4QB2A

Structure of cbm35 in complex with glucuronic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
molecule keywords Xyn30D
total genus 28
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb2A00
3WNMA 4OMDA 2X09A 2VTFA 4FI9A 3PUHA 3C7EA 4DUVA 5DMYA 5IFPA 2VZPA 4A44A 3UESA 5JR2A 4TTGA 2VZVA 2WZ8A 4M4RA 5CZKA 1NAEA 3I2GA 4LKSA 3I2JA 3UNPA 2XHNA 5LA0A 2WYSA 3DYOA 1F4AA 1UYYA 1RYYA 4DXRA 4KWUA 2ZEXA 1H6YA 2EIEA 1CX1A 2WO3A 1XNTA 1JYXA 1GQPA 2B4KA 3LEGA 3A22A 2YG0A 5EJZB 2C4XA 2PQSA 2Z4FA 3VD5A 2QQOA 2WN3A 1UZ0A 1W9WA 3C7HA 4BK4A 2X05A 5JXGA 1UYXA 2QQJA 4XUTA 3T09A 3OG2A 1HN1A 4QDRA 2E33A 3HOBA 3F2ZA 3DYPA 1YQ2A 3ACHA 3A23A 4XUNA 1WKYA 1UY3A 3CIHA 3WNKA 4XUOA 4CUBA 4CU8A 5DPNA 3SKJE 2V4VA 2Y6KA 4GWJA 2OKXA 3ACIA 4A42A 4QDSA 3K75B 1SG3A 1UY4A 3VDAA 2VQUA 3LE0A 2VMDA 4W4ZA 5LA2A 4ZZ5A 5JMOA 3OEBA 4QX0A 4JKKA 2QQLA 2VZ3A 3MV11 3OGRA 1NUKA 3GGLA 4A3ZA 5JXHA 1SHWB 3I3BA 3THDA 3BGAA 3NRUA 4XZUG 3CQOA 4MGSA 4BJ0A 2Y64A 3I2IA 4XVHA 2WDBA 4XUPA 1OF3A 3FHQA 3WNNA 2VZRA 2J1RA 2JKXA 2XQXA 4P5YA 5F7UA 1CZVA 3WF0A 3P6BA 2XOMA 3WQBA 4A45A 3LQCA 2W94A 1DLCA 2EIDA 3I2KA 1OF4A 3HN3A 2EIBA 2J1UA 3THCA 1UXZA 4CU9A 2BERA 4CUAA 3WNPA 1L7QA 1R64A 2JDAA 4CUCA 1UMIA 3ECQA 1EUTA 2DCKA 2VOTA 4MGQA 3IIIA 3WF4A 4CVUA 3CMGA 4LPLA 4ARXA 1PMJX 2VCBA 1D7PM 3UETA 2QBXA 3LPFA 2YB7A 3ACGA 4LHSA 1K3IA 1UY2A 4CU7A 4JX0A 2VL4A 4DEQA 2Y6LA 1CZSA 5LCWL 4IUGA 4DUXA 3JXSA 1O8PA 3NJVA 4MO3M 3U37A 4UI9L 1EUUA 3WF3A 3I2HA 3OB8A 1JZ2A 2WBKA 4TXWA 3NJXA 5EJ1B 5JXJA 3T2QA 2VMFA 1L7RA 3C7OA 4A4AA 3WF2A 2C9KA 1GOFA 4P08A 4W8JA 3VD4A 3ETPA 3CZUA 4ARYA 3CZJA 1MPXA 1W8NA 2RVAA 4OMCA 3SEEA 5LA1A 2ZEWA 4QB2A 5JUVA 3FHAA 2W9XA 3MUY1 2V5DA 3PUIA 4QDQA 3VDCA 1W0NA 3MBWA 5IFTA 3K77A 1UY0A 4DUWA 3W5MA 4MADA 2WAAA 3HNBM 2VZQA 2E26A 1JZ6A 2YFUA 3HNYM 3ABZA 5J1XA 4CU6A 3LEIA 2VO5A 2J1AA 2DDUA 2DCJA 2VZTA 3K46A 4AG4A 1JZ7A 3MO4A 1JU4A 5I0DA 5A1AA 4MOAA 4OUEA 1W99A 2V72A 3IAPA 3LEKA 2QQNA 2VJXA 3VD9A 1GOHA 3WNLA 3T2OA 3BN6A 3W5NA 3K4AA 3C7FA 4PT6A 2BZDA 2WN2A 3NQHA 3OBAA 2WQ8A 2RJ2A 5C71A 2VCCA 2Y6HA 5B4XA 5JXIA 4PF1A 1WCQA 2BBAA 2JE8A 2C26A 3DYMA 3VDBA 3IAQA 2R7EB 2Y6JA 1JZ4A 1I5PA 3FN9A 4E8DA 4QX3A 5IJRA 2J7MA 4JKLA 1CIYA 4OZOA 3E1F1 2W1WA 3IB3A 2WABA 2Y6GA 3VD3A 2VCAA 4A6OA 1GNYA 1OH4A 3GM8A 2W92A 1GOGA 2B9VA 1XNAA 2W5FA 2VZSA 2QQMA 2W87A 1GU3A 1H6XA 1JU3A 1KEXA 4A41A 1US3A 3HPNA 1K45A 1ULPA 2E32A 2J1VA 4RN5A 3T0BA 1DYOA 3C8XA 3OGVA 1US2A 2VZOA 3MUZ1 2EICA 3ACFA 4W50A 2W95A 2WZEA 2QQIA 2BGOA 1K12A 3SKVA 3HNMA 4YPJA 2W47A 3C7GA 1JYWA 3I97A 4ZXEA 4RYDA 4D0QA 4XUQA 4DXTA 3T08A 4P00B 1W8OA 2ZEYA 2ZEZA 5CYYA 2WO1A 3T2PA 4DEVA 2VMCA 3AC0A 2WAOA 3T0DA 1JHJA 4LQRA 2XONA 2YC4A 3FL7A 5G05L 5C70A 1JZ5A 2W1SA 1TVGA 4ZZ8A 1GUIA 1P8JA 1OD3A 4QB1A 1CZTA 1UXXX 3NNGA 3OGSA 4AAXA 3D3AA 1IQDC 4ET7A 5B4NA 4M4PA 1DP0A 3EYPA 5C7GA 1JYNA 2VM9A 5IHRA 2J22A 3CDZB 4QX2A 1JZ8A 3ZM8A 4KMQA 2VC9A 3DECA 1UY1A 2VZ1A 2Y8KA 2HYXA 3VD7A 2E31A 2VR4A 4PQQA 2ZXQA 2BGPA 1JYVA 2W3JA 5IYYA 3I3EA 2J1EA 2YFZA 5G04L 2L9LA 1K42A 1PX4A 3I2FA 1J84A 3K4DA 3CKHA 2HLEA 1UWWA 1F4HA 1W9TA 1UMHA 1SDDB 4QPWA 3OEAA 3LPGA 1KGYA 4GZ9A 1W9SA 2ORXA 2RV9A 1ULOA 4OYUA 2VZUA 4QX1A 4QB6A 3HJRA 2J1TA 1XPWA 3WF1A 4BDVB 1O59A 3P1IA 5HXMA 3IDAA 3K4ZA 4XURA 1NKGA 3WNOA 5EIYB 2W1UA 1GMMA 4DXSA 2KD7A 2W91A 4UOJA 1JI6A 1PX3A 2W46A 3GXUA 1BHGA 2WO2A 1O8SA 4D8MA 4L0PA 3I3DA 2VQTA 4GWIA 4BXSV 4ZY9A 2LS6A 2ID4A 2JD9A 1T2XA 2J1SA 2W1QA 4QAWA 1UX7A 1UYZA 4BK5A 2LW8A 2QQKA 4E8CA 3GDBA 3WSOA 1TG7A 3SEPA 1OT5A 3HEIA 4HG6B 5DQ0A 3A7QA 4KI5M 5FUIA 3J7HA 2WUHA 1XC6A 1PMHX 2YC2A 4JKMA 4UAPA 3T0AA 2CDPA 4JHZA 4P02B 2CDOA 1JZ3A 5DN2A 2ORZA 2X10A 3EB7A 4Z2AA 3A21A 1NX9A 3MV01 1LNSA 1J83A 3WEZA 2VMEA 5HPOA
chains in the Genus database with same CATH superfamily
2XJRA 5A3TA 3FBYA 1LHVA 5IWFA 5FYYA 5C9AB 4UW5A 3PUHA 3C7EA 5FP7A 4QXHA 4L92A 2P3IA 2QNKA 3M3EA 4WVVA 3ZN4A 1JOPA 4N9HA 3RYPA 2P6HA 5C5TA 1NA1A 4TTGA 4MV2A 3WXPA 5HCAA 5LZ6A 1MR5A 5CZKA 5DZEA 3DXTA 5L19A 1LAJA 2AYHA 4N43B 2ZGKA 4LKSA 1MQTC 1W8TA 4CXWA 4JGZB 3AFKA 2JG9B 3POFA 3UNPA 4IL7A 2DU0A 1OHFA 5L9BA 4P5HA 2WYSA 3H3ZA 3IIAA 4E4ZA 1RYYA 5LY1A 3RZGA 2PAMA 2PAKA 4ITCA 1ZBA2 4F8AA 5FV3A 1ZBE1 5E1RA 3WCSA 3ZMOA 1BBT3 1JYXA 1QXPA 4JDOA 1GQPA 4ATEA 1WLDA 1NCQB 1KFUL 3AYDA 4KWLA 1YEWA 1SQ4A 1MZ6A 3A22A 4OULA 4XXAA 4Z92B 4FTEA 2C4XA 1YFWA 5C4WB 3OBZA 1Y9GA 4P9JA 2WZR3 3IT8A 1TMF1 4HBNA 4XJWA 2X5IC 3CL1A 1QY4A 2PXJA 4KGGA 3ZN5A 4QDRA 5FZMA 2VUDA 4XETA 1BVP1 3VBFB 3TEWA 1C8M2 3DYPA 3I8TA 5IVVA 1JS9A 2VNVA 3IZOA 2WNVA 1YQ2A 1AR72 3E97A 1GR3A 4BPZA 4HZFA 1HLCA 2HKXA 2WL1A 3LDRA 5I91A 1UY3A 3DXUA 4OFGA 3WCRA 1M4WA 4QXBA 2VULA 5JOWA 5KHHA 1A78A 2W0XA 4BLJA 2Y6KA 2WSUA 5A3OA 2D3RA 2A75A 1HQNA 3K75B 3EQEA 4Q4Y3 2AH2A 3VDAA 3WQ1A 5FY1A 3N36A 1QJU2 2RM21 5LA2A 4OHWA 2UYBA 4ZZ5A 2RS32 4Q0VA 3J7NA 4NOTA 5M0TA 5JMOA 1XRUA 3OEBA 4QX0A 1QQP2 4JKKA 4ORFA 1RC6A 3UKTA 2Y38A 4QPGA 4S2HA 3WZ1A 4FPHA 1NUKA 2C9AA 3G7DA 3GGLA 4YZ4A 3J8F1 4DY5A 5LWBA 4JTNA 3D82A 1HRV1 2XBO2 3VDDC 3CJIA 2VD7A 4DRRA 1O7FA 1S2KA 4MGSA 1VBB2 4BQ5A 1QIQA 4E4SA 1PIV2 2SBAA 3VHRA 4LR4A 1SZBA 1AX0A 1QJU1 4XUPA 1APNA 1TE1B 2RM22 4JGZA 3WDVA 4BQYA 5JCTA 1VBD2 5A33A 1I3HA 1REFA 2O1QA 1XNDA 5JI7A 1AR93 5F7UA 1G6NA 4P5YA 3Q8AA 4BQ2A 1R091 4N7UA 1X33A 3I59A 4Q0UA 4RS5C 5C8CB 1H2MA 4CDWB 3BOWA 2EIDA 4DIQA 1OF4A 4I3GA 2O14A 4DQAA 4P9XA 2ZGSA 5IVFA 1XU2A 4LHKA 4OQ9A 4CPBD 1RUH3 1IPSA 4MUVA 1ND3C 4YGEA 1Y3TA 2BERA 4CU9A 5L36A 1G9FA 3MIDA 4IE7A 4TYSA 1EPZA 3OPTA 3TB0A 2XLGA 1SLAA 4Q27A 4CCJA 1R64A 2RJKA 3O0VA 2ZOEB 1PGSA 2FCVA 2JDAA 2G1MA 1W05A 3S6PA 3FFQA 1W2OA 5KXCA 3BYWA 4CEWC 3LFIA 2DCKA 4MGQA 1UOGA 2A6ZA 1H2KA 1POQA 2DVAA 1XYNA 3DCQA 3WF4A 3WINE 4RR3C 4AQ6A 4ARXA 5APAA 1PVXA 1SMVA 1RGSA 1MVEA 2BV4A 2YB7A 3EXUA 3ACGA 4AHWA 5JSRA 1CAXB 1K3IA 1WD3A 2WJSA 4JX0A 4XILA 1JOJA 4UF0B 3GCWA 2DFCA 4NIGA 2RJLA 1J3PA 5CA6A 1EV11 1VRH1 3MYXA 1YQ5A 2BEOA 3VBOB 3ZX7A 2P2KA 2A6VA 2ZJCA 4C91A 1S55A 4NRQA 3POYA 4NRPA 3U37A 2ARBA 5FMOS 4CDXA 5CFDB 1ZX5A 5JXJA 2ZKNA 2HWC3 2Q1MA 1SBDA 2WR9A 1DFQA 5IVEA 2R063 5JLVA 2FBEA 1AZDA 1R1A2 5FMDA 3GHNA 1T6GC 3WF2A 4XACA 3OPZA 2C9KA 1RVF1 5JAXA 3BVCA 1DIWA 5LATA 4AI9A 1WWYA 1GLHA 2AC1A 3VD4A 4Q4X2 4ARYA 3FX3A 4L2NA 1W8HA 2JD4A 3SISA 5CFDC 2DBIA 1HB4A 2RVAA 1IHMA 3ZFEC 4AVTA 2ZA9A 2PLV3 3CJIC 5L73A 5JUVA 3B00A 4P9GA 4RA0A 1NCQA 3OD0A 2QJVA 3PUIA 3RI9A 4Q4W1 4YVWC 1CIWA 3ZN6B 1UL9A 2CNAA 2JICA 4EWDA 5IFTA 5JZGB 1I1EA 2CGNA 2HWC1 4QQ2A 4AI3A 4AVSA 1Z7S1 5C9AC 2PA7A 1RL3A 1YFYA 1ZM1A 2ADDA 4XDQA 1GZ9A 1Y9MA 2WRAA 2EA7A 2TUNA 1OUXA 3JD73 1AHSA 2ZBJA 2ZHMA 4WZCA 5CKMA 3D8CA 4F83A 1CAWA 3MZHA 5CG8A 1EV13 1UX6A 3ABZA 1MVQA 3FMGA 5J1XA 4HKOA 4Z1VA 4R4XA 2EIGA 4YZ3A 3WW1A 1WW6A 4YSFA 3SCHA 3VBUB 4IE4A 5GALA 1ENSA 2N7GA 5I0DA 2JDMA 3M3CA 4V2WA 3W58A 2YBKA 1W99A 4HN0A 2RR11 1GNZA 3POSA 4XF3A 4AHZA 1F8VA 4EN6B 2I45A 3LEKA 3H42B 5D8AB 4CXXA 4DOUA 2GC3A 2BFUS 3WNLA 1LU2A 3A0KA 4UWDA 3DKQA 2XUMA 2Z2SB 3GBGA 4K6BA 5FYCA 3BN6A 3W5NA 3K4AA 4EN7B 2BZDA 3OBAA 3NQHA 5FUPA 5JDBA 1POV3 2Y6HA 4IEYA 3SQOA 2JKBA 1RUH1 2BBAA 3DYMA 3ZIXA 1QOTA 3JBG3 1OLME 4JZRA 5FFOC 4N53A 2X5IB 1W6NA 4AQSA 3ELNA 4Z07A 2Y6FA 4CEYC 1VBA1 1PM7A 1JZ4A 1ZZ8A 2PHFA 1N3QA 4M0HA 3JQWA 5FR3A 1YO8A 3UGHA 4XFFA 1R093 3N9QA 5CIRA 5IJRA 3TN93 1MS1A 3HMYA 1ULFA 1DQ6A 1RMU3 4UXAA 1VMHA 5DAQA 4I30A 3T3YA 3E1F1 3POIA 1WBFA 4DB5A 2VW2A 4IGQA 1RUE2 3RG0A 1DYKA 1NLSA 4FAGA 1W0PA 3H8OA 1ZZ9A 1OFSA 4XHBA 2DTWA 5CEHA 1BMV2 3O1MA 4RSUA 3ZFGB 2G9ZA 4PIXA 4COWA 5HV0A 1WMDA 2A71A 2HWB2 3WDUA 2JE9A 2VW1A 5FP9A 1US3A 3HPNA 5FZ0A 3O1PA 1PGL1 4B8EA 1CAVB 1ULPA 3DPRA 3OTFA 1XE8A 1DYOA 3CLPA 1DZQA 1YI7A 3C8XA 1H9PA 2CTVA 2CSGA 1SLIA 3K3NA 3KM5A 4ASMB 4COVA 3QLQA 5BNOC 2XJPA 5HBAA 1PHMA 2YGLA 5FPUA 2QQIA 4MGIE 1PGL2 2BTVC 1ASJ2 4D6SA 2IC1A 2BNNA 5I8TA 2HWB1 3D6EA 2IVJA 1OLQA 2NN8A 4WVMA 4YPJA 1O4TA 2W47A 4HPKA 4Q26A 1XQNA 1AVBA 5F8PA 2Y26A 5L7OA 3NNMA 3SH3A 2RR12 1PZ7A 4BZ4A 3VBOC 1WW5A 4FPFA 3WW2A 4XUQA 4YZ1A 1QMJA 3LOBA 5D21A 2HYKA 3LEMA 3OPWA 5FREA 1KJLA 3VBFC 4COYA 2WO1A 4LOSA 1B35B 2TEPA 5DUVA 2WAOA 4Q4Y2 1BEV3 1ZRRA 1JYCA 3BU7A 1UZYA 5JVVA 3UGFA 3WP3A 4BMBA 1BK1A 4IEWA 3MIEA 3LFMA 3HBZA 4Q4V1 1UZZA 1NYWA 4D3WA 4Y5SA 5I8SA 2FDGA 1QQP3 2CL2A 1OA3A 1TVGA 2F6BA 2W1SA 3HQRA 5F5QA 5H9QA 1P8JA 3VBHC 1OD3A 4QB1A 4P9WA 2UY8A 1W04A 3MIBA 5A80A 1CJPA 3NNGA 3RGBA 1ZRDA 3GHMA 1S1AA 1TME1 3NNLA 2JE7A 5BYNA 3D3AA 1IQDC 1PIV3 3HBKA 2VVEA 4Q1PA 4M4PA 1H4GA 3VBRB 5IHRA 4Y5Z0 2P6CA 3VL9A 1VBD3 3OCPA 4RFRB 5CFDA 4FSJA 2WYFA 1SLLA 5FP8A 3W59A 3POJA 4NWVA 4PI0A 1LKNA 2VU9A 4Y22B 1AXYA 4RQPC 2BFUL 1LJ7A 1DF0A 3KB5A 3M3OA 1TME3 1ULCA 4QHOA 5FZEA 1RHI3 3USSA 5IK8A 4BU2A 4LULA 5F9TA 2IUWA 4Y22A 4HMZA 2HEYF 3VD7A 3DF0A 4JV4A 4WZFA 3PUSA 1LB2A 5A3WA 4AVVA 1IS3A 1ND2C 2AZ5A 3PVEA 3AYEA 5BNNC 3TEXA 4QKFA 4KL1A 1QH6A 1N1SA 1VBD1 3PTYA 1ZZ6A 1UIJA 2BVVA 3MW4A 2YFZA 1XOYA 3CF6E 1W6MA 2OUJA 4O61A 4XFIA 1K42A 3K4DA 3SLIA 3CKHA 5FQ0A 4RQPB 3KCCA 4BE3A 2O0OA 1FOD2 1F4HA 3KGLA 1QOSA 4NUBA 5FXXA 4QPWA 3VLBB 3LPGA 1FMD1 1C5IA 1HQLA 2ZMKA 4LO8A 4PF5A 4J1XA 5FP4A 1GZWB 1LULA 2ORXA 2RV9A 5ISLA 1QQP1 1AJKA 4E2QA 4OYUA 4LK7A 2VZUA 3JQXA 4Q4V3 5ABJB 2AENA 4QXKA 3ZYGA 2J1TA 1ZREA 5A6YA 2JG8B 3WG4A 3IPVB 1O3SA 2WS92 1RMU1 4YW5A 1OH3A 4XURA 1V6MA 2JDHA 3VUOA 2W2IA 3AK0A 1F5FA 3C2UA 3U14A 4AVAA 1LECA 4Q0QA 3ZSLA 4OLLA 2GNTA 1GMMA 1UCXA 4DXSA 2FZ2A 4QHBA 2KD7A 3N7MA 1JI6A 1Y4WA 2W46A 1U5XA 3AJZA 3AZWA 2E9QA 4ZU7A 4YG0A 5FK8A 4GULA 4XIOA 4CTEA 3ZYRA 4D8MA 1W28A 3H1WA 2UWBA 4RL7A 2VQTA 5EYYA 5FPVA 5F1RA 2FHRA 5I0SA 3GF6A 2LS6A 4JHTA 2RDQA 2JD9A 3ES1A 4QX5A 1TEIA 1KFXL 2OXBA 3O1TA 1W8UA 3VBOA 3PNAA 2QQKA 3N4MA 1BLZA 1X9PA 4E8CA 2GNDA 3WW4A 3QOPA 1R1A1 3GDBA 1HW5A 2ZGMA 2IXLA 2WNUC 4L8QA 5FYZA 1TG7A 5LK5A 3ILNA 3H8XA 3VDDA 2R071 3ROUA 4NHKA 2PN5A 3AMHA 5DQ0A 1LGCA 4CE8A 3POGA 5FXZA 4N8MA 4LE3A 3LSDA 4QPIC 1OPMA 1PK6C 3MF9A 5FUIA 3VV1A 2V73A 3LZZA 1XC6A 4OHXA 2ZAHA 4JKMA 3ZR5A 5BNNA 3BTAA 4CDUA 2XHKA 4WVMB 2CDPA 4JHZA 2XVGA 2YXSA 1Q8SA 2RMU1 1JZ3A 3N9NA 2IZWA 4GQ7A 2PHTA 4Z2AA 2AUYA 1F5JA 4LO4B 4XBQA 1SACA 1NX9A 2V4AA 2P5BA 3MV01 4F7ZA 2QQWA 1H4HA 1ULGA 1LENA 2IXKA 2RDNA 4KH9A 3LF7A 3NAPB 4AGVA 5KHJA 2XKPA 1D4M2 2XG3A 4C0HA 1O3QA 1RUG3 5EYXA 2Y34A 1HN0A 2VTFA 2X09A 4FI9A 2WQZC 5JIAA 1UNBA 3ORJA 4ZPIA 2ZX3A 3SCFA 2VZPA 4A44A 4E4DX 1LOGA 2XLAA 1HJGA 1ZBA1 4XEZA 2VZVA 4K1YA 5FK7A 4AI2A 2XVKA 5CAZA 3JBG1 3LB9A 3KCXA 1W9FA 3FC0A 4BIOA 3WDWA 3I2GA 3I2JA 4QKNA 5FZHA 1PVC1 3FFZA 2BOJA 4S2GA 4FQ4A 4Y1VA 3WUDA 3U78A 5ANQA 5JOXA 2B9UA 2MPFA 3AKPA 4QQHA 2J42A 3H7JA 3VBHB 2NM1A 3PU8A 1KS4A 2ZEXA 5BXXA 1H6YA 2ENRA 4FTBA 2Q8CA 2EIEA 1CX1A 4Q8LA 3U4XA 3AP5A 3O5SA 1H8VA 2B4KA 4IE0A 5FZGA 4FPCA 1JH5A 1QHDA 4CPBA 4AQTA 2YG0A 5FXWA 3O0XA 2D40A 2Z4FA 3VD5A 4NIDA 2ARCA 1UN1A 1E5IA 4W6XA 2WN3A 5F3IA 2R043 3V56A 4JTOA 2JB8A 1ZBE2 2QDRA 5EZWA 4BK4A 5FY9A 2PHWA 5CU1A 1PM4A 5FWJA 4CXYA 2QQJA 4XUTA 2B39A 1UYPA 2GMEA 2X5IA 4QGNA 3IBMA 5DDJ3 3OG2A 1HN1A 2TBVA 2JXAA 4IEPA 2WNVB 4FFFA 1GV9A 1ZNPA 3KWVA 4A7KA 3F2ZA 4PLMA 3WG3A 1C28A 2ZX2A 4RGAA 4AW7A 3ZFFA 5F5AA 2WC2A 3ACHA 5FP3A 4GKYA 5GZFA 5LBEA 4FP2A 2WNUB 3CIHA 3FLTA 4JRLA 5LASA 4CUBA 4CU8A 3U07A 5DPNA 3OGGA 2VVDA 4GXLA 2HWF3 4LIUA 1BXHA 2BW8A 3P3PA 1SG3A 1UY4A 3LE0A 4PIYA 1LCLA 1FNZA 3LAGA 1V6IA 1R081 5BV6A 4GMP0 4W4ZA 1LU1A 3FUQA 4LA3A 1GQGA 4Y4YA 4EQVA 2LRPA 2QQLA 3AXDA 4L9BA 1MACA 4QX7A 5EHDA 1LOFA 4YW4A 1YWKA 3ACLA 3TNQA 2VECA 3V65A 4CDUB 3CBNA 5JXHA 1NCQC 1OVPA 1SHWB 1ZZBA 3PDQA 3I3BA 2FCTA 4XOGA 2A6WA 4Z82A 5C3SA 4XZUG 4LIVA 5A3LA 5DDJ1 5F3GA 4FPGA 1R082 3CQOA 1HV1A 4FPJA 1E5HA 4H7MA 3ZKUA 2XL7A 4XVHA 1YC61 5FZ9A 3WHTA 3WNNA 2VZRA 4AFCA 3H50A 1WD4A 2JDKA 4BQ3A 2ET1A 3GZEA 4H3WA 1UW8A 4GH4A 2EXKA 2IXHA 1OOPC 5T55A 1CZVA 4FVVA 2JDZA 3WF0A 2XDVA 5GZEA 2XOMA 3LQCA 3I2KA 1DLCA 2WWUA 4ASKA 3AL6A 4I0BA 5FZBA 5T5OA 3HN3A 3FJSA 3L2YA 1IGOA 4YZ5A 4NMIA 4QM8A 5FJKA 2PHLA 1YIFA 3THCA 4AEDB 4URTA 1QKQA 1RIRA 1ODNA 2JIJA 3FHIB 3LA7A 1AYN2 1D4VB 2BWAA 4LBQA 2OZ6A 4AEJA 4JDNA 2ZKLA 3V0BA 2HWE3 2RMU3 3MIHA 2X29A 3R6SA 3OJBA 4UW3A 5IVBA 1DGWX 4K21A 3POBA 4RHV2 2ERFA 2YPJA 3IPVA 1RUG1 1WUVA 4QM9A 4CCDA 1TME2 1D7PM 2XGXA 3VZNA 2OA2A 2QBXA 3LPFA 2ZGLA 5D8AA 1IOAA 1KS5A 1CONA 1PMIA 2XLFA 4LXLA 4QXCA 5J48A 1FNYA 1CZSA 1Q5OA 3M3QA 1ENXA 2GZWA 1EAH3 4LBQD 5FPBA 3FZ3A 2GC1A 5FLIA 4B1MA 1O8PA 1ZVFA 1FV3A 5K4LA 1ND3A 4O7XA 2YC0A 1IQAA 4FOWA 3SCGA 3H9AA 3OB8A 3WF3A 2WBKA 5I8YA 2VNGA 3KZ4C 3NJXA 4J25A 3KHBA 4YNIA 1DHKB 2ZZJA 4YG3A 3UL2A 3KV6A 1BBT2 3WQ0A 1LOAA 2VMFA 4A4AA 1QJX3 2UYAA 4UT5A 1IPJA 2XWJB 1IG0A 3O1VA 3ZSKA 4E9KA 3AMQA 4Q4W2 1YLLA 3UT0A 1NCRB 2DCTA 3POEA 4QKBA 2VNOA 5KXEA 2OYZA 1G9CA 1X36A 4K8FA 1ULEA 1GZCA 4ISQA 1MPXA 1DGRA 4PI2A 2WS93 3SEEA 3U1XA 4K3UA 1VBC2 2P3YA 3MFAA 4GJZA 3BTZA 3FHAA 2W9XA 1RVF2 1J1LA 3MUY1 2V5DA 5DAWA 3I3QA 4QDQA 2EALA 2DWRA 5FO9B 4RR3B 3AP4A 3K77A 1I9RA 3AYAA 3W5MA 4MADA 5JIUA 4UFKA 1DQ5A 2K2SA 3HNBM 4NE9A 1WCSA 2ZMLA 3RFRA 2JDUA 4DPNA 4Q0SA 3SH4A 1FPN1 2DVFA 4XYXA 1U5ZA 2JDYA 3BI3A 1N47A 3PJYA 4P9YA 4AFDA 2F4PA 2YU1A 3TOJA 5E88A 2VO5A 2EF6A 2DDUA 1AR82 2DCJA 1VB4A 2VZTA 1VAVA 3K46A 2DF7A 3MW2A 4OUSA 4PDWA 4XTPA 5FYBA 4YYOA 5JMCA 1XNKA 3O14A 4B4PA 5C4WA 2RS33 1RUJ3 1VE0A 4QGLA 4EV0A 5LEJA 4OUEA 3VBUA 1QEXA 2Z42A 1OC1A 4MGYE 3IAPA 3RRDA 5J09A 2C24A 3AB0A 5DG1A 2XBO3 1ZRCA 4PBPA 2R16A 4NROA 1GOHA 5CISA 3RVHA 4FBFA 3AVSA 1PNGA 3ZO0B 3ZOIA 1W3XA 1S2EA 3MI8A 1W8FA 3E6DA 2GALA 5FJHA 5JI9A 1DQ4A 4AFAA 2WT1A 4HETA 3V64A 5B4XA 4R9BA 5F32A 4ZS3A 3IKWA 4Y20B 5A1FA 3HQUA 5F3CA 5FO7B 2VW0A 5AVPA 5DZGA 3OF1A 3H8UA 3BTYA 3QH6A 3VHPA 5FZDA 2ETEA 3DUIA 1I5PA 2JDNA 3LD8A 3WOGA 3FN9A 5GLZA 2D6NA 4QX3A 1NXD1 1AL0G 4GWMA 4CDQB 2F17A 2RS12 4K40A 1RUH2 4JGYA 1K5MB 4KWJA 3ZFGC 4OZOA 1WZXA 5JZGC 2WABA 5A7PA 1PO13 5LK7B 2X8KA 5EXOA 3LKJA 3KQ4B 2NYYA 3HVDA 1GNYA 1OH4A 3BUCA 4FFIA 4TWTA 1UZVA 1C3HA 3LDKA 1X7NA 1NA1C 3VL8A 3FE5A 1QNYA 2XVLA 1SBEA 1RTVA 2W5FA 1EAH1 2CHHA 4YFZA 1JYTA 2QQMA 3GZTB 1NT0A 2K9ZA 2Y0OA 3GNEA 4IW3A 1CD3G 2VMGA 1H6XA 1JU3A 1OKOA 3AM2A 4XJAA 1BJQA 3H8RA 5JZGA 1KEXA 2VUCA 2RS31 5FYTA 3FLRA 4DRVA 5BNPB 4M00A 4A41A 2WWSA 1IS4A 2XJUA 4FXGB 5FZKA 4YW1A 3KVAA 2EAKA 2E53A 1YFUA 4UF0A 5FZAA 3M4FA 2E32A 5BNPA 5BY5A 2A3XA 4EZHA 1A34A 4RN5A 5F37A 5BNPC 3NL1A 1G8WA 2ET7A 4SBVA 4Y1YA 4QT6A 3UV9A 3WD5A 1V9U1 2HJIA 4P14A 2HWE1 3VHOA 4AF9A 2Y0IA 3ACFA 3BODA 4N90A 3MF6A 2DTYA 2R042 1NZIA 2W95A 4UFMA 4CEYB 1VALA 1WGPA 1Z78A 1ND2B 3O0WA 5FQ0B 1JZ6A 2R062 4QPIA 2Y60A 2BGOA 1PZ9A 2WO7A 3APBA 1K5JA 4HFSA 1WLWA 1HRI3 3SKVA 2WLPA 2FDIA 2BJSA 3Q8BA 3WT3A 1NG0A 5T3NA 3BTXA 2FDKA 1CX4A 1JYWA 4XBNA 3I97A 2VQ0A 3NNJA 4D0QA 1TMF2 1JHNA 1R1ZA 4DXTA 4XF0A 1RHI1 4P00B 5J37A 3IDCB 1W8OA 5CYYA 1QJX1 4BA6A 3T2PA 4SLIA 1RB8G 3OBRA 1RUI2 1NE6A 4FOQA 2NMOA 3LA2A 1K5MC 5ACA2 2I07B 2BU9A 2C6SA 5D2AA 4WM7A 3HR9A 5A7OA 1IKQA 4LQRA 2D5HA 2R30A 2YC4A 1ENQA 2W52A 2VOKA 1JZ5A 4MGTA 2OIIA 5DUUA 4KU8A 1QXJA 2E6VA 5GLTA 4IERA 4ZZ8A 5C3PA 3RZHA 1GUIA 1Q8PA 2Q1ZB 1CAWB 1QGLA 5FY4A 5T5LA 1CZTA 3OGSA 2FDFA 3AL5A 2WFPA 2QQUA 3E6BA 1BKZA 3K2OA 1R083 1RUI1 3ZFEB 4YVWA 4ET7A 1C8NA 5J98B 1UQXA 3EYPA 1EYBA 5C7GA 1JYNA 5CG9A 2IFWA 3NVCA 1LOCA 2YYOA 3OYWA 4QGMA 5A7WA 3WY6A 2DU1A 1VPHA 2VBBA 1PO21 5DABA 1C5HA 1AJOA 1WCKA 3QBQA 4Y26A 3SC7X 2ARAA 1YRZA 2ILMA 1WMXA 4QX2A 4DFSA 4HVQA 3VBRC 4JDMA 1JMUB 2BGCA 2H6CA 2Q8OA 4LTAA 5I0TA 4YGCA 3ZM8A 1NLRA 2ZGQA 3N9PA 3HT2A 3SH5A 2GNBA 1JODA 2QKDA 4XDOA 1UY1A 5I0UA 1YUDA 2RHPA 2Y8KA 5FY7A 5A33B 2A3YA 2ZS6B 5FPZA 1OBNA 1BQPA 1NY72 2E31A 4HOOA 2VR4A 4HSJA 4LNVA 5EP9A 4CEWB 1AYN3 2V5YA 1V6OA 1JYVA 4OQ8A 2Q1FA 1ND2A 1GZTA 2VTXJ 1V9U2 4E27A 5FBZA 5A3MA 4BHPA 3K51A 1WLTA 4XDPA 1J84A 2HWE2 1R092 3TN92 4X6RB 4BOWA 2R0FA 1EPWA 1RMU2 1W9TA 5GLUA 3T4VA 1SDDB 1D4M1 3OBTA 2UURA 2CU5A 3PVNA 4I0AA 4AEMA 4MXWB 4GAZA 1YNAA 3T1MA 4CCKA 5C3RA 5JPMB 1QOOA 4QX8A 4QX1A 1RUE3 5C5UA 1Z7S3 3JCIA 4JCKA 3HJRA 5I93A 5CKNA 3WF1A 2VVFA 5IK7A 2W08A 1O59A 4Z2WA 1W06A 5FYVA 3P1IA 5IUQA 4F3JA 1IS5A 3K4ZA 4Y24A 1AUYA 2VE1A 2JJ6A 3WNOA 4HPKB 2WWJA 1YHFA 5EIYB 2BDRA 1GKBA 3INAA 4NAOA 2W1UA 1E57A 2RE9A 2XKOA 3VDDB 5JSOA 5FZCA 2W91A 2WKKA 4PLOA 3ZN6A 4RS5B 5C8CC 2AEYA 3KCYA 2WO2A 4ES8A 5KC5A 1K5MA 2D6KA 2G9GA 2AREA 4Q4W3 4AGGA 1SLTA 1CQ9A 2G19A 2ID4A 2JG9C 5A1LA 1T2XA 2J1SA 1H30A 2W1QA 2CYFA 1GWLA 1UX7A 1ASJ3 3MEPA 3PMSA 4G9SB 3ZXLA 4E2GA 3RMYA 1VP6A 1ODMA 3V0BB 3ALQA 4ISRA 3VB9A 3DPRB 1YJKA 2QFEA 3KT4A 3S30A 5L7OC 2CV6A 2D98A 5LBFA 2BVBA 2X53S 3RYRA 1KXGA 3Q8CA 2ZHKA 1OT5A 3B01A 1Q56A 3HEIA 3GBWA 4FPKA 5AFEA 3NWKA 2GAUA 2R32A 4KI5M 1FT9A 4BM8A 5EFUA 4HT1T 1CVNA 1HKDA 2KXLA 1D0HA 3E5XA 1AYM1 3RQ0A 4WBBA 1ZA4A 2B8MA 1PMHX 1OURA 4AHXA 3Q8EA 1QJY1 3Q8FA 4NIHA 4WM8C 2YY1A 4QPGB 5FYSA 1BEV2 1AR83 5A3NA 3OUHA 1DU3D 3AMNA 3I4IA 1OOPB 1XBFA 4Q1RA 4TLGA 3ZYIB 2OW4A 5DN2A 5EWSA 1VRH3 4FXKB 4MLOA 4UW6A 4Q0PA 1GYKA 1RUJ2 1XE0A 1OOPA 4CP2A 1UF2C 1FPN2 2VBDA 2W68A 5FY8A 1J83A 3B93A 3TBDA 4JGZC 3HAGA 3WNMA 1O3RA 1FOD1 2DV9A 2P34A 3AYCA 4DUVA 4B4QA 1FX5A 5FY5A 4AAPA 1VAMA 4JAAA 3TAYA 3WR0A 3LIHA 1HB2A 3ITQA 1LEMA 5IFPA 5HCHA 5JR2A 3DV8A 1AR81 5T50A 2WZ8A 1NQJA 1QJY3 1W8WA 3AZYA 1CN1A 1AR91 1NAEA 4TLFA 5EPAA 2PELA 3RDIA 1HQWA 5KC6A 1LESA 3PJQA 2XHNA 4QQLA 3H3LA 1Q43A 1GWKA 3UGGA 3VKMA 2WA4A 3DYOA 1UYYA 4PHZA 4DXRA 1NE4A 1OQDA 2PLV1 2H6BA 2XL9A 1MS4A 4BH9A 3RZKA 2ZX4A 3ZFFB 5CB7A 5E6HA 3RYKA 3WDYA 5FYIA 3RPQA 1XNTA 2ZAAA 1HXS3 3GJAA 4N53C 1MZFA 5FRAA 4IV3B 4LBJA 1W6QB 2KR2A 5IT6A 2FDJA 4LO6B 1XXNA 2PQSA 1HJFA 3U10A 5ABJC 2QQOA 3M1HA 2PMWB 3R05A 4WVZA 4EWEA 1UOBA 2QVSB 2DUPA 3M70A 1W8ZA 2X05A 3ZIWA 1A8DA 2P17A 4L11A 2XPJA 4EJRA 1BK0A 3VZOA 3EJKA 2YMZA 4Y1XA 3VZMA 3KS7A 5FYUA 2E33A 3HOBA 4Q4V2 1WW4A 4NO4A 2CGOA 5LBBA 3NNFA 4B1LA 4M3CB 1S0IA 5FZ3A 5IVCA 3S57A 3B02A 2WA3A 2I2SA 1WKYA 3WLUA 4NWWA 4COZA 2LTNA 3W9AA 2VMIA 4XUOA 1OI6A 1TNFA 2YROA 3A4UA 4RD7A 1F2NA 2XJTA 2HWD1 3SKJE 4GWJA 2XR4A 1VBE1 3ACIA 4A42A 1O3TA 1HIXA 3DPRC 4M3CF 1OKQA 4FFHA 2XB6C 3VBSB 1DQ1A 2EXHA 2R0HA 2VQUA 4LHLA 1CPNA 4WM8A 3WUCA 4HK8A 2XJSA 4Q29A 2XH6A 3N9LA 2DCZA 1HRI2 3ZXDA 2A5ZA 1PK6A 3OGRA 1S2BA 4A3ZA 4CDWC 2VXRA 1H9WA 4K20A 5KHKA 4OHYA 3THDA 2GSYA 3BGAA 1E5SA 3NRUA 1D2QA 4CDQA 2MEV2 2D5FA 3RJ2X 3MFCA 4C8DA 2FCUA 4LKFA 2G4IA 3O7OA 1TMF3 4FPLA 2XJVA 1ACCA 2R1DA 2JDPA 3I2IA 3D4KA 5A3PA 2WDBA 4J6GA 1LOBA 1OF3A 3FBMA 3FHQA 4O65A 4LE4A 3BKZA 1RUI3 1OA4A 4NHMA 2XQXA 3KT1A 3KMHA 5FY0A 5ACA3 4GMP3 1GBGA 2OT7A 3N3HA 3PURA 4EE2A 4GALA 4EYUA 4YARA 1CJDA 1ND3B 1VIWB 2JIGA 2ZACA 4YM2A 2ZHNA 2FMDA 4LBNA 3RZLA 4CDXC 1PO23 4ONUA 5J96B 2A1XA 2J1UA 1XSRA 2YU2A 1WMEA 3LOIA 4MZUA 2BP6A 1UXZA 1NZCA 3RJRA 4GKXA 3WNPA 5IK4A 3B69A 2WINB 1L7QA 3TEZA 2DFBA 3ZXEA 2ARXA 4YW6A 3USUA 4CUCA 1QH7A 4FPEA 1OFNA 1SEFA 1UMIA 1V6LA 1EUTA 2XMLA 3PL0A 4LBKA 2VOTA 5FZ6A 3WDTA 3IIIA 3P5BA 4CVUA 1MZEA 3CMGA 4LPLA 3N35A 4R9DA 5H9SA 1JUHA 1LOEA 1PMJX 4LLFA 2VCBA 2WIIB 4PLNA 3VBSC 1LTEA 2FD8A 2W39A 3UETA 4YM3A 4LHSA 3UYJA 4CU7A 5KHIA 4YLZA 2VL4A 1SBFA 4DEQA 1DZRA 2Y6LA 5LCWL 1UU4A 4IUGA 5D1IA 1ZA7A 1JUIA 2VQAA 5GZDA 1WW7A 1UO9A 4FQZA 5DAVA 2DVBA 3MGUA 4KGQA 2HEWF 4FOYA 4PBOA 1V9U3 1RUC3 3THPA 5FCCA 1IKPA 4QWNA 1Q8VA 1J1TA 1EUUA 1J59A 1S0FA 3I2HA 5IATA 1JZ2A 2DUOA 1RUF1 3TNPB 2JG8C 2JB4A 1QU0A 5A32A 2B5HA 2UU8A 5LRRA 1S0CA 4YM1A 4YW7A 3KGZA 4R9AA 4XQ4A 2VOXA 5FMOL 1GOFA 3ZFEA 3Q9OA 1Z7S2 5FOJB 2ZGRA 3T4HB 1C1FA 4O9GA 1V70A 2D6MA 2XBO1 3ETPA 3NV2A 1WCDJ 1ZBE3 2LUWA 2O8OA 3CZUA 3J9SA 2WFF1 4IDZA 3CZJA 4XFBA 2AEZA 5CNAA 4OMCA 5DDJ2 5FYMA 3RI8A 5LA1A 2VG9A 3AP7A 1W6OA 1XJAA 2YZ4A 3WV6A 3LGRA 1BEV1 1PO11 1MS0A 1G9DA 1W0NA 2CY6A 1IG3A 2NP0A 3URFA 4AL9A 3I2OA 1UY0A 4DUWA 4E2SA 4EROA 2WAAA 2VZQA 3EBRA 2P1BA 2E26A 3NO8A 1RUC1 3BALA 1U5YA 3AP6A 3QACA 5HV4A 1UZWA 1UPSA 2B45X 4HL0A 5K8SA 3A0NA 1QJFA 2WLQA 4YVSA 5C3OA 3L2HA 1VBE3 2HBTA 4LBLA 2HWD3 3USUB 3WP6A 3OSDA 2AGSA 3S5QA 3ILRA 1M06G 1N1VA 3RNSA 1JZ7A 4XF9A 5K0UB 1JU4A 1Q3EA 4HKWA 5D8AC 2Q4SA 2A73B 4W6WA 5FPLA 2WNVC 4Z8BA 3O1OA 5EQUA 4BQXA 3RZJA 1H1AA 5JR7B 4CZSA 3JD71 3VKNA 3ZLIA 2Q30A 4H55A 1YFXA 4K8RB 1QNWA 3VD9A 5LEKA 2WT0A 3KLSA 2MHFA 4CDXB 3T2OA 3O1UA 1FMD2 4TN7A 3U4SA 4XJ9A 4IE5A 4ATFA 3BIWE 1Z0HA 4ES9A 3C7FA 3UJOA 3H0OA 4PT6A 1C1LA 1COV2 4B4RA 2WQ8A 1J58A 1GICA 1S0GA 3D0SA 4PCRA 4ZXKA 5ANNA 2OS2A 1VR3A 4PF1A 5JWPA 5BPXA 2C26A 4OHZA 4NJ4A 3P3NA 1B35A 2D3SA 2OZJA 4D7SA 2WNOA 4KG8A 1VRH2 3VDBA 4D6RA 1IPKA 2Y6JA 4ZU5A 1GFF2 2HBUA 2D43A 1OLMA 3ZYJB 4DINB 1GWMA 1FPN3 3GZUC 3OD4A 4E8DA 4TZDA 5FIXA 4LO7A 1A6CA 5EJ3A 4FAHA 1CESA 2JENA 1PZ8A 5LB6A 3AX4A 2VH9A 1CIYA 3R4SA 4AXOA 4LBOA 1DGWA 2W1WA 1MQTA 3KD4A 5FZ1A 3FWEA 1AR71 3IB3A 2Y6GA 1S0BA 3VD3A 1RXGA 5K7PA 3KVBA 3R4UA 4A6OA 4BB3A 1F15A 1OPOA 3MDPA 2W92A 4KBZA 2ADEA 2RMU2 3ZXFA 1GOGA 4AZZA 5FPXA 1U12A 1SFYA 4DMIA 1OLRA 1XNAA 5FZIA 4RHV3 4H7LA 2W87A 3C3VA 3MIGA 3W20A 5AC93 1GU3A 5JOZA 4Q2FA 3JUUA 3VZJA 4EN8B 2R6QA 4GH4B 2VTXA 2Z5WA 4URAA 3KV4A 4U2AA 2ES3A 1O4YA 1E5RA 2ZZQA 2VCMA 4Y20A 1NY71 4MG2A 4GWNA 1JZ8A 1EAH2 4I02A 3LDBA 4IEXA 2K0GA 3T0BA 1HX6A 4R4ZA 4A3XA 3R0RA 2R49A 4K1ZA 2ZGTA 2VZOA 3MUZ1 2C5DA 4B29A 1W6MB 5LBCA 2WZEA 1ZYBA 1AYM3 1LGNA 1REEA 4J1WA 5KHGA 4AEKA 2O8QA 5T5PA 3LIGA 4AI0A 1QJX2 1W2TA 1W3VA 1ULDA 1DGLA 3CU7A 4GIQA 5FMBA 1FI2A 4PQ9A 2CAUA 5A6QA 3KV9A 4YFWA 4OI0A 3ZSJA 3C7GA 5DXDA 3POWA 1Y7BA 5J7MA 4ZXEA 1FYUA 4HN1A 5FDBA 1GNHA 2VY0A 4RYDA 4NN0A 5FBJA 1VBC3 2VUJA 3ZSMA 4AE2A 2VGDA 1COV1 1RVF3 3OY8B 5A70A 1W6NB 5HXVA 3JZVA 2ZEYA 2ZEZA 4DEVA 4KG0A 5I0RA 2IFRA 2P4EA 2BNOA 2VMCA 3AC0A 1A8MA 4Y5TA 3T0DA 2GN7A 2R1BA 4PDWC 1H8TA 3KF5A 4PJYA 2YV8A 4META 4QPIB 3OUJA 4FO9A 4EN9B 3FL7A 4P9LA 5ERLA 5G05L 3N7KA 1AF9A 1B35C 2GDFA 4B7EA 2UY9A 4ZU4A 3N9MA 3HWJA 2Q5TA 4K9SA 4B3NA 1WMFA 3TEYA 1CAUA 4PIZA 1UXXX 4AAXA 3K48A 4AOCA 2MEV3 2RS11 4IEQA 4B7KA 3NMBA 1UD1A 2PAEA 1O5LA 5B4NA 1DP0A 1F35A 1V6KA 4MVTA 1GZWA 1G9BA 4AQ2A 3KT7A 2VM9A 1DG6A 1ST8A 2E63A 2F4LA 4AYUA 3VBUC 1RUE1 1SFNA 3VKLA 1RXFA 3AKQA 4ZS2A 5GJ6A 4XE9A 4JRAA 1NQDA 2LROA 1LODA 3ATGA 4KMQA 5FZFA 3AFGA 4L99A 1N1YA 2MEV1 4GD4A 3DECA 4L97A 2VZ1A 2ZABA 5BNOB 5A6ZA 1ZRIA 2KM2A 2HYXA 3ZXGA 4YVSC 1O4ZA 1PO22 1VBB1 1ZBA3 3WX5A 1BVVA 3AMMA 1AR63 1OD5A 2NLRA 3GALA 5FYHA 1LGBA 3M8LA 4CCCA 2ZXQA 2BGPA 3IDEA 4IV3A 1JXNA 3IMMA 4I2OA 2MNGA 2Y33A 5IYYA 3NW4A 2J1EA 5LW9A 2L9LA 2DCYA 1PX4A 3I2FA 2GN3A 2WZR2 2AACA 3ASIA 2Z69A 2E51A 3DN7A 3EMRA 5FLHA 2RS13 4FCAA 1H0BA 2JECA 1B09A 1UMHA 4NVPA 3TYJA 3WDXA 5E89A 4GZ9A 4NHYA 1PO12 3VBRA 2AR6A 5JSPA 1TZOA 1KDMA 1EP0A 1XSQA 4H2AA 2HWF1 3HIFA 4QB6A 4C90A 3SNMA 4AEDA 2CAVA 4KU7A 1AR73 1IZ3A 1XPWA 3ST7A 4ZHNA 1HRV3 2GMPA 4BLIA 5IAXA 2EXIA 3OY8A 2IWGB 2RS51 4GB33 3IDAA 5KXDA 3WG1A 4CP0A 3KHCA 4HXCA 1NKGA 1MEC1 1JW6A 2QDNA 3VGIA 3IN9A 3M2MA 4LMFA 1MZ5A 2DYCA 2B7YA 1QJU3 1PX3A 4OZXA 3I54A 3K3OA 3LWCA 1AXKA 2PTMA 3CJXA 4MHRA 1LEDA 4Q4Y1 1BHGA 5CKQA 4YWAA 2D93A 2UWCA 3I3DA 3SHRA 5K9YA 4R52A 4GWIA 4YVWB 1HB3A 3UJQA 3NV1A 1MEC2 4ZY9A 1W39A 4M3CE 4XABA 2G9FA 2A6XA 2B46X 3E5QA 3T1LA 3WVJA 4QAWA 4CCOA 4IEOA 4BK5A 5AC91 4M0NA 5LA9A 4XMAA 4N53B 1H1MA 4DNYA 4X8NA 4BCUA 1WCUA 1FV2A 3JB4C 1NXMA 3BB6A 4V1PA 1WLCA 3H1YA 4XC9A 2BUKA 2PHUA 4UBGA 2RDSA 1UOFA 3PLQA 4LKEA 2UWAA 4N7IA 5AVAA 5FZOA 5IVYA 5SV8A 4IESA 2YBPA 4QPGC 3V0AA 3J7HA 4QMAA 2BBVA 1KITA 3AMPA 1UU5A 3CHXA 5KBFA 4M3CA 2BYVE 4XXPA 1MS5A 1NCRA 3ZDVA 2P3KA 1CAVA 1VBE2 1WBLA 2TNFA 4ASLA 1OVSA 3QH7A 4P02B 1URXA 5DUXA 4HKLA 2HH9A 5BUVA 3ZPOA 4FPYA 3U75A 5GZGA 5FO8B 4RS5A 3ZYPA 4LBQB 3GJBA 4IEVA 4NR1A 1W2NA 1CPMA 4UFIA 1G7YA 4GH4C 4IE6A 3MLJA 4RQPA 4HVOA 1LNSA 3WEZA 1X8MA 2VBPA 2VMEA 2WZR1 1VB2A 3AZVA 5HPOA 3NKTA 4OMDA 2ZX1A 4MH0E 5KR7A 4AWDA 1LR5A 1G9AA 5DMYA 2BOIA 5F5CA 4FP3A 1PVC2 4BXFA 5J36A 3UKVA 3RS6A 2EAAA 3FLPA 3UESA 4FTSA 3BIEA 4CCNA 4MSVA 5F39A 2FDHA 4NPRA 4M4RA 4R8HA 1POV0 4MGKE 1AX2A 5A32B 4UYBA 3F95A 1YQCA 1DZTA 2ZCWA 3ZYFA 4QPYA 1GP6A 3JU9A 3AP9A 3VBHA 3V0AB 2VAUA 1W2UA 3LSEA 1PGW1 4KWKA 5LA0A 1XYPA 4JGYC 4LA2A 2LM3A 1F4AA 2P3JA 2GNMA 1ONAA 2RS52 1RJ7A 3WP5A 4KWUA 4N9IA 5GKAC 2HWC2 5FKBA 2BWCA 2GMMA 2QTWB 5L7OB 4GA9A 2WO3A 2Q0AA 5JOYA 1XYOA 2K46A 3LEGA 3WNXA 1H1IA 4A7YA 4DZGA 5EJZB 1KQRA 4LK6A 4UW4A 4KQ7A 4E4HA 3AVRA 4QHZA 5HCFA 2GH8A 1UZ0A 1W9WA 4JGYB 3C7HA 3GBFA 4EWAA 5JXGA 4XQDA 1UYXA 2VOVA 5LRSA 3T09A 3VZKA 5AC92 4OI4A 3O12A 4JVAA 4G4FA 3RSJA 4AI8A 2PFWA 2OQ6A 1VAKA 1LHWA 1MS3A 2DUQA 2RG4A 3LCPA 4XCBA 4I0WB 4LLOA 4XFGA 4C0BA 3MICA 5ABJA 5ACA1 5JPNB 3KV5A 5CFCC 4XW3A 3A23A 4XUNA 4XCAA 4D7YA 2KA3A 5H9PA 3AXEA 5IW0A 3WNKA 3ZMNA 5BNOA 4V2VA 2C1FA 1VLNA 1O6UA 3ZYHA 2V4VA 5CADA 1S4CA 3M3IA 4LUMA 5FWEA 2OKXA 4QDSA 3R4DB 3ZPYA 3IMNA 2BPA2 1JBCA 5C8WA 1AL22 1AX1A 1JTZX 2CWMA 5K0UA 1BYHA 3B9IA 2VMDA 5CBLA 1QDOA 2D6PA 3ILFA 4D69A 1VRBA 1SPPA 3AKSA 2NQYA 1OQ1A 4XBLA 1PNFA 2VZ3A 2IVIB 3MV11 3LA3A 1UMZA 2XJQA 1FAYA 1V6NA 2VPVA 1TNRA 4N43C 3BCWA 3ES4A 3BPZA 4FT8A 1WA4A 4CSWA 1ZZCA 2WNUA 1GP4A 2WS91 1S0DA 1AL21 3PMEA 4IEZA 5FTTC 4BJ0A 2PHRA 2Y64A 2OPWA 1DYPA 4OCTA 2C0ZA 3EO6A 2J1RA 3J26N 1CGPA 3ZSEA 4CP1A 2JKXA 5F2SA 1F9KA 4QQPA 1W6OB 3JBG2 3H7YA 3J8F2 2D6OX 3P6BA 3PTRB 3IM0A 3MLKA 3WQBA 3I3MA 3KSCA 4LOTA 2A70A 4A45A 2W94A 5BNQA 3UKNA 2CGPA 5FZ7A 1IS6A 2VNRA 1VJ2A 1YQ6A 4NPLA 5FXVA 2SLIA 3GYDA 2EIBA 2OQ7A 3IWZA 2PYTA 3W21A 1UKGA 4CUAA 3BOPA 1S0EA 1XNCA 4LORA 4OI2A 4MXWA 1VMJA 4CRQA 2P37A 1KJRA 4NAMA 1UPIA 4UFLA 3I7DA 3MW3A 3THTA 3ECQA 1LHUA 2R072 1CR7A 2VUAA 5BNNB 1X9TA 2DVGA 1FATA 3OGJA 4CEWA 1C8M1 1UY2A 5C3QA 1QJY2 2OX0A 1X50A 3NV4A 2HWB3 4FOVA 1JOBA 4GMP1 4CA9A 3G6JB 1AR62 4XJZA 1LRHA 4S2DA 3JXSA 4DUXA 2ZGUA 4XAEA 1HXS1 4QU2A 3RWNA 3E6CC 1RUNA 5AFBA 1ZZ7A 3U11A 1VBA3 2RDRA 3PVBB 4LHNA 2GH2A 4NIAA 3NJVA 2YDEA 1N3PA 2Z79A 4MO3M 2GP3A 2NMNA 4UI9L 5LY2A 2E7AA 2WFF2 4YVSB 2XWBB 4TXWA 5C9AA 1N3OA 1WA6X 2WQ4A 5EJ1B 4BQ1A 3PIGA 1W90A 1SPPB 5F6KA 1HXS2 1RUD3 2YPDA 1C57A 3T2QA 3C7OA 1L7RA 4BQ4A 1I5ZA 2IXJA 1YQ8A 4AHYA 4AEDC 2IXIA 1YI9A 3PU3A 4P08A 4M01A 3CO2A 1GSLA 1UOJA 2NZ9A 1YJLA 4W8JA 3CJIB 4OHVA 4MHUA 1RUF2 4MYEA 2A7AA 2RR13 1HRV2 2D6LX 1W8NA 3ON7A 2ZX0A 4U36A 2ZEWA 1QXRA 4QB2A 4BWOA 4CDQC 4GB32 4Y1UA 4N43A 3QD6A 4NIIA 3B3QE 4XFHA 3VDCA 5FOBB 5F2WA 3MBWA 2VOWA 1O91A 1SFPA 4K7JA 5FZ4A 5F3EA 1KDKA 1OUSA 3ETQA 1LHOA 4I01A 4LUKA 2QQVA 2WSVA 2QQPA 4LT5A 3GZAA 1LHNA 3OYWB 5EV7A 5A7WB 2JWPA 3X29B 4LBMA 4D7TA 2FZ1A 1W6PA 1CAUB 1MEC3 2YFUA 3HNYM 4AGRA 1SDWA 1SLBA 5GM0A 1ASJ1 2GC0A 4GJYA 3LEIA 1SCSA 1O5UA 4CU6A 2J1AA 5FKCA 1L7LA 3WW3A 4BMEA 4HLTA 4CCLA 4X8PA 4AG4A 3MPBA 3ZYBA 1ALYA 4XFCA 3MO4A 3NJZA 3OOXA 3M7AA 4QKDA 4WVWA 3VBFA 3BU0A 1POV1 1J3QA 1F31A 1UKRA 5A1AA 4D94A 1UU6A 4MOAA 4RR3A 4C1WA 4OI1A 2V72A 3TN91 2EVXA 1QJZA 3H3UA 3J7MA 2QQNA 2VJXA 4XHXA 2CWSA 4QQOA 5F5IA 1MS9A 1OSGA 3AZZA 5C6CA 1Q8OA 4TSVA 4XFAA 4IEUA 1G86A 1RHI2 3ZXAC 2WN2A 1OQEA 2LALA 1DQ2A 2RJ2A 2VCCA 3VKFC 2OPKA 5C71A 1HB1A 4IGOA 4NHXA 5JXIA 2JX9A 5FZOB 1WCQA 4DS0A 2JE8A 4CUGA 4FFGA 4IV1A 1SLCA 1S0JA 2HEVF 3EHKA 3N7LA 3HN1A 2ATFA 3IAQA 3B5LB 3IDBB 3KQRA 2R7EB 4MGZE 1H8TC 4W6YA 1BZWA 1ENRA 4UBHA 3HQXA 4JQRA 4A2UA 1RUOA 4INDA 3CNAA 3TRSB 2OUHA 5FMCA 4COUA 1FOD3 2J7MA 1MS8A 3PUQA 4CP9B 1DCSA 4JKLA 2ZPXA 4JQTA 1RUD1 3J4UH 1PVC3 2ZGPA 4RGKA 3U0ZA 4Q8KA 1UAIA 1D2SA 2VCAA 3GM8A 1OXCA 4YW2A 4R9CA 3ZXJA 1DGRN 3N7JA 4XPVA 3T30A 5FUNA 3MPPG 2B9VA 4P9IA 3S7IA 1GQHA 2VZSA 3PUAA 5L9RA 3L9JT 4RGGA 1D0GA 1VBC1 3ME2A 4GB31 4XZPA 4YGDA 2RS53 1C8M3 5K0UC 2R061 2GP5A 5CVRA 3WG2A 5GZCA 4XF1A 1K45A 1QDCA 2J1VA 1AYN1 4H14A 1MQTB 4IQPA 5A3UA 2XXZA 4I3PA 2V09A 3OGVA 3O1RA 1NLQA 1RUC2 1US2A 4CEYA 4AI1A 4CDUC 5KWRA 1PGW2 2IXCA 1NCRC 1QJEA 2WNEA 3RWKX 2XQRA 2EICA 3WP4A 1W9YA 4BQWA 4YRDA 4W50A 4LO5B 4AFBA 5CFCA 3ZFFC 5HCBA 1A3KA 5T5JA 5C33A 5DAXA 4CCMA 3NJYA 4X6QB 4HANA 2DVDA 2FMYA 1K12A 1OA2A 2EXJA 3ZDSA 3HNMA 1FXZA 2ZMNA 2DBNA 5A7SA 1XU1A 3SXWA 2QZ2A 2R041 1RITA 1AR61 1VBB3 5SV5A 1YIPA 3S7EA 2YHJA 4BYYA 3I2DA 3ZFGA 4OUMA 3T08A 2JG9A 2D97A 2RM23 4YZ2A 4AVBA 5C4WC 5HI0A 3FUOA 1QF3A 4WM7B 3PIJA 4IV1B 1DQ0A 4CYDA 1AR92 4HSLA 1CWPA 1AL23 4HK9A 3ZXKA 4AFMA 2D44A 1V0AA 1YYNA 2QZ3A 1JN2P 1JHJA 4QD2A 2XONA 3SITA 1NA1B 2QE3A 1W0OA 1UIKA 4IV1C 3VN4A 5C70A 5J3UA 1XE7A 5A6XA 5FZ8A 3DKWA 2YGMA 1V6JA 4YGBA 4AVCA 5L9VA 2A6YA 4MX3A 5F6LB 2HWD2 4C1XA 5CFCB 3O1SA 1D4M3 4FPOB 5FAXA 1RUG2 4OVEA 1GANA 5DZFA 3I49A 3HD8B 1GP5A 2BQPA 4HONA 2WT2A 5B2GB 4CCEA 5FZLA 4W65A 1HDKA 1NOVA 1OMIA 2D7FA 4ZONA 3ZKYA 2J22A 3AKRA 3NSTA 1U5IA 4O9EA 1DDLA 3PHMA 1DBNA 1HRI1 1X82A 3CDZB 4BISA 2NPIA 1H8TB 5FLJA 1TQ5A 5IAVA 1YCIA 4KBBA 4YW3A 3B94A 4A6SA 1BMV1 4RFT0 3J8F3 1FMD3 1W6PB 2E7TA 3H1MA 1N1TA 2VC9A 3AZXA 4LKDA 4Q5OA 1RINA 3WQ7A 5KXBA 2BNMA 1X8EA 3AJYA 3D0JA 1SCRA 1AXZA 1COV3 4XQWA 2OVUA 3JB8A 2XUEA 2QCSB 4XIKA 3UK9A 1H2LA 3MIFA 3DGTA 2D3PA 4EZ4A 1W03A 3NV3A 3RMXA 4PQQA 2ZGNA 3S0MA 5GLWA 4UFJA 4WV8A 4KNCA 1CAXA 4I09A 2W3JA 3I3EA 3HT1A 3B7MA 2VMHA 2PHDA 4PDWB 4EN0A 5G04L 5DUWA 4AK3A 4XAAA 3OUIA 3ENRA 1EY2A 5A7QA 2HLEA 2R073 1REDA 1UWWA 5T52A 3WHUA 3OEAA 1KGYA 1R1A3 1W9SA 3SMHA 5DAPA 1ULOA 2DURA 3TWIA 4DO0A 3VBSA 2B42B 2QUOA 1Y43B 1I6XA 3E5UA 2PHXA 4Q4X3 2GC2A 3D5OA 1U0AA 5DG2A 1ZRFA 4BDVB 4IXLA 4YM0A 1KRIA 1PIV1 4NPMA 5HXMA 2PLV2 1VBA2 2JG8A 5E8AA 4BIFA 1H2NA 4XF4A 3NAPA 3CEWA 3I59B 5C8CA 3T2TA 2WFF3 2HWF2 2YBSA 2WZPP 1JYIA 3B9CA 4RHV1 4G3YC 5IVJA 3QCWA 1XB9A 4UOJA 4XTMA 3RZMA 3DEMA 1STMA 3GXUA 3N9OA 5A7NA 1RUD2 4AR2A 2GU9A 2YUEA 3GCXA 4MXVA 4WM7C 3NAPC 5GLVA 4JC1A 1O8SA 2Q8DA 4L0PA 1T6BX 4CP9A 3JD72 1HV0A 3AKTA 4BXSV 1EV12 4IETA 3VHNA 1RUF3 4Y4RA 4XMIA 4LITA 1UYZA 1AYM2 1W6QA 2PQQA 2ZTNA 1J3RA 2LW8A 2VXJA 4UFHA 1BBT1 3ZR6A 3VKOA 4Y3OA 3PVOA 3ZVXA 1XNBA 1YXWA 2A3WA 4XJUA 4XJ8A 4YG6A 5E16A 3WSOA 3NKGA 3SEPA 2H0BA 3S5AA 4Y1ZA 2ZGOA 1RUJ1 4HG6B 3A7QA 1L3JA 1RJ8A 3VZLA 1C4RA 4CDWA 1LOFC 4NHLA 1BCXA 5FPAA 5IK5A 2WUHA 3MLLA 5TSWA 2Q8EA 3MHZA 4A7ZA 1Q8QA 4Q4X1 2E7QA 3DL3A 4LEJA 2YC2A 4IV3C 4IGPA 1PK6B 4HVRA 4UAPA 5H9RA 4QU1A 1V00A 3T0AA 3RZZA 2CDOA 4DXZA 2ZHLA 4D6QA 1W2AX 4DY3A 1QWRA 2ORZA 2X10A 3EB7A 3KF3A 4LJHA 4NRMA 2FQPA 4WM8B 1VMFA 2BRTA 4ZKTB 2I74A 3A21A 5T54A 4Y33A 1Y9QA 3J7LA 1KD7A 1DLLA 2JEMA 4S2FA 2H0VA 3BPSA
chains in the Genus database with same CATH topology
3WNMA 4OMDA 2X09A 2VTFA 4FI9A 3PUHA 3C7EA 4DUVA 5DMYA 5IFPA 2VZPA 4A44A 3UESA 5JR2A 4TTGA 2VZVA 2WZ8A 4M4RA 5CZKA 1NAEA 3I2GA 4LKSA 3I2JA 3UNPA 2XHNA 5LA0A 2WYSA 3DYOA 1F4AA 1UYYA 1RYYA 4DXRA 4KWUA 2ZEXA 1H6YA 2EIEA 1CX1A 2WO3A 1XNTA 1JYXA 1GQPA 2B4KA 3LEGA 3A22A 2YG0A 5EJZB 2C4XA 2PQSA 2Z4FA 3VD5A 2QQOA 2WN3A 1UZ0A 1W9WA 3C7HA 4BK4A 2X05A 5JXGA 1UYXA 2QQJA 4XUTA 3T09A 3OG2A 1HN1A 4QDRA 2E33A 3HOBA 3F2ZA 3DYPA 1YQ2A 3ACHA 3A23A 4XUNA 1WKYA 1UY3A 3CIHA 3WNKA 4XUOA 4CUBA 4CU8A 5DPNA 3SKJE 2V4VA 2Y6KA 4GWJA 2OKXA 3ACIA 4A42A 4QDSA 3K75B 1SG3A 1UY4A 3VDAA 2VQUA 3LE0A 2VMDA 4W4ZA 5LA2A 4ZZ5A 5JMOA 3OEBA 4QX0A 4JKKA 2QQLA 2VZ3A 3MV11 3OGRA 1NUKA 3GGLA 4A3ZA 5JXHA 1SHWB 3I3BA 3THDA 3BGAA 3NRUA 4XZUG 3CQOA 4MGSA 4BJ0A 2Y64A 3I2IA 4XVHA 2WDBA 4XUPA 1OF3A 3FHQA 3WNNA 2VZRA 2J1RA 2JKXA 2XQXA 4P5YA 5F7UA 1CZVA 3WF0A 3P6BA 2XOMA 3WQBA 4A45A 3LQCA 2W94A 1DLCA 2EIDA 3I2KA 1OF4A 3HN3A 2EIBA 2J1UA 3THCA 1UXZA 4CU9A 2BERA 4CUAA 3WNPA 1L7QA 1R64A 2JDAA 4CUCA 1UMIA 3ECQA 1EUTA 2DCKA 2VOTA 4MGQA 3IIIA 3WF4A 4CVUA 3CMGA 4LPLA 4ARXA 1PMJX 2VCBA 1D7PM 3UETA 2QBXA 3LPFA 2YB7A 3ACGA 4LHSA 1K3IA 1UY2A 4CU7A 4JX0A 2VL4A 4DEQA 2Y6LA 1CZSA 5LCWL 4IUGA 4DUXA 3JXSA 1O8PA 3NJVA 4MO3M 3U37A 4UI9L 1EUUA 3WF3A 3I2HA 3OB8A 1JZ2A 2WBKA 4TXWA 3NJXA 5EJ1B 5JXJA 3T2QA 2VMFA 1L7RA 3C7OA 4A4AA 3WF2A 2C9KA 1GOFA 4P08A 4W8JA 3VD4A 3ETPA 3CZUA 4ARYA 3CZJA 1MPXA 1W8NA 2RVAA 4OMCA 3SEEA 5LA1A 2ZEWA 4QB2A 5JUVA 3FHAA 2W9XA 3MUY1 2V5DA 3PUIA 4QDQA 3VDCA 1W0NA 3MBWA 5IFTA 3K77A 1UY0A 4DUWA 3W5MA 4MADA 2WAAA 3HNBM 2VZQA 2E26A 1JZ6A 2YFUA 3HNYM 3ABZA 5J1XA 4CU6A 3LEIA 2VO5A 2J1AA 2DDUA 2DCJA 2VZTA 3K46A 4AG4A 1JZ7A 3MO4A 1JU4A 5I0DA 5A1AA 4MOAA 4OUEA 1W99A 2V72A 3IAPA 3LEKA 2QQNA 2VJXA 3VD9A 1GOHA 3WNLA 3T2OA 3BN6A 3W5NA 3K4AA 3C7FA 4PT6A 2BZDA 2WN2A 3NQHA 3OBAA 2WQ8A 2RJ2A 5C71A 2VCCA 2Y6HA 5B4XA 5JXIA 4PF1A 1WCQA 2BBAA 2JE8A 2C26A 3DYMA 3VDBA 3IAQA 2R7EB 2Y6JA 1JZ4A 1I5PA 3FN9A 4E8DA 4QX3A 5IJRA 2J7MA 4JKLA 1CIYA 4OZOA 3E1F1 2W1WA 3IB3A 2WABA 2Y6GA 3VD3A 2VCAA 4A6OA 1GNYA 1OH4A 3GM8A 2W92A 1GOGA 2B9VA 1XNAA 2W5FA 2VZSA 2QQMA 2W87A 1GU3A 1H6XA 1JU3A 1KEXA 4A41A 1US3A 3HPNA 1K45A 1ULPA 2E32A 2J1VA 4RN5A 3T0BA 1DYOA 3C8XA 3OGVA 1US2A 2VZOA 3MUZ1 2EICA 3ACFA 4W50A 2W95A 2WZEA 2QQIA 2BGOA 1K12A 3SKVA 3HNMA 4YPJA 2W47A 3C7GA 1JYWA 3I97A 4ZXEA 4RYDA 4D0QA 4XUQA 4DXTA 3T08A 4P00B 1W8OA 2ZEYA 2ZEZA 5CYYA 2WO1A 3T2PA 4DEVA 2VMCA 3AC0A 2WAOA 3T0DA 1JHJA 4LQRA 2XONA 2YC4A 3FL7A 5G05L 5C70A 1JZ5A 2W1SA 1TVGA 4ZZ8A 1GUIA 1P8JA 1OD3A 4QB1A 1CZTA 1UXXX 3NNGA 3OGSA 4AAXA 3D3AA 1IQDC 4ET7A 5B4NA 4M4PA 1DP0A 3EYPA 5C7GA 1JYNA 2VM9A 5IHRA 2J22A 3CDZB 4QX2A 1JZ8A 3ZM8A 4KMQA 2VC9A 3DECA 1UY1A 2VZ1A 2Y8KA 2HYXA 3VD7A 2E31A 2VR4A 4PQQA 2ZXQA 2BGPA 1JYVA 2W3JA 5IYYA 3I3EA 2J1EA 2YFZA 5G04L 2L9LA 1K42A 1PX4A 3I2FA 1J84A 3K4DA 3CKHA 2HLEA 1UWWA 1F4HA 1W9TA 1UMHA 1SDDB 4QPWA 3OEAA 3LPGA 1KGYA 4GZ9A 1W9SA 2ORXA 2RV9A 1ULOA 4OYUA 2VZUA 4QX1A 4QB6A 3HJRA 2J1TA 1XPWA 3WF1A 4BDVB 1O59A 3P1IA 5HXMA 3IDAA 3K4ZA 4XURA 1NKGA 3WNOA 5EIYB 2W1UA 1GMMA 4DXSA 2KD7A 2W91A 4UOJA 1JI6A 1PX3A 2W46A 3GXUA 1BHGA 2WO2A 1O8SA 4D8MA 4L0PA 3I3DA 2VQTA 4GWIA 4BXSV 4ZY9A 2LS6A 2ID4A 2JD9A 1T2XA 2J1SA 2W1QA 4QAWA 1UX7A 1UYZA 4BK5A 2LW8A 2QQKA 4E8CA 3GDBA 3WSOA 1TG7A 3SEPA 1OT5A 3HEIA 4HG6B 5DQ0A 3A7QA 4KI5M 5FUIA 3J7HA 2WUHA 1XC6A 1PMHX 2YC2A 4JKMA 4UAPA 3T0AA 2CDPA 4JHZA 4P02B 2CDOA 1JZ3A 5DN2A 2ORZA 2X10A 3EB7A 4Z2AA 3A21A 1NX9A 3MV01 1LNSA 1J83A 3WEZA 2VMEA 5HPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNM A;  4OMD A;  2X09 A;  2VTF A;  4FI9 A;  3PUH A;  3C7E A;  4DUV A;  5DMY A;  5IFP A;  2VZP A;  4A44 A;  3UES A;  5JR2 A;  4TTG A;  2VZV A;  2WZ8 A;  4M4R A;  5CZK A;  1NAE A;  3I2G A;  4LKS A;  3I2J A;  3UNP A;  2XHN A;  5LA0 A;  2WYS A;  3DYO A;  1F4A A;  1UYY A;  1RYY A;  4DXR A;  4KWU A;  2ZEX A;  1H6Y A;  2EIE A;  1CX1 A;  2WO3 A;  1XNT A;  1JYX A;  1GQP A;  2B4K A;  3LEG A;  3A22 A;  2YG0 A;  5EJZ B;  2C4X A;  2PQS A;  2Z4F A;  3VD5 A;  2QQO A;  2WN3 A;  1UZ0 A;  1W9W A;  3C7H A;  4BK4 A;  2X05 A;  5JXG A;  1UYX A;  2QQJ A;  4XUT A;  3T09 A;  3OG2 A;  1HN1 A;  4QDR A;  2E33 A;  3HOB A;  3F2Z A;  3DYP A;  1YQ2 A;  3ACH A;  3A23 A;  4XUN A;  1WKY A;  1UY3 A;  3CIH A;  3WNK A;  4XUO A;  4CUB A;  4CU8 A;  5DPN A;  3SKJ E;  2V4V A;  2Y6K A;  4GWJ A;  2OKX A;  3ACI A;  4A42 A;  4QDS A;  3K75 B;  1SG3 A;  1UY4 A;  3VDA A;  2VQU A;  3LE0 A;  2VMD A;  4W4Z A;  5LA2 A;  4ZZ5 A;  5JMO A;  3OEB A;  4QX0 A;  4JKK A;  2QQL A;  2VZ3 A;  3MV1 1;  3OGR A;  1NUK A;  3GGL A;  4A3Z A;  5JXH A;  1SHW B;  3I3B A;  3THD A;  3BGA A;  3NRU A;  4XZU G;  3CQO A;  4MGS A;  4BJ0 A;  2Y64 A;  3I2I A;  4XVH A;  2WDB A;  4XUP A;  1OF3 A;  3FHQ A;  3WNN A;  2VZR A;  2J1R A;  2JKX A;  2XQX A;  4P5Y A;  5F7U A;  1CZV A;  3WF0 A;  3P6B A;  2XOM A;  3WQB A;  4A45 A;  3LQC A;  2W94 A;  1DLC A;  2EID A;  3I2K A;  1OF4 A;  3HN3 A;  2EIB A;  2J1U A;  3THC A;  1UXZ A;  4CU9 A;  2BER A;  4CUA A;  3WNP A;  1L7Q A;  1R64 A;  2JDA A;  4CUC A;  1UMI A;  3ECQ A;  1EUT A;  2DCK A;  2VOT A;  4MGQ A;  3III A;  3WF4 A;  4CVU A;  3CMG A;  4LPL A;  4ARX A;  1PMJ X;  2VCB A;  1D7P M;  3UET A;  2QBX A;  3LPF A;  2YB7 A;  3ACG A;  4LHS A;  1K3I A;  1UY2 A;  4CU7 A;  4JX0 A;  2VL4 A;  4DEQ A;  2Y6L A;  1CZS A;  5LCW L;  4IUG A;  4DUX A;  3JXS A;  1O8P A;  3NJV A;  4MO3 M;  3U37 A;  4UI9 L;  1EUU A;  3WF3 A;  3I2H A;  3OB8 A;  1JZ2 A;  2WBK A;  4TXW A;  3NJX A;  5EJ1 B;  5JXJ A;  3T2Q A;  2VMF A;  1L7R A;  3C7O A;  4A4A A;  3WF2 A;  2C9K A;  1GOF A;  4P08 A;  4W8J A;  3VD4 A;  3ETP A;  3CZU A;  4ARY A;  3CZJ A;  1MPX A;  1W8N A;  2RVA A;  4OMC A;  3SEE A;  5LA1 A;  2ZEW A;  4QB2 A;  5JUV A;  3FHA A;  2W9X A;  3MUY 1;  2V5D A;  3PUI A;  4QDQ A;  3VDC A;  1W0N A;  3MBW A;  5IFT A;  3K77 A;  1UY0 A;  4DUW A;  3W5M A;  4MAD A;  2WAA A;  3HNB M;  2VZQ A;  2E26 A;  1JZ6 A;  2YFU A;  3HNY M;  3ABZ A;  5J1X A;  4CU6 A;  3LEI A;  2VO5 A;  2J1A A;  2DDU A;  2DCJ A;  2VZT A;  3K46 A;  4AG4 A;  1JZ7 A;  3MO4 A;  1JU4 A;  5I0D A;  5A1A A;  4MOA A;  4OUE A;  1W99 A;  2V72 A;  3IAP A;  3LEK A;  2QQN A;  2VJX A;  3VD9 A;  1GOH A;  3WNL A;  3T2O A;  3BN6 A;  3W5N A;  3K4A A;  3C7F A;  4PT6 A;  2BZD A;  2WN2 A;  3NQH A;  3OBA A;  2WQ8 A;  2RJ2 A;  5C71 A;  2VCC A;  2Y6H A;  5B4X A;  5JXI A;  4PF1 A;  1WCQ A;  2BBA A;  2JE8 A;  2C26 A;  3DYM A;  3VDB A;  3IAQ A;  2R7E B;  2Y6J A;  1JZ4 A;  1I5P A;  3FN9 A;  4E8D A;  4QX3 A;  5IJR A;  2J7M A;  4JKL A;  1CIY A;  4OZO A;  3E1F 1;  2W1W A;  3IB3 A;  2WAB A;  2Y6G A;  3VD3 A;  2VCA A;  4A6O A;  1GNY A;  1OH4 A;  3GM8 A;  2W92 A;  1GOG A;  2B9V A;  1XNA A;  2W5F A;  2VZS A;  2QQM A;  2W87 A;  1GU3 A;  1H6X A;  1JU3 A;  1KEX A;  4A41 A;  1US3 A;  3HPN A;  1K45 A;  1ULP A;  2E32 A;  2J1V A;  4RN5 A;  3T0B A;  1DYO A;  3C8X A;  3OGV A;  1US2 A;  2VZO A;  3MUZ 1;  2EIC A;  3ACF A;  4W50 A;  2W95 A;  2WZE A;  2QQI A;  2BGO A;  1K12 A;  3SKV A;  3HNM A;  4YPJ A;  2W47 A;  3C7G A;  1JYW A;  3I97 A;  4ZXE A;  4RYD A;  4D0Q A;  4XUQ A;  4DXT A;  3T08 A;  4P00 B;  1W8O A;  2ZEY A;  2ZEZ A;  5CYY A;  2WO1 A;  3T2P A;  4DEV A;  2VMC A;  3AC0 A;  2WAO A;  3T0D A;  1JHJ A;  4LQR A;  2XON A;  2YC4 A;  3FL7 A;  5G05 L;  5C70 A;  1JZ5 A;  2W1S A;  1TVG A;  4ZZ8 A;  1GUI A;  1P8J A;  1OD3 A;  4QB1 A;  1CZT A;  1UXX X;  3NNG A;  3OGS A;  4AAX A;  3D3A A;  1IQD C;  4ET7 A;  5B4N A;  4M4P A;  1DP0 A;  3EYP A;  5C7G A;  1JYN A;  2VM9 A;  5IHR A;  2J22 A;  3CDZ B;  4QX2 A;  1JZ8 A;  3ZM8 A;  4KMQ A;  2VC9 A;  3DEC A;  1UY1 A;  2VZ1 A;  2Y8K A;  2HYX A;  3VD7 A;  2E31 A;  2VR4 A;  4PQQ A;  2ZXQ A;  2BGP A;  1JYV A;  2W3J A;  5IYY A;  3I3E A;  2J1E A;  2YFZ A;  5G04 L;  2L9L A;  1K42 A;  1PX4 A;  3I2F A;  1J84 A;  3K4D A;  3CKH A;  2HLE A;  1UWW A;  1F4H A;  1W9T A;  1UMH A;  1SDD B;  4QPW A;  3OEA A;  3LPG A;  1KGY A;  4GZ9 A;  1W9S A;  2ORX A;  2RV9 A;  1ULO A;  4OYU A;  2VZU A;  4QX1 A;  4QB6 A;  3HJR A;  2J1T A;  1XPW A;  3WF1 A;  4BDV B;  1O59 A;  3P1I A;  5HXM A;  3IDA A;  3K4Z A;  4XUR A;  1NKG A;  3WNO A;  5EIY B;  2W1U A;  1GMM A;  4DXS A;  2KD7 A;  2W91 A;  4UOJ A;  1JI6 A;  1PX3 A;  2W46 A;  3GXU A;  1BHG A;  2WO2 A;  1O8S A;  4D8M A;  4L0P A;  3I3D A;  2VQT A;  4GWI A;  4BXS V;  4ZY9 A;  2LS6 A;  2ID4 A;  2JD9 A;  1T2X A;  2J1S A;  2W1Q A;  4QAW A;  1UX7 A;  1UYZ A;  4BK5 A;  2LW8 A;  2QQK A;  4E8C A;  3GDB A;  3WSO A;  1TG7 A;  3SEP A;  1OT5 A;  3HEI A;  4HG6 B;  5DQ0 A;  3A7Q A;  4KI5 M;  5FUI A;  3J7H A;  2WUH A;  1XC6 A;  1PMH X;  2YC2 A;  4JKM A;  4UAP A;  3T0A A;  2CDP A;  4JHZ A;  4P02 B;  2CDO A;  1JZ3 A;  5DN2 A;  2ORZ A;  2X10 A;  3EB7 A;  4Z2A A;  3A21 A;  1NX9 A;  3MV0 1;  1LNS A;  1J83 A;  3WEZ A;  2VME A;  5HPO A; 
#chains in the Genus database with same CATH topology
 2XJR A;  5A3T A;  3FBY A;  1LHV A;  5IWF A;  5FYY A;  5C9A B;  4UW5 A;  3PUH A;  3C7E A;  5FP7 A;  4QXH A;  4L92 A;  2P3I A;  2QNK A;  3M3E A;  4WVV A;  3ZN4 A;  1JOP A;  4N9H A;  3RYP A;  2P6H A;  5C5T A;  1NA1 A;  4TTG A;  4MV2 A;  3WXP A;  5HCA A;  5LZ6 A;  1MR5 A;  5CZK A;  5DZE A;  3DXT A;  5L19 A;  1LAJ A;  2AYH A;  4N43 B;  2ZGK A;  4LKS A;  1MQT C;  1W8T A;  4CXW A;  4JGZ B;  3AFK A;  2JG9 B;  3POF A;  3UNP A;  4IL7 A;  2DU0 A;  1OHF A;  5L9B A;  4P5H A;  2WYS A;  3H3Z A;  3IIA A;  4E4Z A;  1RYY A;  5LY1 A;  3RZG A;  2PAM A;  2PAK A;  4ITC A;  1ZBA 2;  4F8A A;  5FV3 A;  1ZBE 1;  5E1R A;  3WCS A;  3ZMO A;  1BBT 3;  1JYX A;  1QXP A;  4JDO A;  1GQP A;  4ATE A;  1WLD A;  1NCQ B;  1KFU L;  3AYD A;  4KWL A;  1YEW A;  1SQ4 A;  1MZ6 A;  3A22 A;  4OUL A;  4XXA A;  4Z92 B;  4FTE A;  2C4X A;  1YFW A;  5C4W B;  3OBZ A;  1Y9G A;  4P9J A;  2WZR 3;  3IT8 A;  1TMF 1;  4HBN A;  4XJW A;  2X5I C;  3CL1 A;  1QY4 A;  2PXJ A;  4KGG A;  3ZN5 A;  4QDR A;  5FZM A;  2VUD A;  4XET A;  1BVP 1;  3VBF B;  3TEW A;  1C8M 2;  3DYP A;  3I8T A;  5IVV A;  1JS9 A;  2VNV A;  3IZO A;  2WNV A;  1YQ2 A;  1AR7 2;  3E97 A;  1GR3 A;  4BPZ A;  4HZF A;  1HLC A;  2HKX A;  2WL1 A;  3LDR A;  5I91 A;  1UY3 A;  3DXU A;  4OFG A;  3WCR A;  1M4W A;  4QXB A;  2VUL A;  5JOW A;  5KHH A;  1A78 A;  2W0X A;  4BLJ A;  2Y6K A;  2WSU A;  5A3O A;  2D3R A;  2A75 A;  1HQN A;  3K75 B;  3EQE A;  4Q4Y 3;  2AH2 A;  3VDA A;  3WQ1 A;  5FY1 A;  3N36 A;  1QJU 2;  2RM2 1;  5LA2 A;  4OHW A;  2UYB A;  4ZZ5 A;  2RS3 2;  4Q0V A;  3J7N A;  4NOT A;  5M0T A;  5JMO A;  1XRU A;  3OEB A;  4QX0 A;  1QQP 2;  4JKK A;  4ORF A;  1RC6 A;  3UKT A;  2Y38 A;  4QPG A;  4S2H A;  3WZ1 A;  4FPH A;  1NUK A;  2C9A A;  3G7D A;  3GGL A;  4YZ4 A;  3J8F 1;  4DY5 A;  5LWB A;  4JTN A;  3D82 A;  1HRV 1;  2XBO 2;  3VDD C;  3CJI A;  2VD7 A;  4DRR A;  1O7F A;  1S2K A;  4MGS A;  1VBB 2;  4BQ5 A;  1QIQ A;  4E4S A;  1PIV 2;  2SBA A;  3VHR A;  4LR4 A;  1SZB A;  1AX0 A;  1QJU 1;  4XUP A;  1APN A;  1TE1 B;  2RM2 2;  4JGZ A;  3WDV A;  4BQY A;  5JCT A;  1VBD 2;  5A33 A;  1I3H A;  1REF A;  2O1Q A;  1XND A;  5JI7 A;  1AR9 3;  5F7U A;  1G6N A;  4P5Y A;  3Q8A A;  4BQ2 A;  1R09 1;  4N7U A;  1X33 A;  3I59 A;  4Q0U A;  4RS5 C;  5C8C B;  1H2M A;  4CDW B;  3BOW A;  2EID A;  4DIQ A;  1OF4 A;  4I3G A;  2O14 A;  4DQA A;  4P9X A;  2ZGS A;  5IVF A;  1XU2 A;  4LHK A;  4OQ9 A;  4CPB D;  1RUH 3;  1IPS A;  4MUV A;  1ND3 C;  4YGE A;  1Y3T A;  2BER A;  4CU9 A;  5L36 A;  1G9F A;  3MID A;  4IE7 A;  4TYS A;  1EPZ A;  3OPT A;  3TB0 A;  2XLG A;  1SLA A;  4Q27 A;  4CCJ A;  1R64 A;  2RJK A;  3O0V A;  2ZOE B;  1PGS A;  2FCV A;  2JDA A;  2G1M A;  1W05 A;  3S6P A;  3FFQ A;  1W2O A;  5KXC A;  3BYW A;  4CEW C;  3LFI A;  2DCK A;  4MGQ A;  1UOG A;  2A6Z A;  1H2K A;  1POQ A;  2DVA A;  1XYN A;  3DCQ A;  3WF4 A;  3WIN E;  4RR3 C;  4AQ6 A;  4ARX A;  5APA A;  1PVX A;  1SMV A;  1RGS A;  1MVE A;  2BV4 A;  2YB7 A;  3EXU A;  3ACG A;  4AHW A;  5JSR A;  1CAX B;  1K3I A;  1WD3 A;  2WJS A;  4JX0 A;  4XIL A;  1JOJ A;  4UF0 B;  3GCW A;  2DFC A;  4NIG A;  2RJL A;  1J3P A;  5CA6 A;  1EV1 1;  1VRH 1;  3MYX A;  1YQ5 A;  2BEO A;  3VBO B;  3ZX7 A;  2P2K A;  2A6V A;  2ZJC A;  4C91 A;  1S55 A;  4NRQ A;  3POY A;  4NRP A;  3U37 A;  2ARB A;  5FMO S;  4CDX A;  5CFD B;  1ZX5 A;  5JXJ A;  2ZKN A;  2HWC 3;  2Q1M A;  1SBD A;  2WR9 A;  1DFQ A;  5IVE A;  2R06 3;  5JLV A;  2FBE A;  1AZD A;  1R1A 2;  5FMD A;  3GHN A;  1T6G C;  3WF2 A;  4XAC A;  3OPZ A;  2C9K A;  1RVF 1;  5JAX A;  3BVC A;  1DIW A;  5LAT A;  4AI9 A;  1WWY A;  1GLH A;  2AC1 A;  3VD4 A;  4Q4X 2;  4ARY A;  3FX3 A;  4L2N A;  1W8H A;  2JD4 A;  3SIS A;  5CFD C;  2DBI A;  1HB4 A;  2RVA A;  1IHM A;  3ZFE C;  4AVT A;  2ZA9 A;  2PLV 3;  3CJI C;  5L73 A;  5JUV A;  3B00 A;  4P9G A;  4RA0 A;  1NCQ A;  3OD0 A;  2QJV A;  3PUI A;  3RI9 A;  4Q4W 1;  4YVW C;  1CIW A;  3ZN6 B;  1UL9 A;  2CNA A;  2JIC A;  4EWD A;  5IFT A;  5JZG B;  1I1E A;  2CGN A;  2HWC 1;  4QQ2 A;  4AI3 A;  4AVS A;  1Z7S 1;  5C9A C;  2PA7 A;  1RL3 A;  1YFY A;  1ZM1 A;  2ADD A;  4XDQ A;  1GZ9 A;  1Y9M A;  2WRA A;  2EA7 A;  2TUN A;  1OUX A;  3JD7 3;  1AHS A;  2ZBJ A;  2ZHM A;  4WZC A;  5CKM A;  3D8C A;  4F83 A;  1CAW A;  3MZH A;  5CG8 A;  1EV1 3;  1UX6 A;  3ABZ A;  1MVQ A;  3FMG A;  5J1X A;  4HKO A;  4Z1V A;  4R4X A;  2EIG A;  4YZ3 A;  3WW1 A;  1WW6 A;  4YSF A;  3SCH A;  3VBU B;  4IE4 A;  5GAL A;  1ENS A;  2N7G A;  5I0D A;  2JDM A;  3M3C A;  4V2W A;  3W58 A;  2YBK A;  1W99 A;  4HN0 A;  2RR1 1;  1GNZ A;  3POS A;  4XF3 A;  4AHZ A;  1F8V A;  4EN6 B;  2I45 A;  3LEK A;  3H42 B;  5D8A B;  4CXX A;  4DOU A;  2GC3 A;  2BFU S;  3WNL A;  1LU2 A;  3A0K A;  4UWD A;  3DKQ A;  2XUM A;  2Z2S B;  3GBG A;  4K6B A;  5FYC A;  3BN6 A;  3W5N A;  3K4A A;  4EN7 B;  2BZD A;  3OBA A;  3NQH A;  5FUP A;  5JDB A;  1POV 3;  2Y6H A;  4IEY A;  3SQO A;  2JKB A;  1RUH 1;  2BBA A;  3DYM A;  3ZIX A;  1QOT A;  3JBG 3;  1OLM E;  4JZR A;  5FFO C;  4N53 A;  2X5I B;  1W6N A;  4AQS A;  3ELN A;  4Z07 A;  2Y6F A;  4CEY C;  1VBA 1;  1PM7 A;  1JZ4 A;  1ZZ8 A;  2PHF A;  1N3Q A;  4M0H A;  3JQW A;  5FR3 A;  1YO8 A;  3UGH A;  4XFF A;  1R09 3;  3N9Q A;  5CIR A;  5IJR A;  3TN9 3;  1MS1 A;  3HMY A;  1ULF A;  1DQ6 A;  1RMU 3;  4UXA A;  1VMH A;  5DAQ A;  4I30 A;  3T3Y A;  3E1F 1;  3POI A;  1WBF A;  4DB5 A;  2VW2 A;  4IGQ A;  1RUE 2;  3RG0 A;  1DYK A;  1NLS A;  4FAG A;  1W0P A;  3H8O A;  1ZZ9 A;  1OFS A;  4XHB A;  2DTW A;  5CEH A;  1BMV 2;  3O1M A;  4RSU A;  3ZFG B;  2G9Z A;  4PIX A;  4COW A;  5HV0 A;  1WMD A;  2A71 A;  2HWB 2;  3WDU A;  2JE9 A;  2VW1 A;  5FP9 A;  1US3 A;  3HPN A;  5FZ0 A;  3O1P A;  1PGL 1;  4B8E A;  1CAV B;  1ULP A;  3DPR A;  3OTF A;  1XE8 A;  1DYO A;  3CLP A;  1DZQ A;  1YI7 A;  3C8X A;  1H9P A;  2CTV A;  2CSG A;  1SLI A;  3K3N A;  3KM5 A;  4ASM B;  4COV A;  3QLQ A;  5BNO C;  2XJP A;  5HBA A;  1PHM A;  2YGL A;  5FPU A;  2QQI A;  4MGI E;  1PGL 2;  2BTV C;  1ASJ 2;  4D6S A;  2IC1 A;  2BNN A;  5I8T A;  2HWB 1;  3D6E A;  2IVJ A;  1OLQ A;  2NN8 A;  4WVM A;  4YPJ A;  1O4T A;  2W47 A;  4HPK A;  4Q26 A;  1XQN A;  1AVB A;  5F8P A;  2Y26 A;  5L7O A;  3NNM A;  3SH3 A;  2RR1 2;  1PZ7 A;  4BZ4 A;  3VBO C;  1WW5 A;  4FPF A;  3WW2 A;  4XUQ A;  4YZ1 A;  1QMJ A;  3LOB A;  5D21 A;  2HYK A;  3LEM A;  3OPW A;  5FRE A;  1KJL A;  3VBF C;  4COY A;  2WO1 A;  4LOS A;  1B35 B;  2TEP A;  5DUV A;  2WAO A;  4Q4Y 2;  1BEV 3;  1ZRR A;  1JYC A;  3BU7 A;  1UZY A;  5JVV A;  3UGF A;  3WP3 A;  4BMB A;  1BK1 A;  4IEW A;  3MIE A;  3LFM A;  3HBZ A;  4Q4V 1;  1UZZ A;  1NYW A;  4D3W A;  4Y5S A;  5I8S A;  2FDG A;  1QQP 3;  2CL2 A;  1OA3 A;  1TVG A;  2F6B A;  2W1S A;  3HQR A;  5F5Q A;  5H9Q A;  1P8J A;  3VBH C;  1OD3 A;  4QB1 A;  4P9W A;  2UY8 A;  1W04 A;  3MIB A;  5A80 A;  1CJP A;  3NNG A;  3RGB A;  1ZRD A;  3GHM A;  1S1A A;  1TME 1;  3NNL A;  2JE7 A;  5BYN A;  3D3A A;  1IQD C;  1PIV 3;  3HBK A;  2VVE A;  4Q1P A;  4M4P A;  1H4G A;  3VBR B;  5IHR A;  4Y5Z 0;  2P6C A;  3VL9 A;  1VBD 3;  3OCP A;  4RFR B;  5CFD A;  4FSJ A;  2WYF A;  1SLL A;  5FP8 A;  3W59 A;  3POJ A;  4NWV A;  4PI0 A;  1LKN A;  2VU9 A;  4Y22 B;  1AXY A;  4RQP C;  2BFU L;  1LJ7 A;  1DF0 A;  3KB5 A;  3M3O A;  1TME 3;  1ULC A;  4QHO A;  5FZE A;  1RHI 3;  3USS A;  5IK8 A;  4BU2 A;  4LUL A;  5F9T A;  2IUW A;  4Y22 A;  4HMZ A;  2HEY F;  3VD7 A;  3DF0 A;  4JV4 A;  4WZF A;  3PUS A;  1LB2 A;  5A3W A;  4AVV A;  1IS3 A;  1ND2 C;  2AZ5 A;  3PVE A;  3AYE A;  5BNN C;  3TEX A;  4QKF A;  4KL1 A;  1QH6 A;  1N1S A;  1VBD 1;  3PTY A;  1ZZ6 A;  1UIJ A;  2BVV A;  3MW4 A;  2YFZ A;  1XOY A;  3CF6 E;  1W6M A;  2OUJ A;  4O61 A;  4XFI A;  1K42 A;  3K4D A;  3SLI A;  3CKH A;  5FQ0 A;  4RQP B;  3KCC A;  4BE3 A;  2O0O A;  1FOD 2;  1F4H A;  3KGL A;  1QOS A;  4NUB A;  5FXX A;  4QPW A;  3VLB B;  3LPG A;  1FMD 1;  1C5I A;  1HQL A;  2ZMK A;  4LO8 A;  4PF5 A;  4J1X A;  5FP4 A;  1GZW B;  1LUL A;  2ORX A;  2RV9 A;  5ISL A;  1QQP 1;  1AJK A;  4E2Q A;  4OYU A;  4LK7 A;  2VZU A;  3JQX A;  4Q4V 3;  5ABJ B;  2AEN A;  4QXK A;  3ZYG A;  2J1T A;  1ZRE A;  5A6Y A;  2JG8 B;  3WG4 A;  3IPV B;  1O3S A;  2WS9 2;  1RMU 1;  4YW5 A;  1OH3 A;  4XUR A;  1V6M A;  2JDH A;  3VUO A;  2W2I A;  3AK0 A;  1F5F A;  3C2U A;  3U14 A;  4AVA A;  1LEC A;  4Q0Q A;  3ZSL A;  4OLL A;  2GNT A;  1GMM A;  1UCX A;  4DXS A;  2FZ2 A;  4QHB A;  2KD7 A;  3N7M A;  1JI6 A;  1Y4W A;  2W46 A;  1U5X A;  3AJZ A;  3AZW A;  2E9Q A;  4ZU7 A;  4YG0 A;  5FK8 A;  4GUL A;  4XIO A;  4CTE A;  3ZYR A;  4D8M A;  1W28 A;  3H1W A;  2UWB A;  4RL7 A;  2VQT A;  5EYY A;  5FPV A;  5F1R A;  2FHR A;  5I0S A;  3GF6 A;  2LS6 A;  4JHT A;  2RDQ A;  2JD9 A;  3ES1 A;  4QX5 A;  1TEI A;  1KFX L;  2OXB A;  3O1T A;  1W8U A;  3VBO A;  3PNA A;  2QQK A;  3N4M A;  1BLZ A;  1X9P A;  4E8C A;  2GND A;  3WW4 A;  3QOP A;  1R1A 1;  3GDB A;  1HW5 A;  2ZGM A;  2IXL A;  2WNU C;  4L8Q A;  5FYZ A;  1TG7 A;  5LK5 A;  3ILN A;  3H8X A;  3VDD A;  2R07 1;  3ROU A;  4NHK A;  2PN5 A;  3AMH A;  5DQ0 A;  1LGC A;  4CE8 A;  3POG A;  5FXZ A;  4N8M A;  4LE3 A;  3LSD A;  4QPI C;  1OPM A;  1PK6 C;  3MF9 A;  5FUI A;  3VV1 A;  2V73 A;  3LZZ A;  1XC6 A;  4OHX A;  2ZAH A;  4JKM A;  3ZR5 A;  5BNN A;  3BTA A;  4CDU A;  2XHK A;  4WVM B;  2CDP A;  4JHZ A;  2XVG A;  2YXS A;  1Q8S A;  2RMU 1;  1JZ3 A;  3N9N A;  2IZW A;  4GQ7 A;  2PHT A;  4Z2A A;  2AUY A;  1F5J A;  4LO4 B;  4XBQ A;  1SAC A;  1NX9 A;  2V4A A;  2P5B A;  3MV0 1;  4F7Z A;  2QQW A;  1H4H A;  1ULG A;  1LEN A;  2IXK A;  2RDN A;  4KH9 A;  3LF7 A;  3NAP B;  4AGV A;  5KHJ A;  2XKP A;  1D4M 2;  2XG3 A;  4C0H A;  1O3Q A;  1RUG 3;  5EYX A;  2Y34 A;  1HN0 A;  2VTF A;  2X09 A;  4FI9 A;  2WQZ C;  5JIA A;  1UNB A;  3ORJ A;  4ZPI A;  2ZX3 A;  3SCF A;  2VZP A;  4A44 A;  4E4D X;  1LOG A;  2XLA A;  1HJG A;  1ZBA 1;  4XEZ A;  2VZV A;  4K1Y A;  5FK7 A;  4AI2 A;  2XVK A;  5CAZ A;  3JBG 1;  3LB9 A;  3KCX A;  1W9F A;  3FC0 A;  4BIO A;  3WDW A;  3I2G A;  3I2J A;  4QKN A;  5FZH A;  1PVC 1;  3FFZ A;  2BOJ A;  4S2G A;  4FQ4 A;  4Y1V A;  3WUD A;  3U78 A;  5ANQ A;  5JOX A;  2B9U A;  2MPF A;  3AKP A;  4QQH A;  2J42 A;  3H7J A;  3VBH B;  2NM1 A;  3PU8 A;  1KS4 A;  2ZEX A;  5BXX A;  1H6Y A;  2ENR A;  4FTB A;  2Q8C A;  2EIE A;  1CX1 A;  4Q8L A;  3U4X A;  3AP5 A;  3O5S A;  1H8V A;  2B4K A;  4IE0 A;  5FZG A;  4FPC A;  1JH5 A;  1QHD A;  4CPB A;  4AQT A;  2YG0 A;  5FXW A;  3O0X A;  2D40 A;  2Z4F A;  3VD5 A;  4NID A;  2ARC A;  1UN1 A;  1E5I A;  4W6X A;  2WN3 A;  5F3I A;  2R04 3;  3V56 A;  4JTO A;  2JB8 A;  1ZBE 2;  2QDR A;  5EZW A;  4BK4 A;  5FY9 A;  2PHW A;  5CU1 A;  1PM4 A;  5FWJ A;  4CXY A;  2QQJ A;  4XUT A;  2B39 A;  1UYP A;  2GME A;  2X5I A;  4QGN A;  3IBM A;  5DDJ 3;  3OG2 A;  1HN1 A;  2TBV A;  2JXA A;  4IEP A;  2WNV B;  4FFF A;  1GV9 A;  1ZNP A;  3KWV A;  4A7K A;  3F2Z A;  4PLM A;  3WG3 A;  1C28 A;  2ZX2 A;  4RGA A;  4AW7 A;  3ZFF A;  5F5A A;  2WC2 A;  3ACH A;  5FP3 A;  4GKY A;  5GZF A;  5LBE A;  4FP2 A;  2WNU B;  3CIH A;  3FLT A;  4JRL A;  5LAS A;  4CUB A;  4CU8 A;  3U07 A;  5DPN A;  3OGG A;  2VVD A;  4GXL A;  2HWF 3;  4LIU A;  1BXH A;  2BW8 A;  3P3P A;  1SG3 A;  1UY4 A;  3LE0 A;  4PIY A;  1LCL A;  1FNZ A;  3LAG A;  1V6I A;  1R08 1;  5BV6 A;  4GMP 0;  4W4Z A;  1LU1 A;  3FUQ A;  4LA3 A;  1GQG A;  4Y4Y A;  4EQV A;  2LRP A;  2QQL A;  3AXD A;  4L9B A;  1MAC A;  4QX7 A;  5EHD A;  1LOF A;  4YW4 A;  1YWK A;  3ACL A;  3TNQ A;  2VEC A;  3V65 A;  4CDU B;  3CBN A;  5JXH A;  1NCQ C;  1OVP A;  1SHW B;  1ZZB A;  3PDQ A;  3I3B A;  2FCT A;  4XOG A;  2A6W A;  4Z82 A;  5C3S A;  4XZU G;  4LIV A;  5A3L A;  5DDJ 1;  5F3G A;  4FPG A;  1R08 2;  3CQO A;  1HV1 A;  4FPJ A;  1E5H A;  4H7M A;  3ZKU A;  2XL7 A;  4XVH A;  1YC6 1;  5FZ9 A;  3WHT A;  3WNN A;  2VZR A;  4AFC A;  3H50 A;  1WD4 A;  2JDK A;  4BQ3 A;  2ET1 A;  3GZE A;  4H3W A;  1UW8 A;  4GH4 A;  2EXK A;  2IXH A;  1OOP C;  5T55 A;  1CZV A;  4FVV A;  2JDZ A;  3WF0 A;  2XDV A;  5GZE A;  2XOM A;  3LQC A;  3I2K A;  1DLC A;  2WWU A;  4ASK A;  3AL6 A;  4I0B A;  5FZB A;  5T5O A;  3HN3 A;  3FJS A;  3L2Y A;  1IGO A;  4YZ5 A;  4NMI A;  4QM8 A;  5FJK A;  2PHL A;  1YIF A;  3THC A;  4AED B;  4URT A;  1QKQ A;  1RIR A;  1ODN A;  2JIJ A;  3FHI B;  3LA7 A;  1AYN 2;  1D4V B;  2BWA A;  4LBQ A;  2OZ6 A;  4AEJ A;  4JDN A;  2ZKL A;  3V0B A;  2HWE 3;  2RMU 3;  3MIH A;  2X29 A;  3R6S A;  3OJB A;  4UW3 A;  5IVB A;  1DGW X;  4K21 A;  3POB A;  4RHV 2;  2ERF A;  2YPJ A;  3IPV A;  1RUG 1;  1WUV A;  4QM9 A;  4CCD A;  1TME 2;  1D7P M;  2XGX A;  3VZN A;  2OA2 A;  2QBX A;  3LPF A;  2ZGL A;  5D8A A;  1IOA A;  1KS5 A;  1CON A;  1PMI A;  2XLF A;  4LXL A;  4QXC A;  5J48 A;  1FNY A;  1CZS A;  1Q5O A;  3M3Q A;  1ENX A;  2GZW A;  1EAH 3;  4LBQ D;  5FPB A;  3FZ3 A;  2GC1 A;  5FLI A;  4B1M A;  1O8P A;  1ZVF A;  1FV3 A;  5K4L A;  1ND3 A;  4O7X A;  2YC0 A;  1IQA A;  4FOW A;  3SCG A;  3H9A A;  3OB8 A;  3WF3 A;  2WBK A;  5I8Y A;  2VNG A;  3KZ4 C;  3NJX A;  4J25 A;  3KHB A;  4YNI A;  1DHK B;  2ZZJ A;  4YG3 A;  3UL2 A;  3KV6 A;  1BBT 2;  3WQ0 A;  1LOA A;  2VMF A;  4A4A A;  1QJX 3;  2UYA A;  4UT5 A;  1IPJ A;  2XWJ B;  1IG0 A;  3O1V A;  3ZSK A;  4E9K A;  3AMQ A;  4Q4W 2;  1YLL A;  3UT0 A;  1NCR B;  2DCT A;  3POE A;  4QKB A;  2VNO A;  5KXE A;  2OYZ A;  1G9C A;  1X36 A;  4K8F A;  1ULE A;  1GZC A;  4ISQ A;  1MPX A;  1DGR A;  4PI2 A;  2WS9 3;  3SEE A;  3U1X A;  4K3U A;  1VBC 2;  2P3Y A;  3MFA A;  4GJZ A;  3BTZ A;  3FHA A;  2W9X A;  1RVF 2;  1J1L A;  3MUY 1;  2V5D A;  5DAW A;  3I3Q A;  4QDQ A;  2EAL A;  2DWR A;  5FO9 B;  4RR3 B;  3AP4 A;  3K77 A;  1I9R A;  3AYA A;  3W5M A;  4MAD A;  5JIU A;  4UFK A;  1DQ5 A;  2K2S A;  3HNB M;  4NE9 A;  1WCS A;  2ZML A;  3RFR A;  2JDU A;  4DPN A;  4Q0S A;  3SH4 A;  1FPN 1;  2DVF A;  4XYX A;  1U5Z A;  2JDY A;  3BI3 A;  1N47 A;  3PJY A;  4P9Y A;  4AFD A;  2F4P A;  2YU1 A;  3TOJ A;  5E88 A;  2VO5 A;  2EF6 A;  2DDU A;  1AR8 2;  2DCJ A;  1VB4 A;  2VZT A;  1VAV A;  3K46 A;  2DF7 A;  3MW2 A;  4OUS A;  4PDW A;  4XTP A;  5FYB A;  4YYO A;  5JMC A;  1XNK A;  3O14 A;  4B4P A;  5C4W A;  2RS3 3;  1RUJ 3;  1VE0 A;  4QGL A;  4EV0 A;  5LEJ A;  4OUE A;  3VBU A;  1QEX A;  2Z42 A;  1OC1 A;  4MGY E;  3IAP A;  3RRD A;  5J09 A;  2C24 A;  3AB0 A;  5DG1 A;  2XBO 3;  1ZRC A;  4PBP A;  2R16 A;  4NRO A;  1GOH A;  5CIS A;  3RVH A;  4FBF A;  3AVS A;  1PNG A;  3ZO0 B;  3ZOI A;  1W3X A;  1S2E A;  3MI8 A;  1W8F A;  3E6D A;  2GAL A;  5FJH A;  5JI9 A;  1DQ4 A;  4AFA A;  2WT1 A;  4HET A;  3V64 A;  5B4X A;  4R9B A;  5F32 A;  4ZS3 A;  3IKW A;  4Y20 B;  5A1F A;  3HQU A;  5F3C A;  5FO7 B;  2VW0 A;  5AVP A;  5DZG A;  3OF1 A;  3H8U A;  3BTY A;  3QH6 A;  3VHP A;  5FZD A;  2ETE A;  3DUI A;  1I5P A;  2JDN A;  3LD8 A;  3WOG A;  3FN9 A;  5GLZ A;  2D6N A;  4QX3 A;  1NXD 1;  1AL0 G;  4GWM A;  4CDQ B;  2F17 A;  2RS1 2;  4K40 A;  1RUH 2;  4JGY A;  1K5M B;  4KWJ A;  3ZFG C;  4OZO A;  1WZX A;  5JZG C;  2WAB A;  5A7P A;  1PO1 3;  5LK7 B;  2X8K A;  5EXO A;  3LKJ A;  3KQ4 B;  2NYY A;  3HVD A;  1GNY A;  1OH4 A;  3BUC A;  4FFI A;  4TWT A;  1UZV A;  1C3H A;  3LDK A;  1X7N A;  1NA1 C;  3VL8 A;  3FE5 A;  1QNY A;  2XVL A;  1SBE A;  1RTV A;  2W5F A;  1EAH 1;  2CHH A;  4YFZ A;  1JYT A;  2QQM A;  3GZT B;  1NT0 A;  2K9Z A;  2Y0O A;  3GNE A;  4IW3 A;  1CD3 G;  2VMG A;  1H6X A;  1JU3 A;  1OKO A;  3AM2 A;  4XJA A;  1BJQ A;  3H8R A;  5JZG A;  1KEX A;  2VUC A;  2RS3 1;  5FYT A;  3FLR A;  4DRV A;  5BNP B;  4M00 A;  4A41 A;  2WWS A;  1IS4 A;  2XJU A;  4FXG B;  5FZK A;  4YW1 A;  3KVA A;  2EAK A;  2E53 A;  1YFU A;  4UF0 A;  5FZA A;  3M4F A;  2E32 A;  5BNP A;  5BY5 A;  2A3X A;  4EZH A;  1A34 A;  4RN5 A;  5F37 A;  5BNP C;  3NL1 A;  1G8W A;  2ET7 A;  4SBV A;  4Y1Y A;  4QT6 A;  3UV9 A;  3WD5 A;  1V9U 1;  2HJI A;  4P14 A;  2HWE 1;  3VHO A;  4AF9 A;  2Y0I A;  3ACF A;  3BOD A;  4N90 A;  3MF6 A;  2DTY A;  2R04 2;  1NZI A;  2W95 A;  4UFM A;  4CEY B;  1VAL A;  1WGP A;  1Z78 A;  1ND2 B;  3O0W A;  5FQ0 B;  1JZ6 A;  2R06 2;  4QPI A;  2Y60 A;  2BGO A;  1PZ9 A;  2WO7 A;  3APB A;  1K5J A;  4HFS A;  1WLW A;  1HRI 3;  3SKV A;  2WLP A;  2FDI A;  2BJS A;  3Q8B A;  3WT3 A;  1NG0 A;  5T3N A;  3BTX A;  2FDK A;  1CX4 A;  1JYW A;  4XBN A;  3I97 A;  2VQ0 A;  3NNJ A;  4D0Q A;  1TMF 2;  1JHN A;  1R1Z A;  4DXT A;  4XF0 A;  1RHI 1;  4P00 B;  5J37 A;  3IDC B;  1W8O A;  5CYY A;  1QJX 1;  4BA6 A;  3T2P A;  4SLI A;  1RB8 G;  3OBR A;  1RUI 2;  1NE6 A;  4FOQ A;  2NMO A;  3LA2 A;  1K5M C;  5ACA 2;  2I07 B;  2BU9 A;  2C6S A;  5D2A A;  4WM7 A;  3HR9 A;  5A7O A;  1IKQ A;  4LQR A;  2D5H A;  2R30 A;  2YC4 A;  1ENQ A;  2W52 A;  2VOK A;  1JZ5 A;  4MGT A;  2OII A;  5DUU A;  4KU8 A;  1QXJ A;  2E6V A;  5GLT A;  4IER A;  4ZZ8 A;  5C3P A;  3RZH A;  1GUI A;  1Q8P A;  2Q1Z B;  1CAW B;  1QGL A;  5FY4 A;  5T5L A;  1CZT A;  3OGS A;  2FDF A;  3AL5 A;  2WFP A;  2QQU A;  3E6B A;  1BKZ A;  3K2O A;  1R08 3;  1RUI 1;  3ZFE B;  4YVW A;  4ET7 A;  1C8N A;  5J98 B;  1UQX A;  3EYP A;  1EYB A;  5C7G A;  1JYN A;  5CG9 A;  2IFW A;  3NVC A;  1LOC A;  2YYO A;  3OYW A;  4QGM A;  5A7W A;  3WY6 A;  2DU1 A;  1VPH A;  2VBB A;  1PO2 1;  5DAB A;  1C5H A;  1AJO A;  1WCK A;  3QBQ A;  4Y26 A;  3SC7 X;  2ARA A;  1YRZ A;  2ILM A;  1WMX A;  4QX2 A;  4DFS A;  4HVQ A;  3VBR C;  4JDM A;  1JMU B;  2BGC A;  2H6C A;  2Q8O A;  4LTA A;  5I0T A;  4YGC A;  3ZM8 A;  1NLR A;  2ZGQ A;  3N9P A;  3HT2 A;  3SH5 A;  2GNB A;  1JOD A;  2QKD A;  4XDO A;  1UY1 A;  5I0U A;  1YUD A;  2RHP A;  2Y8K A;  5FY7 A;  5A33 B;  2A3Y A;  2ZS6 B;  5FPZ A;  1OBN A;  1BQP A;  1NY7 2;  2E31 A;  4HOO A;  2VR4 A;  4HSJ A;  4LNV A;  5EP9 A;  4CEW B;  1AYN 3;  2V5Y A;  1V6O A;  1JYV A;  4OQ8 A;  2Q1F A;  1ND2 A;  1GZT A;  2VTX J;  1V9U 2;  4E27 A;  5FBZ A;  5A3M A;  4BHP A;  3K51 A;  1WLT A;  4XDP A;  1J84 A;  2HWE 2;  1R09 2;  3TN9 2;  4X6R B;  4BOW A;  2R0F A;  1EPW A;  1RMU 2;  1W9T A;  5GLU A;  3T4V A;  1SDD B;  1D4M 1;  3OBT A;  2UUR A;  2CU5 A;  3PVN A;  4I0A A;  4AEM A;  4MXW B;  4GAZ A;  1YNA A;  3T1M A;  4CCK A;  5C3R A;  5JPM B;  1QOO A;  4QX8 A;  4QX1 A;  1RUE 3;  5C5U A;  1Z7S 3;  3JCI A;  4JCK A;  3HJR A;  5I93 A;  5CKN A;  3WF1 A;  2VVF A;  5IK7 A;  2W08 A;  1O59 A;  4Z2W A;  1W06 A;  5FYV A;  3P1I A;  5IUQ A;  4F3J A;  1IS5 A;  3K4Z A;  4Y24 A;  1AUY A;  2VE1 A;  2JJ6 A;  3WNO A;  4HPK B;  2WWJ A;  1YHF A;  5EIY B;  2BDR A;  1GKB A;  3INA A;  4NAO A;  2W1U A;  1E57 A;  2RE9 A;  2XKO A;  3VDD B;  5JSO A;  5FZC A;  2W91 A;  2WKK A;  4PLO A;  3ZN6 A;  4RS5 B;  5C8C C;  2AEY A;  3KCY A;  2WO2 A;  4ES8 A;  5KC5 A;  1K5M A;  2D6K A;  2G9G A;  2ARE A;  4Q4W 3;  4AGG A;  1SLT A;  1CQ9 A;  2G19 A;  2ID4 A;  2JG9 C;  5A1L A;  1T2X A;  2J1S A;  1H30 A;  2W1Q A;  2CYF A;  1GWL A;  1UX7 A;  1ASJ 3;  3MEP A;  3PMS A;  4G9S B;  3ZXL A;  4E2G A;  3RMY A;  1VP6 A;  1ODM A;  3V0B B;  3ALQ A;  4ISR A;  3VB9 A;  3DPR B;  1YJK A;  2QFE A;  3KT4 A;  3S30 A;  5L7O C;  2CV6 A;  2D98 A;  5LBF A;  2BVB A;  2X53 S;  3RYR A;  1KXG A;  3Q8C A;  2ZHK A;  1OT5 A;  3B01 A;  1Q56 A;  3HEI A;  3GBW A;  4FPK A;  5AFE A;  3NWK A;  2GAU A;  2R32 A;  4KI5 M;  1FT9 A;  4BM8 A;  5EFU A;  4HT1 T;  1CVN A;  1HKD A;  2KXL A;  1D0H A;  3E5X A;  1AYM 1;  3RQ0 A;  4WBB A;  1ZA4 A;  2B8M A;  1PMH X;  1OUR A;  4AHX A;  3Q8E A;  1QJY 1;  3Q8F A;  4NIH A;  4WM8 C;  2YY1 A;  4QPG B;  5FYS A;  1BEV 2;  1AR8 3;  5A3N A;  3OUH A;  1DU3 D;  3AMN A;  3I4I A;  1OOP B;  1XBF A;  4Q1R A;  4TLG A;  3ZYI B;  2OW4 A;  5DN2 A;  5EWS A;  1VRH 3;  4FXK B;  4MLO A;  4UW6 A;  4Q0P A;  1GYK A;  1RUJ 2;  1XE0 A;  1OOP A;  4CP2 A;  1UF2 C;  1FPN 2;  2VBD A;  2W68 A;  5FY8 A;  1J83 A;  3B93 A;  3TBD A;  4JGZ C;  3HAG A;  3WNM A;  1O3R A;  1FOD 1;  2DV9 A;  2P34 A;  3AYC A;  4DUV A;  4B4Q A;  1FX5 A;  5FY5 A;  4AAP A;  1VAM A;  4JAA A;  3TAY A;  3WR0 A;  3LIH A;  1HB2 A;  3ITQ A;  1LEM A;  5IFP A;  5HCH A;  5JR2 A;  3DV8 A;  1AR8 1;  5T50 A;  2WZ8 A;  1NQJ A;  1QJY 3;  1W8W A;  3AZY A;  1CN1 A;  1AR9 1;  1NAE A;  4TLF A;  5EPA A;  2PEL A;  3RDI A;  1HQW A;  5KC6 A;  1LES A;  3PJQ A;  2XHN A;  4QQL A;  3H3L A;  1Q43 A;  1GWK A;  3UGG A;  3VKM A;  2WA4 A;  3DYO A;  1UYY A;  4PHZ A;  4DXR A;  1NE4 A;  1OQD A;  2PLV 1;  2H6B A;  2XL9 A;  1MS4 A;  4BH9 A;  3RZK A;  2ZX4 A;  3ZFF B;  5CB7 A;  5E6H A;  3RYK A;  3WDY A;  5FYI A;  3RPQ A;  1XNT A;  2ZAA A;  1HXS 3;  3GJA A;  4N53 C;  1MZF A;  5FRA A;  4IV3 B;  4LBJ A;  1W6Q B;  2KR2 A;  5IT6 A;  2FDJ A;  4LO6 B;  1XXN A;  2PQS A;  1HJF A;  3U10 A;  5ABJ C;  2QQO A;  3M1H A;  2PMW B;  3R05 A;  4WVZ A;  4EWE A;  1UOB A;  2QVS B;  2DUP A;  3M70 A;  1W8Z A;  2X05 A;  3ZIW A;  1A8D A;  2P17 A;  4L11 A;  2XPJ A;  4EJR A;  1BK0 A;  3VZO A;  3EJK A;  2YMZ A;  4Y1X A;  3VZM A;  3KS7 A;  5FYU A;  2E33 A;  3HOB A;  4Q4V 2;  1WW4 A;  4NO4 A;  2CGO A;  5LBB A;  3NNF A;  4B1L A;  4M3C B;  1S0I A;  5FZ3 A;  5IVC A;  3S57 A;  3B02 A;  2WA3 A;  2I2S A;  1WKY A;  3WLU A;  4NWW A;  4COZ A;  2LTN A;  3W9A A;  2VMI A;  4XUO A;  1OI6 A;  1TNF A;  2YRO A;  3A4U A;  4RD7 A;  1F2N A;  2XJT A;  2HWD 1;  3SKJ E;  4GWJ A;  2XR4 A;  1VBE 1;  3ACI A;  4A42 A;  1O3T A;  1HIX A;  3DPR C;  4M3C F;  1OKQ A;  4FFH A;  2XB6 C;  3VBS B;  1DQ1 A;  2EXH A;  2R0H A;  2VQU A;  4LHL A;  1CPN A;  4WM8 A;  3WUC A;  4HK8 A;  2XJS A;  4Q29 A;  2XH6 A;  3N9L A;  2DCZ A;  1HRI 2;  3ZXD A;  2A5Z A;  1PK6 A;  3OGR A;  1S2B A;  4A3Z A;  4CDW C;  2VXR A;  1H9W A;  4K20 A;  5KHK A;  4OHY A;  3THD A;  2GSY A;  3BGA A;  1E5S A;  3NRU A;  1D2Q A;  4CDQ A;  2MEV 2;  2D5F A;  3RJ2 X;  3MFC A;  4C8D A;  2FCU A;  4LKF A;  2G4I A;  3O7O A;  1TMF 3;  4FPL A;  2XJV A;  1ACC A;  2R1D A;  2JDP A;  3I2I A;  3D4K A;  5A3P A;  2WDB A;  4J6G A;  1LOB A;  1OF3 A;  3FBM A;  3FHQ A;  4O65 A;  4LE4 A;  3BKZ A;  1RUI 3;  1OA4 A;  4NHM A;  2XQX A;  3KT1 A;  3KMH A;  5FY0 A;  5ACA 3;  4GMP 3;  1GBG A;  2OT7 A;  3N3H A;  3PUR A;  4EE2 A;  4GAL A;  4EYU A;  4YAR A;  1CJD A;  1ND3 B;  1VIW B;  2JIG A;  2ZAC A;  4YM2 A;  2ZHN A;  2FMD A;  4LBN A;  3RZL A;  4CDX C;  1PO2 3;  4ONU A;  5J96 B;  2A1X A;  2J1U A;  1XSR A;  2YU2 A;  1WME A;  3LOI A;  4MZU A;  2BP6 A;  1UXZ A;  1NZC A;  3RJR A;  4GKX A;  3WNP A;  5IK4 A;  3B69 A;  2WIN B;  1L7Q A;  3TEZ A;  2DFB A;  3ZXE A;  2ARX A;  4YW6 A;  3USU A;  4CUC A;  1QH7 A;  4FPE A;  1OFN A;  1SEF A;  1UMI A;  1V6L A;  1EUT A;  2XML A;  3PL0 A;  4LBK A;  2VOT A;  5FZ6 A;  3WDT A;  3III A;  3P5B A;  4CVU A;  1MZE A;  3CMG A;  4LPL A;  3N35 A;  4R9D A;  5H9S A;  1JUH A;  1LOE A;  1PMJ X;  4LLF A;  2VCB A;  2WII B;  4PLN A;  3VBS C;  1LTE A;  2FD8 A;  2W39 A;  3UET A;  4YM3 A;  4LHS A;  3UYJ A;  4CU7 A;  5KHI A;  4YLZ A;  2VL4 A;  1SBF A;  4DEQ A;  1DZR A;  2Y6L A;  5LCW L;  1UU4 A;  4IUG A;  5D1I A;  1ZA7 A;  1JUI A;  2VQA A;  5GZD A;  1WW7 A;  1UO9 A;  4FQZ A;  5DAV A;  2DVB A;  3MGU A;  4KGQ A;  2HEW F;  4FOY A;  4PBO A;  1V9U 3;  1RUC 3;  3THP A;  5FCC A;  1IKP A;  4QWN A;  1Q8V A;  1J1T A;  1EUU A;  1J59 A;  1S0F A;  3I2H A;  5IAT A;  1JZ2 A;  2DUO A;  1RUF 1;  3TNP B;  2JG8 C;  2JB4 A;  1QU0 A;  5A32 A;  2B5H A;  2UU8 A;  5LRR A;  1S0C A;  4YM1 A;  4YW7 A;  3KGZ A;  4R9A A;  4XQ4 A;  2VOX A;  5FMO L;  1GOF A;  3ZFE A;  3Q9O A;  1Z7S 2;  5FOJ B;  2ZGR A;  3T4H B;  1C1F A;  4O9G A;  1V70 A;  2D6M A;  2XBO 1;  3ETP A;  3NV2 A;  1WCD J;  1ZBE 3;  2LUW A;  2O8O A;  3CZU A;  3J9S A;  2WFF 1;  4IDZ A;  3CZJ A;  4XFB A;  2AEZ A;  5CNA A;  4OMC A;  5DDJ 2;  5FYM A;  3RI8 A;  5LA1 A;  2VG9 A;  3AP7 A;  1W6O A;  1XJA A;  2YZ4 A;  3WV6 A;  3LGR A;  1BEV 1;  1PO1 1;  1MS0 A;  1G9D A;  1W0N A;  2CY6 A;  1IG3 A;  2NP0 A;  3URF A;  4AL9 A;  3I2O A;  1UY0 A;  4DUW A;  4E2S A;  4ERO A;  2WAA A;  2VZQ A;  3EBR A;  2P1B A;  2E26 A;  3NO8 A;  1RUC 1;  3BAL A;  1U5Y A;  3AP6 A;  3QAC A;  5HV4 A;  1UZW A;  1UPS A;  2B45 X;  4HL0 A;  5K8S A;  3A0N A;  1QJF A;  2WLQ A;  4YVS A;  5C3O A;  3L2H A;  1VBE 3;  2HBT A;  4LBL A;  2HWD 3;  3USU B;  3WP6 A;  3OSD A;  2AGS A;  3S5Q A;  3ILR A;  1M06 G;  1N1V A;  3RNS A;  1JZ7 A;  4XF9 A;  5K0U B;  1JU4 A;  1Q3E A;  4HKW A;  5D8A C;  2Q4S A;  2A73 B;  4W6W A;  5FPL A;  2WNV C;  4Z8B A;  3O1O A;  5EQU A;  4BQX A;  3RZJ A;  1H1A A;  5JR7 B;  4CZS A;  3JD7 1;  3VKN A;  3ZLI A;  2Q30 A;  4H55 A;  1YFX A;  4K8R B;  1QNW A;  3VD9 A;  5LEK A;  2WT0 A;  3KLS A;  2MHF A;  4CDX B;  3T2O A;  3O1U A;  1FMD 2;  4TN7 A;  3U4S A;  4XJ9 A;  4IE5 A;  4ATF A;  3BIW E;  1Z0H A;  4ES9 A;  3C7F A;  3UJO A;  3H0O A;  4PT6 A;  1C1L A;  1COV 2;  4B4R A;  2WQ8 A;  1J58 A;  1GIC A;  1S0G A;  3D0S A;  4PCR A;  4ZXK A;  5ANN A;  2OS2 A;  1VR3 A;  4PF1 A;  5JWP A;  5BPX A;  2C26 A;  4OHZ A;  4NJ4 A;  3P3N A;  1B35 A;  2D3S A;  2OZJ A;  4D7S A;  2WNO A;  4KG8 A;  1VRH 2;  3VDB A;  4D6R A;  1IPK A;  2Y6J A;  4ZU5 A;  1GFF 2;  2HBU A;  2D43 A;  1OLM A;  3ZYJ B;  4DIN B;  1GWM A;  1FPN 3;  3GZU C;  3OD4 A;  4E8D A;  4TZD A;  5FIX A;  4LO7 A;  1A6C A;  5EJ3 A;  4FAH A;  1CES A;  2JEN A;  1PZ8 A;  5LB6 A;  3AX4 A;  2VH9 A;  1CIY A;  3R4S A;  4AXO A;  4LBO A;  1DGW A;  2W1W A;  1MQT A;  3KD4 A;  5FZ1 A;  3FWE A;  1AR7 1;  3IB3 A;  2Y6G A;  1S0B A;  3VD3 A;  1RXG A;  5K7P A;  3KVB A;  3R4U A;  4A6O A;  4BB3 A;  1F15 A;  1OPO A;  3MDP A;  2W92 A;  4KBZ A;  2ADE A;  2RMU 2;  3ZXF A;  1GOG A;  4AZZ A;  5FPX A;  1U12 A;  1SFY A;  4DMI A;  1OLR A;  1XNA A;  5FZI A;  4RHV 3;  4H7L A;  2W87 A;  3C3V A;  3MIG A;  3W20 A;  5AC9 3;  1GU3 A;  5JOZ A;  4Q2F A;  3JUU A;  3VZJ A;  4EN8 B;  2R6Q A;  4GH4 B;  2VTX A;  2Z5W A;  4URA A;  3KV4 A;  4U2A A;  2ES3 A;  1O4Y A;  1E5R A;  2ZZQ A;  2VCM A;  4Y20 A;  1NY7 1;  4MG2 A;  4GWN A;  1JZ8 A;  1EAH 2;  4I02 A;  3LDB A;  4IEX A;  2K0G A;  3T0B A;  1HX6 A;  4R4Z A;  4A3X A;  3R0R A;  2R49 A;  4K1Z A;  2ZGT A;  2VZO A;  3MUZ 1;  2C5D A;  4B29 A;  1W6M B;  5LBC A;  2WZE A;  1ZYB A;  1AYM 3;  1LGN A;  1REE A;  4J1W A;  5KHG A;  4AEK A;  2O8Q A;  5T5P A;  3LIG A;  4AI0 A;  1QJX 2;  1W2T A;  1W3V A;  1ULD A;  1DGL A;  3CU7 A;  4GIQ A;  5FMB A;  1FI2 A;  4PQ9 A;  2CAU A;  5A6Q A;  3KV9 A;  4YFW A;  4OI0 A;  3ZSJ A;  3C7G A;  5DXD A;  3POW A;  1Y7B A;  5J7M A;  4ZXE A;  1FYU A;  4HN1 A;  5FDB A;  1GNH A;  2VY0 A;  4RYD A;  4NN0 A;  5FBJ A;  1VBC 3;  2VUJ A;  3ZSM A;  4AE2 A;  2VGD A;  1COV 1;  1RVF 3;  3OY8 B;  5A70 A;  1W6N B;  5HXV A;  3JZV A;  2ZEY A;  2ZEZ A;  4DEV A;  4KG0 A;  5I0R A;  2IFR A;  2P4E A;  2BNO A;  2VMC A;  3AC0 A;  1A8M A;  4Y5T A;  3T0D A;  2GN7 A;  2R1B A;  4PDW C;  1H8T A;  3KF5 A;  4PJY A;  2YV8 A;  4MET A;  4QPI B;  3OUJ A;  4FO9 A;  4EN9 B;  3FL7 A;  4P9L A;  5ERL A;  5G05 L;  3N7K A;  1AF9 A;  1B35 C;  2GDF A;  4B7E A;  2UY9 A;  4ZU4 A;  3N9M A;  3HWJ A;  2Q5T A;  4K9S A;  4B3N A;  1WMF A;  3TEY A;  1CAU A;  4PIZ A;  1UXX X;  4AAX A;  3K48 A;  4AOC A;  2MEV 3;  2RS1 1;  4IEQ A;  4B7K A;  3NMB A;  1UD1 A;  2PAE A;  1O5L A;  5B4N A;  1DP0 A;  1F35 A;  1V6K A;  4MVT A;  1GZW A;  1G9B A;  4AQ2 A;  3KT7 A;  2VM9 A;  1DG6 A;  1ST8 A;  2E63 A;  2F4L A;  4AYU A;  3VBU C;  1RUE 1;  1SFN A;  3VKL A;  1RXF A;  3AKQ A;  4ZS2 A;  5GJ6 A;  4XE9 A;  4JRA A;  1NQD A;  2LRO A;  1LOD A;  3ATG A;  4KMQ A;  5FZF A;  3AFG A;  4L99 A;  1N1Y A;  2MEV 1;  4GD4 A;  3DEC A;  4L97 A;  2VZ1 A;  2ZAB A;  5BNO B;  5A6Z A;  1ZRI A;  2KM2 A;  2HYX A;  3ZXG A;  4YVS C;  1O4Z A;  1PO2 2;  1VBB 1;  1ZBA 3;  3WX5 A;  1BVV A;  3AMM A;  1AR6 3;  1OD5 A;  2NLR A;  3GAL A;  5FYH A;  1LGB A;  3M8L A;  4CCC A;  2ZXQ A;  2BGP A;  3IDE A;  4IV3 A;  1JXN A;  3IMM A;  4I2O A;  2MNG A;  2Y33 A;  5IYY A;  3NW4 A;  2J1E A;  5LW9 A;  2L9L A;  2DCY A;  1PX4 A;  3I2F A;  2GN3 A;  2WZR 2;  2AAC A;  3ASI A;  2Z69 A;  2E51 A;  3DN7 A;  3EMR A;  5FLH A;  2RS1 3;  4FCA A;  1H0B A;  2JEC A;  1B09 A;  1UMH A;  4NVP A;  3TYJ A;  3WDX A;  5E89 A;  4GZ9 A;  4NHY A;  1PO1 2;  3VBR A;  2AR6 A;  5JSP A;  1TZO A;  1KDM A;  1EP0 A;  1XSQ A;  4H2A A;  2HWF 1;  3HIF A;  4QB6 A;  4C90 A;  3SNM A;  4AED A;  2CAV A;  4KU7 A;  1AR7 3;  1IZ3 A;  1XPW A;  3ST7 A;  4ZHN A;  1HRV 3;  2GMP A;  4BLI A;  5IAX A;  2EXI A;  3OY8 A;  2IWG B;  2RS5 1;  4GB3 3;  3IDA A;  5KXD A;  3WG1 A;  4CP0 A;  3KHC A;  4HXC A;  1NKG A;  1MEC 1;  1JW6 A;  2QDN A;  3VGI A;  3IN9 A;  3M2M A;  4LMF A;  1MZ5 A;  2DYC A;  2B7Y A;  1QJU 3;  1PX3 A;  4OZX A;  3I54 A;  3K3O A;  3LWC A;  1AXK A;  2PTM A;  3CJX A;  4MHR A;  1LED A;  4Q4Y 1;  1BHG A;  5CKQ A;  4YWA A;  2D93 A;  2UWC A;  3I3D A;  3SHR A;  5K9Y A;  4R52 A;  4GWI A;  4YVW B;  1HB3 A;  3UJQ A;  3NV1 A;  1MEC 2;  4ZY9 A;  1W39 A;  4M3C E;  4XAB A;  2G9F A;  2A6X A;  2B46 X;  3E5Q A;  3T1L A;  3WVJ A;  4QAW A;  4CCO A;  4IEO A;  4BK5 A;  5AC9 1;  4M0N A;  5LA9 A;  4XMA A;  4N53 B;  1H1M A;  4DNY A;  4X8N A;  4BCU A;  1WCU A;  1FV2 A;  3JB4 C;  1NXM A;  3BB6 A;  4V1P A;  1WLC A;  3H1Y A;  4XC9 A;  2BUK A;  2PHU A;  4UBG A;  2RDS A;  1UOF A;  3PLQ A;  4LKE A;  2UWA A;  4N7I A;  5AVA A;  5FZO A;  5IVY A;  5SV8 A;  4IES A;  2YBP A;  4QPG C;  3V0A A;  3J7H A;  4QMA A;  2BBV A;  1KIT A;  3AMP A;  1UU5 A;  3CHX A;  5KBF A;  4M3C A;  2BYV E;  4XXP A;  1MS5 A;  1NCR A;  3ZDV A;  2P3K A;  1CAV A;  1VBE 2;  1WBL A;  2TNF A;  4ASL A;  1OVS A;  3QH7 A;  4P02 B;  1URX A;  5DUX A;  4HKL A;  2HH9 A;  5BUV A;  3ZPO A;  4FPY A;  3U75 A;  5GZG A;  5FO8 B;  4RS5 A;  3ZYP A;  4LBQ B;  3GJB A;  4IEV A;  4NR1 A;  1W2N A;  1CPM A;  4UFI A;  1G7Y A;  4GH4 C;  4IE6 A;  3MLJ A;  4RQP A;  4HVO A;  1LNS A;  3WEZ A;  1X8M A;  2VBP A;  2VME A;  2WZR 1;  1VB2 A;  3AZV A;  5HPO A;  3NKT A;  4OMD A;  2ZX1 A;  4MH0 E;  5KR7 A;  4AWD A;  1LR5 A;  1G9A A;  5DMY A;  2BOI A;  5F5C A;  4FP3 A;  1PVC 2;  4BXF A;  5J36 A;  3UKV A;  3RS6 A;  2EAA A;  3FLP A;  3UES A;  4FTS A;  3BIE A;  4CCN A;  4MSV A;  5F39 A;  2FDH A;  4NPR A;  4M4R A;  4R8H A;  1POV 0;  4MGK E;  1AX2 A;  5A32 B;  4UYB A;  3F95 A;  1YQC A;  1DZT A;  2ZCW A;  3ZYF A;  4QPY A;  1GP6 A;  3JU9 A;  3AP9 A;  3VBH A;  3V0A B;  2VAU A;  1W2U A;  3LSE A;  1PGW 1;  4KWK A;  5LA0 A;  1XYP A;  4JGY C;  4LA2 A;  2LM3 A;  1F4A A;  2P3J A;  2GNM A;  1ONA A;  2RS5 2;  1RJ7 A;  3WP5 A;  4KWU A;  4N9I A;  5GKA C;  2HWC 2;  5FKB A;  2BWC A;  2GMM A;  2QTW B;  5L7O B;  4GA9 A;  2WO3 A;  2Q0A A;  5JOY A;  1XYO A;  2K46 A;  3LEG A;  3WNX A;  1H1I A;  4A7Y A;  4DZG A;  5EJZ B;  1KQR A;  4LK6 A;  4UW4 A;  4KQ7 A;  4E4H A;  3AVR A;  4QHZ A;  5HCF A;  2GH8 A;  1UZ0 A;  1W9W A;  4JGY B;  3C7H A;  3GBF A;  4EWA A;  5JXG A;  4XQD A;  1UYX A;  2VOV A;  5LRS A;  3T09 A;  3VZK A;  5AC9 2;  4OI4 A;  3O12 A;  4JVA A;  4G4F A;  3RSJ A;  4AI8 A;  2PFW A;  2OQ6 A;  1VAK A;  1LHW A;  1MS3 A;  2DUQ A;  2RG4 A;  3LCP A;  4XCB A;  4I0W B;  4LLO A;  4XFG A;  4C0B A;  3MIC A;  5ABJ A;  5ACA 1;  5JPN B;  3KV5 A;  5CFC C;  4XW3 A;  3A23 A;  4XUN A;  4XCA A;  4D7Y A;  2KA3 A;  5H9P A;  3AXE A;  5IW0 A;  3WNK A;  3ZMN A;  5BNO A;  4V2V A;  2C1F A;  1VLN A;  1O6U A;  3ZYH A;  2V4V A;  5CAD A;  1S4C A;  3M3I A;  4LUM A;  5FWE A;  2OKX A;  4QDS A;  3R4D B;  3ZPY A;  3IMN A;  2BPA 2;  1JBC A;  5C8W A;  1AL2 2;  1AX1 A;  1JTZ X;  2CWM A;  5K0U A;  1BYH A;  3B9I A;  2VMD A;  5CBL A;  1QDO A;  2D6P A;  3ILF A;  4D69 A;  1VRB A;  1SPP A;  3AKS A;  2NQY A;  1OQ1 A;  4XBL A;  1PNF A;  2VZ3 A;  2IVI B;  3MV1 1;  3LA3 A;  1UMZ A;  2XJQ A;  1FAY A;  1V6N A;  2VPV A;  1TNR A;  4N43 C;  3BCW A;  3ES4 A;  3BPZ A;  4FT8 A;  1WA4 A;  4CSW A;  1ZZC A;  2WNU A;  1GP4 A;  2WS9 1;  1S0D A;  1AL2 1;  3PME A;  4IEZ A;  5FTT C;  4BJ0 A;  2PHR A;  2Y64 A;  2OPW A;  1DYP A;  4OCT A;  2C0Z A;  3EO6 A;  2J1R A;  3J26 N;  1CGP A;  3ZSE A;  4CP1 A;  2JKX A;  5F2S A;  1F9K A;  4QQP A;  1W6O B;  3JBG 2;  3H7Y A;  3J8F 2;  2D6O X;  3P6B A;  3PTR B;  3IM0 A;  3MLK A;  3WQB A;  3I3M A;  3KSC A;  4LOT A;  2A70 A;  4A45 A;  2W94 A;  5BNQ A;  3UKN A;  2CGP A;  5FZ7 A;  1IS6 A;  2VNR A;  1VJ2 A;  1YQ6 A;  4NPL A;  5FXV A;  2SLI A;  3GYD A;  2EIB A;  2OQ7 A;  3IWZ A;  2PYT A;  3W21 A;  1UKG A;  4CUA A;  3BOP A;  1S0E A;  1XNC A;  4LOR A;  4OI2 A;  4MXW A;  1VMJ A;  4CRQ A;  2P37 A;  1KJR A;  4NAM A;  1UPI A;  4UFL A;  3I7D A;  3MW3 A;  3THT A;  3ECQ A;  1LHU A;  2R07 2;  1CR7 A;  2VUA A;  5BNN B;  1X9T A;  2DVG A;  1FAT A;  3OGJ A;  4CEW A;  1C8M 1;  1UY2 A;  5C3Q A;  1QJY 2;  2OX0 A;  1X50 A;  3NV4 A;  2HWB 3;  4FOV A;  1JOB A;  4GMP 1;  4CA9 A;  3G6J B;  1AR6 2;  4XJZ A;  1LRH A;  4S2D A;  3JXS A;  4DUX A;  2ZGU A;  4XAE A;  1HXS 1;  4QU2 A;  3RWN A;  3E6C C;  1RUN A;  5AFB A;  1ZZ7 A;  3U11 A;  1VBA 3;  2RDR A;  3PVB B;  4LHN A;  2GH2 A;  4NIA A;  3NJV A;  2YDE A;  1N3P A;  2Z79 A;  4MO3 M;  2GP3 A;  2NMN A;  4UI9 L;  5LY2 A;  2E7A A;  2WFF 2;  4YVS B;  2XWB B;  4TXW A;  5C9A A;  1N3O A;  1WA6 X;  2WQ4 A;  5EJ1 B;  4BQ1 A;  3PIG A;  1W90 A;  1SPP B;  5F6K A;  1HXS 2;  1RUD 3;  2YPD A;  1C57 A;  3T2Q A;  3C7O A;  1L7R A;  4BQ4 A;  1I5Z A;  2IXJ A;  1YQ8 A;  4AHY A;  4AED C;  2IXI A;  1YI9 A;  3PU3 A;  4P08 A;  4M01 A;  3CO2 A;  1GSL A;  1UOJ A;  2NZ9 A;  1YJL A;  4W8J A;  3CJI B;  4OHV A;  4MHU A;  1RUF 2;  4MYE A;  2A7A A;  2RR1 3;  1HRV 2;  2D6L X;  1W8N A;  3ON7 A;  2ZX0 A;  4U36 A;  2ZEW A;  1QXR A;  4QB2 A;  4BWO A;  4CDQ C;  4GB3 2;  4Y1U A;  4N43 A;  3QD6 A;  4NII A;  3B3Q E;  4XFH A;  3VDC A;  5FOB B;  5F2W A;  3MBW A;  2VOW A;  1O91 A;  1SFP A;  4K7J A;  5FZ4 A;  5F3E A;  1KDK A;  1OUS A;  3ETQ A;  1LHO A;  4I01 A;  4LUK A;  2QQV A;  2WSV A;  2QQP A;  4LT5 A;  3GZA A;  1LHN A;  3OYW B;  5EV7 A;  5A7W B;  2JWP A;  3X29 B;  4LBM A;  4D7T A;  2FZ1 A;  1W6P A;  1CAU B;  1MEC 3;  2YFU A;  3HNY M;  4AGR A;  1SDW A;  1SLB A;  5GM0 A;  1ASJ 1;  2GC0 A;  4GJY A;  3LEI A;  1SCS A;  1O5U A;  4CU6 A;  2J1A A;  5FKC A;  1L7L A;  3WW3 A;  4BME A;  4HLT A;  4CCL A;  4X8P A;  4AG4 A;  3MPB A;  3ZYB A;  1ALY A;  4XFC A;  3MO4 A;  3NJZ A;  3OOX A;  3M7A A;  4QKD A;  4WVW A;  3VBF A;  3BU0 A;  1POV 1;  1J3Q A;  1F31 A;  1UKR A;  5A1A A;  4D94 A;  1UU6 A;  4MOA A;  4RR3 A;  4C1W A;  4OI1 A;  2V72 A;  3TN9 1;  2EVX A;  1QJZ A;  3H3U A;  3J7M A;  2QQN A;  2VJX A;  4XHX A;  2CWS A;  4QQO A;  5F5I A;  1MS9 A;  1OSG A;  3AZZ A;  5C6C A;  1Q8O A;  4TSV A;  4XFA A;  4IEU A;  1G86 A;  1RHI 2;  3ZXA C;  2WN2 A;  1OQE A;  2LAL A;  1DQ2 A;  2RJ2 A;  2VCC A;  3VKF C;  2OPK A;  5C71 A;  1HB1 A;  4IGO A;  4NHX A;  5JXI A;  2JX9 A;  5FZO B;  1WCQ A;  4DS0 A;  2JE8 A;  4CUG A;  4FFG A;  4IV1 A;  1SLC A;  1S0J A;  2HEV F;  3EHK A;  3N7L A;  3HN1 A;  2ATF A;  3IAQ A;  3B5L B;  3IDB B;  3KQR A;  2R7E B;  4MGZ E;  1H8T C;  4W6Y A;  1BZW A;  1ENR A;  4UBH A;  3HQX A;  4JQR A;  4A2U A;  1RUO A;  4IND A;  3CNA A;  3TRS B;  2OUH A;  5FMC A;  4COU A;  1FOD 3;  2J7M A;  1MS8 A;  3PUQ A;  4CP9 B;  1DCS A;  4JKL A;  2ZPX A;  4JQT A;  1RUD 1;  3J4U H;  1PVC 3;  2ZGP A;  4RGK A;  3U0Z A;  4Q8K A;  1UAI A;  1D2S A;  2VCA A;  3GM8 A;  1OXC A;  4YW2 A;  4R9C A;  3ZXJ A;  1DGR N;  3N7J A;  4XPV A;  3T30 A;  5FUN A;  3MPP G;  2B9V A;  4P9I A;  3S7I A;  1GQH A;  2VZS A;  3PUA A;  5L9R A;  3L9J T;  4RGG A;  1D0G A;  1VBC 1;  3ME2 A;  4GB3 1;  4XZP A;  4YGD A;  2RS5 3;  1C8M 3;  5K0U C;  2R06 1;  2GP5 A;  5CVR A;  3WG2 A;  5GZC A;  4XF1 A;  1K45 A;  1QDC A;  2J1V A;  1AYN 1;  4H14 A;  1MQT B;  4IQP A;  5A3U A;  2XXZ A;  4I3P A;  2V09 A;  3OGV A;  3O1R A;  1NLQ A;  1RUC 2;  1US2 A;  4CEY A;  4AI1 A;  4CDU C;  5KWR A;  1PGW 2;  2IXC A;  1NCR C;  1QJE A;  2WNE A;  3RWK X;  2XQR A;  2EIC A;  3WP4 A;  1W9Y A;  4BQW A;  4YRD A;  4W50 A;  4LO5 B;  4AFB A;  5CFC A;  3ZFF C;  5HCB A;  1A3K A;  5T5J A;  5C33 A;  5DAX A;  4CCM A;  3NJY A;  4X6Q B;  4HAN A;  2DVD A;  2FMY A;  1K12 A;  1OA2 A;  2EXJ A;  3ZDS A;  3HNM A;  1FXZ A;  2ZMN A;  2DBN A;  5A7S A;  1XU1 A;  3SXW A;  2QZ2 A;  2R04 1;  1RIT A;  1AR6 1;  1VBB 3;  5SV5 A;  1YIP A;  3S7E A;  2YHJ A;  4BYY A;  3I2D A;  3ZFG A;  4OUM A;  3T08 A;  2JG9 A;  2D97 A;  2RM2 3;  4YZ2 A;  4AVB A;  5C4W C;  5HI0 A;  3FUO A;  1QF3 A;  4WM7 B;  3PIJ A;  4IV1 B;  1DQ0 A;  4CYD A;  1AR9 2;  4HSL A;  1CWP A;  1AL2 3;  4HK9 A;  3ZXK A;  4AFM A;  2D44 A;  1V0A A;  1YYN A;  2QZ3 A;  1JN2 P;  1JHJ A;  4QD2 A;  2XON A;  3SIT A;  1NA1 B;  2QE3 A;  1W0O A;  1UIK A;  4IV1 C;  3VN4 A;  5C70 A;  5J3U A;  1XE7 A;  5A6X A;  5FZ8 A;  3DKW A;  2YGM A;  1V6J A;  4YGB A;  4AVC A;  5L9V A;  2A6Y A;  4MX3 A;  5F6L B;  2HWD 2;  4C1X A;  5CFC B;  3O1S A;  1D4M 3;  4FPO B;  5FAX A;  1RUG 2;  4OVE A;  1GAN A;  5DZF A;  3I49 A;  3HD8 B;  1GP5 A;  2BQP A;  4HON A;  2WT2 A;  5B2G B;  4CCE A;  5FZL A;  4W65 A;  1HDK A;  1NOV A;  1OMI A;  2D7F A;  4ZON A;  3ZKY A;  2J22 A;  3AKR A;  3NST A;  1U5I A;  4O9E A;  1DDL A;  3PHM A;  1DBN A;  1HRI 1;  1X82 A;  3CDZ B;  4BIS A;  2NPI A;  1H8T B;  5FLJ A;  1TQ5 A;  5IAV A;  1YCI A;  4KBB A;  4YW3 A;  3B94 A;  4A6S A;  1BMV 1;  4RFT 0;  3J8F 3;  1FMD 3;  1W6P B;  2E7T A;  3H1M A;  1N1T A;  2VC9 A;  3AZX A;  4LKD A;  4Q5O A;  1RIN A;  3WQ7 A;  5KXB A;  2BNM A;  1X8E A;  3AJY A;  3D0J A;  1SCR A;  1AXZ A;  1COV 3;  4XQW A;  2OVU A;  3JB8 A;  2XUE A;  2QCS B;  4XIK A;  3UK9 A;  1H2L A;  3MIF A;  3DGT A;  2D3P A;  4EZ4 A;  1W03 A;  3NV3 A;  3RMX A;  4PQQ A;  2ZGN A;  3S0M A;  5GLW A;  4UFJ A;  4WV8 A;  4KNC A;  1CAX A;  4I09 A;  2W3J A;  3I3E A;  3HT1 A;  3B7M A;  2VMH A;  2PHD A;  4PDW B;  4EN0 A;  5G04 L;  5DUW A;  4AK3 A;  4XAA A;  3OUI A;  3ENR A;  1EY2 A;  5A7Q A;  2HLE A;  2R07 3;  1RED A;  1UWW A;  5T52 A;  3WHU A;  3OEA A;  1KGY A;  1R1A 3;  1W9S A;  3SMH A;  5DAP A;  1ULO A;  2DUR A;  3TWI A;  4DO0 A;  3VBS A;  2B42 B;  2QUO A;  1Y43 B;  1I6X A;  3E5U A;  2PHX A;  4Q4X 3;  2GC2 A;  3D5O A;  1U0A A;  5DG2 A;  1ZRF A;  4BDV B;  4IXL A;  4YM0 A;  1KRI A;  1PIV 1;  4NPM A;  5HXM A;  2PLV 2;  1VBA 2;  2JG8 A;  5E8A A;  4BIF A;  1H2N A;  4XF4 A;  3NAP A;  3CEW A;  3I59 B;  5C8C A;  3T2T A;  2WFF 3;  2HWF 2;  2YBS A;  2WZP P;  1JYI A;  3B9C A;  4RHV 1;  4G3Y C;  5IVJ A;  3QCW A;  1XB9 A;  4UOJ A;  4XTM A;  3RZM A;  3DEM A;  1STM A;  3GXU A;  3N9O A;  5A7N A;  1RUD 2;  4AR2 A;  2GU9 A;  2YUE A;  3GCX A;  4MXV A;  4WM7 C;  3NAP C;  5GLV A;  4JC1 A;  1O8S A;  2Q8D A;  4L0P A;  1T6B X;  4CP9 A;  3JD7 2;  1HV0 A;  3AKT A;  4BXS V;  1EV1 2;  4IET A;  3VHN A;  1RUF 3;  4Y4R A;  4XMI A;  4LIT A;  1UYZ A;  1AYM 2;  1W6Q A;  2PQQ A;  2ZTN A;  1J3R A;  2LW8 A;  2VXJ A;  4UFH A;  1BBT 1;  3ZR6 A;  3VKO A;  4Y3O A;  3PVO A;  3ZVX A;  1XNB A;  1YXW A;  2A3W A;  4XJU A;  4XJ8 A;  4YG6 A;  5E16 A;  3WSO A;  3NKG A;  3SEP A;  2H0B A;  3S5A A;  4Y1Z A;  2ZGO A;  1RUJ 1;  4HG6 B;  3A7Q A;  1L3J A;  1RJ8 A;  3VZL A;  1C4R A;  4CDW A;  1LOF C;  4NHL A;  1BCX A;  5FPA A;  5IK5 A;  2WUH A;  3MLL A;  5TSW A;  2Q8E A;  3MHZ A;  4A7Z A;  1Q8Q A;  4Q4X 1;  2E7Q A;  3DL3 A;  4LEJ A;  2YC2 A;  4IV3 C;  4IGP A;  1PK6 B;  4HVR A;  4UAP A;  5H9R A;  4QU1 A;  1V00 A;  3T0A A;  3RZZ A;  2CDO A;  4DXZ A;  2ZHL A;  4D6Q A;  1W2A X;  4DY3 A;  1QWR A;  2ORZ A;  2X10 A;  3EB7 A;  3KF3 A;  4LJH A;  4NRM A;  2FQP A;  4WM8 B;  1VMF A;  2BRT A;  4ZKT B;  2I74 A;  3A21 A;  5T54 A;  4Y33 A;  1Y9Q A;  3J7L A;  1KD7 A;  1DLL A;  2JEM A;  4S2F A;  2H0V A;  3BPS A; 
#chains in the Genus database with same CATH homology
 3WNM A;  4OMD A;  2X09 A;  2VTF A;  4FI9 A;  3PUH A;  3C7E A;  4DUV A;  5DMY A;  5IFP A;  2VZP A;  4A44 A;  3UES A;  5JR2 A;  4TTG A;  2VZV A;  2WZ8 A;  4M4R A;  5CZK A;  1NAE A;  3I2G A;  4LKS A;  3I2J A;  3UNP A;  2XHN A;  5LA0 A;  2WYS A;  3DYO A;  1F4A A;  1UYY A;  1RYY A;  4DXR A;  4KWU A;  2ZEX A;  1H6Y A;  2EIE A;  1CX1 A;  2WO3 A;  1XNT A;  1JYX A;  1GQP A;  2B4K A;  3LEG A;  3A22 A;  2YG0 A;  5EJZ B;  2C4X A;  2PQS A;  2Z4F A;  3VD5 A;  2QQO A;  2WN3 A;  1UZ0 A;  1W9W A;  3C7H A;  4BK4 A;  2X05 A;  5JXG A;  1UYX A;  2QQJ A;  4XUT A;  3T09 A;  3OG2 A;  1HN1 A;  4QDR A;  2E33 A;  3HOB A;  3F2Z A;  3DYP A;  1YQ2 A;  3ACH A;  3A23 A;  4XUN A;  1WKY A;  1UY3 A;  3CIH A;  3WNK A;  4XUO A;  4CUB A;  4CU8 A;  5DPN A;  3SKJ E;  2V4V A;  2Y6K A;  4GWJ A;  2OKX A;  3ACI A;  4A42 A;  4QDS A;  3K75 B;  1SG3 A;  1UY4 A;  3VDA A;  2VQU A;  3LE0 A;  2VMD A;  4W4Z A;  5LA2 A;  4ZZ5 A;  5JMO A;  3OEB A;  4QX0 A;  4JKK A;  2QQL A;  2VZ3 A;  3MV1 1;  3OGR A;  1NUK A;  3GGL A;  4A3Z A;  5JXH A;  1SHW B;  3I3B A;  3THD A;  3BGA A;  3NRU A;  4XZU G;  3CQO A;  4MGS A;  4BJ0 A;  2Y64 A;  3I2I A;  4XVH A;  2WDB A;  4XUP A;  1OF3 A;  3FHQ A;  3WNN A;  2VZR A;  2J1R A;  2JKX A;  2XQX A;  4P5Y A;  5F7U A;  1CZV A;  3WF0 A;  3P6B A;  2XOM A;  3WQB A;  4A45 A;  3LQC A;  2W94 A;  1DLC A;  2EID A;  3I2K A;  1OF4 A;  3HN3 A;  2EIB A;  2J1U A;  3THC A;  1UXZ A;  4CU9 A;  2BER A;  4CUA A;  3WNP A;  1L7Q A;  1R64 A;  2JDA A;  4CUC A;  1UMI A;  3ECQ A;  1EUT A;  2DCK A;  2VOT A;  4MGQ A;  3III A;  3WF4 A;  4CVU A;  3CMG A;  4LPL A;  4ARX A;  1PMJ X;  2VCB A;  1D7P M;  3UET A;  2QBX A;  3LPF A;  2YB7 A;  3ACG A;  4LHS A;  1K3I A;  1UY2 A;  4CU7 A;  4JX0 A;  2VL4 A;  4DEQ A;  2Y6L A;  1CZS A;  5LCW L;  4IUG A;  4DUX A;  3JXS A;  1O8P A;  3NJV A;  4MO3 M;  3U37 A;  4UI9 L;  1EUU A;  3WF3 A;  3I2H A;  3OB8 A;  1JZ2 A;  2WBK A;  4TXW A;  3NJX A;  5EJ1 B;  5JXJ A;  3T2Q A;  2VMF A;  1L7R A;  3C7O A;  4A4A A;  3WF2 A;  2C9K A;  1GOF A;  4P08 A;  4W8J A;  3VD4 A;  3ETP A;  3CZU A;  4ARY A;  3CZJ A;  1MPX A;  1W8N A;  2RVA A;  4OMC A;  3SEE A;  5LA1 A;  2ZEW A;  4QB2 A;  5JUV A;  3FHA A;  2W9X A;  3MUY 1;  2V5D A;  3PUI A;  4QDQ A;  3VDC A;  1W0N A;  3MBW A;  5IFT A;  3K77 A;  1UY0 A;  4DUW A;  3W5M A;  4MAD A;  2WAA A;  3HNB M;  2VZQ A;  2E26 A;  1JZ6 A;  2YFU A;  3HNY M;  3ABZ A;  5J1X A;  4CU6 A;  3LEI A;  2VO5 A;  2J1A A;  2DDU A;  2DCJ A;  2VZT A;  3K46 A;  4AG4 A;  1JZ7 A;  3MO4 A;  1JU4 A;  5I0D A;  5A1A A;  4MOA A;  4OUE A;  1W99 A;  2V72 A;  3IAP A;  3LEK A;  2QQN A;  2VJX A;  3VD9 A;  1GOH A;  3WNL A;  3T2O A;  3BN6 A;  3W5N A;  3K4A A;  3C7F A;  4PT6 A;  2BZD A;  2WN2 A;  3NQH A;  3OBA A;  2WQ8 A;  2RJ2 A;  5C71 A;  2VCC A;  2Y6H A;  5B4X A;  5JXI A;  4PF1 A;  1WCQ A;  2BBA A;  2JE8 A;  2C26 A;  3DYM A;  3VDB A;  3IAQ A;  2R7E B;  2Y6J A;  1JZ4 A;  1I5P A;  3FN9 A;  4E8D A;  4QX3 A;  5IJR A;  2J7M A;  4JKL A;  1CIY A;  4OZO A;  3E1F 1;  2W1W A;  3IB3 A;  2WAB A;  2Y6G A;  3VD3 A;  2VCA A;  4A6O A;  1GNY A;  1OH4 A;  3GM8 A;  2W92 A;  1GOG A;  2B9V A;  1XNA A;  2W5F A;  2VZS A;  2QQM A;  2W87 A;  1GU3 A;  1H6X A;  1JU3 A;  1KEX A;  4A41 A;  1US3 A;  3HPN A;  1K45 A;  1ULP A;  2E32 A;  2J1V A;  4RN5 A;  3T0B A;  1DYO A;  3C8X A;  3OGV A;  1US2 A;  2VZO A;  3MUZ 1;  2EIC A;  3ACF A;  4W50 A;  2W95 A;  2WZE A;  2QQI A;  2BGO A;  1K12 A;  3SKV A;  3HNM A;  4YPJ A;  2W47 A;  3C7G A;  1JYW A;  3I97 A;  4ZXE A;  4RYD A;  4D0Q A;  4XUQ A;  4DXT A;  3T08 A;  4P00 B;  1W8O A;  2ZEY A;  2ZEZ A;  5CYY A;  2WO1 A;  3T2P A;  4DEV A;  2VMC A;  3AC0 A;  2WAO A;  3T0D A;  1JHJ A;  4LQR A;  2XON A;  2YC4 A;  3FL7 A;  5G05 L;  5C70 A;  1JZ5 A;  2W1S A;  1TVG A;  4ZZ8 A;  1GUI A;  1P8J A;  1OD3 A;  4QB1 A;  1CZT A;  1UXX X;  3NNG A;  3OGS A;  4AAX A;  3D3A A;  1IQD C;  4ET7 A;  5B4N A;  4M4P A;  1DP0 A;  3EYP A;  5C7G A;  1JYN A;  2VM9 A;  5IHR A;  2J22 A;  3CDZ B;  4QX2 A;  1JZ8 A;  3ZM8 A;  4KMQ A;  2VC9 A;  3DEC A;  1UY1 A;  2VZ1 A;  2Y8K A;  2HYX A;  3VD7 A;  2E31 A;  2VR4 A;  4PQQ A;  2ZXQ A;  2BGP A;  1JYV A;  2W3J A;  5IYY A;  3I3E A;  2J1E A;  2YFZ A;  5G04 L;  2L9L A;  1K42 A;  1PX4 A;  3I2F A;  1J84 A;  3K4D A;  3CKH A;  2HLE A;  1UWW A;  1F4H A;  1W9T A;  1UMH A;  1SDD B;  4QPW A;  3OEA A;  3LPG A;  1KGY A;  4GZ9 A;  1W9S A;  2ORX A;  2RV9 A;  1ULO A;  4OYU A;  2VZU A;  4QX1 A;  4QB6 A;  3HJR A;  2J1T A;  1XPW A;  3WF1 A;  4BDV B;  1O59 A;  3P1I A;  5HXM A;  3IDA A;  3K4Z A;  4XUR A;  1NKG A;  3WNO A;  5EIY B;  2W1U A;  1GMM A;  4DXS A;  2KD7 A;  2W91 A;  4UOJ A;  1JI6 A;  1PX3 A;  2W46 A;  3GXU A;  1BHG A;  2WO2 A;  1O8S A;  4D8M A;  4L0P A;  3I3D A;  2VQT A;  4GWI A;  4BXS V;  4ZY9 A;  2LS6 A;  2ID4 A;  2JD9 A;  1T2X A;  2J1S A;  2W1Q A;  4QAW A;  1UX7 A;  1UYZ A;  4BK5 A;  2LW8 A;  2QQK A;  4E8C A;  3GDB A;  3WSO A;  1TG7 A;  3SEP A;  1OT5 A;  3HEI A;  4HG6 B;  5DQ0 A;  3A7Q A;  4KI5 M;  5FUI A;  3J7H A;  2WUH A;  1XC6 A;  1PMH X;  2YC2 A;  4JKM A;  4UAP A;  3T0A A;  2CDP A;  4JHZ A;  4P02 B;  2CDO A;  1JZ3 A;  5DN2 A;  2ORZ A;  2X10 A;  3EB7 A;  4Z2A A;  3A21 A;  1NX9 A;  3MV0 1;  1LNS A;  1J83 A;  3WEZ A;  2VME A;  5HPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...