4QAQA

1.58 a resolution structure of ct263 (mtan) from chlamydia trachomatis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
195
structure length
195
Chain Sequence
b'MFKLLLIFADPAEAARTLSLFPFSLNKENFYTYHTENVLLDVMVLKTWGYRGVVQALSPPPSGYDLWINAGFAGAANPNIPLLKTYTITSVKELTPTTSVEEELEVTPIPRLPLAQLTSVRSPYRDGFHEHLQLVDMEGFFIAKQASLVACPCSMIKVSSDYTTREGQDFLKNNKVKLSQKLAEAIFPIYSSFID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CT263
publication title Structural and Biochemical Characterization of Chlamydia trachomatis Hypothetical Protein CT263 Supports That Menaquinone Synthesis Occurs through the Futalosine Pathway.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Hydrolase
total genus 57
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qaqA00
4LDNA 2IQ5A 1YR3A 4G41A 3NM5A 3P0EA 1N3IA 1V2HE 4LNAA 4LKRA 1T0UA 4F3KA 1Y6QA 4MCIA 4GLJA 3PHBE 1A9SA 1VHJA 2OECA 1Z38A 3ONVA 1RXSA 4OGKA 4F3CA 4DA6A 1RXUA 4OY3A 3F8WA 4D8XA 1A9RA 1Z5NA 4DA7A 4K6OA 4F2PA 3E0QA 4G89A 2QTTA 3FOWA 4D98A 1ODLA 3NM6B 3FB1A 3E9ZA 4U2KA 1YQUA 1ECPA 2QSUA 1CG6A 3OZEA 2QTGA 3LA8A 4QFBA 4M3NA 1RSZA 1QE5A 4BMZA 3MMSA 1JYSA 1Q1GA 2OC9A 1A9TA 1Z37A 2HRDA 4QEZA 2A0XA 5DK6A 4QATA 1RR6A 5F7JA 5B7QA 3ENZA 4TXJA 2AI1A 4JWTA 4WKPA 1V3QE 5EPUA 3IOMA 3BJEA 3PHCA 4QAQA 3BGSA 1PR0A 3NBQA 1A69A 1G2OA 4GMHA 3E9RA 2HSWA 5C80A 4WKNA 1Z36A 1OU4A 1YQQA 1V45E 4BMXA 5CXSA 2QPLA 1U1CA 4YO8A 2RJ3A 1RFGE 1LV8A 1Z35A 4MARA 4OGLA 4TS3A 1V41E 4M7WA 1TGVA 5IFKA 1Y1SA 2AI2A 1JPVA 1Z34A 5F78A 1YBFA 1Z33A 5FAKA 3GGSA 4GLFA 5JPCA 1PR1A 1JDTA 3LGSA 2B94A 1WTAA 4R31A 1LX7A 1PR6A 2PGAA 1JP7A 5I3CA 1PWYE 4TXNA 4YJKA 3T94A 3GB9A 4OJTA 5KB3A 3OF3A 2OXFA 4LZWA 3DDOA 5CXQA 4QASA 3U40A 3UAZA 3EUEA 3ODGA 1PK7A 1T8WA 1K3FA 1PR4A 1U1DA 3UAYA 2BSXA 4OF4A 1OUMA 4TXLA 1OV6A 5ETJA 4G8JA 2I8AA 3BL6A 3KVYA 3IEXA 1A9QA 2QDKA 3KVRA 4DANA 3KVVA 4P54A 4L5CA 1M73E 1TGYA 1ODIA 1I80A 1Z39A 1JE1A 3OZCA 3KU4A 1PBNA 4PR3A 3OZDA 4X24A 1K9SA 1RXCA 4DA0A 3EEIA 3TL6A 4M1EA 4MCHA 3LBAA 3MB8A 4DAOA 4OEHA 4WKBA 4L5YA 1T8RA 4RJ2A 1JDSA 5B7GA 3NM4A 1U1EA 1U1FA 3SCZA 4D8YA 1B8OA 4NS1A 1C3XA 4ECEA 1SD1A 5F73A 4F2WA 4YNBA 1ODJA 4F1WA 1PR2A 2GUWA 4KN5A 1TD1A 4JOSA 2ON6A 4L0MA 2A0WA 1T8SA 1V48A 1OTYA 3D1VA 1TCUA 3DF9A 4I2VA 4E1VA 3DP9A 1ULAA 4EARA 5K1ZA 4DA8A 5F76A 1YRYE 4TYMA 1B8NA 1OVGA 2OC4A 1JE0A 4TXMA 4TTAA 1Z5OA 3K8QA 5EUBA 4YMLA 1JDVA 4L5AA 1Y1RA 1RYZA 1VMKA 3BSFA 5IU6A 2AC7A 3UT6A 3DJFA 4L6IA 5B7PA 5CCEA 3FNQA 3OZBA 3O4VA 4R2XA 1SJ9A 3PNSA 1JDZA 3FAZA 1NC3A 4BMYA 1Y6RA 4H1TA 2Q7OE 3QPBA 5CYFA 3UAWA 2H8GA 1NW4A 4FFSA 5EFOA 3UAXA 2ISCA 1PR5A 1OTXA 4NSNA 2XRFA 3EUFA 3INYA 1A9PA 3FWPA 1SQ6A 1RXYA 1FXUA 1T8YA 4BN0A 5F77A 1U1GA 3K8OE 5CYGA 3OPVA 4TXHA 5F7ZA 3KHSA 3FUCA 3OCCA 4DAEA 1RT9A 4WKCA 4PNPA 1PF7E 4TTJA 1A9OA 3C74A 1VHWA 1Y1QA 4LNHA 3PNPA 1ZL2A 4QARA 4D8VA 1PKEA 4DARA 5B7NA 4NY1A 4WKOA 1V4NA 1SD2A 2I4TA 1TCVA 4UC0A 1VFNA 3UAVA 3P0FA 3OOEA 3OOHA 1K27A 2AI3A 4TTIA 4DABA 4GKAA 4IP0A 1PW7A 1NC1A 1JDUA 5CCDA 1ZOSA 1LVUA 3KUKA 1XE3A 2A8YA 4R2WA 1ULBA 4TS9A 1CB0A 3O6VA 2HN9A 4EB8A 1PK9A 2P4SA 2HWUA 1RCTE 1Z5PA 4JP5A 2A0YA 1ODKA 3DPSA 4D9HA 3EMVA 5F7OA 1Y1TA 5F7XA
chains in the Genus database with same CATH superfamily
3H4IA 4NARA 3H97A 1R6TA 1E64A 1NONA 2FZGA 2C9YA 3O82A 4DWOA 2O0KA 4RPLA 2FJUA 1ACLA 3DBLB 5CM8B 1T0IA 4TMZA 3WL7A 3PCXA 4H2DA 2IL1A 3MT7A 1E2BA 2XI4A 2GEJA 3IJRA 3PJDA 4OKSA 1T2AA 1ZGGA 4TM8A 4DLXA 4MYHA 3D81A 5DXFA 3TECE 5CDHA 4V0KA 3N5KA 1PEDA 1YONA 2ACEA 1WOYA 1WV0A 4LYJA 1ZISA 3M9LA 2DQSA 4G26A 2CHUA 3VBCA 3HEBA 4BTLA 3FOAA 3CEAA 1SEPA 2PQ0A 5JD6A 2B6NA 3FCAA 3IA7A 4RTPA 2W6JA 5LBUA 1FS4A 4BLTA 1D0VA 5A0TA 4A8TA 1J2UA 1H8ED 3IB6A 1JR3A 2OECA 3DC7A 1WP9A 4U7JA 1CQJB 3ONVA 2VRWA 3SYKA 1I33A 1BMQA 4CL2A 2I6SA 4BQRA 2Y1CA 3MIZA 3U3ZA 1KFJB 1N8TA 3BFPA 4JIGA 3AESB 1KI9A 3PLRA 5K2OA 1XELA 1Z0UA 1UEXC 2HWKA 3GOQA 1CZRA 3NMUF 4ZAYA 1I51A 1XDWA 2RH5A 2CK3D 2JA2A 3T9EA 2C3UA 1P45A 1SHZA 4AO7A 4LRXA 3O1JC 3K0HA 4HVTA 1X42A 4C3OB 2H2IA 3B6MA 5KREA 5KTOA 1RZRD 1BMTA 2B61A 1SUAA 3FZNA 2CMHA 3RHTA 3ZHQA 5K3OA 3OT1B 3R9IA 2PCJA 2QE6A 4W63A 4DZTA 2AUTA 1WKVA 3CUKA 1QQTA 4NICA 1HDIA 4URZR 2ROQA 4GKBA 5A6SA 2PSDA 3RU9A 1AS2A 2PH3A 5FBKA 8AT1A 1DTSA 4JSTA 1GZUA 3RFUA 5DTJA 1MO2A 2G5PA 3DMPA 4GPIB 4V39A 5AI5A 4BMZA 5C7LO 1COZA 2XCUA 3HU3A 1JYSA 3NTRA 4C0BA 4XQCA 2WJZB 2DUNA 4P80A 1A7UA 2C4HA 2I4RA 4X7MA 3TZBA 4EQ6A 2BCGY 1J0EA 1CUCA 4D6PA 4TTQA 3L04A 1S6YA 1KTIA 4C4OA 3DWGA 3GUHA 3BDIA 3IP8A 1GL7A 1JX6A 3ILVA 2BJHA 3SHVA 4BCDA 1P29A 2DBRA 1DBQA 1UPUA 1W59A 1P1CA 3HSKA 4AUEA 5LZ2A 1SBYA 5L3ZA 3CR8A 2Q4EA 2V4MA 3I9OA 3PB3A 1E1RD 4UOEA 1VHDA 3WGNA 3MT8A 1XIVA 2DHCA 4NAHA 2C4MA 2XQKA 1FS5A 3BGSA 3HJUA 4IMIB 3BK7A 2WFAA 2C9ZA 3GMSA 1KJYA 2G9QA 2FMXA 2IU6A 3HADA 5HJ5A 5EMKA 4MEBA 1IL0A 1F2UB 2GJSA 1A69A 1PWEA 4TLBA 5FCDA 3ETGA 1IM2A 1ZHHA 2PR2A 3Q7IA 3R20A 3FLEA 4ZYUA 3UWMA 5M34A 2X9GA 4NFSA 1NJ6A 4H6PA 4AYTA 4MAAA 1FRQA 3I5MA 2YV3A 1JT2A 1Z2EA 3E3OA 2VJPA 4ZAVA 5JVDB 3DKPA 3QVTA 2NU8B 1QH0A 4MVJH 3VDNB 5ESRA 2PL1A 3VI3B 2VP5A 1CR6A 3HLTA 1MAUA 3DCYA 4YMGA 1WMSA 5KPJA 1KO8A 2A4KA 2QW8A 3QELB 3QG5A 1P0MA 1U2RA 1NKSA 3NJ8A 1YK0A 4N0MA 1KJIA 1S3SA 4UVGA 4YCAA 3DW1X 3EODA 3TLKA 1UOOA 2IPMA 1DIGA 4UEJA 3LKBA 5EGSA 2BFDA 5CIYA 2XUHA 2ERCA 3DMFA 4J0KA 3CLSC 3WYEA 3TRFA 4EI7A 3UOAB 2P6UA 3PRYA 4XD7A 2C7BA 2F3TA 2QUIA 3EBPA 2RGBA 4BVJA 3JAKA 4IEIA 2AEJA 2NSYA 4E5VA 1PR1A 4RKEA 2FMKA 2J85A 3FPKA 4UQLA 4D3FA 4EITA 2NSDA 3FCUB 1WNFA 3LP6A 3KSMA 2CCJA 3KAKA 3PNLA 4RHYA 5T64A 1LPSA 1TM2A 3LLUA 2DMRA 5I3CA 3F5MA 5LIPA 2ZWIA 3A1UA 4BNGA 1SVUA 1MA0A 2J6BA 2NTNA 2C84A 4C20A 1E3JA 4YJKA 4GOXA 2QB5A 3T7JA 1W1WA 4F2GA 2DFVA 3F7MA 5J58A 1TU0A 5SV2A 4CF6A 1ZMTA 2QD1A 4C0KA 5G0TA 1PIWA 2W9XA 3CB4A 1J56A 3EUEA 1FQJA 5F23A 1X19A 2QP3A 3PDIA 1XXHB 2IPXA 4HDAA 4ODIA 2NQ2C 3S1LA 3WOVA 5KYWB 4RVDA 4ARZB 3WAKA 2P3OA 5ALFA 3WB0A 3HS3A 3REQB 3QIAA 4NZYA 2C7GA 4BVBA 2X0KA 3JVVA 4OHVA 2DWQA 2FG7C 2VH2A 2A57A 4WNAB 4KIGA 3FYDA 1ZHOA 2J0UB 2CY0A 3W2GA 4DLTA 2Y68A 3OH8A 2C2MA 2F8SA 1QU2A 2I6FA 4X92A 3U6KA 2XKBA 4FGUA 1NRWA 1WDLA 4NV3A 4WDQA 4B3IA 3P94A 3MHTA 4FDVA 1V25A 3AB7A 3H6HA 2MIIA 5G02A 3HCRA 1PL0A 4LCJA 1CNMA 2ILTA 3LGAA 2BGTA 4OHYA 4QLAA 1SC1A 4RSMA 3ZHRA 1PYGA 2AC4A 4G81A 5FBQB 3IVGA 5I5GA 3SBXA 2ZSAA 2WU3A 4WLUA 5MDHA 4PFJA 3ZYZA 3E22B 4CJXA 3HR8A 4AUNA 4ZYLA 1SIBE 2WKQA 4O59O 3KXDA 1T43A 1K6JA 2RI0A 3T0IA 3LQ2A 4QTZA 3A9CA 3KVRA 4QQNA 3UW1A 1AS3A 4DR1B 3KSZO 4JQYA 2JI7A 3NDJA 4B71A 2Z6QA 3RU2A 5BORA 4O8CA 4OLHA 4N01A 5HDBB 2ZSUA 3WLIA 4O4LF 3EGEA 5KI6A 1SC6A 1ORWA 1WA5A 3EZXA 4PIVA 1G6HA 5A5DA 4WOKA 1WXXA 3FYSA 4OAOA 3M6UA 3OFND 3Q7SA 4S0XA 3HFGA 5KO2A 5MHTA 2ONKA 3JQAA 1XMVA 2BR4A 1UBOS 3GW8A 4Y0VA 3T3MB 1PTJC 3QU9A 4HTFA 4W9MC 4BX3A 3B20A 2FPXA 1BDJA 2LVBA 3QFHA 4AYXA 1IXSB 3R5SA 5EPOA 3S28A 3C70A 3OBBA 3OIVA 3SFZA 3ZTYA 3PXXA 2C7VA 3LPNA 1WBDA 2QBYB 3EIQA 1KMHA 1OBOA 1TMYA 1A7AA 2QUZA 5JR3A 4FBLA 5CA0F 2B4RO 2CDRA 1C9JA 1AVTA 3ZGLA 3MJVA 2CUNA 2BWJA 4PSKA 4BFUA 3QUSA 4OQDA 3OIWA 3K71B 2XNKA 2DUJA 3GIDA 1WDKA 1L5YA 2GPYA 4LXIA 1XEWY 4URVR 1ORVA 1QWSA 4J07A 3AHJA 5LYJA 3RVKA 3U3OA 2FF7A 2NTYC 4ZMBA 1OAKA 2HF8A 2P69A 4PXAA 1IVYA 1P5ZB 3V4LA 2OA0A 3V80A 5KSOA 2VHJA 3KKMA 1MW8X 1RKUA 2DFPA 3AFOA 3DVQX 1EP3B 2FQXA 5LC1A 2GN2A 5HQJA 1ZGCA 1J9EA 3BMCB 5L7TA 1CR1A 2FPLA 1OI3A 3CVWA 1DDOA 1EFKA 4KE6A 2X40A 1WF3A 2WC1A 1DLJA 3IDAA 1OKKD 4A8JA 2A92A 2XDAA 1C3LA 1T15A 3K0FA 4DCSA 4FPXA 4WFJA 4BWVA 4EG6A 3WA7A 4I2VA 2IV3A 1U9IC 5CEJA 4BY9E 5J59A 1I3KA 1OYYA 4I1UA 5FKJA 1C9KA 3C48A 4OYYA 2I2CA 2PS9A 2O2HA 5FO0A 1OVGA 5DWDA 1DUSA 2FPOA 4TT3D 4BX9A 2X8JB 4N40A 4PNHA 2FWAA 3E7XA 2OFFA 5CB8A 4W1QA 1T4CA 4LZLA 4OHPA 5IUKC 4CXMA 4L5AA 1YC2A 1GWNA 3G9ZA 4MEJA 4P7FA 1GR1A 2P9QA 3OE1A 4KO3S 2W11A 4XB2A 5IU6A 3UGQA 1DP4A 2ZPUA 3CE9A 3FVTA 3IPRA 3GJQA 1WUJS 1EJBA 5L4NA 3GLGB 1LTKA 4PONA 4QBHA 1S02A 3VU9B 3QYJA 3FCCA 3GBVA 2X5JO 3SZGA 3SFVA 4LG1A 4U3JB 4ME6A 2AFVA 1E7SA 2H2FA 1JL3A 1ZBDA 3PNSA 3M4NA 5IJWA 1J5XA 3GJZA 1PR3A 1UPTA 4A2WA 3ZHUA 5CBPA 3NHRA 2GLXA 2Z4SA 4O2AA 4EVSA 4RXUA 1XDSA 3A4MA 4I3HA 1CW2B 1Z73A 4DUGA 2DUUA 1NR5A 4MGIR 4CF3A 2ZETA 1GPWB 3EF0A 1H5NA 1COWD 1RAGA 2R48A 1RXIA 3NTQA 3M70A 5JJ5A 4Q05A 3LH5A 1DKLA 4KIUA 4Q15A 4PBSA 2ZAYA 2YYYA 3DDNA 3FGZA 4QYTA 5F12A 3ZWWA 2JIOA 2QYTA 4U2EA 1OTXA 2ES4A 5A4AA 3VM6A 4GL4A 2XCLA 4OJMX 4JUBA 1VLLA 4QRIA 5H80A 2ODQA 2HLDD 3C1AA 3ELDA 3MD0A 4BRSA 1HPLA 4V02A 3ANTA 1CUIA 1G3QA 2OZLB 4JZYA 4LTNA 2E4YA 1P2UA 3NXSA 4E2FA 4XQGA 3IEPA 4EAAA 1WR8A 3I4FA 1UDWA 3ZWOA 3FYUB 5DX0A 4BX8A 1E2FA 4V3CA 1XMJA 2ZYGA 1XZDA 3G8BA 4R40A 2Q1TA 3H2YA 3OTOB 1WSWA 2QVBA 2ORYA 5HYVA 1J20A 1I5OA 4KWEA 1JHPA 4GAEA 3S81A 3ISTA 1PT7A 3G8DA 2BZ0A 1SCQA 3FDFA 4HWGA 3DEIA 3G0DA 4UKDA 3LX4A 3HJGA 1XJ5A 1I9CA 3OZ7A 4WKCA 1IB0A 2ZI5A 4TTJA 4B3XA 3IP6A 3NRCA 3Q12A 2FX5A 1JJFA 2NMVA 3KEMA 5FIUA 2FR0A 3KJIA 3RUPA 2G9RA 4L5BA 4CKXA 4CW7A 3RVBA 3O8LA 1CBUA 4IIGA 4P0TA 4QD3A 4BVGA 3B1JA 3DUFB 4X85A 2CNOA 3K35A 3PF9A 4DYHA 1CQXA 1N5LA 1QV9A 4N12A 2C7OA 1XVUA 1PDVA 4QOGA 3T9CA 4DUYB 2Y92A 3K09C 1E4EA 1Y82A 3TAHA 1M6VB 4UU1A 3W3ZB 4F91B 1E18A 2G72A 1B6RA 3RRZA 1K4KA 2JBAB 2VT2A 3CKLA 5IJXA 4WI1A 2CLOB 5JYBA 3DD1A 3ZKWB 4UAGA 3GJSA 3KQWA 4QHTA 4CM8B 4LXUA 5HK9A 5ALJA 3N58A 1YD7A 1KE2A 4HWTA 4YAFA 4ZHQA 5HR5A 2AJLI 4MB2A 4N5IX 5J2UB 4YRZA 1UT8A 3PFHA 1VYHA 2YYSA 4EVQA 2EFGA 3FLBA 3R24A 1I1QB 1R6DA 4NFLA 1LSOA 5AM4A 2HJ9A 3L05A 4WD3A 1DG1G 4MW6A 1GXSA 1MLDA 3UV3A 4BL5A 4C14A 3EB9A 3NHUA 2G09A 3BERA 2QLLA 4DCOA 1NURA 2CLDX 3KKZA 3OTIA 4M1WA 4JAVC 1WXHA 3E9MA 3PFWO 3NHJA 2HLNA 1ZD1A 3DH0A 4GKAA 1J8QA 1NFQA 4AAYA 2RGDA 1QVZA 2HMSA 2C3MA 5FBWB 1NC1A 1HZZC 4EBFA 4EVRA 3WWPA 2IWRA 1AXGA 3DTVA 5KKAA 2JJYA 3SC3A 2OCBA 1T0BA 3IAUA 5CB0A 3RVNA 3BRQA 3UMRA 1QX3A 3GRKA 2HBQA 1N0WA 2HSDA 3I8SA 3DDHA 1W19A 3LNCA 3HB4X 1QIFA 3MSXA 3I2KA 3WHLA 4AXBA 4MA0A 1Y80A 2P27A 1MC4A 1WV1A 4WVLA 1YNOA 1GTRA 2R60A 4MV6A 2CHGA 4D44A 3MYRA 4FMBB 2VJLA 1Z6QA 2JHFA 3IQZA 5A7FA 1GPJA 3R5XA 3RYTC 4BTVA 5DTIA 1Y37A 5H81A 1Q1BA 2QX4A 1ZJ5A 2DULA 1VJCA 5BSVA 1B14A 4AJJA 4R1LA 3ZDBA 4IV5A 3NEJA 5F7OA 5KTMA 4R98A 3MG9A 3AR4A 4Z51A 3HB0A 2LCIA 4LNUA 1HI9A 1LPNA 2G28A 3INTA 4HWOA 5FB3A 4ZJYA 3IAAA 4DYVA 1CUBA 4MGZR 1MB0A 4JVMA 2NZXA 3K1TA 5GIPE 3ANLA 3K5PA 5DULA 4YQZA 1KI3A 2B5WA 4TMWA 4KQ9A 1V6CA 3LTEA 5HBRA 5CMLA 2PCLA 3H42B 4QA9A 3AF5A 1AQIA 1ENOA 3WOHA 4ND6A 2R79A 2JVJA 2X0FA 1MENA 2D5IA 1BWQA 2A1UB 5H83A 4D3SA 3BWYA 2MOKA 4NDZA 3ETDA 1IBCA 4OBBA 4S24A 5LP6C 3RARA 3T3PB 2IOYA 3OE7A 4JLWA 1V5GA 3B6EA 2XJ4A 4QGBA 2CL7X 4UCFA 3HKCA 3HP1A 1QZZA 1UK7A 5HMMA 4QPNA 4CG2A 1KJQA 2A2ZA 3PR3A 4UJ5A 5CEFA 5K6AC 4D2IA 1W5SA 2GCNA 4NG5A 4Y1GA 5KBYA 1Z38A 2P75A 2YDYA 1NVBA 2Q4DA 2JAWA 2XQIA 3LO5A 2VA8A 2ZTLA 5EIAA 4YXFA 3DFMA 3FOBA 3OAAA 4GEKA 2HY7A 5T3YA 3GLSA 1C30B 1E69A 1SR8A 3N8DA 2CBGA 3STYA 1GNSA 1KKLA 1Q6ZA 1CU1A 1TCCA 1Z3IX 2PMWB 5ECGC 3EXAA 4E6EA 5JDCA 1HG1A 2IHUA 3I8OA 2ZT7A 1XZCA 2HRZA 1J0CA 1TZ2A 2KYRA 2YWBA 3I64A 4XQ0A 1HYQA 3BHIA 3VRHA 2HMUA 4K6OA 4K5QA 4PO3X 1XTQA 4E1BA 4RYDA 3UFBA 4DJTA 3CX3A 4BMPB 2UAGA 1VE6A 1SVIA 1Z45A 3LUKA 4LDRA 5FWAA 2QTCA 3Q8KA 4ZI7B 2PZGA 5EP3A 1ODLA 1X92A 3LIIA 2XMGA 4I9GA 2I8LA 1X7ZB 5FPQA 1XI2A 3L2OB 4NYIR 4WASA 2I1VB 1GGEA 4KN9S 4FGSA 1KMNA 3EG9A 2XB6A 4ADSG 2HMWA 2PRZA 2AOTB 5SYNA 4QL3A 4YHBA 4R0VA 3DNFA 1S9HA 2EHJA 4ZN6A 4RAOA 5DKFA 3GGGA 4U9IS 4F3RA 2P4UA 3WGGA 3AOGA 2RHWA 3BWXA 1T2VA 4EB6A 6ADHA 3RIGA 1FBTA 3MMSA 5KMGB 3RBZA 2XZOA 4EW3A 3G0CA 3LCRA 1U3TA 3GT0A 2I4OA 3STHA 4KMRA 4DCVA 1N77A 3JQRA 3H65A 2BTEA 4MPPA 2XQJA 1SQGA 3FWHA 1X2EA 4ZVTA 4ZGWA 2F67A 4W5NA 2WU4A 2X3UA 4JBXA 2O23A 4GMKA 1BGXT 5TVGA 4E0BA 2PJDA 2YNMC 3BL5A 4J9UE 1V6SA 1XXHE 3OMLA 5CFQA 2IA5A 4XIFA 4XEUA 3KT8A 3EWNA 3GA5A 3BJEA 5GGYA 2JEYA 3N2IA 4K05A 2ASEA 3TD9A 2BE9A 3HNOA 4O2BB 1P5JA 3ACBA 3CFYA 4INJA 1RP1A 1X9IA 5AT1A 3ZJ4A 4UHFA 3OZUA 4B6QA 1KFCB 2JHPA 4FB4A 3E9DA 1VB5A 2ECKA 4TUYB 1DOZA 2I62A 2XMSA 1G2OA 2A67A 2XCTB 3S7ZA 2J45A 5LMCA 1OXVA 3OZSA 5H82A 3FA2A 1ULTA 3OKCA 2J3DA 5JXIA 2ERYA 1N5MA 2ZXEA 3PUZA 3PSHA 4N5NA 5FNVA 4Q3EA 5CXSA 1MOSA 1KZYC 1T4MA 2QV0A 4WA8A 3O9MA 1K66A 3QJYA 3V7FA 1AMOA 1RFGE 5BT8A 2XRYA 5JCOC 1L7OA 2WTMA 1Y1LA 4OM7A 1W7AA 2VQ3A 3CWZA 4RH0A 2UVPB 4EMBA 4H9GA 1ZD5A 2FOXA 3GMDA 4CL0A 3R9WA 2JGKA 1GTL1 3NEAA 4G56A 4OUDB 3I6IA 4GHWA 4NAVA 4G5GA 5CX1A 4ZT2A 4DW8A 4F5ZA 2QXUA 4UEQA 3ZJTA 4QQ8A 4M37A 2CFCA 5AVKA 4UTPA 5KWIA 1JQ5A 2NV6A 1FFXB 1M1XB 3PT5A 5ALQA 4X71A 4RKWA 3LGSA 2QTHA 1Y6GA 1ZN2A 2G9UA 1JLHA 4HDKB 1JI3A 1PDOA 3VSEA 1UPFA 4P7GA 3W2HA 5KOIA 1TADA 5DBOA 4WESB 1T3HA 5LYJB 1PWYE 1JI0A 4EUEA 1ZINA 2HNKA 2OD9A 3ADOA 3DE0X 5C3UA 3HVRA 5J4YA 2NNWB 2OL4A 4NBWA 2G8LA 3UMCA 4OMUA 3JTMA 4IGIA 2IVFA 2UUOA 3QKSB 4IKEA 4PANA 4RPKA 3SDZA 3MJHA 3IMCA 1TU3A 1FQWA 3PNYA 4WK0B 4Y30A 1WSBA 3VR5A 3G7SA 2LKDA 3H2BA 5CYPA 1NLUA 4BB5A 5AWFC 1D5WA 1ZGBA 3FWNA 4JXKA 3KR0A 1WPRA 5E3HA 2VHUA 1Z4JA 2J9GA 3DE1X 4P4SB 1JRLA 2AZDA 3GCGA 4WN9A 5EYPB 4ZVRA 3KLMX 1FC0A 1RMQA 2HDNB 4GGPA 1Z7YA 4WTOA 1RPJA 1AKRA 4YRDA 3JQ8B 1OWMA 4XM1A 4IX9A 3QKTA 4UNRA 1R6BX 4DMFA 4A7PA 2IH4A 4OF4A 4PZDA 1G21B 3JASA 1LQTA 4F93B 3KPYA 5ICSA 2CKDA 2XOKD 4PQEA 5A05A 4JI7B 3HA7A 2W2NA 3VR6A 5CFZA 5SYMA 2A14A 5D5PA 5DM0A 5B1SA 3SVZA 3IULA 4OOFA 2V55B 3CF6R 4Q03A 5BN5B 5K2MA 3RJTA 3E5HA 4DEYA 2XOEA 1NN1A 3AT1A 1OHHA 4AUMA 1L8XA 1SVWA 4X1IA 3SBDA 3E1SA 3ZDFA 4MVYA 3QXSA 2YUIA 5AW9A 3RT1A 4B48A 1ECJA 1GCIA 4Q39A 3ROPA 1BCRA 3L8YA 3WWCA 5HRAA 5I7VA 5JH7A 1VIDA 2HHHB 2Q6KA 2EWMA 4HJXA 4X90A 2UUCB 1L7BA 2DUMA 1Q0ZA 4V0QA 5DTQA 2O59A 1RAIA 4GLBA 1KY4A 3KVVA 4PYRA 5AIAA 3R6DA 3E2IA 5AHWA 4HFNA 5ENDA 3WLTA 2PXCA 2FFHA 1LKZA 4NC9A 3T52A 1LC3A 5CLQA 3PNKA 3ZHVA 4C1NA 1T25A 3K2IA 2ID7A 4MPJA 3KU4A 4NE9A 4PLZA 3B7GA 5EWMB 3R7WA 5KWJA 1K9SA 4KYVA 4HDOB 1NPTO 1HXHA 1ZI9A 4RCZA 2YWXA 3STVA 1SXJC 3KYIB 4JC0A 1U5BA 1X1AA 2X8AA 3FYHA 4BV8A 4F85A 2QG4A 3T5CA 1TZBA 3SHTA 4GMXA 4X00A 3TKLA 1IJFA 3WV5A 1ZGZA 4RY0A 5CDUA 4TL8A 4YAKA 1LBEA 1ACJA 3Q3IA 4YUZA 2X9VA 2IDMA 3EUAA 1R66A 3ME5A 4BB0A 3GLGE 1QHHB 1XQ1A 2CNNA 2HA4A 2PAAA 1FMFA 2EATA 4BNYA 1N6NA 1LBSA 4KIJA 1ZDMA 4L4YA 5KQSA 4AVYA 2CF5A 3W5SA 2Q9CA 2PLNA 4Z9YA 2D5AA 4RHXA 3EW7A 2ZIXB 5C5IA 2QLMA 1K6IA 3GEGA 4L8GA 2LWIA 2VZEA 3WBJA 2GXAA 3BIOA 4EY3A 4AKEA 4D92A 3MCAA 3EEOA 4L4SA 1U3GA 4J1NA 3T5MA 5HXAA 3JQCA 3UGKA 2IY7A 3IV9A 3MMNA 3FVRA 1VJDA 3VQTA 1G18A 4WE3A 2DPLA 4E3ZA 1RWPA 2A9JA 2OFOA 5ADHA 1WB4A 3X1ZA 3S68A 3TE6A 3Q9SA 1YHNA 2FZ5A 2QL6A 4Q3LA 5CFOA 4KW7A 3I0MA 4XJVA 5DNEA 2C8KA 1M0WA 1UUFA 1EUDA 1G8JA 4JOSA 3N2NA 1PT5A 4BZXA 4IHKA 1TKCA 4RJIA 1FUYB 4BE4A 2H3HA 4NZPA 2HQRA 4WCDA 5KC9A 1YA8A 1VZ3A 1DRUA 2WA1A 2PL9A 3D1VA 4ZU6X 5JTUA 3THWA 3PC8C 4XSHA 3F9RA 4GRDA 3AB8A 4G8BA 3BRWA 5IJ0B 1R5NA 3OEHD 2D4HA 3BHJA 1YRYE 1JN0A 2O1XA 1G3IA 1X1QA 3AXSA 1C8KA 2P7HA 2C4VA 4PC6A 2HW8A 1GA6A 3TTUA 3C0KA 5JNSA 2PAFA 3VR5H 4E1AA 3RLIA 5EI5A 5JPCA 1QNFA 4PRLA 3EQ9A 1JVBA 4ZEOA 4IH9A 1UPCA 2O06A 2OAQ1 5DASA 4K0RA 4TV8A 2ZRHA 4XIGS 3OWOA 3THOA 4HDRA 1EFVB 3R5JA 3KYDA 3U2QA 3I39X 2IP1A 5FTKA 3I9KA 1JYFA 2Q21A 1MC8A 4X45A 3G0GA 4LEIA 2JCBA 3F5SA 5DBEX 1PS9A 2ZRPA 1GCAA 2PKQO 1UAYA 5FV7A 3L18A 1W0JD 4D5EA 4OP2A 1GKYA 2IKSA 3AZOA 3JD2A 3Q3GE 4U7TB 1E20A 1IWOA 4CU2A 1NDHA 1YR2A 3WK9A 4XW2A 1HETA 1RPTA 1J0BA 3BREA 5K6TA 3KVOA 3BGWA 1VHQA 3VR6H 1T9ZA 1NU6A 2DQZA 1QMPA 2F1RA 1IOLA 3LF2A 4J1TA 5EEHA 2P68A 2BT4A 3F6EX 4AMZA 5AW4A 2PGNA 1CY0A 1TF7A 2BEUA 4HK4A 2H4XA 4M54A 5ECYA 2IV2X 4HOYA 4EY4A 1S89A 3BTOA 4LJ7A 3BAFA 4DV4B 1JKFA 3WLMA 1I2ZA 2HJWA 2PZMA 1CRLA 4LC9A 5KOJA 3HP7A 1YFJA 2YHIA 4FHCA 1Q1AA 2EFCB 4HATA 2J59A 3KCNA 2HSJA 3L79A 4IHJF 4GZ6A 3HV2A 5KHAA 4OMCA 3L0SA 4CMEA 2R8ZA 4Y7CA 5IC6A 3LUCA 3WZLA 4EA8A 1TYCA 2OORA 1MTZA 1S4MA 1YQTA 4FFPA 4GWKA 1U28A 4MUXA 4P7KA 4D41A 3VKGA 4ND8A 4X63A 2F00A 4Q4CA 1N6KA 3D7RA 4NX2A 2BMAA 2HO5A 1L8OA 4QUBA 4UBMA 4C6TB 3FOCA 1W2WB 3ML1A 4KXFB 2DVMA 4GSLA 4YCLA 5AI0A 2JJMA 2IELA 2WWFA 3FWPA 4NCAA 3GEEA 1YIDA 1YRHA 3VPAA 3ND8A 5C5EA 5FX2A 3C4JA 3L4JA 4LJ4A 1GZ7A 3WGIA 1D4ZA 1PGJA 2CXTA 3AR7A 3K8OE 1SQFA 1P6XA 4ZZ1A 5A3QA 4KR0A 4BNZA 1G59A 1F6BA 4F72A 1V8FA 4LYDA 1US8A 2QAGC 2VBFA 3DZKA 3O3OB 1XZ8A 1YS2X 4D26A 1KPGA 2MSEB 4M0DA 4JXZA 3IPLA 5JAQA 2NUPA 3AUSA 5D3MB 5IN4A 4FOLA 1QE0A 3M9XA 2GAFA 2GHIA 1C7QA 3ESRA 4DCMA 1LUAA 2H1VA 3E82A 4BNWA 2QVYX 2RH9B 4YAGA 2E6UX 2WBLC 2YFQA 3W8NA 4F4FA 1OX6A 3C85A 1QS0A 3X2EA 4N8EA 3UXHA 1EFPB 4DIDA 1CVLA 4HNRA 4U9HS 3HVHA 4RY9A 1JU4A 5JAPA 5KJCA 5JMOA 1PLKA 1IOVA 1DEOA 5DHUA 1XNGA 2GK4A 3DE6X 2HRQA 3CUVA 5IAGA 4EG0A 1TECE 1R0WA 1CUDA 4P33A 2ZVQX 3L6EA 1MJGM 5HIJA 3UMBA 4DQVA 2ECOA 4IICA 4LXHA 3ROMA 1O54A 3D4BA 3C87A 3PNPA 4N4AA 2BTQB 3N3AC 4IOMA 3T7AA 4NBUA 5G1PA 1MV8A 2HU7A 3KJEA 3L1KA 3W4KA 2XDYA 5THQA 1G8GA 2L19A 4D8VA 5K0EA 4KWIA 3DLHA 1PKEA 4DARA 3VVMA 5B7NA 5CDTA 5JSHA 3FM9A 3AOEC 4TV9F 3HJTA 4YMSA 1ULZA 2DBQA 4C3UA 4R2LA 1RABA 2QMYA 3OUUA 4YBZA 2YBDA 3FMVA 3KS9A 2HBRA 3MMPA 3CURA 3P2IA 4KXUA 4DREA 5F4ZA 1FFAA 5BN3B 1CQIB 4ED9A 3I3OA 3KM0A 3QNWA 3O8RA 3K6JA 5ITZB 3OLCX 4AKSA 1IXZA 2IYOA 4PTLA 4UXIA 5AQEA 5LQUA 5CVTA 1IN7A 1M5TA 1OXBB 4BVFA 4D9GA 3RJ5A 1C7IA 3JQEA 5AMXA 2IEAA 4CIVA 3L1IA 2D62A 4QICA 2H1RA 2VDVE 1D0SA 1W0CA 4NBRA 3RSSA 3LCMA 1VMAA 1TFRA 2OLKA 2SCUB 4R7GA 5BSRA 2Q8QA 3CONA 4BECA 3IBCA 2AD5A 3A4LA 5HOEA 2EC5A 1IXYA 3OPMA 3NIWA 3RABA 4BZZA 1TK9A 3EG5A 2BFMA 1E79A 2XVYA 3CPJB 1QMGA 1UMKA 2GUGA 3FZGA 1UZAA 2A0UA 4MV4A 3DE5X 4RF2A 5AKEA 2Z8YM 4PHCA 3G5AA 1GU7A 2UYQA 1B6SA 4OUKX 3P9CA 5DI3B 2QM8A 5CA0B 2QVGA 3MJFA 4AQYB 2ANCA 4KZKA 2WB4A 2AEMA 1DAKA 3LWBA 3SY8A 3K6RA 5EE0A 3N8HA 1BG6A 5FLKA 3MTBA 4MIYA 3ROTA 4X62B 4BWYA 2AK3A 1VJGA 1Y63A 1Z5PA 2X2EA 3EOAI 4B46A 4U7DA 1XZJA 3OP1A 4TWBA 3SIWA 1EJ6A 4KXNA 4J0JA 4X65B 1L7PA 1GUZA 1U7HA 4LZOA 3RANA 2O5CA 4MJLA 4XR9A 4ETIA 2EQBA 2VHEA 3BF7A 3NBKA 2J33A 3HJBA 3P0HA 4IZOA 3MAAC 1V3TA 4GMFA 1W1UA 1HEYA 1VCNA 2PY6A 3INNA 5FI3A 5A3JA 3MNFA 1JKIA 3UHPA 3AJ9A 4OBWA 3B3GA 3U37A 1NN3A 1HYBA 1DTWA 5KDDA 3K70D 4PC7A 3C3JA 3IAHA 3ZK7A 2VEDA 5AM5A 3EGWA 2P9CA 3JD0A 4JVSB 2QZPA 2V5VA 2Z1MA 2VP4A 4UJ3A 5DLPA 1IZZA 1E2QA 2V7GA 2Z5GA 1H65A 3QWAA 4QPCA 1FE8A 2PUDA 3K9CA 2HGZA 3TXAA 1XKQA 2IIBA 5EHNA 3BFJA 1H9CA 1HTBA 1NW9B 3F0TA 4EMSA 1BHQ1 2BP7B 4OH7A 1KYTA 3RS9A 5COBA 4RTLA 3PFNA 3ZV3A 2I2WA 2I55A 1R0LA 2B30A 2W6OA 3PHBE 3RFXA 2ACKA 4KOEC 2QT9A 4PSDA 1Y8RB 4I19A 4JNCA 4NENB 1Y98A 5K3FA 2RK4A 3GGDA 3BCUA 3O8BA 1JG7A 1EFTA 1M0TA 2YQ5A 3AJRA 4FFRA 1KQNA 5CJ2A 4DY6A 1HTTA 5ADWA 4F3CA 1H6AA 1PG2A 1KS2A 2X14A 3OEWA 1R4NB 4XTCS 4B8WA 1VMEA 3MVEA 4M0CA 1L5KA 5ICFA 4E4TA 4IIBA 2VK8A 4PYNA 1F3LA 4NL4H 2NO1A 4LV6A 3VZBA 1T5IA 1C0LA 1XZQA 2FMHA 1P4HA 2AE1A 1A5TA 1EK1A 1Z0IA 1Z7EA 2PKRA 1VECA 4DDVA 4GR4A 3NHYA 2ZR7A 4ZOEA 1OLUB 3A2MA 3BIJA 3LCCA 3RAEC 2ID8A 2H9YA 1OAAA 2FJ0A 1YQUA 1LI7A 3GNTA 3I2IA 4KYTA 2VP2A 2IOFK 3RYFA 3NW9A 2QRGA 3UK1A 1EGMB 2NQ8A 2YY6A 1IU9A 2YZ2A 4OXIA 1W5EA 4BATA 2XQFA 3SM9A 1P19A 4HGRA 4RACA 2ZYHA 1N7GA 3B1WA 5C9ZA 1NF2A 3AI1A 4QEZA 4ESHA 3E9QA 4EJ0A 1PZGA 3OEEA 4W5WA 6NULA 4QQRA 1QF9A 3BHNA 3H0KA 4Z99A 4NV0A 4J43A 3H8VA 4B6OA 2AI1A 3QNMA 1YRAA 1DCKA 1PJTA 5JD4A 2H4JA 1T26A 1YIAA 1ZSVA 4E6PA 4K87A 4PN3A 1KBZA 5BNIA 5FTJA 4Z1MA 1BYIA 1EAMA 2G9ZA 3C41J 5ALTA 1QIHA 3AY0A 1UXKA 3TSAA 1DAPA 1G21E 3MWGA 2VJNA 5C2JB 4TS1A 1M1NB 2HK9A 3GV0A 2H8KA 3AUTA 5I9MA 2BEVA 3J81k 4Z7OB 3V1KA 4KPGA 1FTWA 4HYEA 4I5IA 3E05A 1MW9X 4AT1A 1NMSA 2NPFA 1KZ6A 3J80A 5DBFA 2EKPA 4X6UA 1BN6A 3EIEA 4EG8A 3M6LA 5I9BA 1LV8A 3AERB 1UZUA 1RPZA 2QMHA 3L4EA 3I2FA 1C7EA 4YJGB 4MARA 4LZAA 5IF9A 2JVKA 1RLUA 4L4XA 3MF4A 3FNHA 1CP2A 5EJ4A 1Y1SA 3BH7A 4WFQA 3ROGA 1U9CA 3UFXB 2PRJA 4EKYA 1AD2A 4H7DA 1XEFA 2E5WA 4MV8A 1WB9A 2A5YB 2D1FA 4F8EA 3T1QA 2BI7A 2CL0X 3EASA 2GZMA 4W5TA 3KUXA 4RMGA 4GMDA 2QU8A 1FLNA 3NVDA 2MHCA 2UZ1A 2BFEB 1JBKA 3CLUC 2QT0A 2AMYA 3PEYA 4NFYA 4OHWA 2FLKA 3OMWA 4PU0A 3R8FA 3I5YA 3PJRA 3O91A 2AFHB 4UW9A 1N0IA 2OKCA 4L76A 3KSAC 4R0NA 5EWLA 4TXNA 2ZQ5A 1SG0A 4YK7A 2ZIUB 2NGRA 2P0YA 3T94A 4DG9A 2WZQA 5C7OO 3MAJA 1NN5A 4OHOA 2NYRA 4COKA 2OXFA 5CR9A 2I6XA 1G17A 1BH2A 3LIPA 3ED1A 3UAZA 3DGFC 2EWWA 1AF4A 3ITKA 4P7JA 2HZBA 3MUFA 4HDNB 1C4OA 4PINA 4QDOA 3G2NA 3OT5A 4ZREA 5IEJA 1NXOA 1T8WA 1XXLA 2ZRJA 4MV1A 4OLFA 1EFRA 3WYFA 1K3FA 1RIIA 2HH9A 4IFTA 4YJ3F 5K3BA 2Z4RA 1JTVA 1L4YA 1UMBB 2ZAIA 4ZVNA 2P30A 2UXDB 3A37A 1SBQA 1MAHA 3OTWA 4WX2B 2ZUBA 2WJAA 1LDGA 2J9FA 4A6EA 4BGDA 1RLIA 2HHAA 1ZUNA 2K5UA 1OV6A 1QGOA 1BOFA 1GUFA 3B6IA 4RA9B 3SEAA 3V33A 4GPEA 1AA9A 3KJHA 4RULA 1RKVA 4G0XA 2VI5A 1FYWA 4G0PA 3RTAA 5I7HA 1JZQA 3W5DA 1W87A 3TX2A 3WWEA 4I1SA 2X1LA 4MMZB 2C5GA 3P4XA 1F8YA 1F2TB 2Y1DA 2ZRCA 2C9CA 3DE7X 4OHRA 5FOTA 4KOAA 3ZU3A 1LBQA 3P2JA 4CDMA 2ZDQA 4QGAA 4EEZA 1UP6A 3FCOA 2VL7A 1Q17A 4RE6A 4Z2AA 1Q7RA 2G25A 3MJRA 1FP4A 3QBTA 3CRMA 4V1CA 1I4EB 4WY5A 3CV3A 2AK2A 4FYWA 4RVOA 3V7WA 5B5SA 1V5FA 3F98A 1UBJS 1KHHA 2YXLA 1J00A 4QXOA 521PA 2BBTA 4NBLA 3T3DA 1ODIA 3W5IA 5DCWA 3B2QA 4HPXB 5DN6A 4BDTA 3MWJA 4XM0A 4BVKA 4RTNA 3WXMA 4H4EA 5G0UA 4QYWA 2JFZA 1N7JA 5E3JA 1O97D 2Z98A 4J6FA 4EYEA 4J6EA 2AQIA 5KZMB 4CR8A 1XCLA 5EZYF 1LTQA 1DG9A 1HDRA 3T34A 2BLLA 1N7HA 3EEIA 4FSDA 4YRLA 2WMDA 4NTZA 3H16A 3GDOA 5JSZB 2GBCA 3LPCA 4YQEA 4WBNB 4LDPA 3D6NB 3N70A 1NUSA 1VL1A 4ZCSA 1QH1B 2SKEA 4AMVA 3MB8A 5F2KA 6Q21A 4Q4HA 2RFLA 4TS4A 4MIOA 4PAOA 2PX0A 4X3OA 3ZZ1A 4DLZA 2BRUA 1MHPA 2NZ8A 1O5IA 4B5LA 4WKBA 1MFPA 3L6RA 4RK5A 5DTMA 1A77A 1DC5A 1WAMA 4ZKDA 4WIAA 1J49A 4F8JA 3W4JA 4DEXA 2JFNA 2QYSA 1JSZA 1Y34E 3QVXA 4OXRA 5GY7A 3HFJA 4DRXB 5SZKB 4OB8A 4CMAA 2C7PA 5F3RA 3ZXSA 4N8SA 1H8EA 1OFUA 2LRHA 2NU6A 3O94A 3ECSA 1J09A 3Q3EA 4OXXA 4C4SA 4BNHA 1CDZA 1SHUX 4IDCA 4TMVA 2HM7A 3C5CA 1HNWB 3U61B 1LJUA 1R4MB 2XH8A 3QOXA 4NS1A 4LXGA 3HR7A 4DLUA 1G1MA 4GOMD 2XODA 3EXEA 2VT6A 4XA8A 1P6UA 3LOPA 3AU9A 1DXOA 3A1DA 4FR0A 3T9DA 3H9BA 3MINA 2OGUA 4D43A 2NSJA 2IEDA 3NOVA 4AJ4A 4TMKA 2CK3A 5EJ8A 2GN4A 2YVKA 2RGUA 2X2OA 2WMNB 4GUDA 4JJIA 2WJ4A 2GUWA 1U2GA 3WBBA 5JD3A 3KTDA 2VQSA 1RZRA 1C50A 1EUQA 3FDZA 4IIYA 1D2EA 3H11B 1GGKA 3KLBA 4BNDA 4MKXA 1W9HA 5CD1A 2QV7A 4D8UA 3BFXA 1J2YA 3ULKA 1TE2A 1NNI1 3RVLA 2Q9AA 3DF9A 4JUIA 2H2GA 1RWNA 5J5VA 5BPFA 1TU4A 1T1IA 1AX9A 5K1ZA 2W2OA 4MQMA 4BCBA 3WA6A 4M46A 4M9SA 2BH9A 3H86A 4DNOA 4LS3A 3B13B 3VUEA 1FYFA 1GSAA 1ZD4A 3Q85A 2ZVDA 3T5BA 3HA2A 2F8MA 2CMKA 3WIOA 1M5RA 1N25A 2IYEA 4CMBA 4ESOA 4YJHA 1HFKA 1I3OA 1KBOA 2NYAA 4FFBB 4QGFA 1SUIA 5C32A 3KJNA 1JAIA 2PT9A 3UHJA 1P9LA 4KLZA 3FRHA 4O33A 1O0CA 1FSPA 1CXZA 3DZBA 5D3ZA 3CVJA 4GPD1 2A94A 4W9NA 4YYEA 3D2LA 2A0KA 2JC3A 2H9AA 4PZZA 3V00A 2FP4A 1OI4A 3GO4A 3VC1A 4X60A 5IDVA 1GN8A 1KI2A 1QVAA 1TM4E 2EW1A 3HYLA 4P2BA 4YAOA 3W9UA 2P4HX 1TIBA 2QAJA 4B81A 4RD3A 3S2GA 2WPDD 4NE7A 1NR1A 3CH5A 2ONCA 5D51S 4PSAA 3VI4B 3VNSA 4AY6A 1N2CA 3DOCA 1BHJA 1BXGB 1MAVA 1U8FO 4UE2A 1SO8A 2OG2A 4IOJA 1XR3A 2B36A 3OJXA 4JI3B 4P08A 1M7HA 1UIMA 5JPIA 4QE3A 1SC4A 4TMXA 1MKYA 1WOMA 2CHFA 2AN4A 5CYFA 2ZBQA 3MGBA 2XEXA 4I4TA 1N1EA 1SB8A 3WGUA 5JW6A 1EUYA 4H6WA 1GDHA 3P0IA 2ZYTX 5I4BA 2OHXA 3GLTA 2NU9B 4Q1BA 3GIWA 2VPQA 4L50A 5E6RB 3IKJA 1R88A 2Q2NA 1S96A 1ORIA 2WYUA 3WGYA 4WZAB 4AK9A 1MF7A 1A7KA 1D6NA 1P0PA 4PAMA 4S0ZA 1R9NA 3X1XA 2XXAA 3BD6A 2RBEA 3DV0A 4BB6A 4DQXA 1Q22A 2E37A 2FDRA 2AE2A 1P8JA 1R0RE 3D3EA 3DFZA 1JEQA 4JYCA 2QY6A 4LPSA 4AJEA 3E5NA 4LC1A 5ENVA 3CIFA 5I7UA 1E1NA 5IT4A 1DARA 2I87A 3AIMA 5LFAA 1VJ5A 5HNKA 1FRNA 4BMCA 3MT0A 1XN4A 3IGFA 1JEYB 1NIJA 1SQ6A 1UPXA 4MPRA 2EG5A 3LECA 1RE0A 2X8LA 3DZGA 2GOYA 1LTHR 3DG9A 4JU9A 3KL2A 4XKJA 4GC9A 2XX3A 4PLFA 3BWCA 4YPOA 3VPXA 2KPOA 3O2SB 2W2LD 5EQFA 3V4SA 3KTAA 4RKYA 4EL0A 2JI8A 2BGNA 1MV5A 4IPTA 3G79A 4GBED 3AHCA 1RLOA 3HXTA 1Z8DA 2MMGA 4F96A 4UTVA 1CERA 3I9JA 3WNQA 1XUOA 1FMTA 3W34A 5KOHA 3LX8A 1G19A 5F7ZA 2HTEA 1EQAA 2XKJE 4S1WA 5BVGB 1SXIA 1HZJA 4JC4A 3G0IA 1L7QA 5AI6A 2I66A 1JHUA 4M8IA 4YV2A 1JFSA 5IS2A 1H0RA 2WU8A 1OH5A 1GL6A 3ONNA 1Z2AA 3VYRB 1NMEA 4ZYXA 3QE9Y 3WKDA 2O2ZA 2JDID 2ZBPA 3IDFA 1GFIA 1PF7E 3NHFA 1EDZA 1GYQA 3ORSA 1L6RA 4Q4AB 4QUDA 1QQ6A 3AUKA 1N6HA 3DBIA 1ISJA 5FUVA 1HURA 2MSLA 10MHA 1E5VA 2B98A 2NO9A 4KWHA 4XVRA 3SX2A 4MAFA 2COKA 3BKXA 4NOMA 3CUWA 3WRYA 2WE8A 1C80A 1DMSA 2OCPA 4DKXA 4EHAA 1O3YA 2NT4A 3U1BA 1O2DA 2X7XA 4YRAA 4L1KA 2YX1A 5CYOA 2Y2UA 3WLFA 3NH9A 1SCIA 4NG4A 4LDAA 1NULA 4FKMA 4J0DA 1O58A 5G1OA 4B9AA 1FLAA 1QH8A 2GETA 3I09A 2DQKA 2MMCA 2X4GA 4PG4A 3RUAA 5CLHA 3OZIA 1WX1A 3GJ5A 2VAVA 1UBTS 3RWBA 4EUHA 1AN0A 2B35A 3KPUA 4H0FA 1NUQA 2I76A 3JQ6A 4R9UC 2WE7A 1PQWA 5TQ0A 1M6EX 1BEEA 1IY9A 3GCWA 3R3YA 1Z6ZA 4M1KA 1FNMA 2BFFB 2XZDA 3OLVA 2JLYA 3E1GA 1KI7A 1TQHA 2JFVA 3CTPA 2ODBA 3UAVA 3WYBA 2V0GA 1KBQA 2Q99A 4J16A 1PUIA 4REQA 1XVAA 2QENA 3G5UA 2IYSA 3G2OA 3IBGA 4GRAA 3CCFA 1HQCA 4WN3A 5E1OA 2YRWA 1BQ3A 3CKYA 4ER5A 1E3IA 1HY3A 2ZE5A 2GVNA 2GR9A 2HT6A 5BSMA 4B7AA 2XADA 4JODA 3EGOA 3K5HA 1DFIA 3NBYC 3N8IA 3A1WA 1X74A 2PU5A 4TVBA 4BIMA 1E2MA 1JQBA 2XTAA 3RUIA 5LOVA 1RYHA 1GZ5A 1V9SA 2GNOA 2IDKA 1T4DA 1JDUA 2BW0A 2OR3A 3QKRB 1C7RA 5CT5A 3V7UA 5IYZA 1TVKB 2JK0A 3FHOA 2F3SA 1CR0A 1NQXA 3TVDA 3ID6C 1FQKA 1JAYA 1I4TD 2BAGA 1D2CA 3GG9A 3C1UA 4F7DA 2EZ4A 4XCXA 2PZBA 4E7OA 2XZPA 2ZIZA 1UWLA 5HILA 3O6VA 3INRA 4LK3A 2ZPAA 3NNDA 4EB8A 3EX7C 3SX0A 3AY6A 1K2VN 3ENVA 3HXMA 2EXXA 2E18A 3LUGA 4EFMA 4E5YA 2JANA 5JCXA 4E12A 4YR7A 3A6ZA 3ES9A 4HUQB 4R05A 1FEZA 4DKJA 1ZC4A 1L5FA 1E9RA 1ZCJA 4X20B 1KQFA 4S2EA 1ICIA 1KIAA 1U80A 2FUG1 4YXWD 2VH5R 3H3JA 1JEDA 3OC0A 1GNQA 2JFYA 2ZRLA 4OJYA 1FW6A 5JS8A 3DUWA 3E9YA 2HMYB 3QVSA 1XV5A 3KHTA 4W8HA 1HRDA 1I3LA 2NSLA 3P52A 1VHTA 1VLQA 3LOQA 2JHCA 1P1BA 4E5MA 2GARA 1OKKA 1WZNA 1YDEA 2J31A 1UXGA 1VPEA 2QTRA 2LZ0A 4Y6SA 2AR9A 3LBNA 3I3SR 3IVMA 1Q0UA 1ZPDA 1LS1A 2DLNA 1Y3FE 4LZNA 1WNTA 4DBVO 1U1IA 1R9JA 2GF9A 4J4BA 4JQZA 3O9VA 3QM1A 2F1KA 3RS5A 3MQ2A 1DKRA 3NYQA 4GE0A 4MCIA 1PDWA 4UDOA 3FSRA 5AOVA 3RK1A 2HT1A 2BKUA 3OPYB 5AYVA 2RGRA 4YMUA 5EJ7A 4Q37A 5HIIA 2N47A 2H2HA 2CDNA 2PIAA 3TRDA 3HKEB 1BE1A 4C0SA 4FDUA 1KDTA 2BPOA 1O57A 5U9CA 1RXSA 2ZRQA 4XYBA 1JG6A 4J9VA 4EKDA 3NUGA 3CLRD 1KI6A 4J7CA 4KR2A 1VDZA 1WCIA 4FOPA 4BJ3A 2RHHA 2YJNA 4JEMA 1HLPA 3ESYA 5GONA 2P3LA 2WD7A 3U7QB 3GUVA 3E0QA 3KT6A 4BASA 3OQOA 5E4JA 1L7XA 4GXQA 4BBJA 3TFWA 3CUTA 4MIEA 3EGDB 3A06A 3O0TA 3NLLA 3AM5A 4M9ZA 3TGWA 3TSZA 2AW5A 3LX6A 3MCTA 1IY1A 1I7PA 2DTXA 1XCBA 2WTXA 1CQWA 2MR6A 1ECFA 3W8EA 3RSOA 1AUQA 1Z4OA 2IIQA 5EXEA 4M3NA 1IQRA 4J4TA 3RTGA 4P0PB 8MHTA 2PZ8A 3NGLA 4M1ZA 3UJDA 3E3AA 1LPOA 3IUQA 4C3VA 5FI5A 2FAXA 2KBFA 4REMA 2OHVA 1OREA 5CD9A 2BSAA 3PDCA 4I1IA 4IHJB 3ZZNA 3THYB 4OK5A 1IHUA 1COWA 2A86A 3MIIA 1LLFA 4OMFG 4WEQA 4X6LA 1AZLA 1S2IA 3HCBA 1IC6A 2REQA 2O54A 4DV3B 5FHQA 3RIXA 5JECA 1H22A 3LUFA 3BMNA 4B6GA 4EJFA 3WLJA 5F7JA 1IHDA 3GNLA 3WGHA 3BD7A 3VH3A 2E4ZA 2YWHA 2AUMA 4K9SA 4EWLA 4XYLA 1E8NA 3E84A 4A0SA 3IOMA 1DWQA 4JT2A 1PYDA 4UULA 5FBLB 5JS1A 1CNEA 2Z8YA 4ZJZA 2ZJ2A 4XJSA 3SE0A 2HLDA 3G23A 3M3PA 3MLEA 1FX0B 1GRVA 2AF4C 4D80A 3BMQB 2KHZA 2YMMA 4K0KB 2PEZA 4HSEA 3UKJA 5B6IA 3LBIA 4XAQA 4D8TA 1YOVA 4QU5A 2XUIA 4KHZA 4P5DA 5KVCA 4S2UA 1GKKA 2F3PA 4KQJA 4WKNA 3T3NA 2PYIA 2ZJ5A 4TLAA 2UUBB 4CKBB 5JZVA 1P7ZA 2HQSA 3AEKB 4LJ6A 4JUAA 4V3BA 3T1NA 1EUCA 2Z6AA 3T7EA 5FWYA 2EGUA 4AY5A 4UCQA 4D0GA 3QVGB 3FH0A 2V7TA 2VOJA 2GB4A 4G5HA 1U8ZA 4MRPA 3DZCA 3LJKA 3WGZA 4EPYA 4NCXA 1SVSA 1W1IA 3WWOA 1U2EA 3G8CA 1WD5A 2PZKA 1KZ4A 2AD1A 2IYXA 4RJKA 5TGTA 4W7HA 1IAVA 2MDTA 4U6NA 4PN7A 3DOIA 2G1KA 5EHZA 3V1MA 3VX4A 1UPAA 5B1DA 3H9JA 2EEPA 5JLAA 3BGIA 4IGEA 1QAQA 1E4VA 4G5RA 2CFRA 4MS4B 4MVJF 4ZANA 3WL3A 2JLAA 4CIWA 1UJ5A 1GN9A 4ZIRB 2VZ8A 3COJA 5IAJA 3L0PA 3NRBA 1W85A 3GRFA 3Q5GA 5HFAA 1SKUA 3QBEA 2B94A 1G5PA 4FHZA 4EHKA 3GWZA 1YL7A 3TQHA 5JZBA 4DMLA 1NASA 4GI3A 4INAA 5IK2D 4YAEA 1I4LD 1G42A 4GR5A 3JU3A 1ZH4A 4HXFB 3ZI7A 2OGSA 3AGPA 4R1MA 3VKWA 4BXOB 3TVTA 5KYGA 3C15C 3UUWA 2X4DA 1K98A 2AOVA 4M0LA 1QGUB 4TV9B 4E5PA 4H1VA 4QYIA 2XV1A 4M21A 4PFKA 4YRPA 4R5HA 3R44A 4KLAA 1Q1NA 4ROSA 5EHIA 1M2FA 5AXDA 3VMFA 4EM6A 4EY7A 4GI7A 5HKOA 4QXRA 4QASA 3QWIA 3U40A 1UK9A 1R6AA 3PD0A 2KWIA 2BFAA 2VXYA 2ZE8A 2J5KA 2XGSA 3DDCA 3G5MA 1J8MF 5G0VA 4BP9A 1KP9A 1N0VC 3ZY5A 2VNJA 3P96A 5EWJB 4CLDA 4HBGA 2CMFA 4UNSA 3PRKE 4H77A 5I51A 3V3TA 1IG3A 2NX2A 3RS3A 3WJ1A 1WPQA 1E6EA 3HEMA 3NOOA 1KSJA 1U90A 3QXHA 1LFAA 3EDOA 3QX8A 4WT7A 4IIJA 3ZE6A 3ZE2B 1Y6FA 1DEXA 2ZIFA 1QSGA 3EZ7A 5DYYA 1VYUA 3RPEA 1JFVA 3HO1A 1UXIA 1YUNA 1U7UA 2D8AA 3C1TA 5CVCA 4KP7A 3WP1B 1XNRB 1P91A 2G1JA 4EYQA 5ITSA 4H1HA 5DCUA 2YICA 4RSRA 2NU7A 4ZZIA 4O0MA 3E7PA 2KJQA 5JAHA 1P0CA 4YQFA 1AB5A 1CDOA 3RVJA 1G9SA 3ZU4A 4YC7A 2PG3A 4XVQA 5ED4A 2FLVA 1L5HB 3R8XA 1DADA 4BQPA 1P2VA 3X1WA 1HDGO 1HDEA 4YONB 5K0FA 1QONA 1RWKA 1TQ6A 5A9SB 1XNHA 1Z74A 1BS1A 4GM4A 3UA3A 4MS3B 1PZEA 1RVV1 1M1YB 4F6RA 2HXYA 4HYYA 1I01A 1M73E 2GM4A 3ADPA 6ABPA 4DWJA 4L8WB 1C1YA 4WH0A 1V16B 5FYDA 3A2KA 1UJ4A 1ZGAA 3UT5A 2ZJ4A 1X8LA 1XAIA 5DTEA 1XRQA 3PC4A 1DQRA 1SHKA 2ZBRA 2VK4A 2FWMX 1MQ8B 2H18A 3DLIA 3NASA 3ON5A 4RQTA 4DM3A 2YRFA 3LRPA 3AJEA 3E7FA 4Q7KA 1JG1A 5CCXA 1TKRA 3QW2A 4OJNA 4QPPA 3RB8A 3N87A 4IILA 3IT3A 2FU5C 4GVXA 4X7PA 4G1EB 4YGYA 3O4RA 5EUMA 4EYSA 1K8XB 3WFZA 2F55A 3UYKA 4BLOA 1H2AS 4RLQA 5GMOA 5AH0A 3TB4A 5LQMA 2Z5FA 4BGIA 4EJSC 4ZAWA 1MGOA 3A36A 4GYYA 5AM1A 3MFQA 4TYWA 4MRNA 4TYYA 2VSNA 1OJLA 1XYVA 4IQ0A 4R71A 3B60A 4UVHA 4MQUA 3GJ6A 4N3CA 4W5HA 2ZAGA 1IPEA 2Q5FA 4R1NA 4TZTA 2B21A 1CJTC 2YOFA 3LUBA 1T6BY 3PTLA 2PL5A 2E82A 4MDHA 5CAEA 4RL6A 3SLRA 3I72A 2AZXA 1FFEA 2J6IA 3FDJA 4IDHA 3SSAA 3T5GA 1T9AA 4BV2A 2DPHA 4UOZA 5K7SA 4JY7A 1PZXA 2C04A 3QXCA 1YNSA 4IJVA 2Y71A 4LX8A 4QEDA 5K99A 3NOQA 5DNDA 4EKNB 2NPIA 3QMWA 2FX3A 1NJSA 4WZAE 4D81A 2P2YA 3D8BA 3EULA 5D87A 4HS9A 3WMRA 5FH9A 4PG8A 1RJ9B 2CCKA 2GM9A 2QU7A 3SU8A 3TLMA 4OO3A 1TO1E 2RH4A 4BGUA 4F3YA 2FW0A 4LA4A 1JKMA 1V48A 3UOWA 1FDWA 1CS0A 1QYDA 2QHXA 3BOSA 3RBVA 3W8FA 1K7FB 5E7IA 3UUFA 1PJRA 4H7FA 1L1QA 1LNSA 5FWDA 1WLYA 3ZWXA 1NSYA 1YZLA 3GNQA 4GI2A 4MQEB 2P2NA 1PHRA 1UWKA 1W4CA 3LHKA 2PMKA 3NI2A 3VH2A 2E4XA 1SCUA 2OVBA 2GT1A 1B0UA 1B8NA 2AUNA 2P6NA 3EQZA 3WLLA 3THXA 4PM4A 5CURA 5A5VA 2YXPX 1UF9A 1XTVA 3PC8A 4YS6A 5G4KB 5HGJA 3RH0A 9ABPA 4ZOLB 2IZ7A 3RIEA 3UQZA 3IJPA 3LW7A 1S9DA 1GAXA 5EQTA 3Q3JB 2I78A 4DTCA 1U5CA 5IXSA 1RQNA 1Z5GA 2PVCA 5JZMA 1RYFA 3OM1A 4L78A 2EV9A 4H31A 1VMKA 2HWXA 5CU7A 2P90A 3ZDXB 2V1UA 1XBTA 3F7OA 2RHLA 1DWUA 1SU7A 2Q0XA 1Q3TA 3I01M 2I91A 1HT2E 1BAPA 3EQ8A 4YCSA 1QP0A 2WDPA 3DJFA 1BWSA 4M36A 5FHRA 2Q0QA 3V4ZA 1U8YA 5JAIA 1A5SB 3NXKA 4J3JA 4AIIA 4G1BA 1VBNA 3B9BA 3P0JA 2VP0A 4CCWA 3VU8A 3RIMA 4TWIA 1E98A 4B32A 1VIYA 1HDOA 1X1BA 4TQUS 5FWXA 5L6MB 2MINB 4XUDA 3PJEA 4FD3A 2ZJ7A 1K5GA 2A9FA 1RZUA 5CHEA 4PX3A 1J70A 2Q7OE 1K1EA 1KVRA 2A9RA 2CLSA 4MRRA 1Z4IA 2V45A 4AMGA 1AU9A 2HA7A 5FL3A 1EZZA 4EQZA 5L40A 3ZY2A 1GILA 3I0ZA 5ALSA 4F6LA 3F6SA 1FVHA 4Q3KA 5DCYA 1SXGA 4LJSA 4BFWA 1EYZA 4IZHA 1Y5LA 4FR5A 4ON9A 2H1FA 4JENA 1DIRA 1B1CA 2DFNA 2J4FA 3OPQA 2OWDA 1IOWA 3QFTA 1P8AA 4ZZ3A 5F64A 2FR8A 3TZKA 1XU9A 3LSTA 4PG7A 4ZO8A 1H0KA 1WD7A 3AKEA 2ZXFA 1OGYA 3BJIC 2V9PA 4CHGA 1NYLA 1Z4QA 1KKMA 3BD9A 1YE8A 5DBIA 3QE4A 1ZK0A 1RWBA 1V35A 1CJVC 1C1DB 3O2JA 1SCJA 4G1VA 3AFIA 3TTVA 3V1TC 2VHZA 4M1YA 4EYGA 1JSRA 2G77B 1Q0PA 2YMPA 4Z2YA 4F4UA 3PQ2A 4S04A 5SZJA 4J3FA 1T5LA 4IQFA 2CZQA 3D5EA 3AY7A 4A2QA 3K20A 4WXMA 5H5JA 4R83A 2QUHA 4MGKR 4B3RB 3O8NA 2YV5A 4RK1A 1LC0A 2WUVA 3D1JA 3ZK9A 4BU1A 5IJ9A 4BTEA 3D43A 4AZ3A 4YJ2A 4PTZA 5J1SB 3GHHA 5JANA 3EARA 1ZSNA 2GAOA 2QAGA 4OQ4A 1PL7A 1UBGA 1NXPA 2EZUA 3G1WA 4HEA6 4KACA 3W1EA 4RTSA 1Y33E 4P4GA 3KFXA 3IUJA 1JH9A 1R3UA 3VOBA 2VRBA 2R00A 3AG6A 2XF2A 3PRJA 5JCZA 1LCIA 2EFJA 1U0NA 4NCIA 3QEKA 3C3EA 3ZHOA 1Q92A 2NUTB 3C3CA 2H07A 1RCFA 2XOKA 4U1RA 2F9MA 4ALLA 3WGQA 4AM8A 5DNUA 1IUPA 3T3IA 4EEXA 5L3SA 4OHXA 4KRFA 1PS8A 2B7BA 3HWX1 3OJEA 3HYRA 3ISJA 4GU5A 4PW0A 2CLCX 1O94C 2JJ2D 4EHLA 3B6JA 4FNGA 3EZNA 5ABPA 1JUDA 4F9TA 3ZZUA 4CL3A 5B2ZA 3GAZA 4IS2A 4Q7JB 2WF6A 2ZYIA 2VRCD 3U3DA 6YASA 4JQSA 1IAQA 2XECA 1LU9A 1KDVA 4RMHA 5HKAA 5JALA 2Z2KA 1CVRA 4BUZA 4YAIA 4I5DA 4D4IA 2FY8A 3CCCA 5BSGA 4IJWA 3P0FA 4YA6A 4LZZA 2ZWMA 1KDPA 2EBUA 2R6ZA 3AOEA 1V39A 3Q8LA 3VHQA 1TCBA 1F8FA 4J4HA 1U81A 3M33A 5TDHA 3RWMB 4EMUA 5CDSA 5HUHA 1SBTA 2CB9A 4J0IA 1WABA 4Y2YA 2R68A 5EZYB 5REQA 2NUAB 4AD8A 4BMOB 4FWTA 1G8MA 4UAUA 3AL2A 4PCVA 4NWIA 5K3CA 3M0EA 5JSUA 1R6VA 1VCHA 2YJTD 4YQYA 3RS0A 1MABA 1YF3A 1NQVA 5K01A 1ML3A 4U8GA 4XXHA 2O8BB 1ZYUA 4KQIA 4LWQA 1VPDA 3NR2A 2HDHA 2XD9A 1ZU4A 2R6AA 1K4MA 3F1KA 3HKDB 2C7RA 4Y2RA 4P7BA 4A6DA 4TL9A 3G9QA 2XJ9A 3U3JA 2DFKB 3EC1A 4OQLA 3S2SA 3QRWA 1ORHA 3LCUA 3T3HA 5IAEA 4EHFA 5BQ5A 3GDWA 1CK4A 3S3TA 1CB0A 2J7KA 3ET5A 4XEHA 4N41A 3KXIA 1YMUA 3EVEA 1DUVG 5WRFA 1YJ8A 2J41A 3QU2A 1BX3A 2OESA 4YPFA 4EGFA 3PHHA 4DJEC 2VUHB 3ETNA 3ABRB 5HE9A 1ZM9A 3ICCA 2VTBA 2G06A 2YVLA 4I8IA 1T3GA 3KOMA 2W6NA 3UUGA 3V9AA 3F2IA 3L8GA 5HM6A 3HYSA 2NZUG 3B1ZA 5B1IA 4EGAA 3COSA 1WS6A 2NZWA 2Z0MA 2GGSA 1YRLA 2IIPA 4IFEA 4QDZA 1DJQA 1JHMA 1F4VA 1C3EA 3MTGA 3MS7A 3OIYA 4FILA 4NPCA 3SEZA 3WBKA 1KVTA 4D1YA 1R0BA 2P6PA 1DWOA 1OX4B 4I46A 4O2AF 1S2LA 3A9SA 1K7SN 5BWBA 5DNAA 1AKYA 1VSUA 2B8WA 3PI7A 4NEQA 1XLVA 2FK7A 1E9VA 4FCVA 4HFRA 1ESDA 3DFIA 3UJNA 5EIXA 2C2XA 2ODWA 3IC5A 5KAMA 1TQDA 2BC9A 3ENWA 4PS0A 2W71A 2IHNA 2I34A 3EA4A 3F8TA 5L3QB 2ZVPX 3P9ZA 4NU6A 1E6CA 3JVDA 2JF0A 1NLZA 3OY2A 3L5OA 3H5VA 2WSSA 3OEHA 4DHWA 1NPYA 1IDOA 1VHJA 2V0CA 2WVJA 1N2SA 3FTDA 3QVMA 2SKDA 4ILEA 1TCAA 4WXRA 4EECA 3DLTA 3LA6A 1GZDA 3KALA 2V0NA 5HRCA 4C88A 3TW8B 1SD5A 4M9UA 4X61A 4DQUA 3AJAA 4A3SA 1XEWX 3F4LA 4FYMA 3Q1KA 3H1EA 4YP5A 1NFRA 4FFVA 3D7SA 4MLCA 1DIOB 4QGHA 2JGDB 2EERA 4K6KA 4Q1VA 2XT9A 4XWYA 4RL4A 2I6QA 2QN7A 3GZJA 1UP4A 4Z8XA 3V2GA 4H1UA 1AXRA 5HZMA 5JRZA 1NVFA 3IXMA 2J5RA 4FUTA 4KEAA 5JMWA 5KEIA 1AV6A 2IZ5A 4CG0A 3QTBA 2AXQA 1I4OA 3BSYA 1B0AA 4P32A 4QUAA 4RJLA 5DNVA 1W0JA 4G2TA 5DGDA 4FM9A 5E95A 4LJAA 2BFNA 2GHQA 1OXTA 4IINA 1V1RB 4E07A 1K97A 2GZ2A 4OSPA 3CZAA 2QMOA 1QHSA 3WI7A 4L7QA 1F3OA 2D0OB 2NXWA 4WJZA 5JXHA 2Q45A 3CSSA 5IASA 2VPTA 1ZO8A 4UDYX 3NORA 5HZHA 1JDPA 4Y6LA 2X3FA 5LN1A 4Q3DA 1Y1KE 3ROZA 4GZLA 1KPHA 5CPBA 5C1BA 3EZ6A 1OF1A 4YI3A 4MXDA 3CG0A 1CEQA 4MLPA 3AEQA 4S1PA 1QHEA 2YASA 4A4DA 3W8DA 5H4GA 2R6R1 2BMVA 2AH5A 1J24A 4Q3NA 4QVGA 4GKKB 4IDFA 1DUIA 2I4LA 4ETNA 4WINA 2YQZA 1GCGA 1W36B 2YZ7A 3CNEA 4PYKA 1G8YA 3HWRA 3MWDB 2XVZA 3CC8A 2ENWA 4FKZA 1NMYA 2XYVA 1Y3HA 1KWKA 5LZ9A 2AT1A 1PX0A 3BCHA 4CF7A 3HJFA 4TXJA 3HE3A 3HRKA 3T1YB 1W88A 5FXMA 3HJAA 1P4JA 5K0NA 1GZSA 1CUVA 1U9ZA 2H2DA 3EDCA 4WXPA 4WJKB 1CV2A 1GG2A 2MSWA 3F5QA 5DF1A 3SPXA 1BEZA 1O96A 1RLMA 3OJCA 4ZVLA 3VZPA 3DXXA 4ZVPA 3R0IA 3WYGA 5FTMA 2LIVA 2Z3WA 3KEGA 1JEAA 1HL3A 1SZDA 3KAQA 1K5DA 3R4CA 1ZN9A 3QBDA 4B75A 1CJCA 1LK7A 2MSDB 5FO1A 4RKRA 5T4EA 2G3YA 2W48A 2XYPA 3HMQA 4L0DA 1XZEA 3PTZA 1NHWA 5K45A 1FDOA 3VAYA 5CIQA 1NRIA 1X80B 2GNPA 4QGGA 4CDNA 2FSVC 4MUAA 2C03A 4L3OA 4ZVVA 1SZPA 2VK1A 1EBBA 5LZ7A 3KX2A 3Q6IA 4MUJA 4WY8A 4K9OA 2UVQA 3MWKA 4DR3B 2YN2A 3GJRA 3LUPA 1CY7A 3UZUA 1T6NA 4IWYA 4NXMB 3BAZA 2AJTA 1JPVA 4WOBA 1N2ZA 4DC9A 3NRJA 3SBEA 1NI5A 1EQUA 4LRYA 5AW1A 2PNFA 4B44A 5FFNA 2EKLA 3MJCA 1KZGB 1QK5A 4G5YA 3UGTA 5HKKD 1ZIDA 2JLCA 2OHJA 2FZ4A 2H1HA 3KL4A 2VDMB 1XA4A 4NK4A 3X1DA 2TMGA 5C7YA 3LCVB 3P1JA 5DBHX 1GG8A 3UCFA 3PVSA 1L5OA 5F9HA 3CG4A 4QHSA 1LLCA 1E3SA 3KAJA 4W6QA 4EIWA 3ZE7A 2JGEA 1MJNA 2GBIA 3ND7A 1QFMA 2WAOA 4PLHA 4MV0A 3ZDEA 2D54A 1ZLXA 4D4LA 3WYDA 2FG5A 3QX3A 4BP8A 1WVIA 2V7QA 4PAQA 4OJTA 4DWVA 4ENPA 1FW8A 4OTZA 4HT3B 5JNVA 2UZ4A 3KQKA 3BA6A 2CF6A 4EP1A 2J67A 2ACVA 1E8MA 2R7AA 1GGMA 1JB9A 1LI4A 1PGQA 1P60A 2B2NA 3JARA 2A7XA 4LXYA 4RC9A 2PMFA 4TWAA 5JWHA 1DC6A 4NZMA 1CUFA 3FTNA 3KWJA 3BIXA 2IHTA 2B8JA 2I7XA 1SCAA 2GRJA 1KEVA 1P5HA 3QUTA 4JWKA 4A8PA 3LQQA 3BWBA 3VBEA 4IFBA 3HWWA 2RGGA 2H92A 3C8MA 3FKJA 3OQJA 1JECA 3A2NA 1BXRA 1VBKA 2NSHA 5HF5A 4UVIA 3TLJA 2DB3A 5L95A 4TXLA 1DJMA 2ACWA 3KELA 3PGJA 5ETJA 2GK6A 2A35A 3AWDA 3Q0IA 3QYPA 1QDEA 3GDGA 4QBKA 2I8AA 3MJTA 2IOQA 4MGHA 5JYCA 4CG3A 1DQSA 2YIMA 2A5FA 3OTQA 4WK2B 3DTTA 3MCUA 3KVYA 3KDPA 2XY4A 4DR7B 1I7SB 5JJIA 3JQPA 3QPWA 3OM0A 1JLMA 3I30X 2VPYA 1B8UA 4UDNA 3ROEA 4C06A 2O8EB 3R5HA 3SIXA 4B0OA 1C1XB 2WW8A 5T5QA 1JS1X 1UMDA 3ICPA 5ALHA 5A1TA 3A3KA 2CEAA 2VDJA 2WR8A 4M1MA 1G63A 2SNIE 1XZIA 3JXEA 3R23A 2VQEB 3K1JA 3WMEA 4DHEA 1GYPA 4GI1A 4HNQA 1MU0A 1LK0A 3H0CA 1A2QA 2B1JA 2HWYA 2AB0A 2PYZA 3E81A 4J0GA 1RI1A 2QLBA 4F1KA 1NP3A 3KFLA 5EIBD 5IUNC 1GGHA 1MOZA 2HI0A 4PR0A 1XA0A 1GGFA 1T8TA 1M2OA 3EH1A 2FPSA 4X24A 3ZDZB 2XNJA 1HSOA 1OVMA 1RXCA 1PSZA 4RHFA 1E4YA 2WZDA 2VNAA 5TF0A 1KYVA 1PWHA 3IR5A 1HOTA 3KQQA 2PQMA 4AJ2A 4MCHA 1QC5A 2I7VA 2E1PA 4B2LA 2E49A 5KTNA 1PT8A 1JVSA 1K5HA 3E35A 4OGWA 2C5EA 1K3UB 4HR7A 3NETA 1TAGA 1WW3A 1CUAA 2LD4A 2WLSA 6REQA 4CR7A 1FRFS 5KQRA 2FJPA 3TB6A 1QFXA 4OK6A 1SCDA 4DADA 3ITDA 3CLKA 1GSOA 2IEZA 4ERNA 3PCRB 1XWWA 2VC2B 5DGXA 2Y8EA 2XCOA 3BB3A 2R4UA 3KTOA 5CH8A 2X1VA 2QTWB 4A0HA 3EMDA 2IIVA 2E21A 3EJ6A 4FCCA 1RW4A 1OU0A 1VE7A 1YR6A 2R65A 1CT9A 1EFCA 1MB3A 1U04A 3F6YA 1XKLA 2AOUB 2GNAA 1D9XA 2PKCA 6PFKA 3CNOA 1C3XA 4ECEA 1SD1A 2Z4TA 5AKKA 4KR6A 1KZ9A 2DE0X 3NBAA 2GRAA 4RD2A 4TLCA 5FQOA 3MS2A 3OLYA 3QFFA 5FNVF 4H08A 1HFJA 1A4UA 2IYTA 1MORA 3P27A 1AKUA 1E1LA 1H3FA 3DAGA 4N9WA 2JZCA 3BRCA 3DBLA 5DTRA 1R16A 3A58B 2HU2A 2RHCA 2R6GA 1TZCA 2Q3BA 2V9ZA 1E1MA 2QQ0A 5LQCA 2QRZA 4R6WA 1DT3A 3CINA 5JIBA 3BGDA 4G5FA 3ZXYA 5JAMA 2E5FA 4CI9A 4OFZA 1E1QD 4EW2A 2RAFA 4G5OA 4QRDA 1WEKA 2WJ3A 3OLZA 1QLJA 3V4FA 5I4KA 1YB5A 2DXIA 1ULAA 3HVIA 1EGVB 3BZUA 1ZY2A 5IC5A 4QM7A 4G1UC 2QE7D 2PT6A 1EM8A 1RC1A 1M76A 5CGQB 2R5NA 2QUJA 3WYNA 1KTVA 4LXXA 4FIZA 4UCXA 3MYYA 3ZXUB 4BO0A 3O31A 4FINA 4DPMA 2ZAOA 1CQJA 5FBZA 2HHJA 4B9EA 4YMLA 5H1YA 5JT1A 5CTJA 2I8CA 2XE6A 1H85A 5ES4B 4OJKA 4QVIA 2JFBA 3B1KA 3AESA 2FGJA 2O8NA 1CRWG 3TW4A 1Q2UA 1HE1C 1QHFA 2ZIWB 3ZLTA 4KMMA 3R6LA 2ZPTX 3TMYA 2WJVA 7ADHA 3NFRA 3JZAA 4O02B 1RAEA 5EVCA 3WS7A 4W9RA 1S8FA 2NXEA 1JVNA 3CWQA 3ZBQA 3B9PA 4KNVA 1E5LA 4HAVA 3OZRA 5AW5A 3GROA 4P8RA 5D00A 1JV2B 1IUNA 3L8FA 4XE5A 3L7YA 4HNGA 5CCEA 2W70A 2FWBA 2BHTA 4DY4A 1LWOA 2H1SA 1B6GA 3OT1A 4RZUA 1M2EA 3T99A 1XPUA 4JEUA 4NU8X 1UKVY 2QQFA 3N2ZB 3UK7A 1L4KA 2CLLB 1ZIOA 3I92A 3KQTA 1PGOA 2XMDA 1NZDA 1QIKA 2BELA 4CQJA 1J5EB 5LDDC 2Q5HA 4RLFA 5AJUA 4BJHB 4F5EA 4PGMA 3UAWA 5JRJA 1LBTA 2F43B 2VF2A 4HH4A 1U11A 1SQ0A 4IDNA 4AN1A 4CNQA 2FQQA 3PVZA 4NYIQ 3W7AA 4G8DA 4JQOA 3CF0A 2FPPB 3BE6A 1QBKC 4BRUA 4B17A 2V1XA 4BNXA 1NVDA 3P4UA 1AQYA 1XO1A 2OV1A 4AG6A 3UAXA 1XTTA 1QVRA 3L02A 3PD1A 3CVYA 3R6GA 1YAHA 2IWHA 3KQOA 1N78A 1VP9A 3NPMA 1N4AA 2IYLD 2H9IA 1L4EA 3QGMA 4NECA 1KXZA 5K3DA 2RMKA 3SOPA 5JH7F 1OH7A 1UC5B 4TSRA 5H70A 5FPPA 2AOWA 1KU0A 1T13A 2G4CA 4X1KB 3L41A 4B6JA 2X1HA 3N74A 4YV7A 4RA6B 3GP8A 2YFHA 2JIPA 2Q4RA 4V2IA 1GZVA 3DAOA 1IUOA 2IU0A 5DPMA 2OZPA 3ONWA 1UFVA 3PA8A 3HNRA 2F4NA 4NONA 5AOBA 5AHRA 3UN1A 5F77A 1KH1A 4KXXA 1F2UA 1NNEA 1UJBA 2O2EA 2IZZA 4QXPA 2P91A 3AFMA 4L3VA 1RI3A 2FRDA 3Q9LA 1WSDA 3NOXA 1NUPA 2X9LA 3GFVA 1H0SA 3NHKA 1CE8B 1ISIA 1WU8A 1XDBA 3OPVA 4OB7A 3WSTA 3LWDA 5JVDA 5GZ3A 1TJNA 3D59A 1ORRA 3IAM1 3SJ7A 1ZC3A 1CZHA 4I1VA 4PYJA 3U56A 2DM6A 1NBWB 1Y4ZA 5ERYA 1ZVKA 1MO6A 1FYXA 1W2HA 3EWAA 4Y6OA 2F1HA 2ZIAA 4R1UA 2YVUA 3NNNA 1UDAA 5DGHA 1N3BA 2CXUA 4ENVA 2BMWA 1C1HA 4JLDA 4B43A 1U7WA 3Q0TA 1D9ZA 4RGBA 2VATA 2JAOA 2IBSA 2ZYVX 3DMGA 1ISSA 3BK2A 3WLRA 3OE5A 5JXWA 4FE7A 1A1SA 4EO9A 2O2CA 2P40A 4K40A 4EYOA 3T1HB 2D7JA 4BBPA 3VH4A 2HZ7A 1Y4SA 1PS0A 4L75A 1KYYA 2W93A 2PBFA 1JZTA 1OFUX 5K3EA 2IOHA 4LVUA 3DNMA 2R0QC 4US0R 2G6BA 4BHTA 2IUFA 3F73A 2C4WA 3WLNA 2I4TA 2Q41A 2DFDA 3EJWA 1IONA 1D2RA 3LV8A 4CKZA 4KG7A 1PFVA 1Z8HA 2P9BA 3R7NA 3IBSA 3RSCA 3UT0A 1CJUC 4MNTA 3PPYA 3ENKA 1PJ4A 5INTA 1ATIA 3KZOA 1NRXA 4CLOB 3ONDA 4N65A 3T1TA 1Y9AA 1HQYE 2WYOA 1L6IA 2QRJA 3I01A 1YB1A 3OOHA 3LP5A 1QX4A 2SICE 2OK8A 1X1DA 2ZR9A 5HDQA 3TBKA 3JV7A 2ADMA 2XXJA 1EX1A 1ZN8A 2OGWA 1CNFA 4FWBA 4OB6A 3AEUB 3REQA 4PX2A 5F2NA 3RV4A 1SXPA 3WWDA 2EAUA 4IP0A 3JQDA 1NXVA 1XAHA 4FFWA 4FYIA 4MR9B 2CE2X 3Q87B 4COOA 5EP1A 5FBVB 5KTPA 2J0UA 1POWA 3MFYA 2AJDA 4G2NA 3WL4A 1GA1A 3ED5A 1WUHS 3HVUA 3OLWA 1QF7A 3OZVA 3PZRA 4FYPA 3L6OO 4LDQA 1ZICA 1G291 4MS1B 1SELA 4O1IA 3GNSA 2G5TA 3MRXA 4R2WA 1C4KA 1XJQA 3EXHC 4K28A 4O4JF 2FFBA 2VJQA 3OIDA 4TS9A 5LBIA 1GR0A 3S0JA 1TTPB 4IUDS 4TV8F 4C0XA 3ZWBA 2JLWA 4N9QA 2C9OA 3K73O 1GQ2A 1GZHB 3LQRA 2H57A 5IKMA 1JHVA 4Q21A 2R96A 3PYMA 4MO2A 5C5DA 4PG5A 2IS1A 4G0OA 4ZCRA 2ZUCA 1G6OA 3E22A 3KB8A 4ZOAA 4QKQA 5DGCA 3FSGD 1J8VA 4KH0A 4LGVA 2YC4C 4MYUA 1U0HC 2WI8A 5A3VA 1JDJA 2BEJA 3D8HA 3U7RA 1SG9A 1IEVA 1NJ2A 1CRQA 2PK3A 3AQIA 1FFDA 3K9FC 4K03A 1TJ3A 2VJCA 1N2XA 5DVZA 3M81A 1W0KD 1NY5A 1IPHA 1YV9A 4L5JA 5TEWA 2VBCA 4LMRA 4UU0A 4DC1A 4Q18A 3AYZB 2OXTA 3K0AB 1UKZA 1TYEB 3QF4B 1P2FA 5TNXA 1GJRA 2OGZA 1ZXBA 4BEVA 5L9AA 2NV2B 2WV9A 1ZM7A 1ZIXA 1P4AA 2RGEA 3TZQA 1U63A 2OQRA 1AC5A 3DEJA 5CH3A 3A31A 1X7GA 2X6RA 1AHPA 3TTWA 1KC1A 3GX1A 3NM5A 1KI8A 2O0HA 3GARA 5FV4A 2P9ZA 2BDEA 1VKOA 1Q7BA 1BMFD 4JITA 1VCIA 3AKDA