 4CADA 4HETA 2WV3A 4X7SL 2ZZUT 3FN3A 3KPRA 3G6AA 4NO0D 5KBPA 3LH2L 5D70L 2KERA 5BO1L 1I8UA 3KPSB 1EHKB 2D8KA 1ES0B 2VRQA 4L48A 1NAKH 4NLHA 1JV5A 3DRQB 3K6FA 4X6CE 1M7XA 4X0KA 3MNVA 2NMSA 4X9IA 2Q6WA 2YWZA 1AP2B 1BM3L 4PG9A 1KPUB 2H8PA 2FT8A 1OK8A 4JHAL 1IX2A 5FUZH 3HKZA 2YEVB 5FO7B 3TEUA 1MWAH 1XR8A 1EO8L 5ID1A 2D03L 2AXFB 4GT0A 5MEQB 3NJJA 2KQMA 2X4SA 4Z7UF 3IMUA 4FFVC 3M1CA 5B3JE 2QVTA 3NZ8B 2UXGA 1ZEAL 1IC4L 1MCRA 2WP3O 4F24A 4XMKH 3MLYH 3T0ED 4QF1A 1GKEA 2YO3A 2ARJA 4X6FB 3T1FB 2WN3A 1T6VN 2RAMA 5DZOA 5JR1H 5JOEA 1MCPH 2I24N 5HHPB 5CM1A 3ARBD 4PREA 5EN2B 1MCSA 3SB3A 2GTWB 1AHWA 3DROB 4RQQA 4R90H 1KEMH 1V3MA 1T5WB 1SLVA 2FJUB 3QFJE 3IU3A 3TZVC 3QBTB 1NGQL 5ISZA 4R7VA 5EFIB 3OJ2C 1UCBL 2DIBA 1LO0L 3GWJA 3MJ9A 4R3SA 3RHWK 3VWKA 4BZ2H 1I7TA 2F74B 2E6JA 1GGIH 2Y7OA 3EO9H 3MI6A 3UZVA 4HS3A 5JHBA 1GSMA 2E0PA 2G0LA 2GK0A 2CLRA 2YGOA 1PD1A 3LV3B 4KVPA 4LEXL 3ASOB 3ARFA 4MFHA 1DQDH 3II2A 3MYZA 5C2BL 2N1TE 3W9DB 1KTCA 4PJAA 3NSXA 4W9LC 1FE8L 2CCVA 3ZDYE 1RJCA 3ZBMA 1RUML 3MV8B 2IPUK 3O8XA 1HSBA 2A77H 1CLCA 1GS6X 4JKMA 1IC0A 1Z9PA 3MGAA 5DMGD 2AJ3A 3KWTA 2C7UB 3BH8B 1CK0L 1ZWIA 1JZDC 1DL7H 1U93B 3TNNB 2F9BT 4NI3A 5MP6H 4HFWB 1XR9A 4KROD 1HKLH 2X2YA 2ZUVA 1MVFA 1M05A 4YXHH 3EYSL 4OCSH 3T2NL 4ODTL 4YUEH 1TZHB 2PYEE 2K6WA 4JJ5B 3VMNA 5E6ID 3TEYA 2BWQA 2O5NA 4WNJA 4MDRA 1ZHKB 1KBGH 4OLYL 3Q6GH 1YJDL 4PMEA 4QAMB 5EIQA 1E5ZA 4QTIL 3T65B 5IV2B 1DVFB 4Y8DC 1RU9L 1IBBA 3KVDD 5KVFE 2GIYA 2N0MA 3LKQA 1J0IA 3FO0H 1PEWA 5TDPB 1HSAB 3MRMB 2JKSA 4WW1B 1G7IB 4K3DL 5H94B 5FO2A 5IK3A 4RX4A 1I7UB 1Z3RA 4XP4L 1CD1A 2R2CA 1IKNC 1LP9A 1XGQB 4N0YL 4BH7A 2D3VA 4FZEL 4JPVH 1F13A 1EJFA 3FFDB 2H6PA 4L9DA 3G6JE 3P3SA 3S3BB 4P3WA 1ZVYA 1G7MA 2DWDB 5TDNA 4MXQD 4UT7H 3WNMA 2CG9X 4XCNB 5CLWA 4ADIA 1PZ3A 3HR5B 2OMBA 2NY3D 3JWNG 4M5YH 3KYNA 1BVLB 1WPCA 1KACB 4XCFL 1P4IL 1PS3A 1CE1L 1RURH 2K7PA 4BFOA 5AAMA 5IZ7A 4BV1A 4WI6A 1JTTA 3E8UL 3C6SA 5DT1H 5HYJA 4Z7VA 2H3NA 4LLWA 5AW1B 1YNLL 1XB8A 3FN0L 4N9OB 2LU7A 3A6BL 2Y0SA 1T6WA 2E5EA 3LNHA 3MV9A 3PS6A 1QNZH 4XP1L 2G5BA 2VXTH 1BXAA 5T3XE 2Z7ZA 5KVDL 4F57H 4LCWE 1N0LB 5D1QA 4XMTA 3QIBD 2WBJC 3H1ZA 2XV2A 4UI2A 5HHOA 3IE4A 3QFJA 5IMKA 2HRGA 1G6RL 1EGJL 4YK4C 4UTCA 3FB6A 2VMFA 1TYJA 1IUZA 1HCVA 5CD3A 3ZZSA 4H8WH 3VD5A 2ZD0A 2BNRA 3HBPA 4KZDH 2GSGB 4GUCA 1E30A 4Y1SA 3V6ZA 1X5JA 2R56H 2JKLA 1AGFA 1ITCA 1UD4A 1B90A 1MRCL 4FQXD 3KLAB 2NX5E 5LBVA 4JE0A 2A5UA 3RTQA 5EOCJ 4JDTH 1N6VA 4LGPB 2VL4A 4X98A 4XVTH 3NGBB 1SBSL 2EO9A 4RGOH 6TAAA 2Z3FA 1GY1A 3AU1A 1P7QA 4UZSA 1A7NL 3OR6B 5BUPA 1FLRL 3S96B 3OJDB 4HKXB 1SHSA 5EZIL 1AACA 2A9NL 5EWIL 4ZTEA 2CBMA 3D18A 3PP4H 2EZ0C 4XNMB 3CSPA 2RCSH 4RIRB 2OP4L 1OWWA 1RP9A 3MRPA 4DERA 1XF2B 2OYPA 3WHE1 1QSFA 3LPPA 3A5VA 4RA0C 3UTOA 3VXPB 2XPGB 1KWKA 3IRZA 3HR6A 4D0CB 5ECJE 2ZKMX 1HCZA 1R3JA 3GJFA 2X42A 1JS4A 4MJIA 2ALAA 1MY5A 1PIFA 1L6ZA 2C1PA 3GI9H 4Z18A 4CSPA 3IMBA 1CURA 3T2OA 4P5MB 5F7NC 2NTSP 3L4TA 5I30H 4LARH 4LZKA 2B15A 1YECH 3C8KB 2J44A 4R4ND 1JHKL 4C47A 5I15H 3PWPD 3G5YB 3FRUB 4KKCD 3MFGB 1NA8A 3TURA 1LD9A 5AOMA 4HS6B 4DVBB 3W0WD 1S9YA 3E6HB 4BK5A 5CJQH 2JIXB 1FL3A 3O3BA 5KTEH 4B9ZA 1MCCA 5E8EA 2IGLA 1TTAA 2WVVA 2VXQA 2VXSH 3PGFH 4TTGA 1OT2A 4JHZA 5E5UB 3TV3L 2AS5M 2QGEA 1MI5E 1CGSH 1T0MA 1R3KA 3IFLH 2OK0L 3NQIA 4UANA 5CIPA 1TNNA 1TOXA 4J3BA 5TD4A 3FO2B 3MRNB 4J3OG 1DQQA 3ZMNA 2HN7B 2Y5QA 3OTTA 5GSRA 4K2UL 1IAII 5ICYB 3L81A 4P2RA 2YZ1A 4OIIH 2CLZA 3BYYA 4YSUA 5LWYL 4UNTA 2XY2A 4TF4A 3QJVB 1PF3A 4HSCX 4O9HL 5DVKA 5TTRA 3T8MA 4WY7L 3DO7B 1UQSB 1OARL 3SDAD 3SO3C 5IESH 1DFBH 4PHZA 4BHUI 3F65A 3S3DB 5LQBL 1MAKA 4LDEB 4MAYD 5F7BA 4X4YB 5ADOL 3UBXA 3CDCA 2OYLA 1Z7JA 4GMTL 4WI2A 3C6LC 3P0VH 5I5RA 5K39A 3FT2B 3NVQA 4ZMOA 4P9HH 5D2LA 4PJDF 1CR9H 2ICWJ 1DVZA 2WWMD 1X5IA 3LRMA 3VXQA 5DD3H 3EXJA 3HMXH 1QABA 1M7UA 3RY4A 4HWEH 3BZEB 5ENWA 3MC0A 2VDMB 3GIVB 1FO0B 5DUBB 4K73A 5F93C 1DSWA 1FDLH 3T6WA 4DNLA 4HG4K 5I1CL 4AMKL 2EZ0D 3GJFH 4Z8FL 3CCHB 1JE6A 2O5YH 4NQEB 4H2AA 4PWIA 1IAOA 1JK8B 4NM8H 2OMXA 4JY4B 1FA4A 3CN1A 2DQTL 1YEGH 5ICXA 4QI3A 4J3OH 5KVEE 3ZQWA 5D72L 1P4IH 1RURL 2YA2A 2CDFA 2H0FA 1WA0X 4U6HA 3MA9H 4FFTA 4Z5RB 4U1JB 2WKOF 3FQXB 3VFGH 5CWSA 1VGKB 3JUYA 1XEDA 1ZDQA 4FFZA 4KC3B 4JHBA 2YC1A 4KHTH 2MH4A 3KHQA 4ETQA 5IQ7H 2E7DA 3PDGA 4PLNC 4NZDA 4YNYA 4I5BB 3UOAB 2O5XL 3EH3B 3DURA 2DTSA 1YYLH 1PFCA 1NMAL 2WQUA 2V2WA 5SWQA 2HA1A 2CLZB 1ED3A 4PJFF 1B4TA 3BW9A 1YMMA 1EEUA 5IOPA 3B5TA 3FQ4A 1HHJB 1WFIA 1WV7T 3MRBB 4PVLA 3P54A 3CE1A 3IDUA 3B7UX 2HX7A 5IW6A 4BD4A 4EUPA 4OCWH 3HJ0A 3RVVD 4P5TB 5IY5B 4PW4A 4MCZB 1MZZA 4HBCL 1AE6H 1CL7I 4H7VA 3QEHB 5IOPB 4FJ6A 4XMLH 1LDSA 1A1MA 3LKNB 2BDNH 3L4WA 3TM6A 3PWVB 1F4AA 3FOLB 1BBDL 2DWYA 1URZA 3FZUD 3QDJB 5IOKA 1WO2A 4RESB 3RIFF 3ZXAC 2IGFH 2BSSB 2BSRA 3QDMD 2NY1B 4NAQA 5J6HA 2W9EH 3VFVB 4YLQT 2I07A 2DQMA 3BP6A 4XMPL 2ZOOA 3FUJA 4ZS7L 3QXDB 1M56B 1RZJC 3PV6B 4G1EA 4P2QD 1EK3A 4U1JA 4R7NA 3C08L 3EBIA 4HKBB 5IFHL 3NACH 2IFGA 2PR4L 3GTVA 4W9CC 3IF1B 5JHDE 3BE1L 3L2LA 2F8XC 4LPCA 1I9JH 1CXIA 4GSRA 1LEGB 1F3JA 3RTQB 1T22A 3AABA 3OAYK 2XXGA 2W38A 2COVD 4UOW0 3QUKA 2YWYA 2FZ3A 3VXUD 1F1AA 5HVFB 4WWKB 3FMGL 2XXFA 3I3BA 2GJPA 3EJQA 1AR2A 4G72B 5HVHB 3FYIB 2AK4A 1EUUA 1QBAA 3KXFE 5DMKB 5E23A 4NFCA 3DO4A 3H53A 3BUPA 2DMCA 4MCYB 2XBZA 4UIKL 4NCC2 4ZQKA 5GGUA 3TN0B 5I0DA 5KVGH 1E6OL 1RIVL 1WCQA 2OXHB 3O6KL 4YHNB 2Y1ZA 3NTCH 3WKQA 1J05A 1LWJA 2YGVA 3INUH 2VMCA 4KX7A 2A2QT 1YZZA 3VO0A 5LDSA 1IBGH 2C9SA 1ZTXH 4RMQA 4Z7VB 4HH8A 2OAAA 5JDJA 4NRYA 5D7IE 1HINL 1SLXA 5D72H 2TRYA 2HN7A 1ZGLM 4APQA 2F8IA 4OM1H 2CD0A 5E9AA 2CCLA 5J3HD 4QIRA 4C8XA 2V5TA 3L1EA 4XCNA 4U0QB 1SUHA 1TJXA 4KHTL 5HVGB 3LRSB 3TESA 1OGAB 3US9A 4RGND 4YC2C 4BH7B 1D3CA 4LP4A 2Z92B 3GBDA 1DLFH 3O3BB 1QSED 1U3NA 4DN3L 2B4CC 5BS0D 3RFZB 3MGTA 2XWBB 4Z78B 1KCSH 2BWDA 3B7RL 5KVGE 4DVBA 1V7NH 3RGBA 3ARUA 2W95A 3RVTD 4Z7WE 3K7UA 2AJUL 4W4OC 5HI4D 4QRPA 1YEIL 4M6OH 4HD9A 1LEIB 3D33A 1LDPH 3TWCL 1BMGA 1RZFL 2VSDA 2XTLA 5DC9B 5I9QB 1E7VA 1XQ4A 4OUUA 4YPGB 5BW7C 2QDWA 2BP3A 5TF1H 3MCLL 3GJFB 1OCRB 4M3JA 4QXGH 4IEFA 2E3VA 1CS6A 5I1DB 3S8WA 2ZPKL 2Y4SA 3LKRB 3PCYA 4P0DA 2Z31D 4Z76B 3P2DA 4OZHF 3VI4E 4FQCL 2VR6A 1CTNA 1JVLA 3H6JA 1MIEH 4CVXA 5GRJH 2A74A 3WFDL 3K8LA 3ELAT 5IJKC 3I75A 1PEZA 3VCLB 1ASQA 3B34A 5EULV 3P0VL 5DFAA 4MS6A 3SKUD 5F1IA 3CLEH 3MHZA 3D25A 1YNTA 5PCYA 4HF5L 1JZ7A 1QFWH 4Z7NF 5AOKA 3U6RB 1DQMH 4TPRL 4DKFL 5J9PA 2WCPA 2B5IB 3LIZL 5K9KA 3D09A 2FE0A 2DYRB 1JNNL 1VKXA 2Y3AA 2H1PL 4HC1H 4JFHD 2HH0L 5TF0A 5B7FA 3FQNB 1SXCA 1BXVA 4LVOB 3F12A 3JTTA 3HLKA 1IGYA 3SYCA 1LEGA 1JXGA 5I82A 3VQLA 4BM7A 1DUZB 2FEDD 5I0VA 4N2KA 3QDHA 4Y1AE 4UDUA 4ELME 2KH2B 1ZLSH 3UBXG 1RY7B 2DLGA 3I50H 3NFNB 5IG7B 3B9VA 1KYFA 3FU7B 4NBXB 3ZYIA 4YMPA 4X6CA 1QZ1A 4NENB 5B4MD 3FHAA 1JGLL 3U30C 5IIEA 3HE7D 3QIUD 2DM2A 4QF1B 2ATAA 2WPGA 3CQFA 3WY2A 3K46A 3IXTA 4EN3C 3BJLA 1UH4A 3DTUB 1PY4A 1YNKH 2VDLL 1R3LA 4IOSA 3CH1B 4N86A 4BQ8A 3DIDA 2YMXH 5ICZB 5FCSH 1KTJA 1HEZB 1IC5L 4U7MA 5GZNC 2UYLA 1VPOH 2YOCA 1I1AC 4Y4KB 4U6TA 4Y88A 2BY3A 3FOLA 2FBJH 3MRLB 5E00A 1GMEA 1Z5LA 4QTHA 1ZIBA 4YHKL 1H3TA 5C0AB 4L8BA 5JW4R 5E0FA 2VLRD 4YBHA 4OZFA 4YDIL 4PGJA 3TVMC 1DO5A 5D1ZB 5IFAL 2R9HD 3FT4B 4P5TA 1BW8A 3LKQB 1YPZB 2WXJA 4G80B 3QGVA 3KPQB 5F7KC 4FE9A 4OCXH 1WWBX 4L4TD 1D6EB 4HUUB 4NHUB 1FL6A 4RRPM 3V0DA 5KJRH 1W0YT 5BOJA 5I73C 1AG6A 2HT2D 4J6RH 2G75A 5FYLL 3ZOAA 1MJJB 3QG7L 5DD1L 2ZUTA 4DFIA 3LS5L 1ZGLP 4K07A 2NY0D 5DJ6B 2HRLA 1HL9A 1SEQL 4ZX3A 5CEZD 2V2TB 1GTNA 4TRPL 3SDXB 5JHMA 5CKAA 2O6PA 1U8QA 4PJXB 4PS3A 4YSRA 5KAQF 3LRKA 1MJ8H 5CBAA 2LHAA 2YXFA 3BZDA 3IDIB 5KYUB 1EJOL 3SPCA 4Z7WB 3GIZL 4QWWC 2AXWA 2G5UA 3QNYA 3WNLA 3WNPA 2UY7A 4G43B 3TNMA 1G7JB 4PJAF 2M8XA 3CPUA 4RDBA 2IADB 1VEOA 2C9UA 1ETZB 2V3FA 4AIXA 3QQ4B 5L4FA 3LEYH 5EUOF 2XIDA 3GXTA 3ARFB 3ARXA 2H32A 4QO1B 3QIUB 3S8FB 2W94A 3KPPB 5EPMB 2JJTA 4XWOC 5F0LB 4GQQA 2IH3B 4IKKA 1P5VB 2IWEA 1X5MA 2VLJA 3RKDD 4HS8L 3AY2A 3HOGA 32C2B 4JM2B 3X1EA 4RFEA 3DVGB 1WZKA 4Q97A 2DTML 2EDRA 4OZHB 3SOBL 2H2PC 5T33H 1HS6A 2BS71 4AKQA 5ISZB 1NGXB 1TQVA 1T5WA 4KK5D 5DU7A 1S9WB 4AYGA 2OI9C 4RCAA 2ZUSA 2UWEA 3O4LD 4M3HA 3DYPA 4K3DH 3CFCH 4D9RE 5JHDA 4FQHA 4PRIE 5KYYB 4TTDC 2D9QB 3FU6A 4E36A 1DVFD 4P9HC 4YX2L 4DKAA 4MWFA 2F7IA 1OSZB 2H2PD 1S5IH 5D2LB 3TIEB 1GYWA 3FT2A 4GW5B 1BREA 2QQNH 3QNFA 4KJPC 3INUL 4MDIA 2VZOA 4BE5A 3A6CL 2IH1B 1EJ8A 4XB7A 5D7IA 4IRJD 4QRBA 4JDEB 1AZUA 2VLJE 1GZQA 3ETTA 2HP4A 1XR8B 1HILA 1OGTB 4XXDA 1II4E 3ARPA 3KW7A 1UXLA 4YUEL 5ACZA 2CQVA 5GXBB 4FHJA 2H8PB 4N8VA 2AJYL 5FUOL 3RPKA 3ORJA 4KNSA 4JFEE 1QEWB 4WI9A 2WQSA 1O6TA 4JLRA 3CDYA 3WUWB 1LNUB 2XQBL 4Z7VF 2J4WH 4QNPE 1JV5B 3DRQA 4P23D 5C0NC 2E7LA 3HCVA 1UD2A 1Q38A 3EO0B 3C60C 3CHRA 5FV1L 1CCZA 3D2UB 4OVUA 3AXLB 2QHRH 2YD7A 1M71A 3WN5A 4CADB 3VGEA 3MTRA 2M1KA 1O6VA 3O9WD 2BCMA 4EBQL 1I7RA 5FYJH 1NFDB 5HY9A 4BYHA 4MWFB 1QI4A 2XACC 4FL4C 1ZS8B 3EG9A 1MFAH 4PJ8D 2UVEA 5IVZB 2FQFA 4I1NB 2WNWA 4U1MA 2EADA 1YEDA 3GKZA 4YK4B 4DZ8B 2HYMA 5C6TL 1FGVL 1ZV5A 4K3GA 3VTMA 5K59E 3RWDA 4BQCA 1J8HD 1VLXA 1ZVSB 4MAYA 2EXSA 1S7UB 1MWAL 3GJEB 3RAJH 2XWJA 5FECA 3N44B 2FO4A 2IGFL 3NAAL 5E6IB 1ET5A 4KI5D 5GJSH 3U36A 2X9XA 1T2JA 5GS0D 4IHBA 4QRSB 1KYDA 3ROLA 4RFEB 32C2A 3GDBA 3BVTA 1R6VA 4M8QB 4GPVA 1XIWD 3NJIA 3QWNA 4S10A 3TBYB 2DI9A 3FO1A 2IWFA 3JV4A 3US0A 4JZJC 4PBVC 5J8OA 1HL8A 3SQBA 4KROC 1YYLL 4KXCA 3TZVA 2VN5A 3IK2A 3U2JA 1YQVL 4TQEH 3VI4B 3MR9A 3ULUE 4DQAA 1UYWH 3BKML 4BE6A 1O6SA 4YGAB 5K9JH 5GGRA 3TNMB 3VW3H 3QNYB 3D06A 5D5MA 3PQYD 3U4KA 5HHQB 4WKZA 4ZOEA 1PZBA 2DOCA 2VXUH 1KIPA 1NM9A 4MXWH 4CGUB 1XL4A 5DA4A 4KJQD 4HJEA 4Z0XA 5TE6H 5TK2A 2Z8RA 4IIQC 2W92A 5IMKB 2E8YA 1BECA 2HKFL 4BZ1A 3AJ7A 5HHOB 3T71A 1FYTB 4Y4HA 4FG2A 4XN8A 4DQOH 4R2GD 5D1QB 3H9SA 4EZJA 1I8LC 4N87A 5FWQA 3CVHB 5KS9B 3ILQC 5DURB 4CVZB 1JWMB 4H1LA 3SO5A 3WXVH 4LLWB 2A6IB 3RFRA 4FFZH 3DV6A 5T33L 1ODAA 2IEPA 4UQBA 5F3BA 5J7CC 4Z7OE 5CEXA 3E38A 1JJUA 4OZFB 1MHPL 2G4GA 2BZ7A 4I0PB 7CGTA 2WMPA 2NXYD 1ZKAA 5ES4B 2VC2H 4P2RE 3H9YA 3O45A 5B22A 3V5DB 1RZ7L 2Z31A 3ULUH 4NQCA 1R17A 3BDYL 2HFTA 3CXHJ 2C7FA 2E7CA 2H6PB 1JSYA 2OQJB 1LO4H 4KDTA 3RIAK 3ZRCC 3DJZA 4X9GA 1GAFH 3Q44A 4XP1H 4JFXB 1KZYA 5IKCA 2UY6A 5LNDA 1DJSA 4Y2DB 4OIAA 3O41B 2C3XA 1TJIL 2HFFA 4OQ1A 1AZRA 4AENB 5G5DB 3LVEA 2GT9A 4J3VA 3ECWA 3NJNA 4MNQB 4MYPA 1JTOA 2DJ4A 4WW2F 2HX8A 4JHUA 1UA7A 2VLJD 3BRFA 3WHE0 5F6HJ 2J8UE 1AGBA 2NUPB 3ULSB 2OZ4L 3AU0A 4LQ1A 4JQXC 1AGDB 5JTWA 5FOBA 3OB0K 5E6RB 4AEHH 3L1OL 3KPNA 4OI7A 2MPAH 4WI8A 1IE5A 5C0EA 4LCCA 1TZHA 3R1GH 4P2OA 1KBPA 1RJZA 4HUMB 1A4KA 1ZHBB 4JL1A 4OGQC 5KSBA 3D50A 2YD9A 3APNA 5AVQB 1KTDB 2FB4H 4JQVA 4LSQL 4Y1AB 4PG2C 2C7UA 1FIEA 1MW3A 1NFDE 2AJ3B 1X44A 2B4CH 3B2PA 3O8XB 5I76A 1MRFL 2EINB 3KGRA 3DHJA 3SE4A 4KUZH 1P6FA 1F6FB 3OC5A 1TEFA 4Z7QE 2E27L 1QNIA 3VXTA 1GPOH 5MEND 3EYFB 3N85L 4U7SA 5AW7B 2YUWA 2OSLB 1QRND 2OMVA 3S48A 4TSAH 3UZVB 3K81A 2PTUA 4MSWB 3ZYOA 3F01A 1UM6L 4ODBD 4QY8A 4FYTA 4KXZH 4G8GE 5E1IA 1I53A 4QRFA 2X4TB 1J1XH 1HI6A 4PJCF 4L1BA 2MKLC 4G6ML 3UPCA 4DEWA 2QKSA 2VL5A 1MCBA 2WZPD 2XTJC 4LARL 1KCVH 2HVKB 3LMJL 4YSSA 4KKLD 4PR5A 3FRPG 3T2QA 1IM9B 1MAJA 2EE6A 4EZMA 5EN2A 4XAKE 3WNKA 1HXYA 5F89B 4KV5E 3K1KC 4FJYA 3QWQB 4NS0A 3WN5C 1R19A 1XGPB 5GISH 3CXHK 3WI9A 3V2AR 1CZ8L 2AEOA 1GS8A 4IKNA 4TQEL 4OCYL 1XH3A 4NO2A 4X6FA 4HH9B 5C08A 5CJOL 5IFJB 4PRPA 5SV4A 3QJHB 4MD4A 4XHJD 4PD4K 5B38A 2MQGA 2MKWA 1UVQB 1OAXL 2X53A 4TL5A 3TCXA 1BQLL 5A16B 3KL5A 4L4JA 3ZHKA 1X9UA 3TBSB 4XI5D 2XBTA 2EDQA 2BC4B 3AMLA 3CGTA 1OT1A 4J5VA 1N68A 2HTKD 1KENL 4Y9CA 3RDTC 5AL8A 3CLEL 3DOSA 2YBRB 3FFCB 2LQRA 3QORB 4HIEA 3EKCA 4F1SA 5JW3L 3F83A 4YHLL 3GTNA 1HAWA 2OA9A 3UAEA 4CW1B 1PU0A 3OMNB 3RA7L 4XCFH 4BFIA 1CTOA 4HLZH 1I1FA 3I2CH 1K8DA 1ZEAH 4EUPG 5EBWB 1HHHA 2OCFD 5C86A 1MJ7H 3CMOL 4GXVL 4ZTPL 3M1BB 2HRHA 2AXJA 3LX9A 3UROR 2IF7A 2ZE0A 5I73B 4ZAKA 2BXZA 3QPXH 3L4XA 2AJVL 1JPTH 2NYYC 3RIKA 5JUEL 4XH2B 1Q9OA 1XSOA 3ZDXB 1JWUB 1FO0H 4DESA 3IFOA 3QUHA 4BWTA 4AKPA 4Q14A 3SPHA 3O3EB 2E46A 4CMHB 2R1YA 4OBRA 4Z3JA 4X5LA 3S4SB 1M1SA 4NN7C 1SBBA 3BZ4B 2VDRL 4KRPB 5DVOA 4BFRA 5K5YA 4XE0A 3QPQD 3BFQG 1S7WA 3EADA 4RETB 2VITB 4MA1B 5H2BB 1AO7D 1QO3A 2F7QA 4GSDL 4OLZH 3IDJA 3CFBB 4IIZA 4UM8B 3VM5A 4ZYKA 3T77B 1C08B 1D9KB 3B37A 5MEOB 1AGCA 5LN4A 5J6GA 3EW3B 2HCZX 2KLRA 3FTXA 1B2WL 3DXAB 1AO7B 2LAGB 2VZTA 3CZLA 4HWZA 4LVNB 4OGXH 4N6RB 3PWPB 2IMMA 5BZDB 5JQ6H 3QB7C 3MV7B 4O2EA 2DF3A 2J57A 4KX8A 4ALAH 1KJMA 3IS0X 1HZKA 4TVPE 4GW1A 1OPOA 2AQ3A 2EDDA 1MW2A 5KYWA 3JYBA 2QFRA 2YPLB 2NNXA 2AQNA 2DJMA 4WVRA 2P52A 2XTSA 2O6FA 2NW3A 4ODTH 5I8CB 4U7KA 4WV1A 3ABGA 1IQWH 3N0PB 2XCMC 3OG4B 4ODXA 3ZGIA 1NCBL 1FP5A 1Q9LA 5FYJU 1YQ2A 5FGSA 4PBWD 2QADC 4WCYH 4AQEB 2R29L 1CMOA 4O2EB 3CSYB 3U7AA 2AMGA 2GYSA 1GS7A 2QGDA 4JRFA 4MCZA 1BFTA 3V6OC 2FLBT 2M83A 5A7BA 4IRJC 1RULH 3DPDA 1MQ8A 3COOA 3X14A 1XEUA 4N68A 4QHNA 1R0AL 3L8QA 4QPEA 2AI0H 2EVGA 2DH2A 4YL4A 5JNYB 3C6LD 5AB1A 4DH2A 4AZ8B 1U3HB 5IJVA 3LN4A 1YMMD 5KS9E 1WD9A 2I27N 3KL0A 3O11A 4XN9A 4G6FD 5A6MA 1QWHA 2F7OA 4TSCL 4R84A 3JYCA 1E8ZA 2V2WB 1TU2B 4JKKA 2WZPA 3WFBH 2XWRA 5E5MA 3MJ9H 2F19H 3IFOB 1HE8A 3FPYA 2ITDB 2YUZA 4A66A 2WXMA 1E5UI 1THAA 1RZIA 2JB5L 4NNPH 1NPJA 1F4XH 1KBWA 2X6MA 2ICES 5B3JF 5E8NA 3RGVB 3NIDF 3AB0B 3MRCB 1VGKA 3ARDC 1KUMA 4KRLB 1RVFL 4NCDA 3FQXA 5BNXD 3DHPA 3T4YA 1VAHA 3QULA 4NWTH 5E51A 2EYSA 4GQ9H 1NCWL 4H40A 1IEAB 1G84A 5GRVL 4IBVA 4DKDC 3UBXI 2NX5B 4MX7A 1LMKA 2NSQA 1EEYA 3NCCB 2VCOA 3B7TA 3MLYL 2A3TA 3ZPDA 2PWDA 3IJ7A 4M03A 1OP5K 4R4FL 3QUMB 5IHHA 5JXAL 5GRWA 3F7RA 5HHOE 1ZLSL 4JJOA 1J0HA 1F42A 3GSVA 4YC2B 1GJIA 1D5RA 2DQUH 2K3TA 2LU5A 2XN2A 1UGKA 3NIDB 4NQDE 4C83B 2YRZA 3BXNA 2J6WA 4XGZB 5FYKH 2CK0H 4XNXL 1HXMB 4JRXA 1G5GA 1Y6NR 2PPDA 4LP8A 5BV7L 4D94A 3QA3A 4BDVA 3CHQA 4WO4D 5F8QC 5JQ6L 1HH9A 2CHXA 3HMWL 5I0XA 1KSRA 2J12B 1E9OB 2HJKB 5IBLD 2X6BA 3FT3B 3FQWB 1NCIA 5C0GB 2VQTA 1A7NH 3I74A 2P3YA 4PLKC 2KUTA 1WITA 2BNQA 3GSOA 4Y2LA 1A6AA 5CBEA 3T3PB 4D7BA 1EANA 4V2BA 1FNHA 1BQHG 4HJ0C 4M7LH 5E4EB 2VERA 3VFGL 4BUHA 2VDRH 2AK4D 3S7GA 1KLGB 4OT1L 4X42A 1XH0A 3V0GA 1CDGA 3Q2VA 4NKMB 2ZOWA 1I7ZB 2CSPA 3L3OA 5DD3L 4IS6B 3T0AA 1BQHB 2EP6A 3DX7B 5D2NB 4NN6B 4WJG3 5DUML 4B3EA 1NAMB 1C1EL 2DRUA 4HT1H 4C59B 3QG7H 5DD1H 2VDNL 4AYFB 3MJ8A 4HDIB 5HJGA 4JN2B 2QZQA 4NC1E 1SLUA 2IPKA 4NNYA 1NC2A 5ALBH 4YWGL 1O9VA 4FI7A 3VFPB 1ADQA 1LDPL 2WKLA 3IAQA 5ID0B 4PU2A 1KT2B 1MIEL 1UKQA 2CHNA 4PLJD 2CZNA 3L13A 4MRBA 1QFWI 3P73B 5DXWA 1BOGA 4CL7A 4MQ7B 3AREC 3HS8A 2V17L 4N8CL 1HZHL 3IGLA 4XNYL 4GSQA 1MEXL 4OV6F 1BYOA 3LKSA 5AFAA 4W4OA 3MNWB 2F53E 5IMLA 5KUMA 4M1CC 2VDNH 3EFOA 3GLAA 4PJHA 4O9HH 3KPLB 3S98A 1BLIA 4ZZFA 5IQMA 3AS2A 1FIGH 4BEIA 3NA9L 4I2XE 2WWOA 1OB0A 4LSSL 3V5KA 3QNZB 2CDEB 3CUPA 4Z0BL 5D7EA 1DBJH 2IH9A 4EJ1C 1D9KD 4G8GB 5CINH 2FLMA 3NFSH 4I9XA 3JV6A 1PG7X 2XSKA 4X98B 5I30L 3JWDC 1QPXA 5I1IL 2D7TL 3CVHH 5L7XH 3IVKA 4L8SC 1OWRM 4G83A 1D5IL 1KXHA 1T2XA 1WA1X 3HB3B 5CUSL 4W9EC 5EMYA 3UIZA 3B8SA 1EDYA 3EZ8A 3SDCC 1DN0B 1WRFA 4Q9QL 2OQJA 5FX3A 3EYSH 5E8PB 4ZXBC 1EHNA 4N8VG 4Q9RH 1I1YB 5I5MA 5I15L 5TQ0H 2W88A 5CZXD 4F3FA 5F1NB 2FX8H 1FZJB 2ZTBA 4NC1C 2GJZB 1KCUH 2K9UA 2WB1A 5JW4Q 5IREA 5DWPA 4FLSA 3BPNC 5DZLA 5CEXB 3OXRA 4MMZC 4FABL 4I3SH 2EUVA 1NBVH 4OJEH 4UIKH 2MNUA 1HNGA 1GPOL 5L0QB 2BH0A 3FUHA 1TZIA 5HYJB 5JXAH 1XHHA 3M86A 3ARDA 4GIPD 3BISA 3QJFB 4ONOA 3H9SB 1ORSA 3QUXB 1QBLL 4FTVB 2CWRA 4G42A 4IW4C 4N8PA 5IW3A 1TSRA 1BZ7B 5C0JB 5HDBE 3WMQA 1DEEA 3BP7B 5F1NA 4JFYA 3TVMD 4RGOL 3ZTCC 1FJ1B 1OZTG 2QKIC 4J4PA 2VH5L 3ZR6A 4ZMWA 1RZKH 4B9IA 2ROXA 4Y16A 4NZUH 5FA3A 2OMZB 5FYLE 3SJVD 1OD7A 4P2RD 4PJGE 4PJ7F 5D71L 4GMSL 3QXAB 2XETA 4KXAA 1KULA 2J2ZB 5BO0D 2X70A 4XWGL 1HXKA 4H25A 5CHNB 2WZ0A 3KYOA 1MFAL 3VXMD 1IJ9A 5D4IA 2I60H 1CLZL 1ZRUA 3KPSE 3HHMA 4FD0A 5J56B 2UXTA 5CP7A 3JTSB 2CKBH 3VRIB 4UM9D 4PUBL 3FQRA 5DHVA 3KDMA 5D4HA 4L5FL 5INDB 4LNRA 3KPLA 2FECI 5TF1L 3MRDB 3TTYA 2OMUA 3RDTB 3GMNB 3JVGC 2XTJE 3OKOA 3AMKA 1L9PA 3QEQD 3S35X 3L3IB 1S78C 3HC0B 4DEPC 1G6VK 4N8UA 3DMMB 1DBKH 2IDTA 1JFHA 5F7EH 3V4VA 5B1JC 5SWSB 3DVFA 4P9ML 1KT2A 3BAIA 3CFMA 4ONGL 4R6UA 4OZIA 4KK5C 3M88A 1VEMA 3AY4A 3EBHA 4KMTL 1QVOA 1USZA 5D5MF 4I3RH 1TTCA 4HK0A 3HLAB 1K2DB 1KPVA 5ETUB 1UASA 1CYWA 4HDIA 3GI8H 1YEFH 3SE9H 5I0WA 1AHWC 5C3LD 4DP5X 5TQ2L 3UP1A 3L5WA 1ZAGA 3HE7B 3LIZA 5HJBA 3BLKA 1DQVA 2XWXA 4WW2B 2OJEB 3ZQ9A 1J5OH 1ZT7B 5A2AA 1DBKL 1IKOP 1V5JA 4WFHE 5D7SH 1QEWA 2Q7NA 4M7JL 4HJ1A 4LFHG 5DRWB 5JQIB 2LU3A 1I8IA 1OGAE 3VA6A 1WP6A 5EO1A 2ZKWA 2YA0A 4R96B 4WK0B 4HMCA 3BUIA 2ARJB 3GNML 4J7RA 5D7LD 3NZSA 3QI9B 3VNZA 1UOLA 3NZHL 5KSBE 3O8XC 1XF5B 4NQDA 3G5WA 3H8NA 3FH8A 5EU6A 3IMRA 2HUEA 3F6JA 3NABH 3ZLQC 1UACL 1YY9C 4N1CA 5T5FH 4K9EC 3QW9A 3BP5B 4K5NA 3OX8A 3BQUA 4UOJA 1KXVC 4RGMB 2E4FA 2WLIB 5BOZG 2MJWA 1T89A 4G7YL 1VENA 5KS9F 2GBUA 1KPUA 3BXNB 3MV9E 3V0EA 2X4PA 1S9WA 2QHRL 5IB2B 2F1AA 2EIKB 2UV3A 2FIKB 4G6JH 4MJIE 4DGWC 4WW2A 5KSVB 4CN6A 1EPFA 3UDWA 1CLZH 3HE7A 3OGCB 1QSVA 3EOYG 2ZG2A 4TL4A 5JHLA 3DVGA 1A6ZB 43CAB 2VLJB 3KPMA 4OZGB 4FQ1H 4RLDA 1CI3M 4WENB 4NKIH 3UTSD 2G9KA 3C2AL 4Q4EA 5T5NG 2F54E 3LKOB 2O5ZL 5EIVA 4H26B 5FO9A 1I31A 4F9PA 3FCSA 4QOKE 1KJ2H 1G7LB 4NKOB 4DK5A 2PR9A 2WLZA 1G7JA 3VXRE 1MN4A 2BP0B 1VFBB 4RH4A 4MZRA 4HJJH 4RWYL 2DY2A 1G9ML 2VLRA 2ZUYA 3AGVA 4FQLL 4MYWB 8FABA 4DHLA 1T1WB 3WENA 4R7LA 1P5UA 2MWCA 4YFLI 1TU2A 1WTGT 2YAEA 1LO3H 3ZT6A 2ZP8A 4ZZKA 1AHKA 3RDTA 1E27A 3AS0A 5FLUA 2XT1B 4YHYC 3U46A 4AZ8A 3FL7A 3QI9D 1N3NB 2PPAA 4FI8A 2Q9OA 1JYXA 1F00I 1S7RB 4LEEA 1SYVB 4XTRD 2CO4A 2ITFA 4GLRH 1A3LH 1ODUA 1IARB 4MHHG 4XO8A 2BNQD 1IAKA 2CBTA 1X4XA 4JDZB 2C3HA 2XIIA 1KGYE 1J9CT 3ULUC 3FT4A 4JO3L 1IILE 4XCEA 1A9EB 4HS8H 3T8XA 4A7GF 5DZNA 1GW6A 4YXKH 1QR1A 4LSQH 2JKXA 5EZLB 1S9XB 2JFCA 3EDJA 1G9NL 2J72A 3W5MA 3W56A 1YY9D 4FTVD 3P30L 4Q58C 4ODXB 2PYFB 1P6AB 4ETYA 3FAWA 2NYKA 4ONHA 1KLFA 4WV1B 3SQOL 5C07B 3UYPB 4KMTH 5ANME 4ZMNA 5JMRA 4YHOL 4IIQA 4IU3B 4YDLC 5ALCL 4L4TE 4ONGH 4ZMYA 3UTTA 2X4UA 4HWUA 4N2GA 2YD0A 5DRXA 3UL4A 3Q05A 3CXDL 2BK8A 2PXYA 5KANI 5EORH 2BNUA 4A6YB 4Y4FB 1J0YA 5DC2A 4RMRA 2WGXA 3TJEL 4U1HA 3G5ZA 2JH2A 3AAZA 2PO6C 1KIQA 2R69A 1IFHH 2BP5M 3MJ7B 4F57L 5KVDH 4J1UB 4EI5D 1B4LA 2GB2A 2MQ3A 3BCFA 4UNVA 5EEUA 2QQLL 2XN9A 1OM3H 2XYBA 3B6SB 3DX1A 1INEH 2GHWB 3VFSA 1INDH 3WFDH 3QORD 2JB6B 5AZEH 3S4SA 2HVJB 2QVIA 5IR1B 3EOBB 5F7DA 3SGKC 3T4AA 2Q0ZX 3E9UA 5CN1A 2AW2A 2YRBA 3HIZA 1Y1DA 4GMSH 5HDWA 4LLYA 3POHA 1BFVH 2E4TA 4GMTH 2FJFA 4O4YH 1PZUB 4BFFA 1WD8A 3GSNL 3BKJL 1J5IA 5IVXA 1P1VA 4KTGA 2QQQA 3M1BA 1YNLH 4XC3H 2GY7B 4OM1L 2RMNA 4OLXH 3KCPB 4NXKA 5CGYD 4JM2F 5CN2A 4L1DA 1V7NL 1USQA 1ZT1B 1ZPUA 4L8SB 3KS0H 1P4BL 2XN9E 3MRKB 1G1KA 4NSKB 4ZD3L 3GXPA 3R06A 3RIFK 2JV6A 3C87A 4Z76A 2IFFL 3A3YB 2FDBP 4M61B 3V52L 3QORA 2AVFA 1VADB 3GMLA 3O0LA 4R5XA 1VESA 2QGBA 2H9GB 5KVGL 2YQGA 5DUJA 5AKTA 3RKPA 2PABA 3MCYA 1G9NH 4J3SA 4WU7B 3C9NA 3S3JA 5BXFB 5I23A 3DUHA 4WUUA 2VW4A 2DWSA 2JXMB 3CBRA 1QACA 4FRWA 1AKJB 3L54A 4YZFF 1CVSC 3TBSA 3MRHA 4Q56A 3DX8A 15C8H 3KVPA 3N0AA 3QYMA 4QOKD 3ZKMC 3VFPA 3TV8A 3QEUB 3HE7C 1QFHA 3GXIA 1NPNA 4JQVC 1G9MH 1JYNA 1N6QL 5E5LA 3JWOH 5C08B 3WD5H 3O2VH 1MOEA 2OL3H 4GQZA 5EH1A 1FFNB 2ADFH 3VFUB 1EBPA 3NMEA 3W11C 5CZVL 1LK2A 3LRSA 1VFAB 3VW3L 2JJSA 2EEFA 3ET9F 4AE0A 3EAKA 5E6SB 3HI5L 3LSOA 2Z4QA 4LCIL 1L9OA 3GMOB 3Q8FA 5TPWH 3I9AA 2P7TA 1MHEA 1QKZH 3Q01A 2VSMB 1NCTA 3OHXB 3HKFA 4LL4A 3M45A 3L3KA 3NP4A 2WLJA 3MXWH 1LO2L 2H1PH 4HC1L 5CFAA 4JO2L 4JM2C 2WJ7A 2WBJA 3LRLA 2CO6B 5IFHH 4ATWA 3MRJA 5EIIG 5CIPH 3WAKA 1UD3A 3QYCA 2R9HC 1FGNL 2BZDA 2PLTA 1U4EA 2L7UA 7TAAA 1NWOA 4PIBA 4U3CA 3NCEB 3JTBA 5C70A 4MSWA 5CU9A 1HOCB 4Z7UA 3DTDA 4MMYA 3MCLH 3MLVL 2DAVA 3D2TA 3HA0A 2NT1A 2X2HA 1OAKL 3CZFA 3DX0A 3GC3A 4MNQD 2QLYA 3FQWA 3VI3E 2EDFA 1SLWA 1AI1L 4NO5B 1JNHA 3L95B 1J0KA 1EFXD 3LVTA 3QZBA 4CMMA 1N5YH 2A0LC 4AY0A 4XNQA 4LSTL 3GT6A 2XX1A 1YEEL 5GRZA 2ZKHH 3NJXA 2WSPA 2ZPKH 2ILLA 5GS2H 1OP4A 2EEAA 3JSSA 1WYJA 4A55A 1N59A 2HFGH 3NPSC 2VXQL 3QUKB 4LLUB 2N7AA 1UH2A 1CXLA 1H6FA 2DIAA 4A7VA 4LOUD 4PWEA 3ZKQD 4XO5A 1AC0A 3MNZB 3BDYH 4G3YL 3JZYA 5DVLA 1R3IL 5BZWB 4GH7B 1BM3H 5L2JA 5F21B 2J4WL 4I89A 3CAFA 1BA9A 1VFOA 4IMLA 5D1ZC 3DPBA 4XCCH 4XWOD 4B60A 3VWKC 3O6LH 4AYMC 2WWKT 5T3XD 5KN5A 5EZJA 5IHUH 5DEFA 4MNQA 1EXHA 1H15B 3QPQC 3WXVL 1QFPA 4TUJA 4K7PH 3U1SL 1A65A 4Q6KA 1JF5A 4Y4KC 5BMFH 1UWYA 2GPZA 4JRLA 3KR3H 1E5CA 3OMAB 1QEXA 1KELL 3TS8A 1BAFH 4MXVE 1A02N 4E42A 5IROC 4A2MA 5B8CA 1ONQB 4DPAX 3NCXA 3KM2A 2PCYA 3V9CA 3A4EA 5B3NA 1S5IL 1A0QH 4EN3B 3V5DA 2CAKA 4HGMA 2W60B 3LPWA 5H35A 1LE5B 1DQLL 5J06A 5L88L 3L45A 3N1GC 3O11B 1N8OE 4OF0A 2CMRH 3NEOA 4P4KC 3LZOA 4PCKA 4N2NA 4H13C 4EN3D 1QW9A 2R1XB 1OAJA 3VM7A 2DQTH 3ML8A 3MUGB 4KDTC 3NTCL 4TNVK 1KELH 4UAHA 1NSNL 3TC9A 1NGZA 1I9EA 3X14B 4FNRA 3T6VA 2L7EA 2BSTB 1WTLA 3QQXA 5AG8A 1IB5A 1PG7H 2XN9D 3H3KA 4LVOC 5ADPH 4JR9H 1RXLA 5AW6B 4O2FB 2DYPA 3IAGC 1YMMB 3BW9B 2Z93A 4NT6A 1QW8A 3T0DA 2IALA 3N3EA 2I60L 4ZUWB 2B14A 1NMCB 3IBEA 3NESA 3QO0A 1N64L 4KKBC 4YBLB 1RIHL 3SBQA 1L5GB 4Z7OB 1UCBH 5DJ0A 4YE4L 5SWQB 1SEBA 1BD2B 2DQFA 3VXSD 2NW3B 4I0CC 1CPUA 4E41B 2X0UA 3ESNA 5JIKA 1IMHC 3UPAA 3GTTA 5GS3A 5KG9B 2HT2C 1WF5A 5DJ8A 2YD1A 3MDJA