4QB2A

Structure of cbm35 in complex with glucuronic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
molecule keywords Xyn30D
total genus 28
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb2A00
1UXZA 2CDOA 2C4XA 2W1QA 4QB2A 1K45A 2C9KA 3CKHA 4ZZ5A 2VZ1A 3MUZ1 2VCAA 3CMGA 4DEVA 1NAEA 5G04L 4JX0A 2YFZA 4CU8A 1UZ0A 4XZUG 2Y6KA 4CVUA 1H6XA 3LEKA 1I5PA 4W4ZA 1XC6A 4AAXA 4BK4A 2QQKA 2EIEA 2QQIA 4QDQA 2W3JA 3UETA 1K12A 3OGVA 1OF3A 5JXHA 3SEEA 4ZY9A 1F4AA 4Z2AA 1P8JA 3WSOA 3K4ZA 3DYMA 1GOFA 1CIYA 5JXGA 2WUHA 4XUQA 2W1UA 3I2IA 3IAPA 2VZRA 1OH4A 3ACHA 2Y6LA 3LE0A 4GWIA 2V4VA 5C71A 4FI9A 5C70A 3BGAA 3I97A 3LPFA 3WEZA 2J1EA 3WF0A 3WNNA 2VR4A 4XUOA 4JKMA 4XURA 3WNPA 3GXUA 2WAOA 1DLCA 3VDCA 3I2FA 2HYXA 4ZXEA 3SEPA 3T09A 1JYVA 1UX7A 1JYNA 3A21A 3WF1A 3IIIA 3I3BA 1UYXA 3OGRA 1K42A 2VQUA 4P02B 1JU3A 3I3DA 2VMEA 3T08A 2RJ2A 4KI5M 2XOMA 1LNSA 3CZJA 3A7QA 2XQXA 3T2PA 3WF2A 4P5YA 1L7QA 1XNAA 4ET7A 4D0QA 4L0PA 1JYWA 1PMJX 4XUNA 3T2OA 4QX3A 3I2GA 1DYOA 3ACIA 2WQ8A 2YG0A 3CDZB 3HN3A 1UXXX 2WYSA 3K4DA 5FUIA 4LKSA 5IYYA 2WDBA 5A1AA 1DP0A 4D8MA 3WNLA 5EJZB 2VZUA 3NJXA 4ARYA 1EUUA 4BJ0A 2W5FA 5J1XA 3UESA 1O8SA 1PMHX 1JU4A 2QBXA 3W5NA 5DPNA 2BZDA 3EB7A 4QX1A 1ULPA 4M4PA 1R64A 4DXRA 1UMHA 4UOJA 2W91A 3WF3A 2W1WA 3UNPA 5IFPA 2ZEXA 3WNMA 2CDPA 3MO4A 2W9XA 2E26A 2VO5A 4MGSA 1BHGA 2J1VA 4OUEA 1K3IA 2VMCA 1TG7A 2BGPA 4CUCA 2ORZA 4LPLA 1NUKA 2ZXQA 2BERA 2V5DA 3HNMA 2W1SA 2VMFA 2E33A 5HXMA 3MUY1 2EIBA 3I3EA 3T2QA 3MV01 4QDSA 2W47A 1O8PA 3CZUA 4BK5A 1XNTA 3K4AA 2WN3A 4YPJA 5LA1A 2QQMA 2ID4A 1J83A 1J84A 1SG3A 3J7HA 4KWUA 4MADA 1GOHA 3HEIA 2W92A 1UY1A 4W8JA 4DXSA 3W5MA 4A45A 2QQNA 2WO3A 3T0DA 1CZTA 3FL7A 2VZVA 3C7EA 3C7GA 3HJRA 3MV11 3C8XA 3WQBA 4CU7A 3PUHA 2LS6A 2LW8A 1GU3A 2ZEZA 3DYPA 4JKLA 3ETPA 2VCBA 3OG2A 2V72A 1CZVA 2WAAA 4UI9L 2L9LA 2RV9A 3K46A 4JKKA 1JZ8A 2VZPA 3IB3A 3WNOA 1YQ2A 5IFTA 1TVGA 2J1SA 5LA2A 5HPOA 3CQOA 2HLEA 3AC0A 1UMIA 3NQHA 4P08A 4LQRA 2BBAA 2J22A 4M4RA 2ORXA 2JKXA 4A42A 3WF4A 3ABZA 2J1UA 1US3A 2W46A 2WZ8A 3T0BA 3P6BA 3D3AA 5EIYB 5CZKA 2Y6GA 2WBKA 4CUBA 3ACFA 3THDA 3VDAA 2ZEWA 4BXSV 4OMCA 3NJVA 3LPGA 1SHWB 3LEIA 1T2XA 2Y6HA 1O59A 3P1IA 5G05L 1W99A 2XHNA 2E32A 4CUAA 1W9SA 2WZEA 2J1TA 1JZ2A 1D7PM 2YFUA 3OBAA 1RYYA 4DUWA 2DCJA 2X05A 2RVAA 1UWWA 2VQTA 4BDVB 1H6YA 4E8CA 2VZQA 3F2ZA 2YC2A 3E1F1 4QX2A 5JMOA 4UAPA 1L7RA 3FHQA 3HNBM 3K77A 2VJXA 3HOBA 2EIDA 5CYYA 5C7GA 1CZSA 4CU9A 4IUGA 1UY2A 1W9WA 4A3ZA 5LA0A 2VC9A 2DDUA 5JUVA 4OZOA 5JR2A 3DECA 2YC4A 1PX4A 3MBWA 1JZ4A 3VDBA 2Y8KA 3FN9A 2C26A 4A44A 2WO2A 2J7MA 3WNKA 5F7UA 3PUIA 2WN2A 4QDRA 1GUIA 4TXWA 2VMDA 1HN1A 2VM9A 4DUXA 3ZM8A 2PQSA 2YB7A 1W0NA 1W8OA 2X09A 4PT6A 1JI6A 1PX3A 4LHSA 2W87A 4XVHA 5IJRA 3ECQA 1OT5A 2VZTA 1JZ7A 4KMQA 2E31A 1OD3A 4OMDA 1GNYA 3SKJE 3VD4A 3VD7A 2EICA 4HG6B 3LEGA 4CU6A 5EJ1B 3SKVA 4QAWA 4AG4A 1JYXA 4TTGA 5LCWL 2B9VA 2WABA 1WCQA 4GZ9A 3C7FA 1OF4A 4E8DA 4QB1A 1UY4A 3CIHA 1US2A 5B4NA 2JE8A 2J1AA 3I2JA 5B4XA 3NNGA 5JXIA 2W95A 3BN6A 2WO1A 1SDDB 2QQLA 3GDBA 1GQPA 1CX1A 3U37A 4OYUA 3VD5A 3VD9A 4PQQA 1JZ5A 2QQOA 4DEQA 1JZ3A 2BGOA 1XPWA 2JD9A 3A23A 1JZ6A 3OB8A 3T0AA 1WKYA 1EUTA 1JHJA 3THCA 4MOAA 5IHRA 1KEXA 1MPXA 2VZSA 1GOGA 1UYZA 2KD7A 3IDAA 3K75B 5I0DA 3I2KA 2DCKA 1GMMA 2XONA 5DMYA 3IAQA 4ZZ8A 5DQ0A 4PF1A 2QQJA 4RYDA 1ULOA 3C7OA 4DXTA 1UYYA 2VOTA 1IQDC 3I2HA 4A6OA 5DN2A 2OKXA 4DUVA 4JHZA 1UY0A 3HNYM 3OEBA 3JXSA 1NX9A 3NRUA 2VCCA 4GWJA 1F4HA 1UY3A 3HPNA 2X10A 3OEAA 2Y64A 2Y6JA 2W94A 3VD3A 3ACGA 3EYPA 2R7EB 2B4KA 1NKGA 4QPWA 3C7HA 2VZOA 3GGLA 4MGQA 4QB6A 2ZEYA 2VZ3A 4W50A 4MO3M 3DYOA 3OGSA 4P00B 2J1RA 3FHAA 3A22A 2VTFA 2Z4FA 2VL4A 4XUPA 4RN5A 1KGYA 4QX0A 4A41A 4A4AA 4XUTA 4ARXA 3GM8A 5JXJA 3LQCA 1W8NA 1W9TA 2JDAA
chains in the Genus database with same CATH superfamily
2CDOA 3WZ1A 3SCHA 4YW4A 4QB2A 1RUE2 1K45A 2TNFA 4AI2A 2RS51 4E2QA 4XF1A 5CFCB 4QGMA 3OUJA 1T6GC 3KCCA 3CKHA 2D43A 3IMNA 1FNYA 2MEV3 4XFAA 2ZGQA 3ZSJA 5FLIA 3VBHA 3WDXA 1VAMA 2VCAA 2E7QA 3ZFFB 3CMGA 2LM3A 4JX0A 5G04L 2YBPA 2YBKA 1FT9A 2PHRA 1G8WA 4LLOA 5AC91 1RUG1 1HW5A 4IV3B 4RS5B 1H1MA 4HBNA 4LOSA 5CG8A 2G9GA 4ISRA 1OMIA 2QQIA 2YXSA 3GZEA 3B5LB 2ATFA 1RUI1 1UU5A 4QPGB 3UK9A 1K12A 4WBBA 3WDUA 1XOYA 3ME2A 4I0BA 4Y26A 4AL9A 3AP5A 1RVF2 4NPMA 1RXGA 3MLJA 4BM8A 4Z2AA 1P8JA 4FPHA 3D0SA 2RDQA 3SH3A 2VGDA 2CU5A 1UZWA 2PAEA 4K20A 4L92A 4PLNA 3MEPA 5BNPB 3W5NA 3ZVXA 1PK6C 2B42B 2A1XA 4QPYA 4PDWA 3IAPA 2XBO3 4Y1YA 4ZHNA 1MVQA 3LE0A 1E5SA 2JEMA 2Y6LA 4AFMA 3NKGA 2ZHMA 4NPLA 5JIUA 2VW1A 4FI9A 3AL6A 1SLTA 3VL9A 1RTVA 4XOGA 5F39A 1IGOA 1XNBA 4HPKB 2WT1A 2BOJA 1TZOA 4INDA 4XAAA 1GICA 3U78A 4R52A 4JKMA 4XUOA 3RZJA 1RUNA 1Q8PA 4XURA 3WNPA 2WAOA 1X8EA 2RR11 4PI0A 3MIGA 1Z0HA 3VKOA 1J3PA 4UWDA 5IVEA 4ATFA 1O7FA 3BIEA 3A21A 4LORA 1YFYA 3ZMNA 1R093 4JTNA 2VG9A 1FAYA 1VBC3 2VECA 5CVRA 1UYXA 4JDMA 1REDA 4ZS3A 2RJKA 2ZTNA 1EPZA 1K42A 2QJVA 1CJPA 2PHFA 5FP4A 2WS91 2D6NA 2WT2A 2CAUA 2A6WA 3FHIB 5K9YA 1JTZX 3FFQA 1RUD3 2RJ2A 4Q8KA 3AJYA 3VBUB 2XOMA 5FWEA 4IE5A 3RWKX 3UGGA 5I93A 5AFEA 2BEOA 1C1LA 3CZJA 4TLFA 2DBIA 5F32A 1NYWA 1VBE1 2K46A 4A2UA 1L7QA 3SMHA 3FX3A 1QOOA 4ET7A 2P1BA 1PMJX 2AACA 1D0HA 1DGWA 5FY5A 1XB9A 5FAXA 1VAKA 2P6HA 4AEMA 5JDBA 3B3QE 1AL0G 2DWRA 5EV7A 3PJQA 1A34A 1UAIA 5A32A 3RZMA 5FY4A 5GM0A 4K8RB 3INAA 4O65A 1RUF1 2WQ8A 3CDZB 1W6NA 5L7OB 5FMOL 2FD8A 1GYKA 5FV3A 4NR1A 5FLHA 3K4DA 4TWTA 4S2GA 1KS5A 3RJRA 1S2BA 1NA1A 2WDBA 3MFAA 1A8MA 5FMDA 4GKYA 3ZPOA 2XBO2 3GYDA 4MHRA 1GANA 3WNLA 1O3SA 1B09A 4OCTA 2KXLA 2WR9A 3ILFA 4NPRA 4FT8A 5HCFA 1EAH2 3FE5A 3JB8A 1NLQA 2ARCA 1QJEA 1V6MA 1TME1 2GC1A 1SLIA 4LO7A 5JPMB 1RITA 2VBPA 1V6IA 4LKFA 5DABA 1O8SA 1SCSA 2UYBA 3MPPG 5J3UA 3V0AB 2Y6FA 4QU1A 1AR91 5ABJA 4UFHA 1CJDA 2FDJA 5FZEA 5CFDB 3AMQA 2K2SA 3EQEA 1VBD3 4N8MA 4QHOA 4CA9A 2FZ1A 3JBG3 2JDHA 3TN91 1UMZA 3B00A 1S0JA 4E27A 2A3WA 4EWEA 2QQPA 3UNPA 3KQRA 3PVOA 1APNA 3GJBA 4ZS2A 1E57A 1VRH1 2CDPA 3AXEA 1SFPA 3MO4A 4HXCA 4OI0A 1TMF3 1HLCA 2XKOA 1BHGA 1RJ7A 1LCLA 1AZDA 1NCQB 2J1VA 4LLFA 3VN4A 5IVJA 4XFBA 1S0GA 1ZBA3 2XVGA 3OTFA 4OUEA 2VMCA 4LHLA 1TG7A 3DKWA 1I3HA 4NN0A 4ZXKA 4Y5SA 2DYCA 2RM21 3O1OA 1V6KA 3N7KA 4FPFA 3HD8B 1C4RA 4CUCA 4LBQA 5IWFA 2ORZA 5KHGA 2WA3A 4QT6A 2JWPA 3IDEA 5FMBA 5FP3A 5A70A 5LY1A 1S0CA 1NT0A 4AEDB 1LECA 1ZBE1 2W1SA 3KSCA 5HXMA 2JE9A 1VIWB 4XW3A 5FXWA 2RR12 3VV1A 2GH2A 3LGRA 3FMGA 1UIKA 1WW6A 5KHKA 1H2LA 1VBA1 2R061 3BIWE 5A3WA 1LOFA 2B46X 2ZOEB 2R043 4WM8C 3PHMA 1VBA3 2R063 5FYUA 3THTA 5FPUA 5CISA 4LXLA 2JDPA 2WN3A 3N9NA 5LA1A 3WQ0A 2SBAA 1W8TA 1CWPA 3I8TA 4MYEA 1SG3A 1J84A 3J7HA 4QPGC 3H1WA 4MADA 2F4LA 2BP6A 1LTEA 1V9U1 3RZKA 4LTAA 3V56A 1N1YA 1PZ9A 1PNGA 1FV2A 1KDKA 3A4UA 5LK7B 1I1EA 3KF3A 4QKBA 5DUVA 2D6MA 3KCYA 3C7EA 3SXWA 3C7GA 5L9RA 1HRV2 3KT1A 2QQWA 4FPLA 3O1SA 2Q8OA 3WQBA 1SPPB 3BVCA 2DCYA 5DZEA 4LO6B 5IK8A 4FBFA 1G9FA 3KMHA 4YGCA 4DRVA 4XF4A 3SHRA 4MG2A 4NIGA 1H4GA 3NNMA 2XUMA 3DYPA 3NV4A 4XYXA 1H8TB 1CIWA 3POEA 2GNMA 5A6YA 4P9XA 3V65A 1FYUA 3M2MA 1J1TA 1N3QA 1RUF2 3I2OA 4UI9L 3JQXA 3FLPA 4BIOA 4CCDA 1ACCA 2ZHLA 1TNFA 5DDJ2 4MLOA 4F83A 4JKKA 4XFIA 3TN93 4BZ4A 1JZ8A 3DF0A 3MIDA 4YVWC 1MQTA 3W58A 1TVGA 2Q5TA 1OSGA 3AP6A 3ATGA 1D4M2 5K8SA 4AI9A 1WUVA 3N9OA 3J8F3 2G1MA 1CQ9A 5KHHA 4WVVA 3CQOA 4LOTA 2Z79A 2Q4SA 1TME2 1UMIA 1UOBA 1WD4A 4C1WA 4IEWA 4LQRA 2BBAA 3KV6A 4PIZA 3BODA 3H3UA 2J22A 1ND2B 2ZABA 4BQ3A 4FAGA 3U4SA 4YRDA 5FZAA 3VBOB 5FO7B 5A7WB 3WF4A 1SBDA 3AZZA 3PMSA 4J6GA 3VBHB 1YIPA 4XBQA 5F1RA 1OH3A 3CU7A 3D3AA 1ZZ9A 2NZ9A 5DZGA 5EIYB 4AQTA 1SLLA 1VRH2 1CAUA 2IXCA 2R072 3WP4A 2WBKA 1COV2 3RZZA 4KQ7A 2NMNA 1W6OA 1F9KA 4YFZA 5E6HA 1KS4A 3V0BB 3LPGA 1JHNA 1SHWB 2ES3A 4GMP0 1UOGA 1W6QA 3AKRA 3BU7A 4HMZA 4JDNA 5G05L 5CFDA 4CCLA 5BV6A 4Q1PA 1W9SA 3P3PA 4GWMA 4PCRA 1D7PM 1VMJA 2A5ZA 3ZFEC 3MGUA 1YHFA 4I02A 5ERLA 1NA1C 1D4VB 3VGIA 4DUWA 5BNNA 2WS93 1E5RA 2WC2A 4DFSA 3VBRB 1R1A3 1W28A 2JG9A 2IXJA 4YGBA 5JAXA 1GNHA 2DV9A 2XWJB 3POIA 2EXIA 1GZWB 3ZYHA 2IC1A 3MFCA 4V1PA 1HQNA 2TEPA 1VBA2 2R062 1SCRA 1QXPA 5EHDA 3VLBB 4D94A 3HNBM 4HK9A 3K77A 2VJXA 2OQ6A 2GN7A 3POFA 3IN9A 1BBT3 5C7GA 1W3VA 4W6XA 3UKVA 4LT5A 4DS0A 2A70A 2DURA 5FZFA 3R4UA 3NAPB 4C0BA 1NE6A 3RWNA 2AREA 2VC9A 3PLQA 3ZFGA 5C33A 5IVCA 2G9ZA 5JUVA 1W9YA 3DECA 1DQ5A 3OGJA 4IEUA 3TNQA 3U1XA 4OHXA 3FBMA 1QJX3 2WZR1 4GMP1 4YZ1A 5L73A 4XF3A 4XBNA 3ZDSA 2ZGSA 1DZQA 2DBNA 2JJ6A 1FPN1 3JCIA 5F2SA 2C26A 1BK0A 4ISQA 4A44A 2WO2A 3N35A 1PO12 1JS9A 1MZFA 3WNKA 4CEYA 3PUIA 2FMDA 4DUXA 1NCRA 2YB7A 5A3OA 2E9QA 1W8OA 2WNOA 4PDWB 4PT6A 4XQWA 3KT4A 3OGGA 3MF9A 1OLQA 1KFUL 3J7NA 4XVHA 4CXYA 4S2HA 5EWSA 5I8SA 5A7PA 3F95A 4YARA 5CKQA 5ABJB 4OZXA 2CGNA 4AFAA 1N3OA 3SISA 3H50A 2E31A 1YIFA 4K40A 4CXWA 1HXS3 1OD3A 2WNUB 2GAUA 2CGOA 2XB6C 3PVBB 5C4WA 1GNYA 1ZZCA 4W65A 5EXOA 2OZJA 5I0SA 2RS32 4R9CA 4HG6B 3LEGA 1SLAA 4CU6A 1CAVA 2ZKLA 5EJ1B 2LROA 1NOVA 4AVSA 2MEV1 3SKVA 1UO9A 4AG4A 5A7SA 3VHOA 1C8M2 4CRQA 2RS53 2GP3A 1UX6A 4AGRA 3S7EA 1WCQA 4QQHA 4Q4W2 4LHKA 2PXJA 1CR7A 1KRIA 2A6ZA 4GA9A 3CIHA 1PK6B 3HBZA 3K51A 1C8NA 4CP9B 1XYPA 1Y7BA 1A6CA 1UQXA 1DGWX 4Q0VA 4Q4Y3 1YQ8A 2JE8A 3GCXA 3K2OA 2WT0A 5A1FA 3TEWA 4QQLA 2ARAA 3BN6A 2BPA2 1SDDB 3ZIXA 3HT2A 4B29A 4OYUA 2XJQA 1UW8A 1RUD2 4XC9A 3AVRA 5BNQA 4PJYA 1ZREA 1ZNPA 1PO13 3AVSA 5FO8B 3LF7A 4FVVA 3WP5A 3ZXAC 2HWD1 2Q1ZB 4NAMA 4Z07A 2WFF1 3D8CA 4YGEA 1KFXL 3PU8A 4X6RB 1JHJA 5GZDA 4Y4RA 4UF0B 2RE9A 3NO8A 3ZPYA 3J7MA 4AWDA 1CVNA 1GOGA 3AZVA 4Y20A 2XJPA 1WW5A 3MIBA 4XJUA 1LB2A 1B35A 5CA6A 4DQAA 4KL1A 3CJIB 2JICA 1GMMA 2XONA 5DAWA 1H2MA 1W0OA 2DFCA 3D82A 1W0PA 1W8ZA 2D6KA 4IQPA 1ZRDA 1IZ3A 4ITCA 2XJVA 4YM0A 3ZN5A 2OT7A 1DQ1A 4C1XA 4SBVA 4OUMA 1OI6A 3ZFEA 1VB4A 3P5BA 3PNAA 2PHTA 4KU8A 4RYDA 1HV0A 1LHNA 1A78A 1X33A 2D97A 2PAMA 1ULFA 2RDSA 3J9SA 4P9GA 1UYYA 5ACA2 4CEYC 1IQDC 3KZ4C 4CEWB 5I91A 5C9AA 1BMV1 1R1A2 1X82A 2PHXA 4Q2FA 5DN2A 1UF2C 3B7MA 3VZOA 2VTXA 3U0ZA 1O91A 4G3YC 3HNYM 2XVLA 3VBUA 3NRUA 4I0WB 1G9BA 2VCCA 4A7ZA 2O8QA 4ZU5A 4AVVA 1QJFA 4D6QA 1HDKA 4QKFA 5DAVA 5FY0A 1VALA 2W94A 3ACGA 3JZVA 1LGCA 4HETA 4YFWA 1QOTA 2GC2A 2UYAA 1K5MA 1VPHA 1REFA 2VZOA 4I01A 4ZPIA 1NY72 1OFNA 2QDNA 4CDQA 5I0RA 1DGLA 3ZX7A 3MZHA 3HWJA 3AB0A 3KF5A 3ZSLA 1OC1A 5CBLA 3FHAA 3KLSA 4IESA 4ASLA 3G6JB 4D3WA 3UV9A 4EV0A 5LEKA 1HQWA 3WG2A 3BOWA 2RMU2 4K9SA 2UURA 1PZ8A 3CJXA 1G9CA 4A41A 4NIDA 2BBVA 2I07B 1PGW1 4AHXA 3B01A 1RUI2 1N1TA 2IVJA 4M3CB 4HVRA 4DMIA 5FCCA 2UY9A 2ZHNA 3MIEA 1YFWA 3PTYA 4OVEA 5FPXA 3L2YA 5LZ6A 4URTA 1O5UA 3VBFA 5FZ1A 4NJ4A 4BU2A 2C4XA 5DUUA 1NQDA 4RQPA 4KGGA 4RHV1 5DXDA 1YJLA 3SCGA 5IVFA 2C9KA 4XTPA 1LOGA 1QQP3 3BPSA 4LUMA 2WZPP 4TYSA 4PBPA 3H8XA 3MIFA 2CAVA 4QXBA 4L99A 3DCQA 3GALA 3T4HB 2VD7A 4JHTA 1AX1A 4Y1ZA 2YHJA 1NXD1 3D5OA 4CU8A 4WM8A 3NNJA 4N7IA 4Q27A 4G4FA 1D0GA 3OBZA 2ZX2A 4K8FA 1I5PA 4TN7A 2BOIA 3FWEA 4XF0A 5LASA 2DVFA 2HWF3 5TSWA 2D3RA 4JVAA 2NQYA 2WFF2 2W3JA 4META 4PLMA 2ZJCA 1QDOA 1EV11 2GP5A 2C1FA 2JB4A 4H7MA 1OOPB 5F3GA 3DYMA 1MS8A 3H8OA 3KT7A 1YNAA 3WXPA 3KM5A 5HXVA 4CP2A 1ASJ1 1C8M3 1MQTC 4UW4A 1LGBA 1RB8G 3VBRC 2DCTA 1OH4A 5A33A 4GWIA 2B39A 1CD3G 4XDPA 4JQRA 1FMD3 2D93A 3BGAA 3WUCA 5C70A 2AC1A 5FYVA 3WEZA 3WF0A 1HXS2 2TUNA 4IDZA 4OUSA 3GCWA 1ZRFA 3LD8A 2HWB1 2VR4A 2OA2A 1DQ2A 4P5HA 4EQVA 2EAAA 3TBDA 3GXUA 3KHBA 3W59A 4J25A 3VDCA 3I2FA 1W2TA 3POGA 3T09A 1JYVA 1UX7A 3WVJA 1W6MB 1GP4A 1Q8OA 3I7DA 4UT5A 1XSQA 3I2DA 5FPLA 5JVVA 3ZSMA 4CDUC 1ULCA 4YZ3A 4YNIA 4LK6A 1Q3EA 4NIIA 3OGRA 4XJAA 4Q4X3 2BV4A 1QWRA 5KR7A 3TEYA 3I3DA 1QY4A 3H42B 3NV2A 3I59B 4WZCA 3M7AA 4RFT0 4CEYB 2R0HA 4MVTA 5KBFA 2XR4A 5DG1A 4AVBA 4KI5M 2D40A 4OQ8A 1LNSA 3WQ1A 2FHRA 4BIFA 3WF2A 1PGL2 1VBB2 2NYYA 1UZYA 3VDDC 3PURA 1PO23 5DUXA 2XLFA 1NLSA 1CAXA 1XYNA 4CP9A 4I09A 1XNCA 5FZDA 5A3PA 2P4EA 1W8UA 3I2GA 4CTEA 2ZX1A 1BBT2 5T5OA 1DYOA 4AI0A 2XGXA 3GF6A 1LOFC 3HN3A 5E88A 3HBKA 4YW6A 1HB4A 5CFCC 1HQLA 1ULGA 5FUIA 4IE6A 4LKSA 1IPJA 4IW3A 5A1AA 4YW2A 5FXZA 1LAJA 2VOVA 3S6PA 2YMZA 4HSJA 2VZUA 1O3TA 3RJ2X 5EYXA 1QNYA 4Q26A 1GZ9A 1EUUA 2RM22 4H7LA 3VBRA 4GJZA 2XDVA 4BJ0A 3U4XA 1LULA 2R0FA 3SNMA 3BUCA 5SV5A 1S0EA 3H8RA 5FYIA 3UESA 3CEWA 1PMHX 4NRPA 5FZOA 1AR83 1UL9A 1XU1A 1SFYA 3A0KA 3AFKA 4IE7A 2HWC1 2PHDA 4QX1A 1VMFA 1GBGA 2YY1A 2E63A 3R4SA 5GLZA 1UYPA 2XWBB 3HQUA 1POV0 5FK8A 2PYTA 2WNUC 5FYSA 2ENRA 2W91A 2MHFA 1AR81 2B5HA 1TEIA 3WF3A 5IFPA 3WNMA 2HWE2 4YWAA 5IK4A 1OOPC 1U5ZA 5FY8A 2P3KA 5FRAA 5BNOB 1RUG2 4JAAA 4XIOA 4UW5A 4YG3A 3ZYFA 2RS12 4R9BA 2E26A 2Y38A 1LHWA 1QQP2 3POBA 1UIJA 1NZIA 5EJ3A 4IV1C 1H1AA 5A3NA 2ET7A 4XDOA 3ST7A 4AXOA 4RGKA 5CADA 5A3TA 1LU1A 2X53S 5JPNB 4LE3A 4XBLA 4AQ2A 3Q9OA 2ZXQA 1ZVFA 4ZU7A 4Q0QA 1PVC2 2BERA 2QCSB 1H30A 3LA2A 3PL0A 2P3YA 1ST8A 2HWB2 3ON7A 3HNMA 1D4M3 1U0AA 1B35C 2WWJA 2I2SA 3MUY1 4QMAA 5E16A 4CCOA 5LWBA 2VOKA 3HQXA 3Q8FA 2RMU3 1EYBA 3ASIA 3I3EA 3T2QA 1MQTB 3E5QA 3MV01 5IT6A 1UPSA 2HYKA 2W47A 1EP0A 1U5XA 3H3LA 2Y26A 3ZIWA 5JI7A 1CAXB 4URAA 2VNRA 2BW8A 5C9AB 1NE4A 3WDYA 4BQYA 3M4FA 5FMOS 2BYVE 3NJZA 2JDMA 4RR3C 4W8JA 4DXSA 2AH2A 1UZZA 3OY8B 5J96B 3W5MA 2BJSA 1YWKA 3AKPA 4CDQC 5IVVA 4JGZC 4M0NA 1FOD2 2C24A 1GZTA 2QFEA 1PIV2 3VZNA 5J7MA 2NLRA 2X8KA 2JDNA 3HJRA 3MV11 5E1RA 5FJKA 5A32B 3C8XA 3IPVA 5ANQA 3LDRA 4WVMB 4TSVA 1KD7A 1L3JA 1SEFA 4LBQB 4JKLA 1O3QA 3GZTB 1WBLA 4IEXA 5C8CB 2VCBA 3OG2A 1YJKA 4LULA 3OCPA 4QD2A 1MS9A 4J1WA 2R042 3ACLA 4AFBA 3PIGA 1VBE2 4HPKA 4YLZA 3V0AA 1AYM2 5C9AC 4E2SA 1AXZA 3WNOA 1LEDA 4MXVA 1VR3A 4QPIB 1JUHA 2ARBA 4N9HA 1X50A 2F4PA 3IIAA 3PVEA 3Q8BA 5A7WA 3T1MA 2GC3A 4QX5A 2R32A 1AR73 4XFCA 5HPOA 2YGMA 1RHI3 4Q1RA 1UPIA 2HLEA 3AC0A 2ET1A 3CL1A 2VMHA 4FTEA 3RNSA 1IPKA 4AOCA 1AR72 3WP6A 1LJ7A 1XE8A 4KG0A 2IXIA 4EN9B 1XSRA 5FZ3A 2P2KA 2JENA 3DXUA 2GC0A 3H1YA 4Q4V2 4M4RA 3ILRA 2HWF1 4RD7A 2ORXA 2EA7A 1RINA 1HB3A 2JKXA 3OBTA 3QBQA 5I0UA 1MS1A 4HONA 4EN6B 1NCRC 2NN8A 2VUJA 2D3PA 2OQ7A 4MGIE 2YC0A 5F5QA 4NROA 1RL3A 3BTZA 4WZFA 2XQRA 1DDLA 1ND2A 5KXDA 4CDWC 1OKQA 4XJWA 2AGSA 3ACFA 3MDPA 3THDA 2A6VA 2ZEWA 3DUIA 4A7KA 4BXSV 2KR2A 1SLCA 2XJSA 4OMCA 1QQP1 5BNPC 2JE7A 1PO21 4LIVA 3C3VA 4O9EA 4QQOA 1QHDA 2C5DA 1XRUA 2D44A 2VNVA 2Y6HA 4QKNA 2D7FA 4WVMA 4CCJA 3NNLA 2XHNA 1ZM1A 5FKBA 2WZEA 3NJYA 1JZ2A 2YFUA 3OBAA 2W0XA 3RS6A 1AR63 3WD5A 1UWWA 1AJKA 4E9KA 2O8OA 2RS52 2WRAA 5FZIA 4MX3A 4N90A 2VQTA 3PUQA 4BDVB 1H6YA 2WA4A 4Q4X1 5KXEA 1BK1A 1WLWA 1UKRA 4OHYA 3E1F1 5BPXA 5FJHA 3WDWA 2ZMNA 5JMOA 4AK3A 4XCBA 3LDKA 3POWA 5FIXA 1MEC1 4CDWA 4AQSA 1L7RA 1YCIA 5FPBA 4QXKA 5EFUA 4AVCA 1LU2A 4MGZE 2ZAAA 1UN1A 4AI3A 5CYYA 5AC92 5JLVA 1CZSA 5ISLA 5L9BA 2XJUA 4LUKA 3L2HA 4NUBA 5C8CA 4CSWA 2HWB3 1BQPA 4LEJA 5FZKA 5EP9A 4FPOB 4QX7A 1W6MA 2YV8A 3DGTA 4EROA 1YYNA 3OUIA 3WDTA 3KGZA 1UU4A 2YU2A 5JOYA 2AZ5A 2YC4A 2A6XA 2VE1A 3O0WA 1RUJ3 3U14A 4BLJA 5JI9A 1A3KA 4NHXA 4I30A 1JYIA 1QIQA 2DTYA 1W90A 2LRPA 1ASJ3 1C8M1 1DZTA 2UY8A 4YVSB 1OUXA 4F3JA 1D2SA 1YFUA 2Y60A 1GUIA 1DGRN 1GP5A 1L7LA 1VBC2 2VMDA 4Q4W1 4TXWA 2K0GA 1RGSA 1W0NA 2OXBA 3ZFFC 2VNGA 3ZO0B 4AEDA 1PX3A 4Z82A 5A33B 1Y9GA 2W87A 3MPBA 4B1LA 2W2IA 2G19A 1K5JA 1H2KA 5IJRA 4B7KA 4BYYA 4D6SA 4BQWA 3WUDA 1CX4A 1R081 3ECQA 1MACA 5LRSA 4LBQD 2VZTA 2FCTA 1HJGA 2OUJA 5FZHA 3R05A 5FZ6A 1UNBA 4RR3A 5FK7A 1GLHA 4YM1A 4CDWB 3SLIA 3KVAA 1BVVA 3O14A 4RQPB 3ETQA 4NOTA 3VD7A 2EICA 4EWDA 1QU0A 2QNKA 1GKBA 2VW0A 4AHZA 4B8EA 3ZSEA 4BWOA 5A7NA 4FFHA 4QAWA 4LKDA 2HWD3 3LSDA 3N9LA 2HWD2 5FOBB 2WYFA 3ILNA 1F5FA 4RHV3 5CKNA 1QEXA 1HRI2 5FFOC 5KXCA 5KC6A 1RUC1 3QLQA 4R9AA 3LEMA 3I59A 4QB1A 3SH4A 4K21A 1VLNA 2D98A 1NG0A 3U11A 2VH9A 1US2A 3ELNA 1H8VA 2VVEA 5IW0A 4QPGA 2BNMA 4NHMA 3VBOA 1O4YA 5CFDC 2J1AA 1PO22 3FLRA 1CAWB 5LK5A 3WY6A 1ZA7A 4XE9A 5JXIA 2W95A 4QX8A 5FPZA 5FZGA 3M3IA 1GQPA 3NVCA 3OSDA 2VPVA 5GALA 4LK7A 2QQOA 2E6VA 4FPGA 4EN7B 4H55A 1DQ4A 1S1AA 1WCDJ 4IV1A 1DF0A 1ALYA 4FPCA 3DN7A 3FFZA 3HT1A 3ZLIA 3WINE 1IKQA 2A3XA 4ZONA 1DZRA 2IFWA 1OFSA 5M0TA 1EPWA 3THCA 2VMGA 4PHZA 2LALA 2VVDA 1Z7S3 3WDVA 4JGZB 1C3HA 1JMUB 2VZSA 4CDQB 2PMWB 3IPVB 1H8TA 1UYZA 2KD7A 3IDAA 3IMMA 1AR92 3CLPA 3K75B 5I0DA 2JDYA 2DCKA 3RMXA 1Q43A 3WCSA 5FP7A 1NY71 3ZFGC 1W6PA 3IAQA 4ZZ8A 4L2NA 3QH6A 2H0VA 1N1VA 2BWCA 1AX2A 3DKQA 4LBLA 5DDJ3 4R9DA 1W06A 5JOZA 3E5UA 2VUCA 1ZZBA 1DHKB 5CFCA 4EE2A 2PLV3 3ZN6B 3N9PA 2QQVA 4HZFA 4COYA 2I45A 4BH9A 5K0UA 1YEWA 3I2HA 3ZMOA 5FPVA 4Q0SA 1CPMA 4JHZA 1W3XA 4DIQA 2DVAA 1F5JA 4CCMA 5J09A 2A71A 3ENRA 4XJ8A 3OEBA 4IEPA 4HN1A 3JXSA 1NX9A 5IVBA 2VAUA 3ZFEB 4QGLA 2JD4A 2PELA 4MXWB 5JZGB 4XMAA 3QACA 4KG8A 3LWCA 1W2OA 3ZDVA 2WFF3 3R4DB 5BNNC 2Y64A 2DU0A 3VD3A 2ADDA 4BOWA 4JRLA 2R7EB 1J3RA 1HB1A 1PO11 2B4KA 2RDNA 2WLPA 3C2UA 3ITQA 3C7HA 3TYJA 2CGPA 3TB0A 2BDRA 4MGQA 5E8AA 3J26N 2YPJA 2CSGA 1IQAA 3S30A 3URFA 1AJOA 3ZOIA 4Z8BA 1UZVA 1QDCA 2PLV2 3AZYA 3FC0A 3DYOA 3OGSA 3O7OA 4JZRA 5FY7A 3FJSA 2NPIA 1A8DA 3A22A 4QPIA 2Z4FA 4JGYA 2VL4A 4LA2A 4DINB 3O0VA 1O4ZA 4M3CE 2ZMLA 1IG3A 3MF6A 3AFGA 4Q8LA 1LKNA 4RN5A 2ZCWA 1W6QB 4WM7A 4A4AA 1Y43B 4XUTA 3LZZA 4P9YA 5FYHA 4HFSA 5LA9A 3VBOC 1HIXA 4DZGA 1ULDA 4Q4V3 3NV1A 3AP9A 1NXMA 2Z5WA 3IBMA 4W6YA 2N7GA 1G9AA 5C5TA 1RUC2 1PZ7A 2JDUA 4QKDA 2PHUA 1UXZA 2RS31 1RHI2 1STMA 2VUAA 4GAZA 1F35A 1JUIA 5GLVA 2ETEA 1JN2P 4HK8A 4WM8B 2VBBA 2XG3A 5IATA 1S0DA 2WJSA 3N7JA 4ASMB 4LO5B 4IV3C 1OQ1A 2DUQA 3A0NA 3MUZ1 4J1XA 4P9IA 4BHPA 3H7JA 1WMFA 4BQ5A 1PHMA 5JMCA 4AEDC 1G9DA 4KWLA 4DXZA 5BNOA 4CYDA 1CESA 3WW1A 2YFZA 2Q8EA 3LFIA 4RS5C 5JCTA 1UZ0A 2JKBA 4XZUG 1QOSA 3WOGA 2ZPXA 4CVUA 1KJRA 2VU9A 1XC6A 2E7TA 4HLTA 4W4ZA 4YW1A 1CAUB 2A73B 3AK0A 1X9PA 1XXNA 2QQKA 4BK4A 2UU8A 4CE8A 2R49A 4OHZA 1IKPA 2XHKA 3OOXA 3UETA 5JXHA 3OGVA 1OF3A 2R30A 4BLIA 2RDRA 2GMPA 5FY9A 1AYN3 4ZY9A 1F4AA 5DUWA 1ZRRA 1HRI3 4LMFA 1CIYA 1IHMA 4AAXA 2GNBA 4KBBA 4TZDA 2VOXA 1ODNA 2HJIA 4LKEA 4XUQA 2JG9B 2W1UA 1DU3D 1FPN3 1JOPA 2H0BA 5C3QA 3I2IA 2EXHA 5KHIA 3WNXA 2ZZJA 1QJX1 2E7AA 2P37A 1ENRA 4GMP3 1E5HA 2V4VA 5C71A 5D8AB 1W8FA 4BA6A 5L36A 3V64A 4COVA 3LPFA 3VBFC 2J1EA 4CCCA 3VUOA 5GLTA 3MI8A 1RC6A 4BMEA 4YZ4A 1OLMA 1W8HA 3AYAA 4PIYA 1UOJA 2UWBA 4AE2A 4HVOA 5FYMA 1Q8VA 4FPEA 1ZRCA 2BU9A 2HYXA 1BBT1 2CHHA 5K7PA 2WNVA 1WGPA 4GALA 1JYNA 1VJ2A 4BMBA 3KV9A 2A7AA 5T5PA 2AEZA 3IIIA 3JB4C 3S0MA 1YRZA 1X8MA 2QUOA 3PUSA 4UFJA 2BVBA 1GQHA 5ACA1 1BMV2 4XXAA 1R1A1 4IEVA 4P02B 5FZ7A 3UJOA 1JU3A 1ULEA 1WA4A 5A7QA 1TNRA 3B93A 3VKNA 3ZXEA 4AAPA 1RUJ2 2VMEA 4UW3A 1J59A 1ODMA 3NV3A 4XETA 4IE4A 4ZKTB 1X36A 4XTMA 1R092 3KVBA 3PUAA 2VUDA 3IKWA 2HBUA 2ZKNA 5K4LA 4U36A 1URXA 3AMPA 4P5YA 1G86A 5H9RA 4Y5Z0 4D0QA 2Z2SB 4L0PA 3UGHA 1JYWA 4FXGB 5LATA 3T2OA 4Y22A 3SH5A 1QF3A 3HMYA 5BNPA 3POYA 3CF6E 4N43A 4N53B 4MGTA 3ACIA 2ZBJA 3ZFFA 3S7IA 2YG0A 4QHZA 3CBNA 4FTBA 1UXXX 3WW4A 2WYSA 3JD71 1U12A 1WCKA 1XQNA 4Y1XA 2VCMA 4OLLA 4C91A 2RM23 4D8MA 4R4ZA 5EJZB 1OQEA 3N36A 1CONA 1ZBA1 1M4WA 1XE7A 3NJXA 4ARYA 2PAKA 2QDRA 3BKZA 1AL23 2BRTA 3GBFA 1BJQA 4L9BA 2W5FA 3U10A 1AYN2 3MLLA 3VB9A 4EYUA 4B4QA 4FAHA 5T55A 2OYZA 5LBCA 4AFDA 5DPNA 4QHBA 1JYTA 2BZDA 2PA7A 3EB7A 3J8F1 3AM2A 3JBG1 5A3MA 4QM8A 1VBD1 1XNKA 4DXRA 2PHWA 2WLQA 3OPZA 1S0IA 4BQ4A 1UMHA 1PGSA 4Y1VA 1YLLA 4UOJA 3VL8A 2HKXA 4NMIA 4CCEA 2W1WA 2ZEXA 5DAXA 3BU0A 1GSLA 2PHLA 4NHKA 5C4WB 4C0HA 2R6QA 3BTYA 2XJTA 4HN0A 5HV4A 2DCZA 3M8LA 4G9SB 4H14A 3WT3A 4MGSA 1AL21 2MEV2 1SZBA 2IFRA 3RPQA 5A1LA 4NRQA 3ROUA 1K3IA 1LENA 2ZX4A 5C6CA 5FWJA 3LOBA 2GMEA 4CDXA 3AZXA 4CCNA 1QJX2 2BGPA 2GNDA 3ES1A 3MW2A 1FOD1 3UKTA 4IL7A 3W9AA 1EV12 4GKXA 1W8WA 1V70A 3E6DA 2WNEA 3DEMA 2V5DA 1V9U3 5FYTA 3AYDA 1RMU2 2JDKA 4AGGA 1OUSA 2VMFA 2ZGOA 1NA1B 4AW7A 2V73A 1QKQA 1PM4A 4AI1A 2JG9C 4EZ4A 1AYM3 4QDSA 2DVBA 4Z2WA 1LGNA 1O8PA 3CZUA 2R041 1VBE3 4UFIA 4BK5A 1CGPA 5FR3A 5KXBA 1AYM1 2IVIB 1RUD1 2EXKA 3GBGA 3H0OA 1AUYA 2ID4A 1JH5A 1RIRA 5C8WA 4XIKA 1ZBE3 4YGDA 5A6XA 3ES4A 1NQJA 4GB32 3HEIA 4OULA 2VOWA 1UY1A 4UBGA 1ZYBA 3K3OA 2FDGA 2BGCA 4Y3OA 4A45A 3MLKA 4KGQA 2QQNA 2WO3A 3WLUA 1CZTA 2DVDA 1FOD3 4L11A 5FQ0B 1R091 2VZVA 1LEMA 1N1SA 4UBHA 5IK7A 4IGPA 4FO9A 4XXPA 3RI8A 4CU7A 1KXGA 2HWF2 1T6BX 5JSRA 2LS6A 2LW8A 1GU3A 3MW4A 3VDDB 2RHPA 5T3NA 1TMF1 3NAPA 2DUPA 2YBSA 3KQ4B 4E4HA 1QXJA 3ETPA 3LB9A 1VRH3 5DAQA 2V72A 2QVSB 4P9JA 2WAAA 4BCUA 1GWMA 5T50A 4XFHA 4AGVA 2RV9A 2W52A 3JD72 5FYBA 4WVZA 3AKQA 4WM7B 4YM2A 2VZPA 3CO2A 3IB3A 5IFTA 4MSVA 2IZWA 3OUHA 3ZYRA 1YQCA 1KITA 4AZZA 1F2NA 1MS4A 5E89A 3K3NA 1AR93 4CDXC 4UXAA 1IG0A 5L9VA 2IXKA 3TAYA 4S2FA 2GN3A 1AYN1 3PDQA 1TME3 5EYYA 4P08A 2R1BA 1S2KA 2EALA 3ZKYA 1YQ5A 1PVXA 2WSVA 1RUI3 3DPRA 1W6NB 2P5BA 4H2AA 5C3RA 1WLCA 1NLRA 1DG6A 4NIAA 4COWA 1OQDA 2DU1A 1DLLA 1RUG3 2W39A 2WZ8A 1H4HA 3VZKA 3JD73 4I0AA 1M06G 2JB8A 3P6BA 5C4WC 1OVPA 1ZX5A 4UW6A 1RUF3 5A7OA 4AI8A 2QKDA 2DTWA 3ORJA 3PU3A 5CZKA 3QCWA 5A3UA 1ZZ8A 3VDAA 4B4RA 2H6BA 4HVQA 2FDHA 3NJVA 1JBCA 4GJYA 4GH4C 2CV6A 1C5IA 2GNTA 2XJRA 1AR82 1UCXA 2IWGB 5FZ9A 4CUAA 2DF7A 2J1TA 3USUB 1F8VA 2D6LX 2YUEA 3WR0A 1WMDA 3JQWA 5JZGA 1QNWA 2RVAA 3LCPA 3OD0A 1WBFA 2BTVC 3ZXJA 2P17A 1POV3 1S0BA 1WMEA 2E51A 1OKOA 4V2WA 4ATEA 2YC2A 5ACA3 1GZCA 5IAXA 1VBC1 5FZCA 2ZA9A 2QZ3A 3NWKA 1WWYA 1CAVB 4I2OA 5GZGA 4LO8A 4Y5TA 5CU1A 4E2GA 1H1IA 5K0UC 4D69A 3CNAA 2EIDA 4I3PA 2WKKA 5KC5A 2RR13 3W21A 3ZR6A 1OPMA 2EIGA 5ANNA 1IS3A 2HEWF 4CU9A 4GULA 2FBEA 4NWWA 1RMU3 2F6BA 3PTRB 4JGZA 1HKDA 4IV3A 1YQ6A 2Y34A 5CEHA 4UF0A 1PNFA 4OZOA 5JR2A 2ZAHA 5FP8A 1DCSA 1IOAA 1PM7A 1PX4A 3MBWA 1JZ4A 4LITA 1CN1A 1LHOA 3TRSB 2XBO1 2Y8KA 4XZPA 3RMYA 2WIIB 2OPKA 1YFXA 1VP6A 3BYWA 4JCKA 2J7MA 4Y33A 2XXZA 5F7UA 4LE4A 1TMF2 3KB5A 1DIWA 2LTNA 1HRI1 3UKNA 1GWLA 1HN1A 1V00A 5FXXA 4MH0E 5GKAC 2PQSA 3OY8A 3S5QA 1JI6A 3DV8A 5FZMA 5FZ8A 5C3SA 4LHSA 1F31A 2VQAA 1WW4A 2WWUA 3WP3A 2V5YA 3IWZA 2D5FA 4Q4Y2 1LOBA 2ZGLA 1OT5A 3T2TA 3K48A 4GH4A 5LW9A 4KMQA 4RGGA 4BQXA 5AC93 2WFPA 3ALQA 4HSLA 4IGQA 4CPBD 3U07A 3N4MA 4OMDA 1I5ZA 3ZSKA 4N53C 3BTXA 1LOCA 1HN0A 3KD4A 3SKJE 4DY5A 4HT1T 4O9GA 1SACA 1RUE1 2ZMKA 4IEOA 1W9FA 5I0TA 1OXCA 5H9PA 1OA4A 5FKCA 5LCWL 1JYXA 4TTGA 2EAKA 2B9VA 3B69A 4Q29A 2WABA 4GZ9A 4B1MA 1AR62 1HJFA 2RS33 3C7FA 5LBEA 1OF4A 2FDFA 1NZCA 1QXRA 1Z78A 4E8DA 5I8TA 2D6OX 2Y0IA 5LY2A 4FFIA 4JC1A 2Y0OA 4Q4V1 3IM0A 1KDMA 2DFBA 4XHBA 3RGBA 1O4TA 4FOWA 3I2JA 5B4XA 4F7ZA 3NNGA 1WD3A 2IUWA 3DL3A 2BFUS 2V09A 2WO1A 2QQLA 4XMIA 2BWAA 5FLJA 1DYKA 3M70A 4M3CA 2RJLA 3O1PA 3VD9A 1Q5OA 5BUVA 1OD5A 1FX5A 1SMVA 1VMHA 3BTAA 1H8TC 1JZ3A 5HCHA 1S0FA 3ZXFA 4LNVA 1DYPA 2JD9A 3A23A 4YW5A 2SLIA 5HBAA 4GXLA 4FQ4A 5I8YA 3EBRA 3OB8A 5LEJA 2JG8B 3E5XA 5D8AC 4RFRB 1EUTA 5LB6A 4D7SA 1W6OB 3H8UA 2XPJA 2CYFA 1MZEA 3H7YA 4YVWB 5IHRA 4WM7C 3FUQA 5A6ZA 5FZBA 2HWC2 3KHCA 3I2KA 3VDDA 4ORFA 5FP9A 3UJQA 3VZLA 5DMYA 1R083 3QOPA 5FYCA 4AR2A 4AEKA 4LA3A 1RUH2 3GJAA 2E53A 2PLV1 4KWKA 4YG0A 4DPNA 4YVSA 1XBFA 3OBRA 4N53A 5FREA 5F37A 1SLBA 1ONAA 5DDJ1 2HWE1 2Z69A 4HKWA 4IEZA 1ULOA 3C7OA 5B2GB 4OQ9A 5FZLA 4CP1A 4YZ2A 1JOJA 4A6OA 4ZU4A 1F15A 2QTWB 2OKXA 1QJU1 3N9MA 3AZWA 3NMBA 4CP0A 1SBFA 1UY0A 1OBNA 1Z7S1 2Q30A 1ZZ6A 4HL0A 1RVF3 4GWJA 2CY6A 4PIXA 2ZGUA 3WHTA 4LBKA 1F4HA 3I54A 5T52A 3LIGA 2VQ0A 3WG3A 4CZSA 2BNOA 5FO9B 4O61A 2X10A 4JGYB 2VXRA 4LIUA 3ZYPA 5FDBA 5H9QA 3EXUA 4Y22B 4CDUB 3AL5A 4DNYA 4EN0A 5FTTC 1NKGA 1X9TA 3GHMA 5KHJA 2C0ZA 2QE3A 4Y1UA 1HX6A 2CNAA 3AJZA 1QMJA 2ZEYA 2VZ3A 4W50A 3WW2A 4QQ2A 1BVP1 4FOYA 4P00B 2J1RA 2JIGA 2VW2A 1V6NA 4H3WA 3VBSC 5T5JA 3ZXLA 2XH6A 2VTFA 2R071 4FPJA 4XUPA 3ZYGA 1BCXA 1RUH3 1COV1 2XMLA 3BPZA 1R082 2HH9A 4FCAA 4QX0A 3PJYA 5T5LA 3RFRA 4BE3A 3NAPC 1IS4A 4Y20B 2YU1A 1C28A 4ARXA 1KQRA 1SFNA 5JXJA 1N47A 2P6CA 4M3CF 5JWPA 1AR61 1PVC3 1YC61 1ND3A 2P3JA 4FSJA 4IEQA 1W2UA 4D7TA 3IZOA 2F17A 1RUC3 1OVSA 5K0UB 2GZWA 3ZXKA 1PIV1 1AXKA 2W1QA 4NO4A 1WCSA 4M00A 5A3LA 4HANA 3USUA 5CG9A 5F6LB 5CB7A 4AHWA 1ZZ7A 4CCKA 2O1QA 2JXAA 5BNNB 4K1YA 2O14A 4FTSA 1O6UA 3KV5A 2VZ1A 4RGAA 4ZZ5A 2RS13 3KV4A 5F5AA 2VNOA 4AF9A 3MIHA 4PDWC 4DEVA 1NAEA 2CWMA 1XU2A 4FPKA 1VAVA 1H9WA 4DRRA 3BOPA 1WZXA 1GQGA 2WNVB 2RG4A 3HIFA 4Q5OA 1BYHA 2OVUA 2Y6KA 1H6XA 3LEKA 2ILMA 2A3YA 5EQUA 5F9TA 4N43C 3IDCB 1PK6A 3POJA 4QU2A 3ZYIB 2EIEA 3FUOA 2NMOA 4QDQA 3VKMA 4X8PA 1I6XA 4X6QB 4BPZA 5J36A 2IXHA 2C9AA 4FP3A 2FDIA 3DXTA 5JIAA 4JTOA 2HEVF 3SEEA 1S4CA 5FZOB 2WZR2 4Y4YA 3KGLA 4Q4W3 3WSOA 3K4ZA 3TEZA 1GOFA 1AR71 4KNCA 4ES9A 1FNZA 4YSFA 5JXGA 2WUHA 4GB33 3THPA 3M3OA 1LRHA 2HBTA 1ZBE2 3VBHC 1QJY3 3ZN6A 4COZA 2BQPA 1RUJ1 2VZRA 2ZGRA 3WW3A 3ACHA 3LAGA 3ZKUA 4XQDA 1MZ6A 1ZA4A 2ZHKA 1QH6A 2OIIA 4Q0PA 4BQ1A 3RZGA 4QXCA 3VBSA 3I97A 4MGYE 1NCQA 3EO6A 4CEWC 3WNNA 2ZGMA 3USSA 5GZEA 4DY3A 5FUPA 1MVEA 3I3QA 4CXXA 4OHWA 2A6YA 3S5AA 5FZ4A 3LIHA 4FFGA 2AR6A 3HN1A 3FZ3A 1LHUA 2OZ6A 4GH4B 1GR3A 3T4VA 1N3PA 1DLCA 1QJU2 4EZHA 4ZXEA 1ENQA 1AHSA 3M3EA 1BEV1 1VBB3 1SBEA 3FLTA 3SEPA 3RZLA 1G7YA 2MPFA 1Z7S2 1MEC3 3U75A 3WF1A 2XUEA 4K7JA 5J48A 4OFGA 2YPDA 2VBDA 4QQPA 1HRV1 1WA6X 2XL9A 3I3BA 2GH8A 4IV1B 3JU9A 5FY1A 4AEJA 2VQUA 1ZBA2 2OW4A 3VZMA 3OYWA 1S2EA 3VHRA 2XLGA 2ZX0A 4Q4X2 3AMMA 3RYRA 2XLAA 4IE0A 3HR9A 3EHKA 2ZS6B 4QWNA 3T08A 2QQUA 4AVTA 4O7XA 1MEC2 2JX9A 3A7QA 2VVFA 2XQXA 3M3QA 3T2PA 2UWAA 5KWRA 2BNNA 1XNAA 3E6BA 3KCXA 4NRMA 4XUNA 5F6KA 1QJZA 2KM2A 5CKMA 4CUGA 1VBD2 4MGKE 3WV6A 3J7LA 3FBYA 1D4M1 3H3ZA 4QX3A 5JSOA 1VE0A 2GDFA 4Z1VA 4K1ZA 3O5SA 3QD6A 3BB6A 1FV3A 4XAEA 3LOIA 1FMD2 4KU7A 3CHXA 2JIJA 4XCAA 4ES8A 3CJIC 3I3MA 1OA2A 5IYYA 2DVGA 2D3SA 1DP0A 4MZUA 1EAH3 2AEYA 3RYKA 2WINB 4K3UA 1QJY2 3T1LA 1LOAA 1MS5A 2J42A 1LESA 2R1DA 1W05A 3E97A 3EJKA 3J4UH 4MHUA 5T54A 2WS92 1BZWA 5IK5A 3ZYBA 3SC7X 1WMXA 1H0BA 4GIQA 3WQ7A 4PLOA 5J1XA 1RHI1 3H1MA 2B9UA 3IDBB 2QBXA 1JU4A 1YI7A 3KS7A 1LR5A 2XL7A 4FXKB 4YW3A 3APBA 4JRAA 3P3NA 2Q8DA 5FOJB 5EPAA 1ZRIA 3VKFC 1ULPA 4JQTA 4M4PA 1R64A 1Q8QA 3T30A 1HB2A 2W68A 1DFQA 1G6NA 1WLDA 4HOOA 5FZ0A 3H9AA 1I9RA 2EVXA 3AXDA 5FYZA 2PQQA 2V4AA 3ZN4A 3WG4A 3EMRA 4A7YA 5BYNA 1J1LA 2B45X 3D4KA 2BVVA 2W9XA 3POSA 4PBOA 4LBNA 2FCUA 1FXZA 2VO5A 4XQ4A 2WO7A 5L7OA 1DQ0A 2AYHA 4IETA 4LO4B 3NL1A 3D6EA 1EAH1 3B02A 3PMEA 2TBVA 2EF6A 3X29B 1Y9MA 1Y3TA 2ARXA 1NUKA 4LPLA 3RVHA 4BB3A 3SITA 1U5YA 1C57A 4XEZA 1VRBA 3RRDA 2PFWA 3R0RA 2E33A 1LODA 3HAGA 5DG2A 2Q8CA 4YZ5A 2WSUA 3OYWB 2EIBA 4UFKA 2FDKA 1W6PB 4FP2A 3GBWA 2LUWA 5LRRA 3TN92 4ONUA 1BEV2 5C3OA 4P9WA 3O12A 4XFFA 1XNTA 3ZR5A 1QH7A 3GNEA 1JXNA 4KH9A 1YO8A 5LBBA 3K4AA 1J3QA 5GLUA 4RS5A 3N3HA 2RMU1 4YPJA 2NM1A 3I4IA 1NCQC 2QQMA 1UKGA 2WL1A 3AP4A 1J83A 1FPN2 1SPPA 4KWUA 1XYOA 3HVDA 1PGW2 5F8PA 1GOHA 4V2VA 4NHLA 3AMHA 4B3NA 2FMYA 2FCVA 2W92A 1NCRB 5BXXA 4EN8B 1HRV3 4Z92B 4K6BA 3O1VA 3T0DA 3FL7A 1BXHA 2ZZQA 2WNVC 4L97A 5IAVA 3WCRA 2AENA 3W20A 1QGLA 4DB5A 3RQ0A 1WCUA 4UYBA 5D1IA 4E4ZA 3PUHA 5HV0A 1JW6A 4YVWA 1WLTA 2ZEZA 4MUVA 4B4PA 1AF9A 3GZUC 3N7MA 4LJHA 3ZFGB 1W39A 1CZVA 2X5IC 4M0HA 4OI2A 5A80A 4JGYC 5JSPA 3O1TA 2K9ZA 2L9LA 1FMD1 2ZGPA 4OI1A 5CIRA 3K46A 4YW7A 4QPIC 2ZX3A 5J98B 4XABA 5JOXA 1YQ2A 3MHZA 2YGLA 4A3XA 2J1SA 1QJY1 3BI3A 4X8NA 3L9JT 1LOEA 5LA2A 3RZHA 1GWKA 1ENSA 2HWC3 1V9U2 1AVBA 2EXJA 4XDQA 3BALA 4PI2A 1EV13 2ZACA 3NQHA 2YZ4A 1OOPA 1WW7A 3M3CA 1LHVA 2ADEA 1PMIA 1ENXA 1CAWA 1W2NA 3AP7A 3WG1A 3LKJA 4RQPC 2VMIA 2OUHA 4FOQA 4DO0A 2WNUA 5IUQA 3RG0A 1V6LA 4AQ6A 4QXHA 4A42A 2X5IA 3ABZA 2YDEA 2J1UA 1US3A 4FFFA 2W46A 4HKLA 3LSEA 3TNPB 5BNOC 3T0BA 3VBSB 4RR3B 2ZGNA 4NHYA 2Z42A 1MZ5A 3DPRB 4FOVA 4WV8A 4NE9A 1TE1B 2Y6GA 4LHNA 4CUBA 4XFGA 1HV1A 3JBG2 1JODA 2CWSA 3E6CC 2XVKA 1XNDA 2JG8C 2WQ4A 3LA3A 3PIJA 4R4XA 5FXVA 3LEIA 1S55A 2JG8A 1T2XA 1YI9A 2WWSA 4BXFA 1O59A 3P1IA 1UU6A 1W99A 1PIV3 1BKZA 1Y9QA 2E32A 2IXLA 3QH7A 3UL2A 2VULA 1JYCA 4XF9A 1W04A 3ZYJB 1B35B 1IS5A 1RYYA 2DCJA 2X05A 3OD4A 3MYXA 4OHVA 1AL22 1OLME 1MS0A 3V0BA 4E8CA 1JOBA 2GMMA 2VTXJ 2VZQA 3F2ZA 4U2AA 4WVWA 4XACA 4QX2A 4D7YA 1XJAA 4AVAA 4W6WA 4P9LA 4CDXB 4C90A 2I74A 4UAPA 4XHXA 3ZXGA 2KA3A 2B7YA 3FHQA 4IXLA 1PGL1 5IVYA 1UOFA 1BEV3 1VBB1 2MNGA 2Q1FA 3HOBA 5AVAA 3VHNA 5FQ0A 4JDOA 3HQRA 1W03A 5BY5A 4QGNA 3O1UA 2C6SA 1GZWA 1OURA 1UY2A 4IUGA 3BCWA 3UGFA 1W9WA 3D0JA 5AFBA 2QZ2A 4A3ZA 5LA0A 5SV8A 2OX0A 2DDUA 2AUYA 3RYPA 2P3IA 1ND3B 1OPOA 4Q0UA 2GALA 4QM9A 3O1RA 3GHNA 3N9QA 4XJZA 3VDBA 4CDUA 5FUNA 4M01A 4ASKA 1GV9A 3FN9A 2VXJA 3KWVA 3WHUA 4N7UA 2JDZA 4GB31 3OJBA 1O5LA 2WN2A 5D8AA 2ZGTA 4QDRA 1RUOA 2VM9A 3MW3A 2G4IA 4OI4A 3RI9A 3ZM8A 3I49A 3M1HA 2HWE3 1UD1A 2JECA 2X09A 4KBZA 3TEXA 3G7DA 4RL7A 1J58A 2FZ2A 1Q56A 3B9CA 3DPRC 5JR7B 5FYYA 1MS3A 3B9IA 4PQ9A 3RSJA 2A75A 3O0XA 3VHPA 5JOWA 1JZ7A 1H2NA 1Y4WA 4GQ7A 4CPBA 5FBJA 2Q0AA 2OPWA 2GSYA 3NNFA 3OF1A 4P14A 4UFMA 2GU9A 3Q8AA 1V0AA 4TLGA 4MXWA 4E4DX 3VD4A 1XE0A 4XPVA 3AMNA 5D21A 5HCBA 5C3PA 5APAA 4Y24A 3LDBA 4XILA 1OHFA 2ERFA 2RS11 4RHV2 1FI2A 2X29A 2D5HA 4BISA 5EZWA 4JV4A 5A6QA 4AHYA 5GZCA 5DAPA 1X7NA 1IS6A 4KWJA 1RXFA 4I3GA 2OS2A 1VB2A 5FPAA 5C5UA 4SLIA 4B7EA 3ZXDA 1MR5A 1PVC1 2BUKA 3Q8EA 3AKTA 3NW4A 4IEYA 1UY4A 2H6CA 5JZGC 4LBMA 5F5IA 2ZGKA 4UFLA 4R8HA 5ABJC 4N43B 1DGRA 1POQA 3NSTA 5B4NA 4LR4A 4F8AA 5C8CC 5L7OC 1COV3 1RUH1 4COUA 2R073 1GNZA 5F5CA 1TQ5A 1REEA 1EY2A 3GDBA 1CX1A 5GLWA 5LBFA 3U37A 5H9SA 3SQOA 3VD5A 2X5IB 3LA7A 3RDIA 2CL2A 2P34A 1W2AX 4PQQA 1JZ5A 1V6OA 4DEQA 4EJRA 2BGOA 2VY0A 1XPWA 5GJ6A 1V6JA 3IT8A 1ASJ2 2W08A 3N7LA 4E4SA 5FBZA 1D2QA 1YUDA 2BFUL 3B94A 1GFF2 4NVPA 3T0AA 1WKYA 1RUE3 3TWIA 1JZ6A 2G9FA 5GZFA 2WQZC 1K5MB 1RVF1 1C1FA 4MOAA 1U5IA 1KEXA 1MPXA 3WX5A 1SDWA 4C8DA 3R6SA 1HXS1 2PN5A 4XJ9A 4AYUA 3J8F2 1QJU3 4NIHA 2Q1MA 4YG6A 3T3YA 2D6PA 1AX0A 3S57A 1R1ZA 4IGOA 4NWVA 2B8MA 1BLZA 5DQ0A 4A6SA 1K5MC 2NP0A 1IPSA 2DUOA 4GWNA 4PF1A 4S2DA 1SQ4A 1ND2C 4BQ2A 5J37A 2QQJA 3GZAA 3LFMA 3SCFA 3CJIA 4DXTA 2VOTA 4MV2A 2HEYF 2PTMA 3VBFB 3AX4A 3AKSA 4DUVA 3UYJA 1CPNA 2Y33A 2UWCA 3VBUC 1H9PA 1OA3A 1OLRA 5HI0A 2CTVA 1GP6A 5F3IA 1C5HA 2WZR3 1Q8SA 3MICA 4D6RA 4YM3A 2O0OA 5D2AA 1RJ8A 5F3EA 1FATA 1DQ6A 4DOUA 1UY3A 4N9IA 2YROA 3HPNA 3OEAA 1YXWA 2Y6JA 4RSUA 3AYCA 5AVPA 3EYPA 5L19A 1RMU1 4YYOA 4FPYA 1O3RA 3JUUA 4NAOA 3Q8CA 4LBJA 4QPWA 4PF5A 3GGLA 4YVSC 1DBNA 1KJLA 2R16A 4QB6A 5HCAA 3O1MA 5F3CA 4MO3M 3UT0A 5F2WA 3NKTA 3PVNA 4HKOA 1AXYA 4EWAA 2YYOA 4L8QA 4LBOA 5FMCA 3VZJA 1KGYA 5DZFA 3VKLA 4Q4Y1 2FQPA 4GD4A 1POV1 4FQZA 3OPTA 2XKPA 3GM8A 4RA0A 5CAZA 3OPWA 3AYEA 3LQCA 1W8NA 1W9TA 2JDAA 1ND3C 4AFCA 5CNAA 1E5IA 4IERA 4CEWA 3TOJA
chains in the Genus database with same CATH topology
1UXZA 2CDOA 2C4XA 2W1QA 4QB2A 1K45A 2C9KA 3CKHA 4ZZ5A 2VZ1A 3MUZ1 2VCAA 3CMGA 4DEVA 1NAEA 5G04L 4JX0A 2YFZA 4CU8A 1UZ0A 4XZUG 2Y6KA 4CVUA 1H6XA 3LEKA 1I5PA 4W4ZA 1XC6A 4AAXA 4BK4A 2QQKA 2EIEA 2QQIA 4QDQA 2W3JA 3UETA 1K12A 3OGVA 1OF3A 5JXHA 3SEEA 4ZY9A 1F4AA 4Z2AA 1P8JA 3WSOA 3K4ZA 3DYMA 1GOFA 1CIYA 5JXGA 2WUHA 4XUQA 2W1UA 3I2IA 3IAPA 2VZRA 1OH4A 3ACHA 2Y6LA 3LE0A 4GWIA 2V4VA 5C71A 4FI9A 5C70A 3BGAA 3I97A 3LPFA 3WEZA 2J1EA 3WF0A 3WNNA 2VR4A 4XUOA 4JKMA 4XURA 3WNPA 3GXUA 2WAOA 1DLCA 3VDCA 3I2FA 2HYXA 4ZXEA 3SEPA 3T09A 1JYVA 1UX7A 1JYNA 3A21A 3WF1A 3IIIA 3I3BA 1UYXA 3OGRA 1K42A 2VQUA 4P02B 1JU3A 3I3DA 2VMEA 3T08A 2RJ2A 4KI5M 2XOMA 1LNSA 3CZJA 3A7QA 2XQXA 3T2PA 3WF2A 4P5YA 1L7QA 1XNAA 4ET7A 4D0QA 4L0PA 1JYWA 1PMJX 4XUNA 3T2OA 4QX3A 3I2GA 1DYOA 3ACIA 2WQ8A 2YG0A 3CDZB 3HN3A 1UXXX 2WYSA 3K4DA 5FUIA 4LKSA 5IYYA 2WDBA 5A1AA 1DP0A 4D8MA 3WNLA 5EJZB 2VZUA 3NJXA 4ARYA 1EUUA 4BJ0A 2W5FA 5J1XA 3UESA 1O8SA 1PMHX 1JU4A 2QBXA 3W5NA 5DPNA 2BZDA 3EB7A 4QX1A 1ULPA 4M4PA 1R64A 4DXRA 1UMHA 4UOJA 2W91A 3WF3A 2W1WA 3UNPA 5IFPA 2ZEXA 3WNMA 2CDPA 3MO4A 2W9XA 2E26A 2VO5A 4MGSA 1BHGA 2J1VA 4OUEA 1K3IA 2VMCA 1TG7A 2BGPA 4CUCA 2ORZA 4LPLA 1NUKA 2ZXQA 2BERA 2V5DA 3HNMA 2W1SA 2VMFA 2E33A 5HXMA 3MUY1 2EIBA 3I3EA 3T2QA 3MV01 4QDSA 2W47A 1O8PA 3CZUA 4BK5A 1XNTA 3K4AA 2WN3A 4YPJA 5LA1A 2QQMA 2ID4A 1J83A 1J84A 1SG3A 3J7HA 4KWUA 4MADA 1GOHA 3HEIA 2W92A 1UY1A 4W8JA 4DXSA 3W5MA 4A45A 2QQNA 2WO3A 3T0DA 1CZTA 3FL7A 2VZVA 3C7EA 3C7GA 3HJRA 3MV11 3C8XA 3WQBA 4CU7A 3PUHA 2LS6A 2LW8A 1GU3A 2ZEZA 3DYPA 4JKLA 3ETPA 2VCBA 3OG2A 2V72A 1CZVA 2WAAA 4UI9L 2L9LA 2RV9A 3K46A 4JKKA 1JZ8A 2VZPA 3IB3A 3WNOA 1YQ2A 5IFTA 1TVGA 2J1SA 5LA2A 5HPOA 3CQOA 2HLEA 3AC0A 1UMIA 3NQHA 4P08A 4LQRA 2BBAA 2J22A 4M4RA 2ORXA 2JKXA 4A42A 3WF4A 3ABZA 2J1UA 1US3A 2W46A 2WZ8A 3T0BA 3P6BA 3D3AA 5EIYB 5CZKA 2Y6GA 2WBKA 4CUBA 3ACFA 3THDA 3VDAA 2ZEWA 4BXSV 4OMCA 3NJVA 3LPGA 1SHWB 3LEIA 1T2XA 2Y6HA 1O59A 3P1IA 5G05L 1W99A 2XHNA 2E32A 4CUAA 1W9SA 2WZEA 2J1TA 1JZ2A 1D7PM 2YFUA 3OBAA 1RYYA 4DUWA 2DCJA 2X05A 2RVAA 1UWWA 2VQTA 4BDVB 1H6YA 4E8CA 2VZQA 3F2ZA 2YC2A 3E1F1 4QX2A 5JMOA 4UAPA 1L7RA 3FHQA 3HNBM 3K77A 2VJXA 3HOBA 2EIDA 5CYYA 5C7GA 1CZSA 4CU9A 4IUGA 1UY2A 1W9WA 4A3ZA 5LA0A 2VC9A 2DDUA 5JUVA 4OZOA 5JR2A 3DECA 2YC4A 1PX4A 3MBWA 1JZ4A 3VDBA 2Y8KA 3FN9A 2C26A 4A44A 2WO2A 2J7MA 3WNKA 5F7UA 3PUIA 2WN2A 4QDRA 1GUIA 4TXWA 2VMDA 1HN1A 2VM9A 4DUXA 3ZM8A 2PQSA 2YB7A 1W0NA 1W8OA 2X09A 4PT6A 1JI6A 1PX3A 4LHSA 2W87A 4XVHA 5IJRA 3ECQA 1OT5A 2VZTA 1JZ7A 4KMQA 2E31A 1OD3A 4OMDA 1GNYA 3SKJE 3VD4A 3VD7A 2EICA 4HG6B 3LEGA 4CU6A 5EJ1B 3SKVA 4QAWA 4AG4A 1JYXA 4TTGA 5LCWL 2B9VA 2WABA 1WCQA 4GZ9A 3C7FA 1OF4A 4E8DA 4QB1A 1UY4A 3CIHA 1US2A 5B4NA 2JE8A 2J1AA 3I2JA 5B4XA 3NNGA 5JXIA 2W95A 3BN6A 2WO1A 1SDDB 2QQLA 3GDBA 1GQPA 1CX1A 3U37A 4OYUA 3VD5A 3VD9A 4PQQA 1JZ5A 2QQOA 4DEQA 1JZ3A 2BGOA 1XPWA 2JD9A 3A23A 1JZ6A 3OB8A 3T0AA 1WKYA 1EUTA 1JHJA 3THCA 4MOAA 5IHRA 1KEXA 1MPXA 2VZSA 1GOGA 1UYZA 2KD7A 3IDAA 3K75B 5I0DA 3I2KA 2DCKA 1GMMA 2XONA 5DMYA 3IAQA 4ZZ8A 5DQ0A 4PF1A 2QQJA 4RYDA 1ULOA 3C7OA 4DXTA 1UYYA 2VOTA 1IQDC 3I2HA 4A6OA 5DN2A 2OKXA 4DUVA 4JHZA 1UY0A 3HNYM 3OEBA 3JXSA 1NX9A 3NRUA 2VCCA 4GWJA 1F4HA 1UY3A 3HPNA 2X10A 3OEAA 2Y64A 2Y6JA 2W94A 3VD3A 3ACGA 3EYPA 2R7EB 2B4KA 1NKGA 4QPWA 3C7HA 2VZOA 3GGLA 4MGQA 4QB6A 2ZEYA 2VZ3A 4W50A 4MO3M 3DYOA 3OGSA 4P00B 2J1RA 3FHAA 3A22A 2VTFA 2Z4FA 2VL4A 4XUPA 4RN5A 1KGYA 4QX0A 4A41A 4A4AA 4XUTA 4ARXA 3GM8A 5JXJA 3LQCA 1W8NA 1W9TA 2JDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UXZ A;  2CDO A;  2C4X A;  2W1Q A;  4QB2 A;  1K45 A;  2C9K A;  3CKH A;  4ZZ5 A;  2VZ1 A;  3MUZ 1;  2VCA A;  3CMG A;  4DEV A;  1NAE A;  5G04 L;  4JX0 A;  2YFZ A;  4CU8 A;  1UZ0 A;  4XZU G;  2Y6K A;  4CVU A;  1H6X A;  3LEK A;  1I5P A;  4W4Z A;  1XC6 A;  4AAX A;  4BK4 A;  2QQK A;  2EIE A;  2QQI A;  4QDQ A;  2W3J A;  3UET A;  1K12 A;  3OGV A;  1OF3 A;  5JXH A;  3SEE A;  4ZY9 A;  1F4A A;  4Z2A A;  1P8J A;  3WSO A;  3K4Z A;  3DYM A;  1GOF A;  1CIY A;  5JXG A;  2WUH A;  4XUQ A;  2W1U A;  3I2I A;  3IAP A;  2VZR A;  1OH4 A;  3ACH A;  2Y6L A;  3LE0 A;  4GWI A;  2V4V A;  5C71 A;  4FI9 A;  5C70 A;  3BGA A;  3I97 A;  3LPF A;  3WEZ A;  2J1E A;  3WF0 A;  3WNN A;  2VR4 A;  4XUO A;  4JKM A;  4XUR A;  3WNP A;  3GXU A;  2WAO A;  1DLC A;  3VDC A;  3I2F A;  2HYX A;  4ZXE A;  3SEP A;  3T09 A;  1JYV A;  1UX7 A;  1JYN A;  3A21 A;  3WF1 A;  3III A;  3I3B A;  1UYX A;  3OGR A;  1K42 A;  2VQU A;  4P02 B;  1JU3 A;  3I3D A;  2VME A;  3T08 A;  2RJ2 A;  4KI5 M;  2XOM A;  1LNS A;  3CZJ A;  3A7Q A;  2XQX A;  3T2P A;  3WF2 A;  4P5Y A;  1L7Q A;  1XNA A;  4ET7 A;  4D0Q A;  4L0P A;  1JYW A;  1PMJ X;  4XUN A;  3T2O A;  4QX3 A;  3I2G A;  1DYO A;  3ACI A;  2WQ8 A;  2YG0 A;  3CDZ B;  3HN3 A;  1UXX X;  2WYS A;  3K4D A;  5FUI A;  4LKS A;  5IYY A;  2WDB A;  5A1A A;  1DP0 A;  4D8M A;  3WNL A;  5EJZ B;  2VZU A;  3NJX A;  4ARY A;  1EUU A;  4BJ0 A;  2W5F A;  5J1X A;  3UES A;  1O8S A;  1PMH X;  1JU4 A;  2QBX A;  3W5N A;  5DPN A;  2BZD A;  3EB7 A;  4QX1 A;  1ULP A;  4M4P A;  1R64 A;  4DXR A;  1UMH A;  4UOJ A;  2W91 A;  3WF3 A;  2W1W A;  3UNP A;  5IFP A;  2ZEX A;  3WNM A;  2CDP A;  3MO4 A;  2W9X A;  2E26 A;  2VO5 A;  4MGS A;  1BHG A;  2J1V A;  4OUE A;  1K3I A;  2VMC A;  1TG7 A;  2BGP A;  4CUC A;  2ORZ A;  4LPL A;  1NUK A;  2ZXQ A;  2BER A;  2V5D A;  3HNM A;  2W1S A;  2VMF A;  2E33 A;  5HXM A;  3MUY 1;  2EIB A;  3I3E A;  3T2Q A;  3MV0 1;  4QDS A;  2W47 A;  1O8P A;  3CZU A;  4BK5 A;  1XNT A;  3K4A A;  2WN3 A;  4YPJ A;  5LA1 A;  2QQM A;  2ID4 A;  1J83 A;  1J84 A;  1SG3 A;  3J7H A;  4KWU A;  4MAD A;  1GOH A;  3HEI A;  2W92 A;  1UY1 A;  4W8J A;  4DXS A;  3W5M A;  4A45 A;  2QQN A;  2WO3 A;  3T0D A;  1CZT A;  3FL7 A;  2VZV A;  3C7E A;  3C7G A;  3HJR A;  3MV1 1;  3C8X A;  3WQB A;  4CU7 A;  3PUH A;  2LS6 A;  2LW8 A;  1GU3 A;  2ZEZ A;  3DYP A;  4JKL A;  3ETP A;  2VCB A;  3OG2 A;  2V72 A;  1CZV A;  2WAA A;  4UI9 L;  2L9L A;  2RV9 A;  3K46 A;  4JKK A;  1JZ8 A;  2VZP A;  3IB3 A;  3WNO A;  1YQ2 A;  5IFT A;  1TVG A;  2J1S A;  5LA2 A;  5HPO A;  3CQO A;  2HLE A;  3AC0 A;  1UMI A;  3NQH A;  4P08 A;  4LQR A;  2BBA A;  2J22 A;  4M4R A;  2ORX A;  2JKX A;  4A42 A;  3WF4 A;  3ABZ A;  2J1U A;  1US3 A;  2W46 A;  2WZ8 A;  3T0B A;  3P6B A;  3D3A A;  5EIY B;  5CZK A;  2Y6G A;  2WBK A;  4CUB A;  3ACF A;  3THD A;  3VDA A;  2ZEW A;  4BXS V;  4OMC A;  3NJV A;  3LPG A;  1SHW B;  3LEI A;  1T2X A;  2Y6H A;  1O59 A;  3P1I A;  5G05 L;  1W99 A;  2XHN A;  2E32 A;  4CUA A;  1W9S A;  2WZE A;  2J1T A;  1JZ2 A;  1D7P M;  2YFU A;  3OBA A;  1RYY A;  4DUW A;  2DCJ A;  2X05 A;  2RVA A;  1UWW A;  2VQT A;  4BDV B;  1H6Y A;  4E8C A;  2VZQ A;  3F2Z A;  2YC2 A;  3E1F 1;  4QX2 A;  5JMO A;  4UAP A;  1L7R A;  3FHQ A;  3HNB M;  3K77 A;  2VJX A;  3HOB A;  2EID A;  5CYY A;  5C7G A;  1CZS A;  4CU9 A;  4IUG A;  1UY2 A;  1W9W A;  4A3Z A;  5LA0 A;  2VC9 A;  2DDU A;  5JUV A;  4OZO A;  5JR2 A;  3DEC A;  2YC4 A;  1PX4 A;  3MBW A;  1JZ4 A;  3VDB A;  2Y8K A;  3FN9 A;  2C26 A;  4A44 A;  2WO2 A;  2J7M A;  3WNK A;  5F7U A;  3PUI A;  2WN2 A;  4QDR A;  1GUI A;  4TXW A;  2VMD A;  1HN1 A;  2VM9 A;  4DUX A;  3ZM8 A;  2PQS A;  2YB7 A;  1W0N A;  1W8O A;  2X09 A;  4PT6 A;  1JI6 A;  1PX3 A;  4LHS A;  2W87 A;  4XVH A;  5IJR A;  3ECQ A;  1OT5 A;  2VZT A;  1JZ7 A;  4KMQ A;  2E31 A;  1OD3 A;  4OMD A;  1GNY A;  3SKJ E;  3VD4 A;  3VD7 A;  2EIC A;  4HG6 B;  3LEG A;  4CU6 A;  5EJ1 B;  3SKV A;  4QAW A;  4AG4 A;  1JYX A;  4TTG A;  5LCW L;  2B9V A;  2WAB A;  1WCQ A;  4GZ9 A;  3C7F A;  1OF4 A;  4E8D A;  4QB1 A;  1UY4 A;  3CIH A;  1US2 A;  5B4N A;  2JE8 A;  2J1A A;  3I2J A;  5B4X A;  3NNG A;  5JXI A;  2W95 A;  3BN6 A;  2WO1 A;  1SDD B;  2QQL A;  3GDB A;  1GQP A;  1CX1 A;  3U37 A;  4OYU A;  3VD5 A;  3VD9 A;  4PQQ A;  1JZ5 A;  2QQO A;  4DEQ A;  1JZ3 A;  2BGO A;  1XPW A;  2JD9 A;  3A23 A;  1JZ6 A;  3OB8 A;  3T0A A;  1WKY A;  1EUT A;  1JHJ A;  3THC A;  4MOA A;  5IHR A;  1KEX A;  1MPX A;  2VZS A;  1GOG A;  1UYZ A;  2KD7 A;  3IDA A;  3K75 B;  5I0D A;  3I2K A;  2DCK A;  1GMM A;  2XON A;  5DMY A;  3IAQ A;  4ZZ8 A;  5DQ0 A;  4PF1 A;  2QQJ A;  4RYD A;  1ULO A;  3C7O A;  4DXT A;  1UYY A;  2VOT A;  1IQD C;  3I2H A;  4A6O A;  5DN2 A;  2OKX A;  4DUV A;  4JHZ A;  1UY0 A;  3HNY M;  3OEB A;  3JXS A;  1NX9 A;  3NRU A;  2VCC A;  4GWJ A;  1F4H A;  1UY3 A;  3HPN A;  2X10 A;  3OEA A;  2Y64 A;  2Y6J A;  2W94 A;  3VD3 A;  3ACG A;  3EYP A;  2R7E B;  2B4K A;  1NKG A;  4QPW A;  3C7H A;  2VZO A;  3GGL A;  4MGQ A;  4QB6 A;  2ZEY A;  2VZ3 A;  4W50 A;  4MO3 M;  3DYO A;  3OGS A;  4P00 B;  2J1R A;  3FHA A;  3A22 A;  2VTF A;  2Z4F A;  2VL4 A;  4XUP A;  4RN5 A;  1KGY A;  4QX0 A;  4A41 A;  4A4A A;  4XUT A;  4ARX A;  3GM8 A;  5JXJ A;  3LQC A;  1W8N A;  1W9T A;  2JDA A; 
#chains in the Genus database with same CATH topology
 2CDO A;  3WZ1 A;  3SCH A;  4YW4 A;  4QB2 A;  1RUE 2;  1K45 A;  2TNF A;  4AI2 A;  2RS5 1;  4E2Q A;  4XF1 A;  5CFC B;  4QGM A;  3OUJ A;  1T6G C;  3KCC A;  3CKH A;  2D43 A;  3IMN A;  1FNY A;  2MEV 3;  4XFA A;  2ZGQ A;  3ZSJ A;  5FLI A;  3VBH A;  3WDX A;  1VAM A;  2VCA A;  2E7Q A;  3ZFF B;  3CMG A;  2LM3 A;  4JX0 A;  5G04 L;  2YBP A;  2YBK A;  1FT9 A;  2PHR A;  1G8W A;  4LLO A;  5AC9 1;  1RUG 1;  1HW5 A;  4IV3 B;  4RS5 B;  1H1M A;  4HBN A;  4LOS A;  5CG8 A;  2G9G A;  4ISR A;  1OMI A;  2QQI A;  2YXS A;  3GZE A;  3B5L B;  2ATF A;  1RUI 1;  1UU5 A;  4QPG B;  3UK9 A;  1K12 A;  4WBB A;  3WDU A;  1XOY A;  3ME2 A;  4I0B A;  4Y26 A;  4AL9 A;  3AP5 A;  1RVF 2;  4NPM A;  1RXG A;  3MLJ A;  4BM8 A;  4Z2A A;  1P8J A;  4FPH A;  3D0S A;  2RDQ A;  3SH3 A;  2VGD A;  2CU5 A;  1UZW A;  2PAE A;  4K20 A;  4L92 A;  4PLN A;  3MEP A;  5BNP B;  3W5N A;  3ZVX A;  1PK6 C;  2B42 B;  2A1X A;  4QPY A;  4PDW A;  3IAP A;  2XBO 3;  4Y1Y A;  4ZHN A;  1MVQ A;  3LE0 A;  1E5S A;  2JEM A;  2Y6L A;  4AFM A;  3NKG A;  2ZHM A;  4NPL A;  5JIU A;  2VW1 A;  4FI9 A;  3AL6 A;  1SLT A;  3VL9 A;  1RTV A;  4XOG A;  5F39 A;  1IGO A;  1XNB A;  4HPK B;  2WT1 A;  2BOJ A;  1TZO A;  4IND A;  4XAA A;  1GIC A;  3U78 A;  4R52 A;  4JKM A;  4XUO A;  3RZJ A;  1RUN A;  1Q8P A;  4XUR A;  3WNP A;  2WAO A;  1X8E A;  2RR1 1;  4PI0 A;  3MIG A;  1Z0H A;  3VKO A;  1J3P A;  4UWD A;  5IVE A;  4ATF A;  1O7F A;  3BIE A;  3A21 A;  4LOR A;  1YFY A;  3ZMN A;  1R09 3;  4JTN A;  2VG9 A;  1FAY A;  1VBC 3;  2VEC A;  5CVR A;  1UYX A;  4JDM A;  1RED A;  4ZS3 A;  2RJK A;  2ZTN A;  1EPZ A;  1K42 A;  2QJV A;  1CJP A;  2PHF A;  5FP4 A;  2WS9 1;  2D6N A;  2WT2 A;  2CAU A;  2A6W A;  3FHI B;  5K9Y A;  1JTZ X;  3FFQ A;  1RUD 3;  2RJ2 A;  4Q8K A;  3AJY A;  3VBU B;  2XOM A;  5FWE A;  4IE5 A;  3RWK X;  3UGG A;  5I93 A;  5AFE A;  2BEO A;  1C1L A;  3CZJ A;  4TLF A;  2DBI A;  5F32 A;  1NYW A;  1VBE 1;  2K46 A;  4A2U A;  1L7Q A;  3SMH A;  3FX3 A;  1QOO A;  4ET7 A;  2P1B A;  1PMJ X;  2AAC A;  1D0H A;  1DGW A;  5FY5 A;  1XB9 A;  5FAX A;  1VAK A;  2P6H A;  4AEM A;  5JDB A;  3B3Q E;  1AL0 G;  2DWR A;  5EV7 A;  3PJQ A;  1A34 A;  1UAI A;  5A32 A;  3RZM A;  5FY4 A;  5GM0 A;  4K8R B;  3INA A;  4O65 A;  1RUF 1;  2WQ8 A;  3CDZ B;  1W6N A;  5L7O B;  5FMO L;  2FD8 A;  1GYK A;  5FV3 A;  4NR1 A;  5FLH A;  3K4D A;  4TWT A;  4S2G A;  1KS5 A;  3RJR A;  1S2B A;  1NA1 A;  2WDB A;  3MFA A;  1A8M A;  5FMD A;  4GKY A;  3ZPO A;  2XBO 2;  3GYD A;  4MHR A;  1GAN A;  3WNL A;  1O3S A;  1B09 A;  4OCT A;  2KXL A;  2WR9 A;  3ILF A;  4NPR A;  4FT8 A;  5HCF A;  1EAH 2;  3FE5 A;  3JB8 A;  1NLQ A;  2ARC A;  1QJE A;  1V6M A;  1TME 1;  2GC1 A;  1SLI A;  4LO7 A;  5JPM B;  1RIT A;  2VBP A;  1V6I A;  4LKF A;  5DAB A;  1O8S A;  1SCS A;  2UYB A;  3MPP G;  5J3U A;  3V0A B;  2Y6F A;  4QU1 A;  1AR9 1;  5ABJ A;  4UFH A;  1CJD A;  2FDJ A;  5FZE A;  5CFD B;  3AMQ A;  2K2S A;  3EQE A;  1VBD 3;  4N8M A;  4QHO A;  4CA9 A;  2FZ1 A;  3JBG 3;  2JDH A;  3TN9 1;  1UMZ A;  3B00 A;  1S0J A;  4E27 A;  2A3W A;  4EWE A;  2QQP A;  3UNP A;  3KQR A;  3PVO A;  1APN A;  3GJB A;  4ZS2 A;  1E57 A;  1VRH 1;  2CDP A;  3AXE A;  1SFP A;  3MO4 A;  4HXC A;  4OI0 A;  1TMF 3;  1HLC A;  2XKO A;  1BHG A;  1RJ7 A;  1LCL A;  1AZD A;  1NCQ B;  2J1V A;  4LLF A;  3VN4 A;  5IVJ A;  4XFB A;  1S0G A;  1ZBA 3;  2XVG A;  3OTF A;  4OUE A;  2VMC A;  4LHL A;  1TG7 A;  3DKW A;  1I3H A;  4NN0 A;  4ZXK A;  4Y5S A;  2DYC A;  2RM2 1;  3O1O A;  1V6K A;  3N7K A;  4FPF A;  3HD8 B;  1C4R A;  4CUC A;  4LBQ A;  5IWF A;  2ORZ A;  5KHG A;  2WA3 A;  4QT6 A;  2JWP A;  3IDE A;  5FMB A;  5FP3 A;  5A70 A;  5LY1 A;  1S0C A;  1NT0 A;  4AED B;  1LEC A;  1ZBE 1;  2W1S A;  3KSC A;  5HXM A;  2JE9 A;  1VIW B;  4XW3 A;  5FXW A;  2RR1 2;  3VV1 A;  2GH2 A;  3LGR A;  3FMG A;  1UIK A;  1WW6 A;  5KHK A;  1H2L A;  1VBA 1;  2R06 1;  3BIW E;  5A3W A;  1LOF A;  2B46 X;  2ZOE B;  2R04 3;  4WM8 C;  3PHM A;  1VBA 3;  2R06 3;  5FYU A;  3THT A;  5FPU A;  5CIS A;  4LXL A;  2JDP A;  2WN3 A;  3N9N A;  5LA1 A;  3WQ0 A;  2SBA A;  1W8T A;  1CWP A;  3I8T A;  4MYE A;  1SG3 A;  1J84 A;  3J7H A;  4QPG C;  3H1W A;  4MAD A;  2F4L A;  2BP6 A;  1LTE A;  1V9U 1;  3RZK A;  4LTA A;  3V56 A;  1N1Y A;  1PZ9 A;  1PNG A;  1FV2 A;  1KDK A;  3A4U A;  5LK7 B;  1I1E A;  3KF3 A;  4QKB A;  5DUV A;  2D6M A;  3KCY A;  3C7E A;  3SXW A;  3C7G A;  5L9R A;  1HRV 2;  3KT1 A;  2QQW A;  4FPL A;  3O1S A;  2Q8O A;  3WQB A;  1SPP B;  3BVC A;  2DCY A;  5DZE A;  4LO6 B;  5IK8 A;  4FBF A;  1G9F A;  3KMH A;  4YGC A;  4DRV A;  4XF4 A;  3SHR A;  4MG2 A;  4NIG A;  1H4G A;  3NNM A;  2XUM A;  3DYP A;  3NV4 A;  4XYX A;  1H8T B;  1CIW A;  3POE A;  2GNM A;  5A6Y A;  4P9X A;  3V65 A;  1FYU A;  3M2M A;  1J1T A;  1N3Q A;  1RUF 2;  3I2O A;  4UI9 L;  3JQX A;  3FLP A;  4BIO A;  4CCD A;  1ACC A;  2ZHL A;  1TNF A;  5DDJ 2;  4MLO A;  4F83 A;  4JKK A;  4XFI A;  3TN9 3;  4BZ4 A;  1JZ8 A;  3DF0 A;  3MID A;  4YVW C;  1MQT A;  3W58 A;  1TVG A;  2Q5T A;  1OSG A;  3AP6 A;  3ATG A;  1D4M 2;  5K8S A;  4AI9 A;  1WUV A;  3N9O A;  3J8F 3;  2G1M A;  1CQ9 A;  5KHH A;  4WVV A;  3CQO A;  4LOT A;  2Z79 A;  2Q4S A;  1TME 2;  1UMI A;  1UOB A;  1WD4 A;  4C1W A;  4IEW A;  4LQR A;  2BBA A;  3KV6 A;  4PIZ A;  3BOD A;  3H3U A;  2J22 A;  1ND2 B;  2ZAB A;  4BQ3 A;  4FAG A;  3U4S A;  4YRD A;  5FZA A;  3VBO B;  5FO7 B;  5A7W B;  3WF4 A;  1SBD A;  3AZZ A;  3PMS A;  4J6G A;  3VBH B;  1YIP A;  4XBQ A;  5F1R A;  1OH3 A;  3CU7 A;  3D3A A;  1ZZ9 A;  2NZ9 A;  5DZG A;  5EIY B;  4AQT A;  1SLL A;  1VRH 2;  1CAU A;  2IXC A;  2R07 2;  3WP4 A;  2WBK A;  1COV 2;  3RZZ A;  4KQ7 A;  2NMN A;  1W6O A;  1F9K A;  4YFZ A;  5E6H A;  1KS4 A;  3V0B B;  3LPG A;  1JHN A;  1SHW B;  2ES3 A;  4GMP 0;  1UOG A;  1W6Q A;  3AKR A;  3BU7 A;  4HMZ A;  4JDN A;  5G05 L;  5CFD A;  4CCL A;  5BV6 A;  4Q1P A;  1W9S A;  3P3P A;  4GWM A;  4PCR A;  1D7P M;  1VMJ A;  2A5Z A;  3ZFE C;  3MGU A;  1YHF A;  4I02 A;  5ERL A;  1NA1 C;  1D4V B;  3VGI A;  4DUW A;  5BNN A;  2WS9 3;  1E5R A;  2WC2 A;  4DFS A;  3VBR B;  1R1A 3;  1W28 A;  2JG9 A;  2IXJ A;  4YGB A;  5JAX A;  1GNH A;  2DV9 A;  2XWJ B;  3POI A;  2EXI A;  1GZW B;  3ZYH A;  2IC1 A;  3MFC A;  4V1P A;  1HQN A;  2TEP A;  1VBA 2;  2R06 2;  1SCR A;  1QXP A;  5EHD A;  3VLB B;  4D94 A;  3HNB M;  4HK9 A;  3K77 A;  2VJX A;  2OQ6 A;  2GN7 A;  3POF A;  3IN9 A;  1BBT 3;  5C7G A;  1W3V A;  4W6X A;  3UKV A;  4LT5 A;  4DS0 A;  2A70 A;  2DUR A;  5FZF A;  3R4U A;  3NAP B;  4C0B A;  1NE6 A;  3RWN A;  2ARE A;  2VC9 A;  3PLQ A;  3ZFG A;  5C33 A;  5IVC A;  2G9Z A;  5JUV A;  1W9Y A;  3DEC A;  1DQ5 A;  3OGJ A;  4IEU A;  3TNQ A;  3U1X A;  4OHX A;  3FBM A;  1QJX 3;  2WZR 1;  4GMP 1;  4YZ1 A;  5L73 A;  4XF3 A;  4XBN A;  3ZDS A;  2ZGS A;  1DZQ A;  2DBN A;  2JJ6 A;  1FPN 1;  3JCI A;  5F2S A;  2C26 A;  1BK0 A;  4ISQ A;  4A44 A;  2WO2 A;  3N35 A;  1PO1 2;  1JS9 A;  1MZF A;  3WNK A;  4CEY A;  3PUI A;  2FMD A;  4DUX A;  1NCR A;  2YB7 A;  5A3O A;  2E9Q A;  1W8O A;  2WNO A;  4PDW B;  4PT6 A;  4XQW A;  3KT4 A;  3OGG A;  3MF9 A;  1OLQ A;  1KFU L;  3J7N A;  4XVH A;  4CXY A;  4S2H A;  5EWS A;  5I8S A;  5A7P A;  3F95 A;  4YAR A;  5CKQ A;  5ABJ B;  4OZX A;  2CGN A;  4AFA A;  1N3O A;  3SIS A;  3H50 A;  2E31 A;  1YIF A;  4K40 A;  4CXW A;  1HXS 3;  1OD3 A;  2WNU B;  2GAU A;  2CGO A;  2XB6 C;  3PVB B;  5C4W A;  1GNY A;  1ZZC A;  4W65 A;  5EXO A;  2OZJ A;  5I0S A;  2RS3 2;  4R9C A;  4HG6 B;  3LEG A;  1SLA A;  4CU6 A;  1CAV A;  2ZKL A;  5EJ1 B;  2LRO A;  1NOV A;  4AVS A;  2MEV 1;  3SKV A;  1UO9 A;  4AG4 A;  5A7S A;  3VHO A;  1C8M 2;  4CRQ A;  2RS5 3;  2GP3 A;  1UX6 A;  4AGR A;  3S7E A;  1WCQ A;  4QQH A;  4Q4W 2;  4LHK A;  2PXJ A;  1CR7 A;  1KRI A;  2A6Z A;  4GA9 A;  3CIH A;  1PK6 B;  3HBZ A;  3K51 A;  1C8N A;  4CP9 B;  1XYP A;  1Y7B A;  1A6C A;  1UQX A;  1DGW X;  4Q0V A;  4Q4Y 3;  1YQ8 A;  2JE8 A;  3GCX A;  3K2O A;  2WT0 A;  5A1F A;  3TEW A;  4QQL A;  2ARA A;  3BN6 A;  2BPA 2;  1SDD B;  3ZIX A;  3HT2 A;  4B29 A;  4OYU A;  2XJQ A;  1UW8 A;  1RUD 2;  4XC9 A;  3AVR A;  5BNQ A;  4PJY A;  1ZRE A;  1ZNP A;  1PO1 3;  3AVS A;  5FO8 B;  3LF7 A;  4FVV A;  3WP5 A;  3ZXA C;  2HWD 1;  2Q1Z B;  4NAM A;  4Z07 A;  2WFF 1;  3D8C A;  4YGE A;  1KFX L;  3PU8 A;  4X6R B;  1JHJ A;  5GZD A;  4Y4R A;  4UF0 B;  2RE9 A;  3NO8 A;  3ZPY A;  3J7M A;  4AWD A;  1CVN A;  1GOG A;  3AZV A;  4Y20 A;  2XJP A;  1WW5 A;  3MIB A;  4XJU A;  1LB2 A;  1B35 A;  5CA6 A;  4DQA A;  4KL1 A;  3CJI B;  2JIC A;  1GMM A;  2XON A;  5DAW A;  1H2M A;  1W0O A;  2DFC A;  3D82 A;  1W0P A;  1W8Z A;  2D6K A;  4IQP A;  1ZRD A;  1IZ3 A;  4ITC A;  2XJV A;  4YM0 A;  3ZN5 A;  2OT7 A;  1DQ1 A;  4C1X A;  4SBV A;  4OUM A;  1OI6 A;  3ZFE A;  1VB4 A;  3P5B A;  3PNA A;  2PHT A;  4KU8 A;  4RYD A;  1HV0 A;  1LHN A;  1A78 A;  1X33 A;  2D97 A;  2PAM A;  1ULF A;  2RDS A;  3J9S A;  4P9G A;  1UYY A;  5ACA 2;  4CEY C;  1IQD C;  3KZ4 C;  4CEW B;  5I91 A;  5C9A A;  1BMV 1;  1R1A 2;  1X82 A;  2PHX A;  4Q2F A;  5DN2 A;  1UF2 C;  3B7M A;  3VZO A;  2VTX A;  3U0Z A;  1O91 A;  4G3Y C;  3HNY M;  2XVL A;  3VBU A;  3NRU A;  4I0W B;  1G9B A;  2VCC A;  4A7Z A;  2O8Q A;  4ZU5 A;  4AVV A;  1QJF A;  4D6Q A;  1HDK A;  4QKF A;  5DAV A;  5FY0 A;  1VAL A;  2W94 A;  3ACG A;  3JZV A;  1LGC A;  4HET A;  4YFW A;  1QOT A;  2GC2 A;  2UYA A;  1K5M A;  1VPH A;  1REF A;  2VZO A;  4I01 A;  4ZPI A;  1NY7 2;  1OFN A;  2QDN A;  4CDQ A;  5I0R A;  1DGL A;  3ZX7 A;  3MZH A;  3HWJ A;  3AB0 A;  3KF5 A;  3ZSL A;  1OC1 A;  5CBL A;  3FHA A;  3KLS A;  4IES A;  4ASL A;  3G6J B;  4D3W A;  3UV9 A;  4EV0 A;  5LEK A;  1HQW A;  3WG2 A;  3BOW A;  2RMU 2;  4K9S A;  2UUR A;  1PZ8 A;  3CJX A;  1G9C A;  4A41 A;  4NID A;  2BBV A;  2I07 B;  1PGW 1;  4AHX A;  3B01 A;  1RUI 2;  1N1T A;  2IVJ A;  4M3C B;  4HVR A;  4DMI A;  5FCC A;  2UY9 A;  2ZHN A;  3MIE A;  1YFW A;  3PTY A;  4OVE A;  5FPX A;  3L2Y A;  5LZ6 A;  4URT A;  1O5U A;  3VBF A;  5FZ1 A;  4NJ4 A;  4BU2 A;  2C4X A;  5DUU A;  1NQD A;  4RQP A;  4KGG A;  4RHV 1;  5DXD A;  1YJL A;  3SCG A;  5IVF A;  2C9K A;  4XTP A;  1LOG A;  1QQP 3;  3BPS A;  4LUM A;  2WZP P;  4TYS A;  4PBP A;  3H8X A;  3MIF A;  2CAV A;  4QXB A;  4L99 A;  3DCQ A;  3GAL A;  3T4H B;  2VD7 A;  4JHT A;  1AX1 A;  4Y1Z A;  2YHJ A;  1NXD 1;  3D5O A;  4CU8 A;  4WM8 A;  3NNJ A;  4N7I A;  4Q27 A;  4G4F A;  1D0G A;  3OBZ A;  2ZX2 A;  4K8F A;  1I5P A;  4TN7 A;  2BOI A;  3FWE A;  4XF0 A;  5LAS A;  2DVF A;  2HWF 3;  5TSW A;  2D3R A;  4JVA A;  2NQY A;  2WFF 2;  2W3J A;  4MET A;  4PLM A;  2ZJC A;  1QDO A;  1EV1 1;  2GP5 A;  2C1F A;  2JB4 A;  4H7M A;  1OOP B;  5F3G A;  3DYM A;  1MS8 A;  3H8O A;  3KT7 A;  1YNA A;  3WXP A;  3KM5 A;  5HXV A;  4CP2 A;  1ASJ 1;  1C8M 3;  1MQT C;  4UW4 A;  1LGB A;  1RB8 G;  3VBR C;  2DCT A;  1OH4 A;  5A33 A;  4GWI A;  2B39 A;  1CD3 G;  4XDP A;  4JQR A;  1FMD 3;  2D93 A;  3BGA A;  3WUC A;  5C70 A;  2AC1 A;  5FYV A;  3WEZ A;  3WF0 A;  1HXS 2;  2TUN A;  4IDZ A;  4OUS A;  3GCW A;  1ZRF A;  3LD8 A;  2HWB 1;  2VR4 A;  2OA2 A;  1DQ2 A;  4P5H A;  4EQV A;  2EAA A;  3TBD A;  3GXU A;  3KHB A;  3W59 A;  4J25 A;  3VDC A;  3I2F A;  1W2T A;  3POG A;  3T09 A;  1JYV A;  1UX7 A;  3WVJ A;  1W6M B;  1GP4 A;  1Q8O A;  3I7D A;  4UT5 A;  1XSQ A;  3I2D A;  5FPL A;  5JVV A;  3ZSM A;  4CDU C;  1ULC A;  4YZ3 A;  4YNI A;  4LK6 A;  1Q3E A;  4NII A;  3OGR A;  4XJA A;  4Q4X 3;  2BV4 A;  1QWR A;  5KR7 A;  3TEY A;  3I3D A;  1QY4 A;  3H42 B;  3NV2 A;  3I59 B;  4WZC A;  3M7A A;  4RFT 0;  4CEY B;  2R0H A;  4MVT A;  5KBF A;  2XR4 A;  5DG1 A;  4AVB A;  4KI5 M;  2D40 A;  4OQ8 A;  1LNS A;  3WQ1 A;  2FHR A;  4BIF A;  3WF2 A;  1PGL 2;  1VBB 2;  2NYY A;  1UZY A;  3VDD C;  3PUR A;  1PO2 3;  5DUX A;  2XLF A;  1NLS A;  1CAX A;  1XYN A;  4CP9 A;  4I09 A;  1XNC A;  5FZD A;  5A3P A;  2P4E A;  1W8U A;  3I2G A;  4CTE A;  2ZX1 A;  1BBT 2;  5T5O A;  1DYO A;  4AI0 A;  2XGX A;  3GF6 A;  1LOF C;  3HN3 A;  5E88 A;  3HBK A;  4YW6 A;  1HB4 A;  5CFC C;  1HQL A;  1ULG A;  5FUI A;  4IE6 A;  4LKS A;  1IPJ A;  4IW3 A;  5A1A A;  4YW2 A;  5FXZ A;  1LAJ A;  2VOV A;  3S6P A;  2YMZ A;  4HSJ A;  2VZU A;  1O3T A;  3RJ2 X;  5EYX A;  1QNY A;  4Q26 A;  1GZ9 A;  1EUU A;  2RM2 2;  4H7L A;  3VBR A;  4GJZ A;  2XDV A;  4BJ0 A;  3U4X A;  1LUL A;  2R0F A;  3SNM A;  3BUC A;  5SV5 A;  1S0E A;  3H8R A;  5FYI A;  3UES A;  3CEW A;  1PMH X;  4NRP A;  5FZO A;  1AR8 3;  1UL9 A;  1XU1 A;  1SFY A;  3A0K A;  3AFK A;  4IE7 A;  2HWC 1;  2PHD A;  4QX1 A;  1VMF A;  1GBG A;  2YY1 A;  2E63 A;  3R4S A;  5GLZ A;  1UYP A;  2XWB B;  3HQU A;  1POV 0;  5FK8 A;  2PYT A;  2WNU C;  5FYS A;  2ENR A;  2W91 A;  2MHF A;  1AR8 1;  2B5H A;  1TEI A;  3WF3 A;  5IFP A;  3WNM A;  2HWE 2;  4YWA A;  5IK4 A;  1OOP C;  1U5Z A;  5FY8 A;  2P3K A;  5FRA A;  5BNO B;  1RUG 2;  4JAA A;  4XIO A;  4UW5 A;  4YG3 A;  3ZYF A;  2RS1 2;  4R9B A;  2E26 A;  2Y38 A;  1LHW A;  1QQP 2;  3POB A;  1UIJ A;  1NZI A;  5EJ3 A;  4IV1 C;  1H1A A;  5A3N A;  2ET7 A;  4XDO A;  3ST7 A;  4AXO A;  4RGK A;  5CAD A;  5A3T A;  1LU1 A;  2X53 S;  5JPN B;  4LE3 A;  4XBL A;  4AQ2 A;  3Q9O A;  2ZXQ A;  1ZVF A;  4ZU7 A;  4Q0Q A;  1PVC 2;  2BER A;  2QCS B;  1H30 A;  3LA2 A;  3PL0 A;  2P3Y A;  1ST8 A;  2HWB 2;  3ON7 A;  3HNM A;  1D4M 3;  1U0A A;  1B35 C;  2WWJ A;  2I2S A;  3MUY 1;  4QMA A;  5E16 A;  4CCO A;  5LWB A;  2VOK A;  3HQX A;  3Q8F A;  2RMU 3;  1EYB A;  3ASI A;  3I3E A;  3T2Q A;  1MQT B;  3E5Q A;  3MV0 1;  5IT6 A;  1UPS A;  2HYK A;  2W47 A;  1EP0 A;  1U5X A;  3H3L A;  2Y26 A;  3ZIW A;  5JI7 A;  1CAX B;  4URA A;  2VNR A;  2BW8 A;  5C9A B;  1NE4 A;  3WDY A;  4BQY A;  3M4F A;  5FMO S;  2BYV E;  3NJZ A;  2JDM A;  4RR3 C;  4W8J A;  4DXS A;  2AH2 A;  1UZZ A;  3OY8 B;  5J96 B;  3W5M A;  2BJS A;  1YWK A;  3AKP A;  4CDQ C;  5IVV A;  4JGZ C;  4M0N A;  1FOD 2;  2C24 A;  1GZT A;  2QFE A;  1PIV 2;  3VZN A;  5J7M A;  2NLR A;  2X8K A;  2JDN A;  3HJR A;  3MV1 1;  5E1R A;  5FJK A;  5A32 B;  3C8X A;  3IPV A;  5ANQ A;  3LDR A;  4WVM B;  4TSV A;  1KD7 A;  1L3J A;  1SEF A;  4LBQ B;  4JKL A;  1O3Q A;  3GZT B;  1WBL A;  4IEX A;  5C8C B;  2VCB A;  3OG2 A;  1YJK A;  4LUL A;  3OCP A;  4QD2 A;  1MS9 A;  4J1W A;  2R04 2;  3ACL A;  4AFB A;  3PIG A;  1VBE 2;  4HPK A;  4YLZ A;  3V0A A;  1AYM 2;  5C9A C;  4E2S A;  1AXZ A;  3WNO A;  1LED A;  4MXV A;  1VR3 A;  4QPI B;  1JUH A;  2ARB A;  4N9H A;  1X50 A;  2F4P A;  3IIA A;  3PVE A;  3Q8B A;  5A7W A;  3T1M A;  2GC3 A;  4QX5 A;  2R32 A;  1AR7 3;  4XFC A;  5HPO A;  2YGM A;  1RHI 3;  4Q1R A;  1UPI A;  2HLE A;  3AC0 A;  2ET1 A;  3CL1 A;  2VMH A;  4FTE A;  3RNS A;  1IPK A;  4AOC A;  1AR7 2;  3WP6 A;  1LJ7 A;  1XE8 A;  4KG0 A;  2IXI A;  4EN9 B;  1XSR A;  5FZ3 A;  2P2K A;  2JEN A;  3DXU A;  2GC0 A;  3H1Y A;  4Q4V 2;  4M4R A;  3ILR A;  2HWF 1;  4RD7 A;  2ORX A;  2EA7 A;  1RIN A;  1HB3 A;  2JKX A;  3OBT A;  3QBQ A;  5I0U A;  1MS1 A;  4HON A;  4EN6 B;  1NCR C;  2NN8 A;  2VUJ A;  2D3P A;  2OQ7 A;  4MGI E;  2YC0 A;  5F5Q A;  4NRO A;  1RL3 A;  3BTZ A;  4WZF A;  2XQR A;  1DDL A;  1ND2 A;  5KXD A;  4CDW C;  1OKQ A;  4XJW A;  2AGS A;  3ACF A;  3MDP A;  3THD A;  2A6V A;  2ZEW A;  3DUI A;  4A7K A;  4BXS V;  2KR2 A;  1SLC A;  2XJS A;  4OMC A;  1QQP 1;  5BNP C;  2JE7 A;  1PO2 1;  4LIV A;  3C3V A;  4O9E A;  4QQO A;  1QHD A;  2C5D A;  1XRU A;  2D44 A;  2VNV A;  2Y6H A;  4QKN A;  2D7F A;  4WVM A;  4CCJ A;  3NNL A;  2XHN A;  1ZM1 A;  5FKB A;  2WZE A;  3NJY A;  1JZ2 A;  2YFU A;  3OBA A;  2W0X A;  3RS6 A;  1AR6 3;  3WD5 A;  1UWW A;  1AJK A;  4E9K A;  2O8O A;  2RS5 2;  2WRA A;  5FZI A;  4MX3 A;  4N90 A;  2VQT A;  3PUQ A;  4BDV B;  1H6Y A;  2WA4 A;  4Q4X 1;  5KXE A;  1BK1 A;  1WLW A;  1UKR A;  4OHY A;  3E1F 1;  5BPX A;  5FJH A;  3WDW A;  2ZMN A;  5JMO A;  4AK3 A;  4XCB A;  3LDK A;  3POW A;  5FIX A;  1MEC 1;  4CDW A;  4AQS A;  1L7R A;  1YCI A;  5FPB A;  4QXK A;  5EFU A;  4AVC A;  1LU2 A;  4MGZ E;  2ZAA A;  1UN1 A;  4AI3 A;  5CYY A;  5AC9 2;  5JLV A;  1CZS A;  5ISL A;  5L9B A;  2XJU A;  4LUK A;  3L2H A;  4NUB A;  5C8C A;  4CSW A;  2HWB 3;  1BQP A;  4LEJ A;  5FZK A;  5EP9 A;  4FPO B;  4QX7 A;  1W6M A;  2YV8 A;  3DGT A;  4ERO A;  1YYN A;  3OUI A;  3WDT A;  3KGZ A;  1UU4 A;  2YU2 A;  5JOY A;  2AZ5 A;  2YC4 A;  2A6X A;  2VE1 A;  3O0W A;  1RUJ 3;  3U14 A;  4BLJ A;  5JI9 A;  1A3K A;  4NHX A;  4I30 A;  1JYI A;  1QIQ A;  2DTY A;  1W90 A;  2LRP A;  1ASJ 3;  1C8M 1;  1DZT A;  2UY8 A;  4YVS B;  1OUX A;  4F3J A;  1D2S A;  1YFU A;  2Y60 A;  1GUI A;  1DGR N;  1GP5 A;  1L7L A;  1VBC 2;  2VMD A;  4Q4W 1;  4TXW A;  2K0G A;  1RGS A;  1W0N A;  2OXB A;  3ZFF C;  2VNG A;  3ZO0 B;  4AED A;  1PX3 A;  4Z82 A;  5A33 B;  1Y9G A;  2W87 A;  3MPB A;  4B1L A;  2W2I A;  2G19 A;  1K5J A;  1H2K A;  5IJR A;  4B7K A;  4BYY A;  4D6S A;  4BQW A;  3WUD A;  1CX4 A;  1R08 1;  3ECQ A;  1MAC A;  5LRS A;  4LBQ D;  2VZT A;  2FCT A;  1HJG A;  2OUJ A;  5FZH A;  3R05 A;  5FZ6 A;  1UNB A;  4RR3 A;  5FK7 A;  1GLH A;  4YM1 A;  4CDW B;  3SLI A;  3KVA A;  1BVV A;  3O14 A;  4RQP B;  3ETQ A;  4NOT A;  3VD7 A;  2EIC A;  4EWD A;  1QU0 A;  2QNK A;  1GKB A;  2VW0 A;  4AHZ A;  4B8E A;  3ZSE A;  4BWO A;  5A7N A;  4FFH A;  4QAW A;  4LKD A;  2HWD 3;  3LSD A;  3N9L A;  2HWD 2;  5FOB B;  2WYF A;  3ILN A;  1F5F A;  4RHV 3;  5CKN A;  1QEX A;  1HRI 2;  5FFO C;  5KXC A;  5KC6 A;  1RUC 1;  3QLQ A;  4R9A A;  3LEM A;  3I59 A;  4QB1 A;  3SH4 A;  4K21 A;  1VLN A;  2D98 A;  1NG0 A;  3U11 A;  2VH9 A;  1US2 A;  3ELN A;  1H8V A;  2VVE A;  5IW0 A;  4QPG A;  2BNM A;  4NHM A;  3VBO A;  1O4Y A;  5CFD C;  2J1A A;  1PO2 2;  3FLR A;  1CAW B;  5LK5 A;  3WY6 A;  1ZA7 A;  4XE9 A;  5JXI A;  2W95 A;  4QX8 A;  5FPZ A;  5FZG A;  3M3I A;  1GQP A;  3NVC A;  3OSD A;  2VPV A;  5GAL A;  4LK7 A;  2QQO A;  2E6V A;  4FPG A;  4EN7 B;  4H55 A;  1DQ4 A;  1S1A A;  1WCD J;  4IV1 A;  1DF0 A;  1ALY A;  4FPC A;  3DN7 A;  3FFZ A;  3HT1 A;  3ZLI A;  3WIN E;  1IKQ A;  2A3X A;  4ZON A;  1DZR A;  2IFW A;  1OFS A;  5M0T A;  1EPW A;  3THC A;  2VMG A;  4PHZ A;  2LAL A;  2VVD A;  1Z7S 3;  3WDV A;  4JGZ B;  1C3H A;  1JMU B;  2VZS A;  4CDQ B;  2PMW B;  3IPV B;  1H8T A;  1UYZ A;  2KD7 A;  3IDA A;  3IMM A;  1AR9 2;  3CLP A;  3K75 B;  5I0D A;  2JDY A;  2DCK A;  3RMX A;  1Q43 A;  3WCS A;  5FP7 A;  1NY7 1;  3ZFG C;  1W6P A;  3IAQ A;  4ZZ8 A;  4L2N A;  3QH6 A;  2H0V A;  1N1V A;  2BWC A;  1AX2 A;  3DKQ A;  4LBL A;  5DDJ 3;  4R9D A;  1W06 A;  5JOZ A;  3E5U A;  2VUC A;  1ZZB A;  1DHK B;  5CFC A;  4EE2 A;  2PLV 3;  3ZN6 B;  3N9P A;  2QQV A;  4HZF A;  4COY A;  2I45 A;  4BH9 A;  5K0U A;  1YEW A;  3I2H A;  3ZMO A;  5FPV A;  4Q0S A;  1CPM A;  4JHZ A;  1W3X A;  4DIQ A;  2DVA A;  1F5J A;  4CCM A;  5J09 A;  2A71 A;  3ENR A;  4XJ8 A;  3OEB A;  4IEP A;  4HN1 A;  3JXS A;  1NX9 A;  5IVB A;  2VAU A;  3ZFE B;  4QGL A;  2JD4 A;  2PEL A;  4MXW B;  5JZG B;  4XMA A;  3QAC A;  4KG8 A;  3LWC A;  1W2O A;  3ZDV A;  2WFF 3;  3R4D B;  5BNN C;  2Y64 A;  2DU0 A;  3VD3 A;  2ADD A;  4BOW A;  4JRL A;  2R7E B;  1J3R A;  1HB1 A;  1PO1 1;  2B4K A;  2RDN A;  2WLP A;  3C2U A;  3ITQ A;  3C7H A;  3TYJ A;  2CGP A;  3TB0 A;  2BDR A;  4MGQ A;  5E8A A;  3J26 N;  2YPJ A;  2CSG A;  1IQA A;  3S30 A;  3URF A;  1AJO A;  3ZOI A;  4Z8B A;  1UZV A;  1QDC A;  2PLV 2;  3AZY A;  3FC0 A;  3DYO A;  3OGS A;  3O7O A;  4JZR A;  5FY7 A;  3FJS A;  2NPI A;  1A8D A;  3A22 A;  4QPI A;  2Z4F A;  4JGY A;  2VL4 A;  4LA2 A;  4DIN B;  3O0V A;  1O4Z A;  4M3C E;  2ZML A;  1IG3 A;  3MF6 A;  3AFG A;  4Q8L A;  1LKN A;  4RN5 A;  2ZCW A;  1W6Q B;  4WM7 A;  4A4A A;  1Y43 B;  4XUT A;  3LZZ A;  4P9Y A;  5FYH A;  4HFS A;  5LA9 A;  3VBO C;  1HIX A;  4DZG A;  1ULD A;  4Q4V 3;  3NV1 A;  3AP9 A;  1NXM A;  2Z5W A;  3IBM A;  4W6Y A;  2N7G A;  1G9A A;  5C5T A;  1RUC 2;  1PZ7 A;  2JDU A;  4QKD A;  2PHU A;  1UXZ A;  2RS3 1;  1RHI 2;  1STM A;  2VUA A;  4GAZ A;  1F35 A;  1JUI A;  5GLV A;  2ETE A;  1JN2 P;  4HK8 A;  4WM8 B;  2VBB A;  2XG3 A;  5IAT A;  1S0D A;  2WJS A;  3N7J A;  4ASM B;  4LO5 B;  4IV3 C;  1OQ1 A;  2DUQ A;  3A0N A;  3MUZ 1;  4J1X A;  4P9I A;  4BHP A;  3H7J A;  1WMF A;  4BQ5 A;  1PHM A;  5JMC A;  4AED C;  1G9D A;  4KWL A;  4DXZ A;  5BNO A;  4CYD A;  1CES A;  3WW1 A;  2YFZ A;  2Q8E A;  3LFI A;  4RS5 C;  5JCT A;  1UZ0 A;  2JKB A;  4XZU G;  1QOS A;  3WOG A;  2ZPX A;  4CVU A;  1KJR A;  2VU9 A;  1XC6 A;  2E7T A;  4HLT A;  4W4Z A;  4YW1 A;  1CAU B;  2A73 B;  3AK0 A;  1X9P A;  1XXN A;  2QQK A;  4BK4 A;  2UU8 A;  4CE8 A;  2R49 A;  4OHZ A;  1IKP A;  2XHK A;  3OOX A;  3UET A;  5JXH A;  3OGV A;  1OF3 A;  2R30 A;  4BLI A;  2RDR A;  2GMP A;  5FY9 A;  1AYN 3;  4ZY9 A;  1F4A A;  5DUW A;  1ZRR A;  1HRI 3;  4LMF A;  1CIY A;  1IHM A;  4AAX A;  2GNB A;  4KBB A;  4TZD A;  2VOX A;  1ODN A;  2HJI A;  4LKE A;  4XUQ A;  2JG9 B;  2W1U A;  1DU3 D;  1FPN 3;  1JOP A;  2H0B A;  5C3Q A;  3I2I A;  2EXH A;  5KHI A;  3WNX A;  2ZZJ A;  1QJX 1;  2E7A A;  2P37 A;  1ENR A;  4GMP 3;  1E5H A;  2V4V A;  5C71 A;  5D8A B;  1W8F A;  4BA6 A;  5L36 A;  3V64 A;  4COV A;  3LPF A;  3VBF C;  2J1E A;  4CCC A;  3VUO A;  5GLT A;  3MI8 A;  1RC6 A;  4BME A;  4YZ4 A;  1OLM A;  1W8H A;  3AYA A;  4PIY A;  1UOJ A;  2UWB A;  4AE2 A;  4HVO A;  5FYM A;  1Q8V A;  4FPE A;  1ZRC A;  2BU9 A;  2HYX A;  1BBT 1;  2CHH A;  5K7P A;  2WNV A;  1WGP A;  4GAL A;  1JYN A;  1VJ2 A;  4BMB A;  3KV9 A;  2A7A A;  5T5P A;  2AEZ A;  3III A;  3JB4 C;  3S0M A;  1YRZ A;  1X8M A;  2QUO A;  3PUS A;  4UFJ A;  2BVB A;  1GQH A;  5ACA 1;  1BMV 2;  4XXA A;  1R1A 1;  4IEV A;  4P02 B;  5FZ7 A;  3UJO A;  1JU3 A;  1ULE A;  1WA4 A;  5A7Q A;  1TNR A;  3B93 A;  3VKN A;  3ZXE A;  4AAP A;  1RUJ 2;  2VME A;  4UW3 A;  1J59 A;  1ODM A;  3NV3 A;  4XET A;  4IE4 A;  4ZKT B;  1X36 A;  4XTM A;  1R09 2;  3KVB A;  3PUA A;  2VUD A;  3IKW A;  2HBU A;  2ZKN A;  5K4L A;  4U36 A;  1URX A;  3AMP A;  4P5Y A;  1G86 A;  5H9R A;  4Y5Z 0;  4D0Q A;  2Z2S B;  4L0P A;  3UGH A;  1JYW A;  4FXG B;  5LAT A;  3T2O A;  4Y22 A;  3SH5 A;  1QF3 A;  3HMY A;  5BNP A;  3POY A;  3CF6 E;  4N43 A;  4N53 B;  4MGT A;  3ACI A;  2ZBJ A;  3ZFF A;  3S7I A;  2YG0 A;  4QHZ A;  3CBN A;  4FTB A;  1UXX X;  3WW4 A;  2WYS A;  3JD7 1;  1U12 A;  1WCK A;  1XQN A;  4Y1X A;  2VCM A;  4OLL A;  4C91 A;  2RM2 3;  4D8M A;  4R4Z A;  5EJZ B;  1OQE A;  3N36 A;  1CON A;  1ZBA 1;  1M4W A;  1XE7 A;  3NJX A;  4ARY A;  2PAK A;  2QDR A;  3BKZ A;  1AL2 3;  2BRT A;  3GBF A;  1BJQ A;  4L9B A;  2W5F A;  3U10 A;  1AYN 2;  3MLL A;  3VB9 A;  4EYU A;  4B4Q A;  4FAH A;  5T55 A;  2OYZ A;  5LBC A;  4AFD A;  5DPN A;  4QHB A;  1JYT A;  2BZD A;  2PA7 A;  3EB7 A;  3J8F 1;  3AM2 A;  3JBG 1;  5A3M A;  4QM8 A;  1VBD 1;  1XNK A;  4DXR A;  2PHW A;  2WLQ A;  3OPZ A;  1S0I A;  4BQ4 A;  1UMH A;  1PGS A;  4Y1V A;  1YLL A;  4UOJ A;  3VL8 A;  2HKX A;  4NMI A;  4CCE A;  2W1W A;  2ZEX A;  5DAX A;  3BU0 A;  1GSL A;  2PHL A;  4NHK A;  5C4W B;  4C0H A;  2R6Q A;  3BTY A;  2XJT A;  4HN0 A;  5HV4 A;  2DCZ A;  3M8L A;  4G9S B;  4H14 A;  3WT3 A;  4MGS A;  1AL2 1;  2MEV 2;  1SZB A;  2IFR A;  3RPQ A;  5A1L A;  4NRQ A;  3ROU A;  1K3I A;  1LEN A;  2ZX4 A;  5C6C A;  5FWJ A;  3LOB A;  2GME A;  4CDX A;  3AZX A;  4CCN A;  1QJX 2;  2BGP A;  2GND A;  3ES1 A;  3MW2 A;  1FOD 1;  3UKT A;  4IL7 A;  3W9A A;  1EV1 2;  4GKX A;  1W8W A;  1V70 A;  3E6D A;  2WNE A;  3DEM A;  2V5D A;  1V9U 3;  5FYT A;  3AYD A;  1RMU 2;  2JDK A;  4AGG A;  1OUS A;  2VMF A;  2ZGO A;  1NA1 B;  4AW7 A;  2V73 A;  1QKQ A;  1PM4 A;  4AI1 A;  2JG9 C;  4EZ4 A;  1AYM 3;  4QDS A;  2DVB A;  4Z2W A;  1LGN A;  1O8P A;  3CZU A;  2R04 1;  1VBE 3;  4UFI A;  4BK5 A;  1CGP A;  5FR3 A;  5KXB A;  1AYM 1;  2IVI B;  1RUD 1;  2EXK A;  3GBG A;  3H0O A;  1AUY A;  2ID4 A;  1JH5 A;  1RIR A;  5C8W A;  4XIK A;  1ZBE 3;  4YGD A;  5A6X A;  3ES4 A;  1NQJ A;  4GB3 2;  3HEI A;  4OUL A;  2VOW A;  1UY1 A;  4UBG A;  1ZYB A;  3K3O A;  2FDG A;  2BGC A;  4Y3O A;  4A45 A;  3MLK A;  4KGQ A;  2QQN A;  2WO3 A;  3WLU A;  1CZT A;  2DVD A;  1FOD 3;  4L11 A;  5FQ0 B;  1R09 1;  2VZV A;  1LEM A;  1N1S A;  4UBH A;  5IK7 A;  4IGP A;  4FO9 A;  4XXP A;  3RI8 A;  4CU7 A;  1KXG A;  2HWF 2;  1T6B X;  5JSR A;  2LS6 A;  2LW8 A;  1GU3 A;  3MW4 A;  3VDD B;  2RHP A;  5T3N A;  1TMF 1;  3NAP A;  2DUP A;  2YBS A;  3KQ4 B;  4E4H A;  1QXJ A;  3ETP A;  3LB9 A;  1VRH 3;  5DAQ A;  2V72 A;  2QVS B;  4P9J A;  2WAA A;  4BCU A;  1GWM A;  5T50 A;  4XFH A;  4AGV A;  2RV9 A;  2W52 A;  3JD7 2;  5FYB A;  4WVZ A;  3AKQ A;  4WM7 B;  4YM2 A;  2VZP A;  3CO2 A;  3IB3 A;  5IFT A;  4MSV A;  2IZW A;  3OUH A;  3ZYR A;  1YQC A;  1KIT A;  4AZZ A;  1F2N A;  1MS4 A;  5E89 A;  3K3N A;  1AR9 3;  4CDX C;  4UXA A;  1IG0 A;  5L9V A;  2IXK A;  3TAY A;  4S2F A;  2GN3 A;  1AYN 1;  3PDQ A;  1TME 3;  5EYY A;  4P08 A;  2R1B A;  1S2K A;  2EAL A;  3ZKY A;  1YQ5 A;  1PVX A;  2WSV A;  1RUI 3;  3DPR A;  1W6N B;  2P5B A;  4H2A A;  5C3R A;  1WLC A;  1NLR A;  1DG6 A;  4NIA A;  4COW A;  1OQD A;  2DU1 A;  1DLL A;  1RUG 3;  2W39 A;  2WZ8 A;  1H4H A;  3VZK A;  3JD7 3;  4I0A A;  1M06 G;  2JB8 A;  3P6B A;  5C4W C;  1OVP A;  1ZX5 A;  4UW6 A;  1RUF 3;  5A7O A;  4AI8 A;  2QKD A;  2DTW A;  3ORJ A;  3PU3 A;  5CZK A;  3QCW A;  5A3U A;  1ZZ8 A;  3VDA A;  4B4R A;  2H6B A;  4HVQ A;  2FDH A;  3NJV A;  1JBC A;  4GJY A;  4GH4 C;  2CV6 A;  1C5I A;  2GNT A;  2XJR A;  1AR8 2;  1UCX A;  2IWG B;  5FZ9 A;  4CUA A;  2DF7 A;  2J1T A;  3USU B;  1F8V A;  2D6L X;  2YUE A;  3WR0 A;  1WMD A;  3JQW A;  5JZG A;  1QNW A;  2RVA A;  3LCP A;  3OD0 A;  1WBF A;  2BTV C;  3ZXJ A;  2P17 A;  1POV 3;  1S0B A;  1WME A;  2E51 A;  1OKO A;  4V2W A;  4ATE A;  2YC2 A;  5ACA 3;  1GZC A;  5IAX A;  1VBC 1;  5FZC A;  2ZA9 A;  2QZ3 A;  3NWK A;  1WWY A;  1CAV B;  4I2O A;  5GZG A;  4LO8 A;  4Y5T A;  5CU1 A;  4E2G A;  1H1I A;  5K0U C;  4D69 A;  3CNA A;  2EID A;  4I3P A;  2WKK A;  5KC5 A;  2RR1 3;  3W21 A;  3ZR6 A;  1OPM A;  2EIG A;  5ANN A;  1IS3 A;  2HEW F;  4CU9 A;  4GUL A;  2FBE A;  4NWW A;  1RMU 3;  2F6B A;  3PTR B;  4JGZ A;  1HKD A;  4IV3 A;  1YQ6 A;  2Y34 A;  5CEH A;  4UF0 A;  1PNF A;  4OZO A;  5JR2 A;  2ZAH A;  5FP8 A;  1DCS A;  1IOA A;  1PM7 A;  1PX4 A;  3MBW A;  1JZ4 A;  4LIT A;  1CN1 A;  1LHO A;  3TRS B;  2XBO 1;  2Y8K A;  4XZP A;  3RMY A;  2WII B;  2OPK A;  1YFX A;  1VP6 A;  3BYW A;  4JCK A;  2J7M A;  4Y33 A;  2XXZ A;  5F7U A;  4LE4 A;  1TMF 2;  3KB5 A;  1DIW A;  2LTN A;  1HRI 1;  3UKN A;  1GWL A;  1HN1 A;  1V00 A;  5FXX A;  4MH0 E;  5GKA C;  2PQS A;  3OY8 A;  3S5Q A;  1JI6 A;  3DV8 A;  5FZM A;  5FZ8 A;  5C3S A;  4LHS A;  1F31 A;  2VQA A;  1WW4 A;  2WWU A;  3WP3 A;  2V5Y A;  3IWZ A;  2D5F A;  4Q4Y 2;  1LOB A;  2ZGL A;  1OT5 A;  3T2T A;  3K48 A;  4GH4 A;  5LW9 A;  4KMQ A;  4RGG A;  4BQX A;  5AC9 3;  2WFP A;  3ALQ A;  4HSL A;  4IGQ A;  4CPB D;  3U07 A;  3N4M A;  4OMD A;  1I5Z A;  3ZSK A;  4N53 C;  3BTX A;  1LOC A;  1HN0 A;  3KD4 A;  3SKJ E;  4DY5 A;  4HT1 T;  4O9G A;  1SAC A;  1RUE 1;  2ZMK A;  4IEO A;  1W9F A;  5I0T A;  1OXC A;  5H9P A;  1OA4 A;  5FKC A;  5LCW L;  1JYX A;  4TTG A;  2EAK A;  2B9V A;  3B69 A;  4Q29 A;  2WAB A;  4GZ9 A;  4B1M A;  1AR6 2;  1HJF A;  2RS3 3;  3C7F A;  5LBE A;  1OF4 A;  2FDF A;  1NZC A;  1QXR A;  1Z78 A;  4E8D A;  5I8T A;  2D6O X;  2Y0I A;  5LY2 A;  4FFI A;  4JC1 A;  2Y0O A;  4Q4V 1;  3IM0 A;  1KDM A;  2DFB A;  4XHB A;  3RGB A;  1O4T A;  4FOW A;  3I2J A;  5B4X A;  4F7Z A;  3NNG A;  1WD3 A;  2IUW A;  3DL3 A;  2BFU S;  2V09 A;  2WO1 A;  2QQL A;  4XMI A;  2BWA A;  5FLJ A;  1DYK A;  3M70 A;  4M3C A;  2RJL A;  3O1P A;  3VD9 A;  1Q5O A;  5BUV A;  1OD5 A;  1FX5 A;  1SMV A;  1VMH A;  3BTA A;  1H8T C;  1JZ3 A;  5HCH A;  1S0F A;  3ZXF A;  4LNV A;  1DYP A;  2JD9 A;  3A23 A;  4YW5 A;  2SLI A;  5HBA A;  4GXL A;  4FQ4 A;  5I8Y A;  3EBR A;  3OB8 A;  5LEJ A;  2JG8 B;  3E5X A;  5D8A C;  4RFR B;  1EUT A;  5LB6 A;  4D7S A;  1W6O B;  3H8U A;  2XPJ A;  2CYF A;  1MZE A;  3H7Y A;  4YVW B;  5IHR A;  4WM7 C;  3FUQ A;  5A6Z A;  5FZB A;  2HWC 2;  3KHC A;  3I2K A;  3VDD A;  4ORF A;  5FP9 A;  3UJQ A;  3VZL A;  5DMY A;  1R08 3;  3QOP A;  5FYC A;  4AR2 A;  4AEK A;  4LA3 A;  1RUH 2;  3GJA A;  2E53 A;  2PLV 1;  4KWK A;  4YG0 A;  4DPN A;  4YVS A;  1XBF A;  3OBR A;  4N53 A;  5FRE A;  5F37 A;  1SLB A;  1ONA A;  5DDJ 1;  2HWE 1;  2Z69 A;  4HKW A;  4IEZ A;  1ULO A;  3C7O A;  5B2G B;  4OQ9 A;  5FZL A;  4CP1 A;  4YZ2 A;  1JOJ A;  4A6O A;  4ZU4 A;  1F15 A;  2QTW B;  2OKX A;  1QJU 1;  3N9M A;  3AZW A;  3NMB A;  4CP0 A;  1SBF A;  1UY0 A;  1OBN A;  1Z7S 1;  2Q30 A;  1ZZ6 A;  4HL0 A;  1RVF 3;  4GWJ A;  2CY6 A;  4PIX A;  2ZGU A;  3WHT A;  4LBK A;  1F4H A;  3I54 A;  5T52 A;  3LIG A;  2VQ0 A;  3WG3 A;  4CZS A;  2BNO A;  5FO9 B;  4O61 A;  2X10 A;  4JGY B;  2VXR A;  4LIU A;  3ZYP A;  5FDB A;  5H9Q A;  3EXU A;  4Y22 B;  4CDU B;  3AL5 A;  4DNY A;  4EN0 A;  5FTT C;  1NKG A;  1X9T A;  3GHM A;  5KHJ A;  2C0Z A;  2QE3 A;  4Y1U A;  1HX6 A;  2CNA A;  3AJZ A;  1QMJ A;  2ZEY A;  2VZ3 A;  4W50 A;  3WW2 A;  4QQ2 A;  1BVP 1;  4FOY A;  4P00 B;  2J1R A;  2JIG A;  2VW2 A;  1V6N A;  4H3W A;  3VBS C;  5T5J A;  3ZXL A;  2XH6 A;  2VTF A;  2R07 1;  4FPJ A;  4XUP A;  3ZYG A;  1BCX A;  1RUH 3;  1COV 1;  2XML A;  3BPZ A;  1R08 2;  2HH9 A;  4FCA A;  4QX0 A;  3PJY A;  5T5L A;  3RFR A;  4BE3 A;  3NAP C;  1IS4 A;  4Y20 B;  2YU1 A;  1C28 A;  4ARX A;  1KQR A;  1SFN A;  5JXJ A;  1N47 A;  2P6C A;  4M3C F;  5JWP A;  1AR6 1;  1PVC 3;  1YC6 1;  1ND3 A;  2P3J A;  4FSJ A;  4IEQ A;  1W2U A;  4D7T A;  3IZO A;  2F17 A;  1RUC 3;  1OVS A;  5K0U B;  2GZW A;  3ZXK A;  1PIV 1;  1AXK A;  2W1Q A;  4NO4 A;  1WCS A;  4M00 A;  5A3L A;  4HAN A;  3USU A;  5CG9 A;  5F6L B;  5CB7 A;  4AHW A;  1ZZ7 A;  4CCK A;  2O1Q A;  2JXA A;  5BNN B;  4K1Y A;  2O14 A;  4FTS A;  1O6U A;  3KV5 A;  2VZ1 A;  4RGA A;  4ZZ5 A;  2RS1 3;  3KV4 A;  5F5A A;  2VNO A;  4AF9 A;  3MIH A;  4PDW C;  4DEV A;  1NAE A;  2CWM A;  1XU2 A;  4FPK A;  1VAV A;  1H9W A;  4DRR A;  3BOP A;  1WZX A;  1GQG A;  2WNV B;  2RG4 A;  3HIF A;  4Q5O A;  1BYH A;  2OVU A;  2Y6K A;  1H6X A;  3LEK A;  2ILM A;  2A3Y A;  5EQU A;  5F9T A;  4N43 C;  3IDC B;  1PK6 A;  3POJ A;  4QU2 A;  3ZYI B;  2EIE A;  3FUO A;  2NMO A;  4QDQ A;  3VKM A;  4X8P A;  1I6X A;  4X6Q B;  4BPZ A;  5J36 A;  2IXH A;  2C9A A;  4FP3 A;  2FDI A;  3DXT A;  5JIA A;  4JTO A;  2HEV F;  3SEE A;  1S4C A;  5FZO B;  2WZR 2;  4Y4Y A;  3KGL A;  4Q4W 3;  3WSO A;  3K4Z A;  3TEZ A;  1GOF A;  1AR7 1;  4KNC A;  4ES9 A;  1FNZ A;  4YSF A;  5JXG A;  2WUH A;  4GB3 3;  3THP A;  3M3O A;  1LRH A;  2HBT A;  1ZBE 2;  3VBH C;  1QJY 3;  3ZN6 A;  4COZ A;  2BQP A;  1RUJ 1;  2VZR A;  2ZGR A;  3WW3 A;  3ACH A;  3LAG A;  3ZKU A;  4XQD A;  1MZ6 A;  1ZA4 A;  2ZHK A;  1QH6 A;  2OII A;  4Q0P A;  4BQ1 A;  3RZG A;  4QXC A;  3VBS A;  3I97 A;  4MGY E;  1NCQ A;  3EO6 A;  4CEW C;  3WNN A;  2ZGM A;  3USS A;  5GZE A;  4DY3 A;  5FUP A;  1MVE A;  3I3Q A;  4CXX A;  4OHW A;  2A6Y A;  3S5A A;  5FZ4 A;  3LIH A;  4FFG A;  2AR6 A;  3HN1 A;  3FZ3 A;  1LHU A;  2OZ6 A;  4GH4 B;  1GR3 A;  3T4V A;  1N3P A;  1DLC A;  1QJU 2;  4EZH A;  4ZXE A;  1ENQ A;  1AHS A;  3M3E A;  1BEV 1;  1VBB 3;  1SBE A;  3FLT A;  3SEP A;  3RZL A;  1G7Y A;  2MPF A;  1Z7S 2;  1MEC 3;  3U75 A;  3WF1 A;  2XUE A;  4K7J A;  5J48 A;  4OFG A;  2YPD A;  2VBD A;  4QQP A;  1HRV 1;  1WA6 X;  2XL9 A;  3I3B A;  2GH8 A;  4IV1 B;  3JU9 A;  5FY1 A;  4AEJ A;  2VQU A;  1ZBA 2;  2OW4 A;  3VZM A;  3OYW A;  1S2E A;  3VHR A;  2XLG A;  2ZX0 A;  4Q4X 2;  3AMM A;  3RYR A;  2XLA A;  4IE0 A;  3HR9 A;  3EHK A;  2ZS6 B;  4QWN A;  3T08 A;  2QQU A;  4AVT A;  4O7X A;  1MEC 2;  2JX9 A;  3A7Q A;  2VVF A;  2XQX A;  3M3Q A;  3T2P A;  2UWA A;  5KWR A;  2BNN A;  1XNA A;  3E6B A;  3KCX A;  4NRM A;  4XUN A;  5F6K A;  1QJZ A;  2KM2 A;  5CKM A;  4CUG A;  1VBD 2;  4MGK E;  3WV6 A;  3J7L A;  3FBY A;  1D4M 1;  3H3Z A;  4QX3 A;  5JSO A;  1VE0 A;  2GDF A;  4Z1V A;  4K1Z A;  3O5S A;  3QD6 A;  3BB6 A;  1FV3 A;  4XAE A;  3LOI A;  1FMD 2;  4KU7 A;  3CHX A;  2JIJ A;  4XCA A;  4ES8 A;  3CJI C;  3I3M A;  1OA2 A;  5IYY A;  2DVG A;  2D3S A;  1DP0 A;  4MZU A;  1EAH 3;  2AEY A;  3RYK A;  2WIN B;  4K3U A;  1QJY 2;  3T1L A;  1LOA A;  1MS5 A;  2J42 A;  1LES A;  2R1D A;  1W05 A;  3E97 A;  3EJK A;  3J4U H;  4MHU A;  5T54 A;  2WS9 2;  1BZW A;  5IK5 A;  3ZYB A;  3SC7 X;  1WMX A;  1H0B A;  4GIQ A;  3WQ7 A;  4PLO A;  5J1X A;  1RHI 1;  3H1M A;  2B9U A;  3IDB B;  2QBX A;  1JU4 A;  1YI7 A;  3KS7 A;  1LR5 A;  2XL7 A;  4FXK B;  4YW3 A;  3APB A;  4JRA A;  3P3N A;  2Q8D A;  5FOJ B;  5EPA A;  1ZRI A;  3VKF C;  1ULP A;  4JQT A;  4M4P A;  1R64 A;  1Q8Q A;  3T30 A;  1HB2 A;  2W68 A;  1DFQ A;  1G6N A;  1WLD A;  4HOO A;  5FZ0 A;  3H9A A;  1I9R A;  2EVX A;  3AXD A;  5FYZ A;  2PQQ A;  2V4A A;  3ZN4 A;  3WG4 A;  3EMR A;  4A7Y A;  5BYN A;  1J1L A;  2B45 X;  3D4K A;  2BVV A;  2W9X A;  3POS A;  4PBO A;  4LBN A;  2FCU A;  1FXZ A;  2VO5 A;  4XQ4 A;  2WO7 A;  5L7O A;  1DQ0 A;  2AYH A;  4IET A;  4LO4 B;  3NL1 A;  3D6E A;  1EAH 1;  3B02 A;  3PME A;  2TBV A;  2EF6 A;  3X29 B;  1Y9M A;  1Y3T A;  2ARX A;  1NUK A;  4LPL A;  3RVH A;  4BB3 A;  3SIT A;  1U5Y A;  1C57 A;  4XEZ A;  1VRB A;  3RRD A;  2PFW A;  3R0R A;  2E33 A;  1LOD A;  3HAG A;  5DG2 A;  2Q8C A;  4YZ5 A;  2WSU A;  3OYW B;  2EIB A;  4UFK A;  2FDK A;  1W6P B;  4FP2 A;  3GBW A;  2LUW A;  5LRR A;  3TN9 2;  4ONU A;  1BEV 2;  5C3O A;  4P9W A;  3O12 A;  4XFF A;  1XNT A;  3ZR5 A;  1QH7 A;  3GNE A;  1JXN A;  4KH9 A;  1YO8 A;  5LBB A;  3K4A A;  1J3Q A;  5GLU A;  4RS5 A;  3N3H A;  2RMU 1;  4YPJ A;  2NM1 A;  3I4I A;  1NCQ C;  2QQM A;  1UKG A;  2WL1 A;  3AP4 A;  1J83 A;  1FPN 2;  1SPP A;  4KWU A;  1XYO A;  3HVD A;  1PGW 2;  5F8P A;  1GOH A;  4V2V A;  4NHL A;  3AMH A;  4B3N A;  2FMY A;  2FCV A;  2W92 A;  1NCR B;  5BXX A;  4EN8 B;  1HRV 3;  4Z92 B;  4K6B A;  3O1V A;  3T0D A;  3FL7 A;  1BXH A;  2ZZQ A;  2WNV C;  4L97 A;  5IAV A;  3WCR A;  2AEN A;  3W20 A;  1QGL A;  4DB5 A;  3RQ0 A;  1WCU A;  4UYB A;  5D1I A;  4E4Z A;  3PUH A;  5HV0 A;  1JW6 A;  4YVW A;  1WLT A;  2ZEZ A;  4MUV A;  4B4P A;  1AF9 A;  3GZU C;  3N7M A;  4LJH A;  3ZFG B;  1W39 A;  1CZV A;  2X5I C;  4M0H A;  4OI2 A;  5A80 A;  4JGY C;  5JSP A;  3O1T A;  2K9Z A;  2L9L A;  1FMD 1;  2ZGP A;  4OI1 A;  5CIR A;  3K46 A;  4YW7 A;  4QPI C;  2ZX3 A;  5J98 B;  4XAB A;  5JOX A;  1YQ2 A;  3MHZ A;  2YGL A;  4A3X A;  2J1S A;  1QJY 1;  3BI3 A;  4X8N A;  3L9J T;  1LOE A;  5LA2 A;  3RZH A;  1GWK A;  1ENS A;  2HWC 3;  1V9U 2;  1AVB A;  2EXJ A;  4XDQ A;  3BAL A;  4PI2 A;  1EV1 3;  2ZAC A;  3NQH A;  2YZ4 A;  1OOP A;  1WW7 A;  3M3C A;  1LHV A;  2ADE A;  1PMI A;  1ENX A;  1CAW A;  1W2N A;  3AP7 A;  3WG1 A;  3LKJ A;  4RQP C;  2VMI A;  2OUH A;  4FOQ A;  4DO0 A;  2WNU A;  5IUQ A;  3RG0 A;  1V6L A;  4AQ6 A;  4QXH A;  4A42 A;  2X5I A;  3ABZ A;  2YDE A;  2J1U A;  1US3 A;  4FFF A;  2W46 A;  4HKL A;  3LSE A;  3TNP B;  5BNO C;  3T0B A;  3VBS B;  4RR3 B;  2ZGN A;  4NHY A;  2Z42 A;  1MZ5 A;  3DPR B;  4FOV A;  4WV8 A;  4NE9 A;  1TE1 B;  2Y6G A;  4LHN A;  4CUB A;  4XFG A;  1HV1 A;  3JBG 2;  1JOD A;  2CWS A;  3E6C C;  2XVK A;  1XND A;  2JG8 C;  2WQ4 A;  3LA3 A;  3PIJ A;  4R4X A;  5FXV A;  3LEI A;  1S55 A;  2JG8 A;  1T2X A;  1YI9 A;  2WWS A;  4BXF A;  1O59 A;  3P1I A;  1UU6 A;  1W99 A;  1PIV 3;  1BKZ A;  1Y9Q A;  2E32 A;  2IXL A;  3QH7 A;  3UL2 A;  2VUL A;  1JYC A;  4XF9 A;  1W04 A;  3ZYJ B;  1B35 B;  1IS5 A;  1RYY A;  2DCJ A;  2X05 A;  3OD4 A;  3MYX A;  4OHV A;  1AL2 2;  1OLM E;  1MS0 A;  3V0B A;  4E8C A;  1JOB A;  2GMM A;  2VTX J;  2VZQ A;  3F2Z A;  4U2A A;  4WVW A;  4XAC A;  4QX2 A;  4D7Y A;  1XJA A;  4AVA A;  4W6W A;  4P9L A;  4CDX B;  4C90 A;  2I74 A;  4UAP A;  4XHX A;  3ZXG A;  2KA3 A;  2B7Y A;  3FHQ A;  4IXL A;  1PGL 1;  5IVY A;  1UOF A;  1BEV 3;  1VBB 1;  2MNG A;  2Q1F A;  3HOB A;  5AVA A;  3VHN A;  5FQ0 A;  4JDO A;  3HQR A;  1W03 A;  5BY5 A;  4QGN A;  3O1U A;  2C6S A;  1GZW A;  1OUR A;  1UY2 A;  4IUG A;  3BCW A;  3UGF A;  1W9W A;  3D0J A;  5AFB A;  2QZ2 A;  4A3Z A;  5LA0 A;  5SV8 A;  2OX0 A;  2DDU A;  2AUY A;  3RYP A;  2P3I A;  1ND3 B;  1OPO A;  4Q0U A;  2GAL A;  4QM9 A;  3O1R A;  3GHN A;  3N9Q A;  4XJZ A;  3VDB A;  4CDU A;  5FUN A;  4M01 A;  4ASK A;  1GV9 A;  3FN9 A;  2VXJ A;  3KWV A;  3WHU A;  4N7U A;  2JDZ A;  4GB3 1;  3OJB A;  1O5L A;  2WN2 A;  5D8A A;  2ZGT A;  4QDR A;  1RUO A;  2VM9 A;  3MW3 A;  2G4I A;  4OI4 A;  3RI9 A;  3ZM8 A;  3I49 A;  3M1H A;  2HWE 3;  1UD1 A;  2JEC A;  2X09 A;  4KBZ A;  3TEX A;  3G7D A;  4RL7 A;  1J58 A;  2FZ2 A;  1Q56 A;  3B9C A;  3DPR C;  5JR7 B;  5FYY A;  1MS3 A;  3B9I A;  4PQ9 A;  3RSJ A;  2A75 A;  3O0X A;  3VHP A;  5JOW A;  1JZ7 A;  1H2N A;  1Y4W A;  4GQ7 A;  4CPB A;  5FBJ A;  2Q0A A;  2OPW A;  2GSY A;  3NNF A;  3OF1 A;  4P14 A;  4UFM A;  2GU9 A;  3Q8A A;  1V0A A;  4TLG A;  4MXW A;  4E4D X;  3VD4 A;  1XE0 A;  4XPV A;  3AMN A;  5D21 A;  5HCB A;  5C3P A;  5APA A;  4Y24 A;  3LDB A;  4XIL A;  1OHF A;  2ERF A;  2RS1 1;  4RHV 2;  1FI2 A;  2X29 A;  2D5H A;  4BIS A;  5EZW A;  4JV4 A;  5A6Q A;  4AHY A;  5GZC A;  5DAP A;  1X7N A;  1IS6 A;  4KWJ A;  1RXF A;  4I3G A;  2OS2 A;  1VB2 A;  5FPA A;  5C5U A;  4SLI A;  4B7E A;  3ZXD A;  1MR5 A;  1PVC 1;  2BUK A;  3Q8E A;  3AKT A;  3NW4 A;  4IEY A;  1UY4 A;  2H6C A;  5JZG C;  4LBM A;  5F5I A;  2ZGK A;  4UFL A;  4R8H A;  5ABJ C;  4N43 B;  1DGR A;  1POQ A;  3NST A;  5B4N A;  4LR4 A;  4F8A A;  5C8C C;  5L7O C;  1COV 3;  1RUH 1;  4COU A;  2R07 3;  1GNZ A;  5F5C A;  1TQ5 A;  1REE A;  1EY2 A;  3GDB A;  1CX1 A;  5GLW A;  5LBF A;  3U37 A;  5H9S A;  3SQO A;  3VD5 A;  2X5I B;  3LA7 A;  3RDI A;  2CL2 A;  2P34 A;  1W2A X;  4PQQ A;  1JZ5 A;  1V6O A;  4DEQ A;  4EJR A;  2BGO A;  2VY0 A;  1XPW A;  5GJ6 A;  1V6J A;  3IT8 A;  1ASJ 2;  2W08 A;  3N7L A;  4E4S A;  5FBZ A;  1D2Q A;  1YUD A;  2BFU L;  3B94 A;  1GFF 2;  4NVP A;  3T0A A;  1WKY A;  1RUE 3;  3TWI A;  1JZ6 A;  2G9F A;  5GZF A;  2WQZ C;  1K5M B;  1RVF 1;  1C1F A;  4MOA A;  1U5I A;  1KEX A;  1MPX A;  3WX5 A;  1SDW A;  4C8D A;  3R6S A;  1HXS 1;  2PN5 A;  4XJ9 A;  4AYU A;  3J8F 2;  1QJU 3;  4NIH A;  2Q1M A;  4YG6 A;  3T3Y A;  2D6P A;  1AX0 A;  3S57 A;  1R1Z A;  4IGO A;  4NWV A;  2B8M A;  1BLZ A;  5DQ0 A;  4A6S A;  1K5M C;  2NP0 A;  1IPS A;  2DUO A;  4GWN A;  4PF1 A;  4S2D A;  1SQ4 A;  1ND2 C;  4BQ2 A;  5J37 A;  2QQJ A;  3GZA A;  3LFM A;  3SCF A;  3CJI A;  4DXT A;  2VOT A;  4MV2 A;  2HEY F;  2PTM A;  3VBF B;  3AX4 A;  3AKS A;  4DUV A;  3UYJ A;  1CPN A;  2Y33 A;  2UWC A;  3VBU C;  1H9P A;  1OA3 A;  1OLR A;  5HI0 A;  2CTV A;  1GP6 A;  5F3I A;  1C5H A;  2WZR 3;  1Q8S A;  3MIC A;  4D6R A;  4YM3 A;  2O0O A;  5D2A A;  1RJ8 A;  5F3E A;  1FAT A;  1DQ6 A;  4DOU A;  1UY3 A;  4N9I A;  2YRO A;  3HPN A;  3OEA A;  1YXW A;  2Y6J A;  4RSU A;  3AYC A;  5AVP A;  3EYP A;  5L19 A;  1RMU 1;  4YYO A;  4FPY A;  1O3R A;  3JUU A;  4NAO A;  3Q8C A;  4LBJ A;  4QPW A;  4PF5 A;  3GGL A;  4YVS C;  1DBN A;  1KJL A;  2R16 A;  4QB6 A;  5HCA A;  3O1M A;  5F3C A;  4MO3 M;  3UT0 A;  5F2W A;  3NKT A;  3PVN A;  4HKO A;  1AXY A;  4EWA A;  2YYO A;  4L8Q A;  4LBO A;  5FMC A;  3VZJ A;  1KGY A;  5DZF A;  3VKL A;  4Q4Y 1;  2FQP A;  4GD4 A;  1POV 1;  4FQZ A;  3OPT A;  2XKP A;  3GM8 A;  4RA0 A;  5CAZ A;  3OPW A;  3AYE A;  3LQC A;  1W8N A;  1W9T A;  2JDA A;  1ND3 C;  4AFC A;  5CNA A;  1E5I A;  4IER A;  4CEW A;  3TOJ A; 
#chains in the Genus database with same CATH homology
 1UXZ A;  2CDO A;  2C4X A;  2W1Q A;  4QB2 A;  1K45 A;  2C9K A;  3CKH A;  4ZZ5 A;  2VZ1 A;  3MUZ 1;  2VCA A;  3CMG A;  4DEV A;  1NAE A;  5G04 L;  4JX0 A;  2YFZ A;  4CU8 A;  1UZ0 A;  4XZU G;  2Y6K A;  4CVU A;  1H6X A;  3LEK A;  1I5P A;  4W4Z A;  1XC6 A;  4AAX A;  4BK4 A;  2QQK A;  2EIE A;  2QQI A;  4QDQ A;  2W3J A;  3UET A;  1K12 A;  3OGV A;  1OF3 A;  5JXH A;  3SEE A;  4ZY9 A;  1F4A A;  4Z2A A;  1P8J A;  3WSO A;  3K4Z A;  3DYM A;  1GOF A;  1CIY A;  5JXG A;  2WUH A;  4XUQ A;  2W1U A;  3I2I A;  3IAP A;  2VZR A;  1OH4 A;  3ACH A;  2Y6L A;  3LE0 A;  4GWI A;  2V4V A;  5C71 A;  4FI9 A;  5C70 A;  3BGA A;  3I97 A;  3LPF A;  3WEZ A;  2J1E A;  3WF0 A;  3WNN A;  2VR4 A;  4XUO A;  4JKM A;  4XUR A;  3WNP A;  3GXU A;  2WAO A;  1DLC A;  3VDC A;  3I2F A;  2HYX A;  4ZXE A;  3SEP A;  3T09 A;  1JYV A;  1UX7 A;  1JYN A;  3A21 A;  3WF1 A;  3III A;  3I3B A;  1UYX A;  3OGR A;  1K42 A;  2VQU A;  4P02 B;  1JU3 A;  3I3D A;  2VME A;  3T08 A;  2RJ2 A;  4KI5 M;  2XOM A;  1LNS A;  3CZJ A;  3A7Q A;  2XQX A;  3T2P A;  3WF2 A;  4P5Y A;  1L7Q A;  1XNA A;  4ET7 A;  4D0Q A;  4L0P A;  1JYW A;  1PMJ X;  4XUN A;  3T2O A;  4QX3 A;  3I2G A;  1DYO A;  3ACI A;  2WQ8 A;  2YG0 A;  3CDZ B;  3HN3 A;  1UXX X;  2WYS A;  3K4D A;  5FUI A;  4LKS A;  5IYY A;  2WDB A;  5A1A A;  1DP0 A;  4D8M A;  3WNL A;  5EJZ B;  2VZU A;  3NJX A;  4ARY A;  1EUU A;  4BJ0 A;  2W5F A;  5J1X A;  3UES A;  1O8S A;  1PMH X;  1JU4 A;  2QBX A;  3W5N A;  5DPN A;  2BZD A;  3EB7 A;  4QX1 A;  1ULP A;  4M4P A;  1R64 A;  4DXR A;  1UMH A;  4UOJ A;  2W91 A;  3WF3 A;  2W1W A;  3UNP A;  5IFP A;  2ZEX A;  3WNM A;  2CDP A;  3MO4 A;  2W9X A;  2E26 A;  2VO5 A;  4MGS A;  1BHG A;  2J1V A;  4OUE A;  1K3I A;  2VMC A;  1TG7 A;  2BGP A;  4CUC A;  2ORZ A;  4LPL A;  1NUK A;  2ZXQ A;  2BER A;  2V5D A;  3HNM A;  2W1S A;  2VMF A;  2E33 A;  5HXM A;  3MUY 1;  2EIB A;  3I3E A;  3T2Q A;  3MV0 1;  4QDS A;  2W47 A;  1O8P A;  3CZU A;  4BK5 A;  1XNT A;  3K4A A;  2WN3 A;  4YPJ A;  5LA1 A;  2QQM A;  2ID4 A;  1J83 A;  1J84 A;  1SG3 A;  3J7H A;  4KWU A;  4MAD A;  1GOH A;  3HEI A;  2W92 A;  1UY1 A;  4W8J A;  4DXS A;  3W5M A;  4A45 A;  2QQN A;  2WO3 A;  3T0D A;  1CZT A;  3FL7 A;  2VZV A;  3C7E A;  3C7G A;  3HJR A;  3MV1 1;  3C8X A;  3WQB A;  4CU7 A;  3PUH A;  2LS6 A;  2LW8 A;  1GU3 A;  2ZEZ A;  3DYP A;  4JKL A;  3ETP A;  2VCB A;  3OG2 A;  2V72 A;  1CZV A;  2WAA A;  4UI9 L;  2L9L A;  2RV9 A;  3K46 A;  4JKK A;  1JZ8 A;  2VZP A;  3IB3 A;  3WNO A;  1YQ2 A;  5IFT A;  1TVG A;  2J1S A;  5LA2 A;  5HPO A;  3CQO A;  2HLE A;  3AC0 A;  1UMI A;  3NQH A;  4P08 A;  4LQR A;  2BBA A;  2J22 A;  4M4R A;  2ORX A;  2JKX A;  4A42 A;  3WF4 A;  3ABZ A;  2J1U A;  1US3 A;  2W46 A;  2WZ8 A;  3T0B A;  3P6B A;  3D3A A;  5EIY B;  5CZK A;  2Y6G A;  2WBK A;  4CUB A;  3ACF A;  3THD A;  3VDA A;  2ZEW A;  4BXS V;  4OMC A;  3NJV A;  3LPG A;  1SHW B;  3LEI A;  1T2X A;  2Y6H A;  1O59 A;  3P1I A;  5G05 L;  1W99 A;  2XHN A;  2E32 A;  4CUA A;  1W9S A;  2WZE A;  2J1T A;  1JZ2 A;  1D7P M;  2YFU A;  3OBA A;  1RYY A;  4DUW A;  2DCJ A;  2X05 A;  2RVA A;  1UWW A;  2VQT A;  4BDV B;  1H6Y A;  4E8C A;  2VZQ A;  3F2Z A;  2YC2 A;  3E1F 1;  4QX2 A;  5JMO A;  4UAP A;  1L7R A;  3FHQ A;  3HNB M;  3K77 A;  2VJX A;  3HOB A;  2EID A;  5CYY A;  5C7G A;  1CZS A;  4CU9 A;  4IUG A;  1UY2 A;  1W9W A;  4A3Z A;  5LA0 A;  2VC9 A;  2DDU A;  5JUV A;  4OZO A;  5JR2 A;  3DEC A;  2YC4 A;  1PX4 A;  3MBW A;  1JZ4 A;  3VDB A;  2Y8K A;  3FN9 A;  2C26 A;  4A44 A;  2WO2 A;  2J7M A;  3WNK A;  5F7U A;  3PUI A;  2WN2 A;  4QDR A;  1GUI A;  4TXW A;  2VMD A;  1HN1 A;  2VM9 A;  4DUX A;  3ZM8 A;  2PQS A;  2YB7 A;  1W0N A;  1W8O A;  2X09 A;  4PT6 A;  1JI6 A;  1PX3 A;  4LHS A;  2W87 A;  4XVH A;  5IJR A;  3ECQ A;  1OT5 A;  2VZT A;  1JZ7 A;  4KMQ A;  2E31 A;  1OD3 A;  4OMD A;  1GNY A;  3SKJ E;  3VD4 A;  3VD7 A;  2EIC A;  4HG6 B;  3LEG A;  4CU6 A;  5EJ1 B;  3SKV A;  4QAW A;  4AG4 A;  1JYX A;  4TTG A;  5LCW L;  2B9V A;  2WAB A;  1WCQ A;  4GZ9 A;  3C7F A;  1OF4 A;  4E8D A;  4QB1 A;  1UY4 A;  3CIH A;  1US2 A;  5B4N A;  2JE8 A;  2J1A A;  3I2J A;  5B4X A;  3NNG A;  5JXI A;  2W95 A;  3BN6 A;  2WO1 A;  1SDD B;  2QQL A;  3GDB A;  1GQP A;  1CX1 A;  3U37 A;  4OYU A;  3VD5 A;  3VD9 A;  4PQQ A;  1JZ5 A;  2QQO A;  4DEQ A;  1JZ3 A;  2BGO A;  1XPW A;  2JD9 A;  3A23 A;  1JZ6 A;  3OB8 A;  3T0A A;  1WKY A;  1EUT A;  1JHJ A;  3THC A;  4MOA A;  5IHR A;  1KEX A;  1MPX A;  2VZS A;  1GOG A;  1UYZ A;  2KD7 A;  3IDA A;  3K75 B;  5I0D A;  3I2K A;  2DCK A;  1GMM A;  2XON A;  5DMY A;  3IAQ A;  4ZZ8 A;  5DQ0 A;  4PF1 A;  2QQJ A;  4RYD A;  1ULO A;  3C7O A;  4DXT A;  1UYY A;  2VOT A;  1IQD C;  3I2H A;  4A6O A;  5DN2 A;  2OKX A;  4DUV A;  4JHZ A;  1UY0 A;  3HNY M;  3OEB A;  3JXS A;  1NX9 A;  3NRU A;  2VCC A;  4GWJ A;  1F4H A;  1UY3 A;  3HPN A;  2X10 A;  3OEA A;  2Y64 A;  2Y6J A;  2W94 A;  3VD3 A;  3ACG A;  3EYP A;  2R7E B;  2B4K A;  1NKG A;  4QPW A;  3C7H A;  2VZO A;  3GGL A;  4MGQ A;  4QB6 A;  2ZEY A;  2VZ3 A;  4W50 A;  4MO3 M;  3DYO A;  3OGS A;  4P00 B;  2J1R A;  3FHA A;  3A22 A;  2VTF A;  2Z4F A;  2VL4 A;  4XUP A;  4RN5 A;  1KGY A;  4QX0 A;  4A41 A;  4A4A A;  4XUT A;  4ARX A;  3GM8 A;  5JXJ A;  3LQC A;  1W8N A;  1W9T A;  2JDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...