4QAMB

Crystal structure of the rpgr rcc1-like domain in complex with the rpgr-interacting domain of rpgrip1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
187
structure length
180
Chain Sequence
DSDDVIVPPMDSEKMCIEIVSLAFYPEAEVMSDENIKQVYVEYKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X-linked retinitis pigmentosa GTPase regulator
publication title C2 domains as protein-protein interaction modules in the ciliary transition zone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18111 RPGR1_C Retinitis pigmentosa G-protein regulator interacting C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4qamB00
1E90A 1WFJA 1E8YA 4DNLA 1BCIA 1CJYA 1HE8A 4Y1TA 1UOWA 5T8IA 4FJZA 2WXIA 2EP6A 1BDYA 3P2BA 3QJZA 1GMIA 2N1TE 4JPSA 4XE0A 4TV3A 4Y1SA 3PYCA 4BFRA 2DMGA 2WXLA 4F92B 3KWUA 4ANUA 1WFMA 3ZIMA 3W57A 3GPEA 4QAMB 2ENQA 4L1BA 4L23A 4AOFA 4TUUA 2DMHA 2KI6A 3CSFA 2K4AA 5JHAA 4IQHA 2WXMA 1DJZA 2ZKMX 2Z0UA 4ANVA 3IBEA 3OAWA 3F04A 3M7FB 4IHBA 4FLHA 2LHAA 4EZLA 3PS6A 4ANXA 2RD0A 3ML8A 2ENJA 5JHBA 2Y3AA 1V27A 2WXPA 2WXRA 3B7YA 1RH8A 2QZ5A 2CHXA 2Q0ZX 3ML9A 3QR1A 1TJXA 2B3RA 1E7UA 3NZSA 4L1LA 3IM1A 2V4LA 1QATA 2WXNA 3QR0A 2ENPA 4DK5A 4LDCA 3FBKA 3OHMB 3L13A 3L54A 4KZ0A 4AJWA 3QAQA 4LCVA 2CHDA 3DPDA 4A55A 2WXHA 3HIZA 1E7VA 1DJGA 4QJ3B 3T8MA 2CJSA 4PS7A 5KJ7E 3F00A 3LJ3A 2WXFA 1E8ZA 2CM5A 2FJUB 4FA6A 2K8MA 2K3HA 3TJPA 5H4ZA 3HN8A 4LT7A 5EDSA 3APFA 3PFQA 4F1SA 5CCGE 2CJTA 4FJYA 4F91B 2NCEA 1DJXA 4XX5A 4L2YA 1DJWA 4ICXA 4WWOA 2R83A 3L16A 1A25A 3QARA 2ISDA 2Q3XA 3L9BA 1BYNA 4NS0A 3R7RA 1DJYA 4NP9A 4XZ4A 3ZVVA 1K5WA 1RSYA 5CCHE 2A4ZA 4PS8A 2WXOA 1W16A 4KZCA 4QJ4B 4URKA 4OVVA 4BGDA 2X38A 3ENEA 3DBSA 4FHJA 3N5AA 3APCA 3ZW3A 1UOVA 3APDA 1RLWA 2NQ3A 4FADA 3F05A 1DSYA 5CCJA 3L17A 4G11A 4WWNA 3R7QA 3W56A 5G2NA 3CSTA 3RDJA 4TS6A 4ANWA 5G55A 4F93B 2D8KA 3TL5A 3L08A 4WEEA 4GB9A 4EZJA 1DQVA 3HHMA 4KITB 3PRZA 2NSQA 4QJ5B 2WXKA 4WWPA 4FHKA 4HLEA 2YOAA 3NSJA 4PS3A 2CHZA 1DJIA 1TJMA 1W15A 1QASA 2BWQA 3MJWA 3PREA 2WXGA 3RPBA 4ICWA 3F01A 3L4CA 2CHWA 3KWTA 4NPKA 3SD5A 4EZKA 2QZQA 2UZPA 4V11A 3FDWA 2K45A 4MJJA 5H4YA 4J6IA 4HVBA 4NPJA 3NZUA 4FULA 4WAFA 3S2AA 3TWYA 1E8XA 1YRKA 4GNKB 2JQZA 3JZYA 4OVUA 2YRBA 2A5UA 1E8WA 1DJHA 2CM6A 2WXJA 2WXQA 2FK9A 3QK0A 1UGKA
chains in the Genus database with same CATH superfamily
4TOYL 4ZDHA 4JHVA 3LXUX 2H45A 3U2SB 2FJGB 4KHXL 3AS0A 4YDVB 2MTPA 1AR1D 4RETB 5IFJA 3EYQD 1M6UA 2UZXA 3QXVA 5ETUB 3WHE0 4G1EB 2DN7A 3QJSB 1AXIB 3Q6FB 3SQOL 3ZIMA 2YPVA 3HLAA 5JXED 3WL9A 1CLZL 2DMHA 3MX0B 5DD3H 4IQHA 2B4CL 4X6DF 4KJYB 3QXWA 3NJGA 4FN0A 4NENA 4R2GD 1JL8A 1XWVA 3UBHA 2NYYC 1FL5B 2YPKB 3S5YA 1E3FA 5I6LA 1G6RA 2ENJA 1S78D 1UJTA 1QFOA 1MCEA 5CJOH 1XH3B 5ID0A 3ZK0A 5GS2H 4J12A 4L1LA 1SMAA 4DTGH 4JN1H 4Q6IC 4BFFA 1A14L 3X3FH 3H6AA 3HZVA 1KY7A 2GC4C 1F1AA 2OSYA 4UQDA 2E75C 4UM8A 4F5CA 4GAFB 4QOKB 1GJIA 3KYKL 3QNZB 3QPKA 4XMKH 2C9SA 1AZUA 2W07A 1M9WA 4IRJA 1CN4A 5J13B 1IBYA 4BH8A 4KRMB 3WO4B 4RMWA 2HKFH 3QZWB 3K80A 4NO5A 3B9KA 3F7RA 4PJAA 3V8OA 1E40A 4HKJA 1KYFA 3OJ2C 4B0MM 2ADIA 3QHZL 4ZJ9A 4G9FA 1QRNE 1E27A 4PJEB 1L9PA 4ZW8A 4IOIB 2BIOA 5C0JA 3TBBA 5DWUL 2ARJB 3HZMA 4QO1B 3QA3B 4KJPC 3H3PH 3QEQD 4NKDB 5GS2D 4ORGA 4R3SB 5TK4A 2WLLB 3T71A 5EFIB 2A9ML 4G8FB 4PJFF 1OK8A 2BP8A 4JFFB 4P4RA 1F4WH 3QEHA 4BFOA 5AOLA 3ZQWA 4LLUB 5PCYA 2B59B 2J2ZB 3OXRB 1BOYA 5DVLA 2NT1A 3DK2A 1X9UA 3F62A 4Q89A 4GRMB 2PPFA 4GAGL 3F6IA 1A3LL 4LCWD 3MLXH 5D71L 3QDHA 1P1ZB 1EZVY 1LNUA 4BK8A 3RI5K 1CI3M 2Z35A 1J86A 2PYEA 5A2IH 3MMEB 3VTAA 2Y36H 3KW8A 1AIFA 1U8NB 1JUFA 2KLTA 3LRSB 2Y2TA 2P7TA 1KIUA 3NJXA 4TRPH 2I25N 1BFOB 4XC3L 4QF1B 2P49B 1MCCA 2H0FA 2WTRB 1S46A 1JPFA 1ULVA 5DZLA 4Z18A 4GSQA 4OBRA 2XY2A 4ZDHB 3AG2B 4HLJA 3VDCA 2VXVH 3ISRA 3BSZL 1T1ZA 1TVBA 1N2RA 2ZX5A 4KTEH 5B8CB 5IFHL 2W80C 4XB8A 3FH7A 2WSPA 2BOLA 2VISB 4O9HL 4AYSA 2BCMA 1BW8A 3WL9B 1OQOA 4Z78A 5IKCA 1J1XH 5HHXL 1F02I 3EYFA 4GXUN 2IAAC 2J57A 1A6WH 2VLKD 3HLKA 3CZJA 2ID5A 4G6KH 3APNA 5GS0C 2X2HA 4MNGE 2D7OA 4YDLC 4KK8D 1G6RB 5CUSL 3IJYB 2ZG2A 5AQ0A 5ID0B 4QHLA 3X11A 2RH0A 4K8RH 3HZVB 4LPVA 4XWOC 2EO9A 1RZ7L 1XZ0B 2ZXCA 3MLTA 3MJ8A 4UB0H 4UM8B 1L9TA 3FO9B 4OJFH 4K23H 3D08A 4AJYV 4NBZB 2CKBH 3VI4A 1EEQA 2D3NA 3KPNB 2W07B 1FNHA 3HI5L 3NIGB 4IRJB 5IEKB 5DD5H 4DKAA 3B2DC 5IVZA 3AMKA 1ZLVH 4A37A 2A1WL 1KOAA 1WD8A 2C3WA 3HE7C 4NO5B 4PV9A 1FF5A 4UOW0 4HKJB 4YHLH 4UAOC 5C71A 2ADIB 2MEJB 3JTBA 4G9FB 1OWRM 4JPIB 3PL6C 2G9KA 1I9RH 5C2BL 3MLZH 5I6OA 3KPPA 4IMLB 1J9SA 1RZKH 1SLXA 2PP9A 3TESA 1TKWA 1B0WA 1E6OH 4Q97A 3KMDA 4L8DA 2QMKA 2BP8B 5IF0A 3QEHB 3D50A 1F5WA 4BCZA 2BY2A 3S0PA 4DUXA 3GSXB 1X7QA 1Q0XH 2VMEA 4M1CD 3UGEA 3MNVA 1WTLA 2B20A 3BQUA 5K5YA 4DN4H 4MB4A 3PWLB 4TQIA 6PAZA 3WY4A 4NWTL 2NW3A 5C6TH 1QTYT 3KNBA 1JIBA 2X6MA 4FAAB 4P0DA 4LOUC 4JZJC 2XOTA 4U2YA 1NCAH 3D2UD 4FLOA 2F74A 3QIUD 4IJTA 1DUZA 5EZJA 1C5DB 3NIDE 3LZFL 5I9QB 1L9NA 4MA7H 5D1ZD 2EIJB 3B43A 5BMFL 2D31B 4BWTA 43CAA 4MSWA 2Y06L 5HVHC 2B0SL 4MJ5A 4N1CA 3K2KA 2ADGA 4FQ2L 1T1ZB 1KJMA 1N2RB 1FRGH 4MLIA 2EVGA 1CU4L 5HDRA 4JG5A 5FO9A 2PYFA 2D9CA 4K3EL 4WFGE 5EIIA 4JDEB 5B3SB 1A7QL 2JKJA 4BEIA 5T3XH 3D9AL 4AXWB 3E38A 5IKCB 3V5HA 4PB9H 4M8UA 3EYFB 4OLWL 3EYUH 1M4KA 2OMBA 2LU4A 4GBXD 2IAND 2Y7QA 2WOBA 3QEQA 3MBXL 4J6RL 5I71C 5AVVB 3ZGHA 2OYMA 1JWSB 2Y24A 2AEWA 5D5MF 5HDOA 3OM3B 4DKFL 3NSFA 5A2CA 1R19A 1TTCA 3PJNA 3X11B 1FI8C 1NCHA 4EZLA 4LP5A 1U33A 4XP9L 5I73B 3KVPA 5E8DL 4BHUA 5D1QD 1XB6A 3ML9A 3MLTB 3MJ8B 2D3JA 4B7LA 1XO8A 2YPLB 3VFNA 1I1RA 2CPCA 4YZFF 1IT9L 2PWFA 1IBHA 3BUIA 2F58H 4KRNA 4AL8H 4S11A 1IGIL 1T5WA 1OHZA 4PV9B 5C0DA 5C0FA 4RAUB 3QCUH 1BOGA 2FNBA 2NNFA 4L4VE 5F0MB 5JIQA 3W3BA 3LB6D 3GMPB 4NXSA 2X1XR 5GJSH 5F6HJ 3C5SB 2GUOA 3KPPB 5IM7A 4F1SA 3SGJC 2BOCA 1IJNA 2GEEA 5DVOA 4L8DB 5DUML 4QKXB 4OB5L 3PDDA 1HK6A 1OL0A 2WOYA 4YPGA 4FNTA 3MOAL 1P53A 2DQJL 3UYRL 1LGVA 4W4NA 1ML0A 4U7MA 2HA1A 4GRWH 1AR1B 4S1RH 1XR8A 1NBVL 4IBYA 3KS0J 1KTJA 4M62H 2FQEA 4N2AA 4O5LH 4PRID 5FHAL 4MA8H 4O58H 2EH7H 2NW3B 2OYLA 4ZUWA 2OMNA 3KNBB 1NCIA 3UYPA 4R2GB 4KGLA 3H55A 5DLML 4MZRA 4L3ED 1GMEA 4F8TA 3L3KB 1C16A 4GT0A 1KULA 1JHLH 1BEYL 2Y1VA 1W0WA 3RX7A 3KDMA 5IV2A 2AV7A 4OCWH 3N44F 1NCDL 3HTLX 4MSWB 3SD5A 3M46A 1GOGA 4GW4A 5HYEA 4OQ1A 3RWGB 2EEDA 4E9SA 3T0ED 4YBHA 3NH7L 4L8SC 5IMOA 4HUVB 4YDZA 3KYNB 2PYFB 1NAKL 3OR6B 2P8LB 4KNQA 2FK9A 5C70A 2UX7A 1YY9D 3B34A 5AW3B 3WSQL 4LARL 4EEEA 5L6YH 1MI5D 2GKIA 3GBEA 5AAMA 5IHUL 5CLYA 4L5FH 3AS3A 1OSPL 3G04B 2Y7QB 4ZTOL 3QEQB 4M6OL 2QR0A 1BJ8A 4NUJA 4M48L 5DMKA 1SLWA 4B9CA 1LEGA 1QPPA 5H2BA 4XP4L 2BOBA 5E0QA 1MCLA 1KYAA 2OAAA 2Y07L 4B97A 3L3IA 2GIMA 3DX1A 2E7DA 2CKBA 4GPVA 4QMEA 1N6QH 3SE3A 2K9UA 4PJIB 4NKOA 1FNSH 2X6BA 2Q9OA 5IQ7H 2PF6A 1I75A 1RH8A 2CWRA 3DTUB 2AEOA 3VB8A 4P2OD 1I9JL 3T04D 3VACA 4G82A 4A2FA 3BE1H 4X80L 1OAKH 1D5BA 1JF6A 4LCWB 4KZ0A 5E56A 2DQMA 1MLCA 4M4PA 3OKYA 4QHUA 5C0DB 2FX8H 1SOKA 2Z7UA 5DK0B 3ZE2B 3JXAA 4PJBA 3IDGB 2QFPA 2GUOB 5IM7B 2AQNA 1EJ6A 1JRHH 2BOCB 3MRKA 1WF5A 2GJZA 5FYLE 5IQMA 4ISVB 2I69A 1MCRA 5D1ZA 1A4AA 5GZNA 1C7TA 3LPPA 5CZRA 4K2UL 4YPGB 4QT5A 1D5RA 1U36A 4U1KB 1JI1A 5EUOF 3VFTB 1XQ4A 4GRLC 1JNNH 3EJZD 3V5KB 3SDXB 3UDWC 2KKQA 3ZVVA 1XR8B 3DRTA 4BUHA 2H7WA 3VNZA 1TU2A 4C83A 2BO0A 3NVQA 4JCWA 1UOVA 2ZOLA 4NZUH 3SYCA 3WEXA 4TSAL 4ZUWB 4XP1L 2N4IA 3KXFE 2GIYA 3DVNB 2VLKB 2LABA 1AYRA 3D0LB 3OF6A 2Y22A 1BX2A 2VDRH 4ELKB 5D2NA 1C16B 3AQZA 3K6IA 4UTBL 4AK1A 4EI5A 4ZMZA 4YS4A 2Z31D 1W0WB 3KDMB 3KYOA 5TF0A 3LH2L 4D9RD 5D1QA 5IV2B 4HPHA 4MA3B 1UYWH 4GW4B 3WJMB 3ARED 4W9FC 2VXQL 4UINL 4D0BA 1QHOA 5HVWA 5IMOB 1YNTA 2WJ7A 3SSGA 2K45A 1ZY9A 3BAKA 3GTTA 5FHBH 2P24A 4C56A 2KPNA 4HZ1A 3VG0L 1U58B 1K6QL 1JPTL 5I8EB 1YJDH 4YMPA 5MHSE 3L2NA 2Z65C 3ILEA 5GGRY 1HE8A 1RUMH 5JLZA 3IYLW 2HFGH 3FS9A 4KTDL 3QIBA 4RRPA 3WI9A 3U6XS 3U82B 3AG4B 3O9WA 3HJEA 1LEGB 1CICD 4MD0A 1WBZB 2ATAA 5D8JH 4A7GF 4E5XG 2MCAA 1R3KA 3ZSSA 1K2DB 2KI6A 3O11A 3L3IB 1JHKH 4JE4B 3ZTJH 2ENYA 2FX7H 5C0EB 4XN9A 4AEFA 4N9GA 5JORA 1DBKL 2X10A 5I6NA 2AMUA 2DLFH 2YD2A 3M7FB 1A47A 4NT6B 3IDMB 5CZXC 1E4WH 1W72B 4MRBA 3V2AR 1SUJA 3NCMA 3TTYA 3KL5A 1D5BB 4I3SH 4Z8FL 4U1IA 1ANUA 1MLCB 2Y2WA 2IFFL 4QHUB 5BQDA 2VL5A 1IVLA 4GOSA 2KQNA 1TZGH 4MYPA 5D1XC 3GLEA 4L3EA 3K8MA 3D2UB 2Z91B 4EXPX 5TPWL 3QIUB 4A55A 2VSMB 4AGNA 3VE0B 3ZR6A 3MRKB 1MIML 4TUKH 1W6LA 1ZV9A 2GJZB 1WSST 3QULB 2XNAA 5KVEH 3BVTA 5D1ZB 1BQHG 3RNKA 4WI5A 1BLNB 3HFML 5AVQB 5CJ8A 1RIUH 1S2EA 3QWOA 5F21B 1O7DC 2R9HC 2CIKA 4AQAB 5E2VH 5KVFH 1A7BA 1K4DB 2OP4H 2XCMC 2XXMB 1YNKL 1DN0A 4YWGH 3CFBA 5MERA 4ZPTA 1HEJC 4OF0A 4WJ5A 2XTSA 2EJ1A 4C83B 1NCBH 4L1TA 4MAUH 1MI5A 1FSKC 3D4ZA 4RFOH 4OD2A 4RISH 1M57B 3KZ8A 3STLA 4U6VL 1NEPA 4OCNC 2Y1AA 2IANB 3JWNG 4GBXB 3RFRA 5A6LA 1L7IL 3NK4A 4H1LB 3EG9A 4XN4A 1BX2B 4IJ3C 4V2CB 3WGUB 3D33A 3VAEA 4KZDH 4EDXA 1R3LB 4EI5B 1I8KB 1NMBL 2OMZA 3LRMA 3KBPA 4EUPG 4Q74A 5ISZE 1ZLDA 3WMQA 4N8CH 1UWYA 4DZBA 5D1QB 3RNQB 1CF8H 4OZGB 1IC4L 4K5OA 1T0PB 2EUZA 3UGUA 4G42A 4HK3N 1CGTA 1OB1A 1KGCE 3CH1A 4G6MH 4WCYL 1LMKA 4MXWL 4XAWH 4IEFA 2P24B 4C56B 1ZTMA 4RLDA 5I74C 1CR9H 3MRLA 4XGZA 5L0QB 5AZ2H 2WZAA 1M1XB 1TQWA 2IFGA 3CMOH 3T3MF 3BKMH 3HA0A 4LSQL 4FFYL 3GZKA 4H2AA 1J0IA 2ZOTA 4I13B 3FN3A 1EEYB 5JOFA 2XA8L 5FDWB 4DGYL 1VFAB 3EZ8A 3TCLB 3WV0A 1Q72H 4QTFA 3O9WB 1EAOA 1UCBH 2XWZA 1PKQA 4JRFA 2HT2D 5CZKA 4KY1H 1R3KB 1KLGB 3O11B 4FX5A 5C0ND 3CLFH 3TWCL 4CVXA 4FCHA 2P5PA 2BVOA 3FQWA 3L3JB 5JORB 2R1YB 4EXKA 2QADC 4UOJA 5EO9A 3K6FA 2X1PA 4PRIB 4A66A 5AZUA 5EF2A 4KKAD 2A83A 1CGYA 2WC7A 2Y5TA 3F65A 3IJEA 2R1WB 4U1IB 5CM1A 1R9FA 1ZT1A 1EXHA 3O6KH 3OLIA 4L3EB 4LLYB 4D0DA 5BS0A 4GQQA 2O4EA 1QVOA 2ZSVB 3EYOA 3HE6D 4E9TA 3QAQA 4LVNB 5FLVA 2A4CA 2AQRA 2KQMA 3DPDA 3EH3B 3WS3A 1HHHB 2OTWA 3LD8C 3RNKB 4AV5A 4F8NA 1CBVL 2AK4D 3R4DA 4NO2B 3TPKA 3UMNA 3QWOB 4GRWB 1R5VA 3AREA 4ZMXA 3T0EB 3MA7B 4LT7A 5FEBA 1CMOA 2XN1A 1DN0B 3VXMA 5D96B 5MERB 4ZPTB 2VQ1A 4K3DH 2EEFA 2VLJA 2FATL 1KGIA 1KTLA 4TULL 4NJAH 3D6GA 5TK2A 3X1GA 3VRLE 2KLSA 3UO8B 2D0GA 4OZ4B 1MI5B 2VZ1A 4JREB 3ELAT 1E3XA 3GGWA 2W95A 4ZSOA 1I3GH 4ABWA 1INDH 3KPRE 4KO9A 1KLUB 1HHIA 1NIBA 2QQKL 3HNVL 3HMXH 1IILE 1KB9K 3N5AA 3K8LA 1K8IB 4WUUE 1DQLH 1TEFA 4X7SL 4X8GA 3C5ZD 4HJUA 5CGTA 5CCJA 3ZHFA 1FVDA 1GZHA 1KBGH 5DHMC 5KYUB 2OMZB 4YBQC 5EMYA 4L4JA 3U36B 3NMEA 1U8IB 4ATWA 3FUKA 5CXPA 1PZDA 3IDIA 4DZBB 3N9GH 1PNCA 3IGAB 1MCKA 4FFVC 4MHHG 4XNUH 1F90H 4G42B 3S36X 2OMTA 4LRNL 1JZFA 4RFNB 4P2OB 3BUYA 4JPKH 4PV8B 1JMXA 2EUWA 3QW9A 3DRQA 4IEFB 3OMAB 1B90A 2R1XA 4FFZL 1KB3A 1TVHA 3FN0L 4QD2E 1PDKA 2A4EA 3BXNB 4KI5F 4LPTA 1U8KB 4YE4H 3DIFB 4IBVA 4I0KA 1B2WH 4WWKD 5CGYC 1WA2X 3HNTH 1VGEL 1INQA 1EZLA 3GHBL 3QQ3A 4XNQA 1DEDA 5I66A 4HUWB 1EHLH 4BE6A 1E6JH 1PKQB 2XVKA 5HGAA 1JPSL 1PZ5A 3RRQA 4BSJA 4U6YA 3IEAA 4CVXB 1XGRB 1KNOA 4HBCL 3ARYA 1BZOA 4LPUA 4I89A 2DQHL 2FWOA 4F8OA 3FQWB 4HU8A 4Z3FA 5EO9B 4AQZA 2IDUA 1U3ZA 3K46A 3N6YA 4X99A 4Z3JA 4Q6YA 2I07A 2A83B 3TJEL 4XBGB 1TUPA 2X4NA 2MQ3A 3IAPA 2FBJH 2XVGA 2IO5A 3WAKA 1NGPL 1OW0C 5TE7L 5MEND 1JGLL 3GJFH 3KCPB 5SX5K 1YN7A 1TYRA 3IKCA 3GRBA 3QFDA 4LSSL 2XQYK 1L4IA 5EDSA 3IMRA 4D0DB 1SQMA 4RRPM 1MCFA 4ZOCA 1T1XA 1UVQA 1QVOB 3EYOB 1QEWA 2ENPA 1JGDA 4H26B 5H35A 3M86A 3CXDH 2X4TA 2Z31B 4NFCA 1HHKA 2OTWB 1CT8A 3O2VH 1FVCA 3CZUB 4O2CA 2C3VA 3GBML 3N85H 3K2UH 1CFNB 4AQ1B 1I7TB 3AREB 3T6VA 1JTOA 3WEAA 5LO7A 3MV8D 3WG7B 3WXWL 4FA6A 4OAWB 3VXMB 1M7DB 4DESA 2A74C 2VQ1B 4JN2A 5T1MB 2DD8L 1HZKA 1KTLB 1UM4H 2QHRH 3BVWA 1HQRA 1BQLL 2WUBH 2EZ0C 3QUXD 4XZ4A 5LGKA 1RJLA 3MRGB 2AJZA 2JB5L 4HZAA 3OLEA 1WUNT 3N41F 3O4OB 4QHPA 4E42A 2CJUL 1JERA 1FVDB 4FNRA 1PG7X 1CICB 4K71C 5TDPA 4FGMA 2F53E 3ASWA 3IDIB 1KENL 4WRLA 4C4KT 5A2KH 3VD5A 5CCKL 2AJXH 4NNYA 4M56A 3GXPA 2CCLA 2OMTB 1ZVYA 4ZFOL 4UNVA 3BUYB 4RGND 3ESMA 4MJHA 5BV7H 1BVZA 4FTVD 4OJCA 5FW8A 3TVMD 2IH3A 3FOLA 1UA6H 2DJMA 4MX7B 2R1XB 5GGRB 3REVB 4G5ZL 5J7CC 3AQDA 1TVHB 3ET9F 1VLXA 3SBQA 4N6QA 3U6XA 4A04A 4N2EA 4QRTB 4FZ8L 3ULUH 3HE6A 3Q2VA 2GTWB 5KBPA 1EVTC 4HT1H 1ADQH 1JWUA 2K70A 5EZLA 2CM6A 2AK4A 1IFHL 3QQ3B 3ROOB 4XNQB 1AANA 3IGUA 4P46A 4IHOA 4R96A 4F24A 4LQFH 1V5JA 4LBEB 2FWOB 3CDCA 3FC8A 3L7FB 5HI5D 1YEKL 3LPFA 1HNGA 1UWXK 3L1OH 4G43A 3K7UA 4X99B 2E9IA 3GS4A 1MKFA 1OTTC 3B1UA 2Y3NA 3H56A 2N7AA 1GGTA 2J55A 3SBWC 3CLEL 1AHKA 3PJSA 1DFBL 3INOA 1YN7B 4BE5A 3QFDB 2ZUTA 4H25A 1LMIA 4R84A 4P9HL 4AUUA 1T1XB 3GSVA 1UVQB 3C5ZA 4L1HA 3SN6N 4U7SA 2Q2EB 5KS9B 1CC3A 25C8L 1MCOH 3CZGA 3QAZB 3BT2L 5H35B 1M7XA 3VD1A 4YZFE 5PAZA 1CT8B 1ZVNA 1FVCB 4GP4B 2C3VB 1AXSA 1SOQA 2EYTB 4IS6A 4N8UA 3DX8A 1HL8A 5IBLC 4AK2A 1O7DE 4TUOA 5IW6B 1G1OA 1WBXA 2VMCA 4GP8B 3TEZA 3CN0A 4ZNEA 4PHXA 4BBWA 4KX9A 4JN2B 3BQVA 2NTSP 1KB9J 4JO3H 4OI9A 5I76B 1HZLA 4BHUI 2F7OA 2DTMH 2NX5A 3KLQA 3Q8BA 3X12B 3HMXA 2Z8SA 1CZ8L 5DQ9A 1A6VL 2EDDA 2VZTA 4JFEA 3ZHDA 3BD4A 4RSYA 4XOBA 4NIKB 1FGVH 3O6ML 1HQRB 2K1MA 4XCEA 1RJLB 2AJZB 4PAZA 4GI6A 1D7DA 5IZ7A 1GGCH 5HDBB 1MQKH 2JKXA 5FYKH 3MCLH 4N8VG 3WD5H 4P3DA 1NLBL 3R4RA 4ONGH 3UADA 3CDGB 4NBXB 2WWMD 4HIHA 5LQBL 2P5WA 2H2SD 1P5UA 1F3RB 1AD0A 4NNYB 4RWYL 5IMLA 1X7SA 6FABL 3KWWA 4PWEA 4XNMA 3R1GL 1PG7L 4XBEL 4H8WL 3LRLA 3P30L 3IU4H 5I1GH 3FOLB 4NBYB 1ZA6A 5MENA 4IK6A 4AUYA 4PRHD 4B9IA 3KJ4C 1MVUA 1RZ8A 4TNVK 2CHZA 2FLMA 3PGCA 5CWSB 3HE6B 4OLYL 5FF6A 4AT6A 4OJEH 2O5NA 4ZS6C 1C08A 1KXVA 3K2IA 1JWUB 3M8OH 5CN2A 4XNDA 3OB0K 5EZLB 5IQ9A 4X7CC 2AK4B 4GXFA 3LV3B 2BDNH 4NKIH 4IHOB 4AUJA 2NSMA 4WLCA 2FGWL 5LCVL 4NGHL 3JWDH 4R96B 3MV8A 2ZCHL 4MKTA 3BD5A 4PI0A 3EBIA 4F8PA 5KVGL 1A7RH 4KI5C 3UC0L 1OXYA 4TQEL 1H8SA 3CN3A 2XKNB 2ZKHL 2P47B 3ESVF 3RTQD 1YEFL 2RCSL 4LKCA 5DC9B 4GUOA 1B9ZA 5F44A 2OK0L 2ATPB 1CDJA 5ILTH 1ETB1 4FABL 5B1JC 1R5WA 5EZIL 5JPNC 1MH5A 5LBGA 1SDDA 2D03L 3VUAA 2Z0UA 3BPLB 5ADPH 2O5XH 3GSVB 3OAWA 3C5ZB 5EEVA 1FBIL 1NCTA 1WQVT 3QB7C 2JCCA 1Q9WA 1BZ7A 1QFUL 5I5IA 3PU7A 1LO5A 2ZX9A 4IS6B 3B6SA 4ZMAT 2BRQA 5AAWC 4HS6A 1MFNA 4XI5C 1NJ9B 4FYQA 1RK0A 3HC4H 1JBJA 3QQDA 4PS7A 4XH2A 4JO4H 2NDFA 5DUPL 1QBLL 1SNRA 3F7YA 3OAUH 5DQ9B 4U6TA 2JQAA 1JGUL 4ZNCD 4XCEB 4FJYA 4WWKB 1TEGA 2WNXA 3HW7A 5TD4A 3P69A 3WKYA 4PD4K 3RA7H 5GQBA 3UACA 1IM3A 2VKWA 4KV5F 4JKNA 5GGTL 2FX9L 2JB6A 4KO5A 1KCRH 4M7ZB 4XBMA 1FJ1A 3OX8B 2O6PA 1PZ2A 2X2YA 1RUQL 4UIKL 1AD0B 2EABA 1X5XA 3BUTA 5D1ZI 2HX9A 1EVUA 1U95B 5D4QA 5HYFA 2CO2A 4XNMB 1DR9A 1MHCA 4UT6H 4FG4A 2XJLA 2ZNWA 5AUMA 2FO4B 1KPUB 1DUYB 4XXWC 5G55A 4AZ8A 5H8DA 3T4YB 5MENB 3MRIA 3B5TA 3RL2B 4WI0A 1CD9B 1RZ8B 3FRPA 1CFQA 1QUNA 4LLQA 1Z9LA 1ACCA 2FQGA 1ADQA 3AW5A 3BWSA 2DKMA 5EBWB 4YSAA 3IMUA 4H4NA 1I9IH 1I8IB 1AS6A 5KJRL 2AXGB 5JHDD 4F8QA 4D9QE 4DP2X 2NXZC 4WV1C 2MQGA 2VIRA 2RHEA 5T5FH 1F58L 5GZOC 4XP5H 3IF1A 4GNKB 4ONOA 4RMTA 4N2DA 3MV8B 4KO7A 3IDYB 2VLRD 2R23B 3DGCR 1T0OA 3MROB 2W65B 1WC7B 1UT1A 4Z7QB 1YEJH 4ZMWA 3ATBA 1GVIA 3GJFB 1KIQB 4H20H 4NP4H 1MG3C 4DP7X 1UXWA 4XTRC 4CVZA 5EG6C 4JDTL 6CGTA 1EERB 3FO1A 1E42A 3DJTA 4WGWB 2MCPH 3LNHA 3IKKA 3QUXB 4Y1SA 2HWZL 3QRGH 1R5WB 3KS0H 3TEUA 1J05A 4L29A 4IMKA 3WKNA 2COVD 2GJ6E 3INUL 4JANA 3CSFA 1QNZH 3GSNH 1FE8L 4AH2B 5C0IA 3F84A 3S35H 3DK0A 3OJDA 1K72A 5ACMA 1IAKA 2CLZB 1Q9WB 2JCCB 3VGAB 1E9PA 4MAZA 3AG3B 4NOBA 1ACZA 3FSAA 2WXPA 3T0BA 3B7TA 3HOGA 1AI1L 3B6SB 4KWUA 2CUAA 3BMWA 4HS6B 1R3JA 2MFNA 4FTVB 2H6UA 1RK0B 3D18B 4XXDA 3NJJA 4XH2B 5DQJA 1URIA 4M1GH 2IOIA 3F7YB 1X4YA 2NT0A 4Y19D 1Q1JL 4ETQA 2CH8A 2QGBA 2OTPA 4Y0GA 3ZL4L 4YBLC 1XTLA 1LO0H 4BZ2H 2R0LL 3PFQA 5DJ6A 1WLHA 3A6OA 3ARUA 5HVGB 3WFBH 5EULV 1BVOA 1IGFL 1KB5B 2JB6B 2HKHL 3L1EA 3FQ1A 1EHNA 3U0WH 3FMGH 4E68A 1HHJA 4LCUB 5BV7B 3V52L 2IGLA 1OVZA 1V3MA 2JI2A 1WHPA 3GI8H 4JFWA 3HUJF 3P40A 4QXGL 3VA6A 1R75A 1G9NC 2YPVL 3QUKA 4I9XA 4PJ8A 5EN3A 1MHCB 3GLDA 5AUMB 3RTQA 1KN2H 2OXHA 3K2MC 3TNNA 5A7EA 1DANT 3OC5A 4AIEA 2CR3A 1OTUD 1DQTA 4YSTA 4MVBC 4WI0B 3P54A 3FRPB 3U0PA 1QUNB 4IBSA 5C2UB 1G6RL 1RP9A 5DJZA 3K5SA 4L0ZA 1K3ZA 2J1WA 4OCYL 3V0EA 3WFEH 4CMMB 4CN6A 3SOTA 2BW5A 3I6GB 4MB1A 3QC6X 4U3HA 2G2NA 1KTDA 1IKNA 1NOFA 3MNMA 2XBDA 4X9HA 2CHWA 4O51A 3DX2A 3NZ8B 3FTVA 2OR7A 5AKTA 5AVSB 3O6FD 5DA0B 2WHVA 4N6RA 4NM8H 1DEEB 4PW3A 4TVPL 5HDQL 1EO5A 1U3HD 3QJVB 4FNPA 2IMMA 4JVPA 1D5IH 1U4FA 3EFOB 3T3ME 1H3PL 1L6PA 4LOFA 3T8VA 4L9LC 3MO1B 2YQBA 4W93A 5FB8A 2HRPH 2WNWA 2Y5EA 1UXWB 4PG2C 4EI0A 4X6EA 2NW2B 2QSVA 1QA9A 2NXYD 5GGSY 5HHOD 3N0PB 3U46B 5DS1A 1J05B 1J9CT 4JHAL 5GRZA 4APXA 3LZQA 4JANB 1JZJA 2P5EA 5L7XH 5LKNA 4J3OF 3OJDB 1QFHA 3KLDA 1IAKB 1FFQA 1QRND 5FC9A 3VFOB 1QBAA 2YS4A 2MQCA 4B3EA 4KQ4H 3M1BA 5AKVA 3BVNB 1KC5L 1B3IA 4FCAA 1NPNA 1Z7JA 2WKGA 3AT8A 2ICES 4N0UA 1ZTXL 3MGOA 2V8MA 3ULVL 1SN2A 4Z5RA 3QR1A 3WFDH 5JXAH 4FXLA 2AJSL 5IHBA 1Q9KB 3GSRA 4LSRH 3L4XA 4PRHB 5DQJB 1QABA 5K1VA 2VO5A 4KVCH 5LBSH 5LN8A 5K9KA 5F9WC 1H3VA 2O61B 1RCYA 3BDBA 2CJSA 1NC4A 1JZ8A 2D2CC 4NQVA 3Q5YA 5DRXA 5JHDA 4AV4A 2VDLH 5FXCH 4HK0A 3JTTB 4UM9D 1JRHI 4HAFA 4JO2L 2E7LA 1IAOB 3I6KA 4KNSA 1SN5A 4DKEL 4FG2A 5JPMC 2VXUH 3VJ6A 5K9JL 1HHJB 4UT6A 3V9CA 5AL8A 2VLRA 1HEHC 3BAWA 4HH9B 4YVNA 4KZEH 1S3KH 4ALAC 5K33A 1FCCA 3QUKB 5C09D 3UAFA 5E00A 5AZEH 3RB7A 3RTQB 5GS1B 2O5ZH 4FI6A 2HT3C 5F3BA 4TTDD 2KHAA 3TJHC 3LQZB 5I1JH 4Q58C 5CEYA 3OJMB 2MCG1 2G9HA 1TTRA 1JVLA 1SBSH 1RUPH 4PCTA 4WHCA 4L37B 2OMVB 3MR9A 3D4CA 4JRWA 4JFDE 5DJZB 4QRPA 3DPBA 1D6VL 2FB4L 3Q5OA 3JT2A 4Y8DC 5T5FA 3L5IA 3X3GH 2XG5B 4U1NA 1TO4A 1UTDA 1KTDB 3LQAC 2ZP0T 4R7VA 1WHOA 5E6RB 1ZEAL 2XZQL 2WLZA 4O51B 3QZBA 2Z92B 1ED3A 3VGBA 4LF3A 1USQA 2XIBA 1MAML 2BHUA 1CDYA 4ODUB 1VZHA 2NDGA 3ARGD 1LTXA 2OMUA 4OCLC 5E99L 3MV9E 4I3RL 4HVBA 5JYLA 4G7YH 4FMKA 3AGWA 3MA9L 4PREA 2MOGA 3S34H 1XCQA 4NOFA 3C08H 3NIGF 3I50H 3QXDB 3RI5F 5KVMC 1E8WA 3ARWA 1Q0EA 4Y19A 5DVPA 1ILUA 3MLYH 3SE8H 1R24B 2EXWD 1O6TA 1ZHNB 2J5LC 2ZX8A 4N8PA 3RBSA 3S5LG 3GSNA 3SPIA 2W0FA 2NY2D 3A24A 4CSPA 5I8CB 4Q9QL 2Y5QA 1T1WA 4X98A 4F20A 4ABVA 4KQ3L 2Q87A 3MLVH 5E1AB 2FEDD 2VW7A 3VYNA 3V4UH 3VSQA 1ZLUH 2EVHA 1L7TH 2O6EA 3PQYA 1TVDA 4IDLA 4QAMB 3V9FA 4H88L 3U7WH 3M1BB 2WQSA 3D1MC 4CUCA 2JTYA 1UACL 5F7BA 4IRZH 2VR9A 1UT9A 5KN5A 3MGOB 4Z5RB 1TDQA 1VERA 3WFCH 2XZCL 4DVRL 1UZ8A 4NN5C 4LFHG 3CZNA 4Z3GA 3GSRB 5IJDC 3VA2C 3QI9A 2X53A 2H41A 1FN4A 3AABA 4NX0A 1IGJB 3AB0B 2F1AA 4OCSH 4YAQB 4NNXB 1HSAA 4BZ2A 1M53A 3MLRH 5J12B 4G6JH 1BM7A 4UZSA 2EE6A 3QIWD 4NQVB 2Y7OA 5DRXB 3SO3B 5JHDB 1GRWA 3EH4B 4GLRH 5IHZA 3MV7A 5JYMA 5J6HA 1F41A 3CVHB 2GVYA 4NRZA 3I6KB 4PMEA 3O6FA 3BJ91 4F9PC 5CD5D 1U3HA 2Z8RA 4RGOH 2VLRB 3F58H 2J3SA 4HP5A 5DD3L 2UXFA 1GIGH 4OUUB 1DVFC 1A1NA 3S8GB 3SODB 5E9DD 4YO0B 2IWFA 1G9MH 2VC2B 2Y72A 1IAIH 5CJOL 1IIIA 2IG2L 5JDSB 5HHOA 4FKEA 3P11H 4DTGL 4EO5A 2OJEB 2ZOWA 4JN1L 2XICA 1FZKB 4G70B 5M7QA 1M2OA 3X3FL 1ZWIA 3MR9B 4NIYE 1FAKT 5JHLH 4PS4H 3OLGA 2HAZA 4GJTB 2E6QA 4U1NB 1GCYA 1NWPA 4XMKL 3ARDD 3KLHC 4I2XE 5MEQA 1ED3B 4EI6A 2XV3A 3LVEA 2HKFL 3W11D 1OEZW 4LF3B 4RDQG 1VACB 2OJ1A 5IT2H 2EUXA 1ZGLA 1GS8A 5AW2B 3RZCD 2AQPA 1YA5A 2VLMD 2J1ZA 3ETSA 4PREB 1PTZA 3F83A 2X4RB 1LJMA 1QO3A 1KXTB 1SY6H 5DVNA 4HS3B 4Y19B 4OW6A 4KXBA 4R0LB 1L0XA 3OJVC 4QHKJ 4X9GA 3EJSA 2A5UA 2XXGA 3B5GA 3EDJA 3GSNB 4OZHA 2W0FB 1F4WL 3TFKD 1T1WB 2P3YA 2AQQA 4L8CA 3OKEB 4Y5YB 5IK3B 1QHPA 3TP4A 3Q01A 2QT6A 1CXKA 2OKMA 3DUUA 3E8VA 1OSYA 2NQDA 1VEPA 4NYLA 5J13C 5SV4A 5DJXA 2FWLB 4HKXA 4YDIH 4NAJA 4AQEA 1I85A 4UCFA 2BM3A 4Z7WB 2ENQA 3FFOA 2KYIA 3MLXL 1FZOA 5KN5B 2BS71 3W0WE 3GIZL 1A7OH 2YN5A 1A9VA 3HEIB 2A3TA 2J4WH 2Y36L 4JJ5A 3H2WA 5LBSA 3KVDD 5CP7B 2CGZA 4PJ5D 4ONHA 4FEMA 3T4AA 2IWGA 4TRPL 4MDJA 3CQPA 4U1SA 3QUZA 3BAJA 2OX5A 2BSRB 2DQGH 4OGAC 1CLOH 1QATA 2YA0A 3LPOA 1YVLA 3HC0B 1SVCP 5IHZB 2VXVL 5HDWA 3UBGA 4KTEL 4K7PH 4NRZB 1I3VA 2ORBH 3O6FB 1YUHA 4DO6A 4PVBA 4HK3J 4G83A 1P5VA 1NCCH 1U3HB 3E2HB 5HY9A 1XMEB 2JJSC 1J1XL 2Z93A 2Z7YA 2OL3H 2SEBA 1A6WL 4P23C 1A1NB 2KL6A 3D5OF 2A77H 4G6KL 4N2GA 3LKQA 4G7VH 1WE5A 2V3DA 4RWHA 1NMCB 3B2XA 1LD9B 2E7LC 3RJOA 1IEAA 4EIUA 5I19H 2NXYB 5HHOB 1ID5I 3QZOA 3QJTB 2R7EA 4W70A 3V0FA 4K8RL 4N20A 4BKLB 1RLWA 2BP0A 4UB0L 1MHEB 1NUGA 2HZHA 1VJSA 3QUMH 5B8CC 3FQUB 3QS2A 3ZHLA 5FPIA 4K23L 3ABLB 4GQZA 1T04A 2CKBL 4XO3A 2CPUA 1V55B 2QSQA 3Q9QA 4JFOA 4PY7A 3MBWA 5DD5L 4XAKE 2UY7B 2HP4A 2XYCA 1DVZA 1OTSC 3NG5A 4XNYH 4PJIF 4YHLL 4G8GD 4U3CA 4GQ9H 4NO0D 4RA3A 4Y88A 1I9RL 5GGSB 5IEHA 3LNGA 1QO3B 1RZKL 4R4NC 3FDWA 1E6OL 4O4YL 2EIZA 1XMWA 2K9FB 2YGVA 3VG9C 4OZHB 1Y6NR 3ZE2F 4HJTA 3FFCE 3SDAD 4JG0H 5GRXG 1WAAA 4FD0A 4FTDA 3GXFA 1SXZA 4WJKB 4L8CB 1Q0XL 3E1ZA 3PWPA 3I85A 4PG9A 1WFJA 2EYSA 1WZKA 3MODH 3N04A 3DUUB 5ERWB 3X1BA 4IRZA 5ICZA 3U30C 3S96A 3FTYA 5DJXB 3ZTCC 1UXLA 1N0XH 3FQRB 3GBLA 4DN4L 5IROD 2Q7YA 3DHJA 5C6TL 3IJHB 4P5RA 5C09B 3ASOB 1I4FA 3BYTA 4KVPA 3SDXF 3TT3L 2Q8AL 1DBBH 4JJ5B 1NCAL 4P4KD 4ESKA 2EDLA 4LSPH 5J1TC 2HTLC 2WO2B 4PRPA 1AGDA 5D7LA 1EUTA 3T4AB 3DJSA 4MDJB 4MA7L 2VDLB 2WXRA 4S1SH 2HJFA 4W1TA 3Q05A 1YN6A 2VUYA 4XMVA 5SWZE 2HSIA 3Q5TA 5EC1A 2DJSA 4KJQC 2WO3B 1RQ5A 1FRGL 1JZEA 1WPCA 2B14A 3DX4A 4AEEA 3B7RL 3ARDA 3DO3A 4B5EA 5DMGD 1I8LA 1UKSA 4UQCA 2C1OA 3ARGB 5T3XL 3RZCA 1KCSH 1OGAA 1YEGH 1YQ2A 4UNIA 1T7XA 4PB9L 4MMYB 3EYUL 2SEBB 3H1ZA 3FU8A 4MNQE 1UH4A 4IKKA 1ZVSB 3POCA 2HLAA 3PWNA 3LKQB 3X14B 1VB9A 1SN0A 1UJ3B 3IN2A 1M2VA 4G80B 1QBMH 1RZJH 1OPGH 3G9AB 2NY2B 4I0PA 1J8SA 2R7EB 5JHLA 4FQXA 2VRAA 2Y6SD 3BZ5A 1AJ7H 1O6SB 5A7BA 1MFMA 4I4WA 2WSDA 4URKA 2XN9D 2ZXQA 1IL1A 1D9KD 3BGAA 3KPSD 2IPTH 1SHXA 2WM0A 5EF0A 1C7SA 1TLMA 2YLKA 2QBWA 5DRWA 2VITA 4XHJC 2G2PA 5HSFA 1SOSA 1T04B 3C12A 4V1DE 4PRDA 3UTTE 4PY7B 2F58L 2FBRA 3PWJB 3MBWB 3FOMA 3U1QA 1RFDH 4X4ME 4AL8L 1YAZA 4OCRH 4LCYA 1U3JA 5IMMA 3MRMB 3PLYA 1SY6A 3UX9B 4CC4A 1GYVA 3IU3A 4ZQKA 3WTSA 5GJSL 4W9KC 3LAFA 4LO9A 2BSTA 4FQCH 4H44C 2DV6A 3NFPA 4NFBA 4U0RC 1X5IA 4U6HA 3T08A 3K1DA 4LNRA 4DPCX 3QIWB 2NYZA 1JVKA 3ZE1B 1B6DA 4TNWK 5I8KH 4S1RL 4MCMA 2ICEB 4M62L 4O5LL 3S96B 5IB2B 1EMTH 5KVGE 4MA8L 3NIDB 2EH7L 2Q7YB 2A6DB 1ZGLM 3KCWA 3AZUA 3FW6A 1SJXA 1I4FB 3VSTA 2RR3A 3OWEA 3QGVA 5K9OA 3OKLA 4B7IA 2YRPA 5E9DB 2IF7A 1A22B 1WFMA 1EH9A 1XCXA 3IFPB 4J4PD 1IQDA 1CIDA 5C7XH 1AGDB 1KDIA 3BSHA 1JHLL 3O45A 5INCA 2VR7A 1YN6B 4HUMB 2VXTH 3NDZE 4OCWL 1S7UA 3MHZA 5EC1B 2PMZA 3EYQC 4GEJA 2YKLH 4HWEH 3PPSA 2DY2A 3AY2A 2DICA 4I8DA 4ZQTA 3ARDB 1TLKA 2HUEA 1T3FA 2B1OA 3FU0A 1MCIA 3NA4A 3OV6A 4LLVA 3U2IA 4YJZL 3IGLA 4D0CB 1IO4C 3U79A 5L6YL 4OZGF 2PN5A 4G8GA 3RZCB 4F7KA 1HX0A 4PP2A 4L5FL 4ZX5A 3FKUS 2JF1A 1O0VA 1OPOA 4PLJC 5ISZD 2FCBA 3D4YA 4M6NH 1S78C 4K94C 3GEWB 2HLAB 3VXOA 3PWNB 4EKXA 1FLTX 4K9EC 1S9KC 4Y4KA 3WDJA 1M2VB 1WGVA 1N3NA 4NQSB 5SX5H 2YMTA 4NJ9H 3MUHL 1THCA 2IGFH 3G6JA 3QUMA 3Q9PA 3N50A 4NP9A 4I4WB 1IL1B 1E2VA 5J8OA 2CLRA 1FNSL 3CNKA 4Y1AA 5IQ7L 1N7MH 3QWNA 3TH2T 2VITB 1EGJA 2H2PD 4PRDB 3EH1A 3BE1L 5K69A 1OAKL 1OGTB 3HAEH 4LCYB 4JZNA 4PJCA 5EPMA 4DOHB 2FX8L 2WPGA 3GBNH 3RWEB 1BJ1J 3BP5A 4ZQKB 5CSZA 3OWRA 4Y5XC 1UB6B 1KYOJ 4FMVA 1JGIA 1J12A 4PJ5B 4TXVB 1NPJA 1JRHL 4X6FA 2AXFA 4A2MA 3BRDA 3KPLB 1YPZA 4FQQA 1TOXA 4TQHA 1TITA 5FECA 4XPBH 5C0AD 4F7MB 4LLMA 3WE1A 4CU6A 4EBQH 3MRPA 1JNNL 2W9LA 4ZBJA 4OZIE 1QQDA 3BN9D 2YEZA 4KMTH 4WHDA 1PLGH 3MBED 1MEXH 4QOKE 2NMSA 2NNRA 3O3EA 3TYFA 4CGTA 4GRWF 3T2QA 4BCYA 1IEHA 3L4ZA 3IB4A 4NZUL 1EXGA 1E8YA 1UEMA 2Y7MA 1CD0A 3HZKB 3WUWB 3WYRA 3V55A 3L3HA 1HL9A 1I53A 3CFQA 3GMNA 4PJEE 2DI8A 4L9DA 1U8HA 1AR2A 1I3RA 2VDRL 4P5MA 5ALBH 1GJWA 4G8AC 2GY5A 4YHNA 4LZKA 4HISA 5E4IA 4H0LC 4JFFE 5DJDB 2MKWA 3CZEA 3FJTA 4KU1A 4S0TD 1D2PA 1D9KA 4WK0B 1UYWL 3F04A 3EOAB 1YEEH 1A2YB 5DS8A 2MNUA 4PCSA 2NYKA 4WW1A 1QKZH 3W38A 5FHBL 3UH8A 3QFGA 4HGWA 1T3FB 4LLVB 5SWSD 2YXVA 5DO8A 2OL3B 4MRCA 2CO7B 1YJDL 4A6YB 4G8GB 4Z7UB 4BFKA 4NO0B 5EIQA 5EU4A 2BIIA 4A39A 4XN8A 3L3OA 1RUML 1TJIH 2BZCA 5EF3A 2DWDB 4N2BA 4YFEA 3C6LD 3IPEA 4UUJB 3VH8A 2AJVH 3C09B 1OAUL 2VDOH 2ERJB 4JDZA 3SDAB 5I17A 5D8JL 1IV8A 3G6JB 2KT6A 3ZUNC 2ADJA 3JWOH 1JHKL 3RGVC 2CBTA 4U1HB 2FX7L 1D5ZB 1H0DA 3P4NA 1WA1X 1RERA 3MUJA 3HJ0A 4LASH 1IJ9A 4C47A 1K85A 2BFVH 2DLFL 4NN7B 3HS0A 1E4WL 2K7QA 2ENSA 2AEPH 4HSQA 4I0PC 4I3SL 3V6OC 4JZNB 3IXTB 2DQTH 4ADGA 3SCMC 4IKLA 3U1SH 1BAWA 1IAIM 1C5BH 1TZGL 3I6SA 3RY6A 4P4KB 5DEFA 5TQ0H 2VAJA 4GKSA 5ESVA 3L1FA 4TUKL 2VWEC 4X6FB 3JV0A 2AXFB 5GGQH 2WO4A 5KVEL 3GEFA 3IMWA 1ZT7B 1QWUA 4AQ8C 4GKNA 2YAQA 4GAAA 1RIUL 4XB3A 4W9GC 2K4WA 1TJMA 4WI9A 1W91A 5E2VL 5KVFL 3IFLH 2ZKWA 5H37G 3DX6B 3RX8A 2YAOA 4Q9RH 5BOZG 1DDTA 1PNDA 2FL5A 3KM1A 4Y9GA 4YWGL 3TBCA 5DZPA 4QRSB 4JY4B 3SE6A 1YDPA 2I24N 3WUZA 4OUOA 4TVPE 4HJSA 3TYFB 1NEUA 4MAUL 4AM0B 2W0PA 3NFNA 4KX7A 4AIZB 1KYDA 4RFOL 1KSRA 4OGQC 5F6HI 1WFTA 2WXQA 4PJAE 4RISL 3QK0A 3F85A 3QXAA 5JA8B 3QIUC 4G9FE 5IJVA 1CJYA 3VYPA 5E4AA 1A9EB 1U8HB 1XL6A 5ENWB 4BFGA 1WFUA 2YD9A 5DA4A 4KZDL 1S7WA 2LU5A 4P5MB 5HYSG 2DYSB 4YHNB 1NFKA 4BFRA 1JV5A 1Q90A 4UU9B 2XN9B 1D9KB 3KPSB 1CF8L 4B9PA 4YSQA 2JNZA 5E8EB 1AGBA 4G6ML 2Z64C 2RFXB 1TQUA 4XAWL 5B39G 4FXGC 1ZTXE 3F3HA 1CR9L 2QZ5A 2NOYA 2EKSB 5AZ2L 3WELA 4GW1A 4XC3H 3CMOL 4GBXC 3BKML 3BUDA 2YK1H 5D2LA 5EU4B 3UTSD 4IBWA 2K0RA 1OCRB 4M43H 1VFMA 2PYEE 4PJHA 4HPOH 3OGCA 1VDGA 1P9MC 2GBTA 2MTAA 1Y6KR 4Z9KB 1UASA 1UOLA 1Q72L 2X1WL 1IB5A 5FYKU 2OCFD 5KSAA 1UCBL 3QEUA 4NC2B 5HJDA 3WIFB 4XXCC 2KH2B 2W92A 3QQ9D 4KY1L 5C0AA 3ZKMD 4ES9A 4F7TB 5KYXA 4HYTB 1G7LB 1OF0A 2ADJB 3QSKB 2CJTA 3CLFL 3GF8A 3L2LA 2J43A 2YBRA 3P4NB 5M95B 1MWAH 2V2TA 2NZ1A 1A25A 2WV3A 1EUUA 3HAEA 4KFZC 2GPZA 3E8UL 2L7QA 5L0QC 1OE1A 4X9IA 2BY1A 4HJJH 4BSWA 1ZLWK 5GPRA 4JFPA 4HMDA 1TT6A 2X89D 5EOQH 3I9GH 4PUBH 3D0VB 4TNGA 3O6KL 3CAFA 4GUPB 4MMZB 5FFLA 5AOIA 5L2JA 5ESVB 3US9A 2PETA 5F7LB 4NDMA 4F93B 4ODBD 4GKNB 4HFWA 5D7HA 1PVHA 1ZE3C 3C2AH 4BFIB 5HXMA 5BUAA 3FU6A 5FKAA 4QY8A 3RAJH 5E6IC 4B9YA 2DWSA 3ZTDC 1NKGA 5DRNB 1EAPA 4K3HA 4N1EA 5KS9F 1SFHA 1ZVHA 4K3DL 4C4KO 4WNQB 1YDPB 4NJAL 4RAVA 5KBLA 4WHTB 3DO7A 3NFNB 3SKNA 1PCSA 3TCXA 1I3GL 4OVUA 1INDL 1Q9LA 5DMIH 2V2WB 5ISZB 3RJDA 3HMXL 5IJVB 2YQ2A 1ZS8A 1CFVL 5DZVA 1ZHBA 1GC1H 2ROYA 3TBSA 5AKSA 3B2UD 3CBJB 3UCQA 2BVQA 1KBGL 2LT9A 1FZJA 3V4PB 1TMQA 3ORJA 3GMLB 3T8XB 3Q7JA 3N9GL 3Q1SH 4NQED 3SDCC 2J1KA 1FL6B 2BS9A 4XNUL 1CQKA 4NRYA 2FNWA 5I6MA 2F2HA 5D96C 1F90L 1WBYA 4HULB 1AGBB 2WAQA 5H94A 5FW6A 1K5NB 1HINH 1PY9A 1YY9C 3FUEA 3RU8H 2NY5H 1IC5H 4NHCL 4Y7MA 5KSUA 4AMXA 1TSRA 2VTFA 4YC2B 4JREC 4H8VA 3AM8C 1P4LA 3KPMA 5JO5A 4IOSA 3BLPX 4GW1B 4ZYKB 3MLWL 2ZXDA 1JTPA 3SZ6A 1U6AL 2OXGA 4YE4L 2YUWA 3L4YA 3MUZ1 4DCQB 4PJHB 4ZFZA 1VZGA 3HNTL 4QRFA 1SDYA 2BRRH 5DU7A 4FQ2H 5A16A 2B7DT 3ZKND 2XT1B 4A63A 1AIZA 5JIMA 1EHLL 1E6JL 3KBEA 3DV6A 2IOOA 5C0AB 3Q6GH 1A6TA 3ARRA 4I18C 5IWLA 3QXUA 4S10A 1MCJA 2YBRB 4P2OC 1JS4A 3QDJA 3SPJA 2EXYD 5F7MC 2V2TB 1Z66A 4P2QA 4FQPA 3HAEB 2QELA 3WKPA 4QHMB 1XZWA 3MBXH 4YSEA 1EAJA 4HIEB 3FTGA 5KW9H 5F71A 4JFPB 3BGMB 2FBJL 4E41D 4DKFH 1KGWA 1NGXA 3FHAA 3ZKSD 3L5HA 3P77B 1UB5A 2XWTA 4Z0BH 1VIWA 1ZHLB 5ITFA 5L2JB 3QEQE 5DT1H 3CXDL 5DRZA 5AVYB 2WVVA 2ED6A 3L9EA 3BDYL 2IVFC 3O3BA 3VFWA 3CHRA 4R4FH 4HFWB 2MQ0A 2ADFH 3N85L 4Y4HD 1CQYA 2I7SA 3EJZC 4QY8B 3KWXA 5ABAA 2AK1H 1QHQA 2GB2A 2X5PA 4PJIE 5F1IA 5J0BA 1YUKB 3BZFB 2DI7A 3P4MB 5SWSB 1JGEA 2XQBH 1UM4L 5CINH 3OAZK 4C57C 4LCWE 1AYOA 4WSKA 2I85A 1AOZA 4IIZA 4L4TA 4WENB 5FFOA 4ZW6A 1Q9LB 4LEXH 4HUXB 3ZE2E 1HESA 3MKKA 1RU9H 3MOAH 3KH3A 5AVWB 4TNVF 1QI4A 2GBVA 3C6LB 5GGUA 2CHNA 4JAMB 1CPUA 2Z31C 5FOBA 4IRSD 3TBSB 2QGEA 4Y4FD 3HFFA 3OAYH 4MCZB 4F7PA 4RH4A 2VKXA 3GXUB 4XX1E 4ZFGH 3VD9A 4ZPVA 3ARBD 4BUQA 2HCZX 1RZIA 4GAJH 3FU7A 4LKXB 4ABUA 3WDIA 2AJXL 4WDIB 1JYNA 4YZWA 2ZSWA 1WBYB 4JQXA 3HRZA 4YEFA 3SDXE 3GWJA 5BV7L 5DLMH 4XT1C 5KSUB 5AEAA 2K4AA 3WE6B 4ANKA 1UA6L 2CJ3A 5I1DA 3DX9B 4IBQA 4OLZH 1DJSA 2X89A 3IDNA 4R7NA 3LQAL 2O5YH 4ELMA 4XCFH 2VLKE 3NEOA 2OXGB 3ULUL 2VUKA 4YXLL 4JFXB 4RESB 2P4AB 3F12A 1A4BA 4ZFZB 4HT1L 1XF2A 1ADQL 1CICC 4K4KA 3IFOB 3QJFA 1NFDA 1BMWA 3UAJD 3VI3A 4D94A 3GXTA 4J3TA 1U8JA 3DTXA 3U0TA 2WGXA 3FB8B 1MWAA 2WBJC 3DV6B 3WSQH 7CGTA 4LARH 2Y9RT 1A6TB 5BUGA 1U41A 1SJEB 2RTTA 4LQFL 2D4DA 1OCWH 2WXFA 3CWGA 2YRLA 4MMXA 1BD2A 1TNNA 2F7RA 2X4UA 1PJ9A 3II1A 3QFJD 4GLRI 5ICUA 5ABZA 3DXAA 3L1OL 4YHIA 2BX5A 2F08A 2E9GA 4NNPH 2X3BA 3FTGB 5DI8A 1ITBB 3TIEA 4B9JA 1GZPA 1JD7A 1BAGA 3C60C 5ANMA 4R90H 4CU8A 2ZNXA 5DFVD 1XSKA 2B8OT 2XWTB 1BBJA 1AC0A 4FF9A 4GS7B 5FM8A 5ITFB 5I1CH 2XDHA 1MCOL 5DRZB 2VWEE 1IAII 2CCVA 2JIXD 4GG8B 1NFAA 4NQEA 4WU7A 5AB2A 2PCPB 1DTUA 1J0HA 1OB0A 2NZ9D 3GS7A 4KNTA 3J8F7 3FRUB 4LCCA 2EIMB 1PY0A 2JELH 3QUGA 2CBOA 3IN0A 2CK0H 1FYTD 1CLYH 2O30A 1MCBA 3G5XA 4HF5H 4KDTA 4KKBD 4MAYA 4S1QH 4JO3L 4LVHB 2DTML 2JI1A 4ZZFA 4Y9FA 1I8MA 1VF5C 3B9AA 1B88A 3UTSB 4Z3IA 3GMRB 4JFYA 1FGVL 4LEOA 1NIFA 4JRXD 3MUUA 3MZTA 1Y07A 4AJVA 1GGCL 4XR8C 5E2JA 3QAZC 3FULA 5JW4N 5FYKL 5FOBB 5FAAA 2EVFA 2IDSA 4ONGL 2VO8A 1WH0A 4ZPVB 3BZEA 3LKOB 4LLAA 3B9EA 3QO1A 1F13A 2D3VA 1E90A 2DQFA 5CJXA 1RZIB 3FU7B 2EEXA 3ABKB 3TONA 2ZSWB 2EILB 2ZAGA 1JZ5A 1P84J 4QI3A 4R7LA 2MCMA 4ZMPA 2VDMH 2HVJA 2HH0H 4P3CH 2EE0A 3IU4L 1OP5H 5I1GL 5IREA 3W57A 4PCYA 5CFHA 3CFMA 4PLOB 2CXKA 4R7NB 1PQZA 3QBTB 2OQJA 3SQBB 3WN5C 4ELMB 2I32A 3HI1A 2IANE 4RFEA 1IUZA 2UWEB 3A67H 3F12B 2FJHB 4C58B 1XF2B 3VWKD 5I26A 2HT2C 1NFDB 2IAMC 2X40A 3VI3B 4GXUM 4Y4HA 5C0NC 3DTXB 1U8OB 3U0TB 4EIGB 2BDNL 4XO4A 3WLWC 4E9RA 5KSBA 1NGWA 5D1QE 2VNCA 3CVIH 3UIZA 5A3ID 3JWDL 4OZGE 5DD6A 3FF7A 3LEVH 4MMXB 1B0GA 2UXTA 1A7RL 2XXFA 1BZ9A 1PLCA 1X5AA 4PJXF 4PJ9D 4QYAA 4R5TA 5C6PB 1CCZA 1KGXA 2ICWB 5T3XE 4QRQA 3HG4A 4C56E 1H15A 3PGFH 5DI8B 1S5HB 4LU5H 4UTCA 4OF5A 3TIEB 4YXHH 3QDMD 1GZPB 1WWAX 3K91A 3BWZA 4JM2D 5ANMB 2N7BA 4P5TD 1NTDA 3VMPA 1RSFA 1BBJB 2R0KH 3IE9A 1DQMH 2O5XL 5F8QC 2YBGA 4IRSA 4Y4FA 2MOVA 3K6OA 3LQMA 3R06A 1OT4A 1RZGB 2JTDA 2YO3A 3QPXH 1OQXA 2QVMA 1PMYA 3MV01 3V0DA 4NQEB 4WU7B 4JJHA 2B77A 3RIAF 2VOTA 1GR7A 3FU9A 3C9NA 1JXJA 1UM5H 4RMQA 1HQ4A 3PNWA 3HG0A 1QP1A 1K4CA 2QKIB 1UWGH 2EDEA 3FCGA 4HH8A 4NPYA 4Y2DD 3HC4L 4DT2A 4Z76A 3ZDXE 1XIWA 1J5DA 4JO4L 3OKKA 2V5TA 2BZ7A 1S9VB 5T1KA 3EUUA 1I8MB 3OAUL 1GYAA 3WO3B 4JL2A 4LEOB 1E9QA 1UXMA 3D39A 4KQ0A 4L3EE 4Q4EA 2CBQA 1W9XA 4KKCC 3RA7L 3UYOD 1YNKH 3JWNH 1TCRA 5LG1A 2ZE0A 4G9DA 3RUGA 3UAJA 3UEZA 5IB1B 5KG9A 4TTGA 3S2AA 3EJRA 4K3JH 4JVWA 5FA3A 3BZEB 4GG6A 1KCRL 2ITCA 2UZYA 5DHEA 4ZUTA 3QO1B 5E08H 2DQFB 4S0SD 4GRWE 1RHFA 4EN3C 4EUPH 1XAUA 2J1XA 2GAZA 3T0EE 1DO6A 2DEWX 5G4NA 3QFJA 4S0HA 1DE4A 2QGDA 4AG4H 1T5KA 4D8OA 4UT6L 4RX4A 4M5ZL 1OKEA 1GMIA 4Y89A 5J3HC 2AV1A 5DJ0A 1AGFB 4E41B 4BD4A 1MI5E 3GSQA 5GS3A 5I82A 1QLRA 5JIPA 1NMBH 1AGEB 1FO0H 1PGRB 4UDTA 4WWKC 1N64H 1KUMA 5FYJU 3KAAA 4PSPA 4Q2ZA 5J6GB 4FZEH 3ARZA 5E0FA 2GHZA 3I02A 5AYUH 3SE4A 1LP9A 1YMHA 1M7IB 2FIKA 5T5FL 4Y4HB 5JQ6H 1DO5A 2YD6A 4PR5B 4MD5A 1NGWB 2UXVA 3NN8B 4XP5L 4WTWA 5KSBB 5DD6B 2AS5M 2VCOA 1FYTA 2XYBA 3SOBH 4PW4A 4LSQH 5F7DB 1ZLEA 3X13B 4QRRA 1M6OA 1YEJL 4W6WB 2ZUVA 4L5FE 3EO1B 3A4FA 4PJDA 5FCSH 3VRJA 1MAKA 3A5VA 2OLDA 2MCPL 4QRUA 5L2KD 3QRGL 4JKWA 1AQHA 4ONFH 2VH5L 3DNKA 5MI0B 3GSNL 1QNZL 2WLKA 4IRSB 1AZVA 4J23A 4Y4FB 1EJFA 5EBGA 1BF8A 3R06B 3S35L 2QL1A 1SJVA 5BZWA 4RZCA 3DV4A 3PHOB 3RFZB 2BIQA 1PKQE 3NZHL 1CE1L 3H7BB 3C9NB 1ACYH 4W9EC 1NOLA 1HQ4B 1NZRA 3PNWB 4JUSA 4MQ7A 3P1VA 4W68A 4WI4A 1WK0A 4OI7A 1IGTA 1CLCA 4X0NA 1MHHA 2BS8A 4KMLB 2V9RA 4M1GL 3QUXC 3ZYZA 3CJJA 4OIAA 2AF2A 4NI3A 5I18H 1E9QB 4KRPD 3UZVA 3BO8B 1TQVA 4JRYA 3NSJA 1LO0L 4HJ0C 4BZ2L 4F2MA 1BFVH 1CG9B 2YQGA 2QKSA 1LEKA 3CHPA 3K72A 4FP8L 3STZB 1QPKA 1TCRB 4NQDA 3WFBL 4G9DB 3VGAC 2YARA 4D9RE 4GG6B 5HGHA 3U0WL 3FMGL 3NCYP 4NO3A 4X4ZA 1KJ2H 1FGNH 3GRWH 2JKLA 4RGNC 3QFJB 1DE4B 3GI8L 1GSMA 3TVMC 5I15H 3VXME 1F18A 1FNFA 3JYCA 1GTNA 5AW1B 1KN2L 1H3TA 2EDXA 3ARFC 3GNMH 2AV1B 2HG5B 5DJ0B 1G9EA 5I0YA 3GSQB 1G9HA 1Z6JT 4G1MB 5HD8D 4P5TA 1CFSA 2JKTM 3I3EA 4HEME 2M83A 2HB0A 5C07D 3CFDA 2NTFB 3WFEL 4MA1B 2ZKMX 1MOEA 2JIXB 1JMZA 4R7DA 1MZYA 1YMHB 2WZ6A 4E5XA 3AXIA 2LU3A 4P2RA 4MQXD 3HG1D 4WTZG 2R39A 1NC2D 4FFZH 5HI5C 1O5PA 5JZ7D 4N24A 4NM8L 3FN0H 4XNZB 4JFSA 2H5UA 2A6JA 2UYLA 1FYTB 1D5IL 4XPGH 4Y2DA 4C4UA 3VD3A 3VXNA 2E0PA 4MQSB 5GXBB 2HRPL 3OBAA 2OSLA 5F3HB 1UGNA 4XC1H 3LKPA 4XN7A 1J10A 3FSOA 3GHBH 3VRJB 5DYOA 2AAVA 4YNYB 4JRXB 4X6CA 2XU9A 2BJMH 5DJYA 1KLFA 3QG6B 2LU7A 2LGNA 4U4BA 5L8LB 2PNDA 5CCGE 4X8JA 1NSNH 2R2BA 5ALCH 5L7XL 2NY4B 2E4TA 4DGUA 1BQHA 1HXKA 1UFUA 1JZHA 3K3QA 5BZWB 1T83C 4M5TA 3V79C 2IQ9H 2RB8A 3DV4B 4N0CC 2WWKT 3X1EA 1GGIH 2J8HA 4KQ4L 4GO8A 3VXUD 2XLLA 1EZVX 3LNEA 5E94B 5F9JA 1IARB 1L0QA 1W80A 1DBJH 3BT0A 3DMMD 3J27A 4ZXBC 5AW0B 1CO1A 1FLRH 3TO2B 3WFDL 5JXAL 1YEDB 4H13C 1IGTB 3DUSB 1MHHB 2JH2A 4W9DC 4YFLI 5E1GA 4Z7WF 1NM4A 4KVCL 2CXGA 5LBSL 4Y9BA 3CFEA 3GDCA 3AUVA 1ZHKA 3OR7B 4APQA 2CA4A 1G1CA 1HFUA 1QZNA 5KVEE 2GT9B 2VDLL 3LIZH 1IE4A 3K72B 4DN3H 2ZCZA 4CNIB 4NQDB 5I1HH 1SPDA 2M2DA 1UH3A 5KS9E 2WWMC 1IKFH 4EUPA 2H2SC 5KVFE 3MRBB 3E3QC 5C6WH 3HCVA 2VXUL 2VDMB 2Y1ZA 3VQLA 4PJ9B 3RDTD 3CSBA 2QQLH 4LLDB 1S3KL 3CX5K 3ATEA 3WGVB 5IESH 5IR1A 3VM5A 4PGBB 1JF1B 2CALA 5AZEL 2K6ZA 1FO0A 1EBAA 2O5ZL 3GM8A 4HWBH 3QDMB 3V4LA 4EE2A 5DO2D 2BXYA 2XFGB 4JM2B 5I1JL 2G3NA 3D2TA 4Y1TA 1MLBA 4P5TB 1SBSL 4GFXA 2EP6A 2D9QB 5EUKA 3EYVA 2BMKB 1KENH 1LDSA 2EDNA 3FT4A 3EJYD 3OKMA 5CEZH 3CFDB 3F6LA 5J5EA 4N2HA 5ABDE 4QYOB 5HDBE 1EDQA 1CD1A 3MKGA 3MXWH 4KOCA 3X3GL 3VFMB 5IVOA 3DBXB 4CMHB 4R7DB 5DFTA 4UQIM 3VMNA 4E5XB 2UUDH 4G7SB 2QLVB 4JHWH 1E4JA 4POZC 1S8DB 2ODHA 3S36H 4JQIH 5CD3B 1LE9B 1HOCB 3GJEB 4HBQA 4Y2DB 2GJPA 2ZOOA 5AVTB 3VXNB 4G7YL 1JG9A 4X4YB 2B3RA 3H4FA 4XE5B 1KACB 5GS1C 3TXAA 3S34L 3C08L 4PJ7A 3I50L 1OGSA 2H1PH 1B9KA 3MLYL 3SE8L 1OZTG 5DYOB 2AP2A 3N43B 5CEZD 2N59A 1N26A 4QDGA 5EO0A 3PIQA 4FNUA 1KLFB 4XAKD 1FA4A 3MLVL 4HC1H 5EIVA 2AW2A 2KUTA 2V9QA 2P8PB 1UATA 2MOQA 1L7TL 2AK4E 5B3JF 1DZ0A 3OQRA 3NT0A 1RI8A 5J4MA 2X4PA 3U7WL 1VZIA 3UTQB 5KSVA 4IRZL 2EDJA 1HIMH 3LN9A 5GRWA 4ZFQA 3UROR 2Y7LA 3S3SA 1W8NA 5FIEA 4JCMA 1N8ZA 4BH7B 2A4ZA 2X7LB 2ZWSA 3WFCL 2WLNA 3FFCD 3BISA 3N0AA 2C9RA 1ZXQA 2COQA 4ATTA 3APCA 3APDA 3LXCA 1JAEA 3B7SA 5HJ3A 4HCGA 4IU3A 4OCSL 1B4RA 4YUEH 2XPYA 3N55A 4G6JL 1EHKB 5B1AB 1A6UH 1A8ZA 2FLRT 1N0LA 2C8NA 4KROD 4OF8A 4NQCD 4EVNA 1AH1A 2J88H 1W8EA 5C8JA 3TO4C 3QH3B 2DJUA 2IBZX 1BZ8A 4JY6B 1KJ2A 3GRWA 2IDQA 5DK2B 5DUBB 4LHJB 4TVSa 1YYMH 3G08A 3MRQB 4WW2A 4RGOL 4QGYA 5F7YC 3F58L 4NM4H 5CFAA 3D8MA 5IVXB 3IWUA 4WUKH 5IR1B 3AUWB 2CE6A 4NPJA 3N1FC 3MCYA 2UY6B 1NGYA 5D7JD 1FO0B 1MVFA 4MNGA 3QNFA 3ZY7A 3AB0C 4ENED 1G9ML 2NZIA 3BAXA 4WI3A 1IAIL 5EH1A 5L2KB 2A38A 4JFEE 3A3YB 3P11L 1EXUA 5EUKB 3TBVA 5CEXB 3EHBD 3GSWA 4GINA 1OOWA 1X3DA 5AFAA 3F8UB 4BYHA 5JHLL 1R46A 4RWYH 3LVTA 1SHMA 4PS4L 5HP5A 1CD1B 5CP3H 1I8UA 4XNAA 1J8HA 4GMTH 2W81C 3HB3D 1MXGA 3MRCA 2YMOA 3VXUA 5D93B 2Z8WC 4UI2A 2AEQL 2BXZA 4KNUA 4PMFA 2P5WE 2WYIA 4GW5B 2Q10A 5LHDA 4BKSC 3LN4A 5IT2L 3IBEA 1EV2E 1BVNP 3NDYE 3JV4A 3BEWA 4OLYH 2GSIA 1SY6L 1T2QH 2NYYD 5MENE 1C1EL 4N2NA 4KRPB 2GCYA 1WP6A 1ZK9A 4U1GB 3BP4A 4OKVB 5HPMB 4AYBA 5FK9A 3ABGA 2LE9A 2WQWA 3SGEH 5I6XC 1JK8A 3E6FA 1F4HA 2GW5A 3VCLA 4YDIL 4LSVH 2ESVD 5KSVB 1XF4B 3RDTA 1T20A 3MV8E 3PABB 5EZOH 1N8ZB 2VLLB 3AY4C 1Q4NX 1A7OL 4Z7QE 1V10A 2J4WL 1DVUA 1XB8A 1X5MA 2WLIB 3WNKA 4WFHD 3UEQA 4JK0D 5I1KH 1L6XA 4OGZA 3NIDF 4R0LC 2IALA 5HJ3B 3L5WA 1I7ZB 5TQ2H 1S7TB 4EF3A 3THMH 4KJPD 1CL7H 1QFUH 3LIZA 2DQGL 3BLKA 1NIDA 1CLOL 1TENA 1TO5A 5C07B 4OV5B 5TDOA 5DD1H 4Y5YC 3BAYA 2R0WH 3IBOA 1FH5H 1N0LB 1XF3A 2XX1A 4C55A 4EVNB 4F37K 2LAAA 3CX5J 5D7EA 4WEEA 4A38A 1E5ZA 1JHTA 3H9HA 4RGMC 4K7PL 5DR5H 4YSSA 4CADA 2JCCE 1KJ2B 3HG1B 1NC2B 2ORBL 5EC2B 4WW2B 3G08B 5D7IB 2RQ8A 3Q2WA 1NCCL 3MRNA 3BWAA 3R18A 4JHBA 4HWBA 4PGDB 4X7TA 1RIHH 2HFTA 4OIIH 4BK5C 4FTVE 3CD4A 1OTUC 1RIVH 3HG2A 1BYOA 1IIKA 3L6FB 2A77L 1NGYB 4H1LG 4G7VL 3NIFB 2EIEA 3O3AB 3QYNA 1B2YA 2ATKB 3N91A 3SDDA 3RWHA 3TBVB 5GS0H 5G5DA 1XGUB 1D3CA 1AP2A 3WJJC 3KEHA 3TT1H 4DO5A 3DJRA 4NZ8A 1BAFH 1LXMA 1T89A 3JUZA 2HLEB 3QUML 3DYMA 4LLWA 1Q38A 2Q76B 3FT3A 3KGTA 4TNWF 4JQIA 1L6ZA 3VXUB 5EU6D 3ULSB 4DK6A 2APXA 3DOHA 1EGJL 4F33A 4YDKH 3DMMB 4XNYL 4YHMH 3SKOB 4M9PA 3T0WA 1T1YA 4ZOBA 4GUQA 4EAEA 4WO0A 3DKHA 4F2EA 2VN7A 1ASPA 4GQ9L 5JIIA 3RL1A 3ZDYB 2PO6A 2NXYC 3F7LA 2GG1A 4ACTA 3ZRFC 3ZOAA 4LEEA 1HAWA 4FL4B 4NC0B 5ACZA 5EOTA 4HC1A 3IJ8A 4JG0L 3ZZQA 2LR4A 3N06B 15C8L 4YSOA 2APWA 3SQRA 1FIEA 1N59A 4NQCA 1OP3K 1MRFH 4G3YH 4XWOD 4JGUA 3MODL 5AOMA 4BM7A 4U3SB 3WNIA 3TU6A 1JK8B 2V7NA 3VDAA 3IMTA 3VCLB 2R15A 2X0VA 2EICA 1U2CA 1N0XL 2VDKH 4F7CA 3OHXB 4P2YA 5IOPA 1S4IA 4YXKH 3RDTB 3LS4H 1E9OA 1L9MA 5MEPB 5JOPD 5BO1H 3MREA 1YZZA 2NCEA 4FG6C 4HG4K 1DBBL 4YK4B 2YC1A 1P7QA 5FGBC 4LSPL 5C0CA 2AGJH 3KYAA 1MHPH 2ICCA 3PL6D 4U1MB 1RUKL 2IALB 3RGHA 1PSKL 3ALXA 3FK3A 5JW5A 4KHTH 2G75A 2G0LA 4YQXH 3FB6A 4PQXA 3W9EA 4AYGA 2J6WA 5FDYA 3SB3A 5BOPA 1VEMA 1XCTA 3EGSB 3HR5A 5DCCA 5ESAB 5CJ5A 4N8VA 4UV7H 3S88H 1N5AA 2ZPKL 4Z7IA 3FT2A 1JHTB 2A9BA 5EBMA 1TNMA 5FM5M 5I5JA 3RILA 1T2XA 2GFBB 1MNUH 1MJ8H 3MFFA 3OC8A 2ITFA 4Y16D 1DQVA 3IJSB 1KCSL 3BWAB 3V6FA 1YEGL 1JSYA 1WIOA 4CJ1A 3EH5B 1Z9PA 3ATAA 5EV7A 3PXHA 4YIQA 3RKPA 2BWQA 1QUPA 4TTDC 2R0LH 4GIPD 4KC3B 5CR1A 3RWCA 2ILLA 2JXMA 2FLBT 2OMYA 1XGPA 4G59C 3MLPA 3EXJA 3QRFM 1G7JA 1QBML 1RZJL 2CA3A 1OPGL 4Z7UF 5H4YA 5F9AC 3TWYA 4ZFOB 5FYKE 1AJ7L 1CFTA 2B5IC 5G5DB 3DETC 2FH8A 2W5PA 4Q6IA 4UYQA 3OQ3B 3VFRA 2IPTL 1CXFA 3FL7A 1H5BC 1YEWA 2ZWYA 1RHHA 5C0BD 5DF0A 5HDLA 3FT3B 4LSUH 4TQPA 1S7QB 2ESVA 2XTLA 4H0GA 3WFHA 4B53A 1RFDL 4MNHA 4ZT1A 3VH8G 4NI6A 1F86A 5F1NA 4KVNH 5BRQA 3GMMB 3NCBB 2DJ4A 5E4EB 2B2XH 3P0YH 2J8UA 4AGPA 3LKNB 1X9RA 3UTOA 1G84A 3NRFA 5E2TL 1UJ3C 4AMKH 2IH8A 3MJ6A 4FQCL 4Q52A 5HGDA 2VAAA 2WLHA 3EDFA 4KUZH 2IEPA 3I2CH 2CHXA 2G60L 4QEGA 2FEDC 1HH9B 3N42F 3IAQA 4KROB 5TE6H 1FG2B 4NQCB 2ED7A 4KXAA 3I84A 3IMVA 5I8KL 5T1LA 4AGOA 4ZD3H 2Q3AA 5D4JA 2L8AA 2HT4D 1ZAGA 2WZ0A 1YYLH 1F4YL 4RBPK 1EMTL 1VGKA 4QIRA 3U2JA 4OJDH 1RK1A 3KBFA 1BBDH 3W1ZA 4PJGA 1QACA 1E9OB 3G5YB 2K8MA 3KXFA 3MLSH 3K1KC 4HZLA 4UT9H 4H5SA 2IDTA 5KYYB 4CKQA 1PX4A 1E5AA 3FH5A 4QHKI 3ZKXB 2YC1B 5C0CB 5C7XL 3U9WA 5K93A 2CIIA 5BPPA 3L9BA 4HIIA 2NY6C 5JW5B 1DFXA 3SYQA 3EHBB 3A4DA 4IRJD 2VXTL 3OL2A 1KC5H 1IGMH 1II4E 1XCTB 2J6EH 3HR5B 3Q3GA 3BW9A 3TGXA 3UXFA 3B9KD 3L5JA 2YKLL 1NWOA 4HWEL 3ZW3A 2ICEC 1N5AB 2P5EE 3VFSA 3HB3B 1F6LL 1HCYA 5EBMB 5CD5C 3L2MA 4UILH 3D7PA 4Y8AA 4C8XA 2BY0A 2WZ5A 4TS6A 3H9YA 3MRRA 4GO9A 4MXVF 3I75A 3V6FB 4FG0A 4F15B 2FEJA 2J56A 4GYBA 3E6HA 4M6NL 1CWVA 2PCFA 4WWPA 4LAQH 5E4OA 1HWWA 2JXMB 2OMYB 3GZQA 1XGPB 2NUTA 1SFDA 2WTOA 4V33A 2EDRA 3TURA 4JO2H 1SZNA 2DQDL 4NJ9L 1J48A 3U4BH 4OBSA 5AOKA 1N5YH 1S9YA 1XDTT 4DKEH 5JR1H 4O02H 3ULVD 2FDBP 4Q6IB 1GL4B 5JHDE 4M61B 1QZ1A 3KYMA 1J87A 3QNXA 1PLAA 1N7ML 5HGBA 2PYED 5EU3A 3O2DH 2ESVB 3WFHB 4MNHB 2VERN 3WTWA 2XQYG 2D0HA 3NRQA 2CUIA 2VLRE 3UPRA 1H9DA 1EFQA 5EO1A 3HE7A 2FT8A 2YD4A 1JXDA 2J8UB 3NQKA 3BIBX 3DJ9A 4NUPA 3ZYIA 1TZAA 3D51A 4TSCH 1D6VH 3VX1A 2FB4H 3PL6A 3EYSH 5DZ9A 3OAZH 3PAYA 5AVZB 5HGDB 5E7BA 1E4XI 1A66A 4KKZA 3T1FA 1FV1B 1AY1H 1KTRL 3RVTD 1HTYA 4HIJB 2I60H 5HYJD 4NWUH 4I3GA 4XPBL 4EBQL 1SXCA 3LTVA 5DJCA 5JDJA 3J2PA 1X4XA 1GH7A 3ECWA 4KMTL 1PLGL 1FG9C 4YOKA 2QDWA 2A6IA 2QQQA 2VR6A 3AACA 4U6XA 3ZL1A 1BA9A 2CHDA 2PTTA 4PJGB 1DSFH 1OF2A 5E2WH 1FP5A 1MFBH 1PD1A 2M8XA 4KQ3H 4WY7H 4LCIL 4K0OA 4Y5VC 1CYGA 1HU8A 1RJYA 2VR3A 3DUHA 4P07A 5ALBL 4Y19E 5I16A 3AU1A 1Y7VA 5F0JB 4HIIB 3VM7A 4EOWH 1TZHB 4HKBA 2JJTC 2GK0A 4HETA 2JMRA 4LOEA 1UACH 2XVLA 3JVFC 4B9GA 1YEEL 3BH9A 3ME0A 4DPAX 5IJBC 2XKSA 3CN2A 3VFSB 4GRLD 2XZCH 4M00A 3W9DA 3DJZA 3EGDB 1QKZL 4FHJA 4EDWL 2GBUA 5B1BB 4BQ8A 3PQYE 3BUBA 1PG7W 3VMOA 4AYEC 1A5FH 5EU6B 1PIGA 2H32H 4KK5D 4RMSA 5LWYL 4PRBA 1VPOH 4G11A 4Q4IA 1A7NH 4AITA 4X83A 3PDOB 2IOMA 3BAEL 4XN1A 2C26A 3BFQG 3FU3A 4MDIA 1TJIL 4ZUUB 5BQ7A 1U91A 4HWNA 5CIPB 2Q8BH 1JNLH 2WK2A 5F6IC 2NUTB 1OCZB 2AJVL 4FHKA 4YDLB 2VDOL 3CPUA 3O0RH 2H3NB 2BVYA 3GK8H 3VFVA 3BQUD 3CG8A 3JWOL 2FHFA 4MJJA 1TJGH 4LASL 5I1LA 4BFBD 4X6DA 2BFVL 2VUOA 5CLZA 1V7NH 3MRHA 4Y2OA 5HGBB 1PCXA 3SY0B 4A2EA 4X4XA 5EU3B 2R0ZH 1XT5A 2IXQA 2AEPL 4QXTB 1J1OH 3POHA 1SMDA 3F6JA 2IG2H 1DQDH 2DQTL 4Z0XA 2W9DH 4YFLF 3UPRB 4FA7B 5EO1B 3U1SL 3HE7B 3O8XC 1T0NA 4HV8A 1C5BL 4H8PA 4K7FB 3RGBA 4UAOB 2CMRL 3L3GB 5TQ0L 1RZQA 1AO7A 4OZIB 3B5HA 1U8MA 3PL6B 3BCDA 2AXHA 5GGQL 4CKVX 1IU1A 3TOPA 2ERJC 3SGJA 3SDAC 5HHOE 3T1FB 1MW1A 4TUUA 2OW6A 2ZJSH 5J57B 4B3VA 3H9SD 4MJ2A 1PBYA 3RURA 2K6WA 3IFLL 4R4BA 3MI6A 1IEBA 4NN7C 2YGOA 2BNUA 4AEIH 2VDKB 4M7KH 5FUCE 4DKDC 5IROC 4N86A 2A6IB 2KC0A 3QRLA 1ETZA 1XEUA 2YD3A 1EK3A 4U6XB 4Y16B 3KPTA 1N18A 2Z34A 3QPQC 4UT9A 1HILA 2DLEA 2IPKA 4PJFA 1OF2B 2OW7A 4P4KC 1U8LA 1T5XB 3NP4A 1ZT4B 1JGVH 1ONQA 4JZJB 4M3HA 5D1XD 2J5WA 1RJYB 2ZOKA 3TV8A 3T6WA 2V0AA 3RTLA 1JNJA 1OT2A 2J6EA 1A4JA 3HBZA 4FS0A 3PGDA 1JI2A 1SYSB 1WYJA 5B3JE 4OZHE 1F11A 5JW3H 2BHZA 3L45A 5F7NC 4CU7A 3QJRB 2DM7A 1CUOA 5ICYA 5C0BB 2PW2A 3TTSA 1SEBA 3GIZH 3NAAL 1P2CB 5DMGC 1PEZA 3W9DB 4L8SA 5F2FA 2NY3C 2FEEI 3QS3A 4CC0A 1UWEH 4PRBB 3G6DL 1JPGB 5EHFA 4Q8BA 5LUMA 2GK2A 2VN6A 3Q44A 4X6BA 2NQ3A 4HX1A 2D4FA 5C09E 2YK1L 1JCKA 2GAZB 4M43L 3BEVA 4JPQA 4MDIB 4UWQB 7PCYA 5BQ7B 3EFFA 4HPOL 1U91B 3CSGA 1MFCH 3RKDD 2MH4A 3P73A 5I71B 2Y6SC 4O02A 5IFJB 2UZXB 3VXPA 1XBRA 2FQDA 1E43A 5HYJA 4XPHL