4QB2A

Structure of cbm35 in complex with glucuronic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
b'TGTTYEAETGTTLTDAVVETLYPGYTGSGYVNFNAYTNSAIEWNAINNMTTGTKNVKFRYALESGTRNLDIYVNGTKVLSNEPFTETGSWSTWGEKTIQVAMNSGVNTLRIVTTGTEGPNMDNITVTAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xyn30D
publication title Structural Analysis of Glucuronoxylan-specific Xyn30D and Its Attached CBM35 Domain Gives Insights into the Role of Modularity in Specificity.
pubmed doi rcsb
source organism Paenibacillus barcinonensis
molecule tags Sugar binding protein
total genus 28
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qb2A00
3P6BA 1YQ2A 1EUUA 2WDBA 2ZEZA 4ZXEA 2BGPA 3K46A 4CU9A 3ECQA 5C7GA 2BBAA 1NX9A 3MBWA 1W0NA 4XUPA 5DPNA 1UY1A 4KWUA 3I2HA 3ACGA 1CZSA 4DUXA 3THDA 2YC4A 1F4HA 1JYNA 3W5MA 1XPWA 4W8JA 2VZSA 3K75B 4LPLA 3WF0A 1KGYA 2QQLA 1O59A 3T09A 3CDZB 4XURA 2Y6LA 4XUQA 3ACIA 1EUTA 1IQDC 1DLCA 4PF1A 4OMDA 3ABZA 3PUHA 3HOBA 2W47A 5J1XA 2LW8A 1J84A 3CZJA 3HNMA 2WZ8A 3VD4A 2E33A 2WAOA 1JYWA 4GWJA 4CUCA 1OT5A 2VZ1A 4MGQA 2RV9A 2KD7A 3OG2A 1GOHA 3FN9A 4ET7A 1I5PA 3OEAA 3VDAA 2V72A 3FHAA 4ARYA 3U37A 4UOJA 1UWWA 4LKSA 5CZKA 3WNPA 4XUNA 1WKYA 3WNNA 2W95A 1UY4A 3WF3A 3VD3A 1JHJA 5LA0A 4PT6A 2LS6A 1ULOA 2VZQA 4QDQA 1XC6A 4E8CA 3F2ZA 3NNGA 4DEQA 1H6YA 1XNTA 3I2FA 4BJ0A 2W1UA 2W94A 3MV11 3I2JA 1JZ8A 3VD9A 1DP0A 4QPWA 1WCQA 2Y6KA 4ZZ8A 3J7HA 2VTFA 3WNMA 4A45A 2W9XA 5B4XA 1K45A 3A23A 3C7FA 5JXIA 3T0BA 1PX3A 3HNBM 3DECA 1DYOA 5FUIA 1UY3A 4MOAA 5HPOA 3CZUA 3WF2A 2ID4A 2J1AA 4UAPA 5JUVA 1UMIA 3IAPA 2W91A 3K4AA 4QX2A 1K42A 3WNKA 2WYSA 4M4RA 4OUEA 5C71A 2VMDA 2Y8KA 3C7GA 5CYYA 4CUAA 3WNLA 5IHRA 2VMFA 2VZUA 3WSOA 1XNAA 3OGRA 2OKXA 2Z4FA 2W92A 3C7EA 4OMCA 2WO1A 1JZ5A 1UYXA 3IIIA 4JKMA 2WQ8A 2QQIA 3DYOA 1GU3A 3K4ZA 2L9LA 4D0QA 2W1WA 1JZ7A 2EICA 4TXWA 3VD7A 2X09A 5A1AA 2W3JA 2VCBA 5DN2A 4A41A 1W99A 4D8MA 3CIHA 2QQMA 1W9WA 4JKLA 3CQOA 3W5NA 3SKVA 4BK5A 1K12A 1JZ3A 4A6OA 2JD9A 2VCCA 3MO4A 2VCAA 3LPGA 4Z2AA 3NJXA 1GUIA 1W8NA 3LEKA 4QX1A 5B4NA 2J7MA 3GXUA 3NRUA 1UMHA 2C9KA 5EIYB 3THCA 3HN3A 3I3BA 2J22A 2W1QA 3OGSA 2ZEYA 1D7PM 2B4KA 1TG7A 2J1EA 4XVHA 3HNYM 3ACFA 4P5YA 5F7UA 4DXRA 2VL4A 2HLEA 1UXZA 1JI6A 2EIEA 1UYZA 4A44A 2E26A 4DXTA 5IFPA 5JXGA 3DYPA 3SKJE 3T0DA 1O8SA 1R64A 2ORXA 3WEZA 3WQBA 1JZ4A 3WF4A 4CU7A 3CMGA 2EIBA 2WN2A 4DXSA 2V4VA 2JDAA 3K77A 2VR4A 2Y6GA 5C70A 2WABA 1W9TA 1GMMA 4QB6A 4LQRA 2VQTA 3SEPA 3VD5A 4FI9A 2VZTA 3HJRA 1UY0A 4QDSA 4KI5M 1SHWB 4RYDA 1NAEA 3VDBA 3ACHA 2JE8A 3D3AA 3C7HA 2XOMA 1F4AA 4JKKA 2WUHA 3IAQA 5JXJA 3MUZ1 4ZY9A 2YFZA 1CIYA 3I3DA 1PX4A 5EJ1B 1NUKA 2VJXA 3LEIA 3WF1A 3JXSA 2J1UA 2VQUA 1TVGA 2VZ3A 3NJVA 4QX3A 2W1SA 4XUOA 2B9VA 2ZEXA 1JYVA 2CDOA 4GWIA 2YC2A 1PMJX 3OEBA 4QAWA 4AG4A 2BGOA 1HN1A 2W87A 2ORZA 2WBKA 1UYYA 3HEIA 4QB1A 1OF3A 4P08A 1JZ2A 4GZ9A 1CX1A 1GOGA 1UY2A 3E1F1 2WN3A 2W5FA 4JX0A 2E31A 4A3ZA 2ZEWA 4A42A 3BN6A 2RVAA 2VMEA 4L0PA 2WAAA 2C4XA 2C26A 3A22A 4UI9L 4CVUA 4XUTA 2E32A 3DYMA 3UETA 1P8JA 2X05A 3A21A 4M4PA 4CU8A 3BGAA 1L7RA 3OB8A 5JMOA 2CDPA 2ZXQA 3EB7A 5HXMA 2DCKA 2YG0A 4MO3M 1JU3A 3PUIA 2VZVA 3HPNA 4QB2A 5LCWL 4OYUA 3T0AA 3LPFA 2PQSA 4DEVA 2YB7A 1SDDB 3WNOA 4ARXA 1JU4A 3LEGA 3VDCA 4OZOA 3I2IA 2Y64A 3T2QA 3FHQA 2WO3A 2J1VA 2Y6HA 1MPXA 4LHSA 5IJRA 2W46A 4BDVB 4XZUG 4IUGA 3UESA 5G05L 4KMQA 3I2KA 2QQNA 3I2GA 3UNPA 2JKXA 2XONA 1CZTA 1US2A 3IB3A 4CUBA 3FL7A 5G04L 4DUVA 1OH4A 5LA1A 3GDBA 1UZ0A 2X10A 2VZRA 3C7OA 2J1TA 3GM8A 5IYYA 1PMHX 2V5DA 4BXSV 5DMYA 4P02B 1JZ6A 1GQPA 4AAXA 2RJ2A 1W9SA 3OBAA 1OF4A 2R7EB 1K3IA 2Y6JA 5IFTA 1NKGA 2VZOA 1UXXX 1W8OA 1KEXA 4MADA 3T08A 4CU6A 4HG6B 2XHNA 2QQKA 2XQXA 4W4ZA 4P00B 3OGVA 3A7QA 3P1IA 3EYPA 5I0DA 4W50A 2VZPA 3ETPA 2J1SA 1ULPA 2WO2A 1JYXA 1CZVA 3AC0A 3I3EA 5JXHA 2HYXA 3LE0A 4DUWA 3MUY1 2BERA 2WZEA 5JR2A 1SG3A 2QBXA 3T2OA 2DCJA 2EIDA 4TTGA 3LQCA 2BZDA 4BK4A 1BHGA 3IDAA 1GNYA 4E8DA 1GOFA 2YFUA 1T2XA 3T2PA 4ZZ5A 4A4AA 2VO5A 1RYYA 1L7QA 3K4DA 1OD3A 4YPJA 4JHZA 2QQJA 4QDRA 3I97A 1US3A 4RN5A 5LA2A 2DDUA 2VOTA 2VMCA 5EJZB 1UX7A 4PQQA 3CKHA 2VM9A 2J1RA 3ZM8A 2QQOA 3C8XA 1J83A 1LNSA 3NQHA 3GGLA 1O8PA 1H6XA 4QX0A 3MV01 2VC9A 5DQ0A 3SEEA 4MGSA
chains in the Genus database with same CATH superfamily
3P6BA 3ZSEA 3ZYHA 1VAKA 3W59A 1EUUA 1O3RA 2R49A 1N1VA 4N8MA 3FFZA 4AHYA 1BBT1 3N3HA 1WD3A 3IWZA 5KBFA 1OLME 3BIWE 2OQ7A 3ECQA 2ZJCA 2BDRA 1NX9A 3KV9A 1OVSA 1HV0A 1WCSA 4UF0A 2D6NA 4IESA 3DPRA 2ZMLA 4OHZA 4BQYA 4EN0A 3O1MA 2VW1A 5C3RA 3ZLIA 2LROA 2VXRA 4JCKA 4YW5A 5GJ6A 3UYJA 1H9WA 3ZFEA 4D3WA 3MIDA 2E51A 3THDA 2GP3A 2RS13 4HMZA 2O0OA 3ZFGC 5KHKA 1JYNA 1K5MA 4FT8A 4LOSA 4W8JA 1V6KA 3MFAA 4LPLA 5M0TA 4L2NA 4LO6B 4Y5Z0 2FCUA 5LBEA 2B39A 3T4VA 1O59A 1CAWA 3RZMA 4XURA 4OUMA 3ACIA 3IDCB 3M3CA 2PXJA 2XHKA 3J8F1 5D8AB 4GKYA 1N3QA 5FBZA 3ZYBA 1VBE2 3UJOA 1XE8A 2VOVA 2W47A 4TSVA 4IEVA 4NMIA 3WR0A 2DCYA 3ZXAC 1Z7S2 3SCGA 4NIIA 2YROA 3LOBA 3QH6A 2JIGA 1AR61 3HBKA 3J7LA 5C5UA 3PURA 2JDMA 3KT4A 1UZVA 3BODA 4C1WA 5GM0A 3SH3A 4GWJA 3HN1A 4CUCA 4KL1A 3VLBB 4BISA 4DZGA 5KXDA 5IK5A 2KD7A 5DZEA 4LULA 1OLMA 3MIGA 5FPZA 5HCAA 3FN9A 1I5PA 2V72A 4JGYC 4QHZA 2XBO1 5CIRA 4E2QA 3POYA 2I74A 4LKDA 3K3OA 3VGIA 3FHAA 2ZAHA 4Q1PA 1C8M1 1HRI1 1PO22 1UWWA 2QCSB 2VUDA 4QXKA 1MS3A 4XFGA 3DKWA 3RG0A 3NWKA 4F83A 1FAYA 4XXAA 3U4XA 2FD8A 1VBC2 4FFGA 3GJBA 4XUNA 1XRUA 1MS5A 2YHJA 3ZDVA 1ZREA 2JD4A 4Q4X1 3H1WA 1UIJA 2WNVC 2OT7A 5GZFA 1O91A 2A3XA 1LGCA 5FREA 1HN0A 4COVA 5LA0A 1PGW1 4PT6A 4PDWC 1ULOA 3E6CC 1QJU1 3N9QA 4JQTA 1IPJA 2R30A 1H6YA 4AQTA 2X8KA 2IXHA 4DB5A 2W94A 3H50A 3MV11 1OLQA 1JZ8A 3KHCA 5T5LA 3M3IA 3H3LA 2BJSA 5F3EA 2ATFA 1QXRA 2R073 2Y6KA 3J7HA 5FFOC 5DDJ3 3WNMA 2VMHA 3ALQA 4L9BA 3B93A 4RFT0 3PVNA 1W6MA 3A23A 1UD1A 3AB0A 1PZ8A 4Q0VA 3ZFGA 3TAYA 4OHXA 3HNBM 1LGNA 4XDQA 3WDUA 5JOZA 3DECA 1C1FA 1DYOA 2H6CA 1UY3A 3HT1A 3JBG2 5HPOA 1NXMA 2VVFA 4FAHA 2J1AA 1GZWB 1PMIA 2F4PA 2D6PA 2JENA 3IAPA 3JZVA 4IE5A 5FBJA 5ISLA 1AL21 4URAA 3B94A 4R8HA 4RS5B 2R6QA 2WL1A 1QNWA 5CEHA 1S2BA 2IC1A 1IS4A 4R4ZA 1E57A 1VBE3 3AMMA 2VZUA 1XNAA 5A1LA 2OKXA 4PIXA 1MZFA 2Z4FA 1Y4WA 2BOJA 1RGSA 2OYZA 2W92A 4NROA 4Y20A 1XSQA 4ZS3A 4UFKA 4AFCA 3KS7A 4OMCA 5FWEA 1U5XA 2A1XA 3H0OA 4SLIA 5BNOC 1NG0A 2WYFA 2XLFA 3LIHA 2H0VA 1HRV3 5FYVA 3IIIA 4XFFA 4JKMA 1MS4A 5IVEA 1PGSA 3MIEA 4LO4B 3WUDA 3DYOA 1GU3A 2GU9A 3X29B 4K1YA 4EYUA 2W1WA 5DAXA 1MEC1 2EICA 2ZGKA 1REEA 3MIFA 1V0AA 2Z5WA 2X09A 4LKEA 3MIHA 2KR2A 2OVUA 1ND2C 3DV8A 4QX7A 1W0OA 2HWC2 2WO7A 4JGYA 5EP9A 3WDWA 5LK7B 3C3VA 5FKBA 1CQ9A 5CG8A 4K8RB 3JB4C 1RJ7A 4AVBA 1OUXA 5K7PA 1WBLA 2MEV2 2VH9A 4A2UA 2QQMA 1GQHA 1W9WA 1ZZBA 1A34A 4LIUA 3CQOA 2ZGPA 1W3XA 4H2AA 5ABJC 3A4UA 1ZZ7A 3UKVA 1POV1 1C8NA 5F8PA 1K12A 4BQ3A 3WW4A 2VCCA 1TME2 3ZMOA 3LPGA 1CJDA 4KWJA 5FO8B 4QX1A 1AR72 2WNVA 1HJFA 1RUD2 5DUVA 2J7MA 3AZYA 4KBBA 3GBGA 3GXUA 1UMHA 2C9KA 2JKBA 4PDWA 5A7PA 1CPMA 3SLIA 3HT2A 2G9FA 1I1EA 4CCEA 2W1QA 1GP6A 1YHFA 2GNTA 2YU2A 2VNOA 1TG7A 1ULCA 5LBFA 3I3QA 1Q8QA 4XVHA 4Y1ZA 4E4SA 3ZSJA 4BMEA 5T3NA 2ZHNA 1NQJA 2Y0OA 4P5YA 3KQ4B 1V9U2 2EIEA 5F9TA 2YGMA 4A44A 3LCPA 3POBA 4HT1T 3HR9A 3NJZA 1WUVA 2WKKA 5IVVA 2WT2A 1SPPB 1R64A 3N7LA 3MIBA 2EXHA 2ET7A 2RDRA 4COUA 4DIQA 5F3CA 1W8TA 2BNOA 2D3SA 2DFCA 3B9CA 3CMGA 3U14A 4AAPA 3AZXA 5C3QA 4DXSA 2P3KA 3ZDSA 5FZDA 2ZACA 1QJZA 4LLOA 2JDAA 4HL0A 2TUNA 2C24A 1QNYA 4QQ2A 5FZFA 5FZ9A 2VR4A 3ENRA 5FXXA 1UW8A 3URFA 4CP0A 5C70A 5A7NA 1QJX1 1JXNA 1W9TA 4ZPIA 3PUQA 1EAH1 4AI3A 5J09A 3E5XA 4HK9A 2VW0A 5BNOA 1R091 2FCTA 3H42B 4FI9A 4YVSB 2VZTA 3HJRA 3MF6A 4KI5M 3FLPA 1SHWB 4RYDA 1M06G 1NAEA 3MGUA 5HCBA 5IK4A 2IXJA 2VW2A 3KCXA 1LHVA 5CNAA 3VDBA 3D8CA 5FLHA 2JE8A 1QDCA 1ZBA1 4BQ2A 2Z42A 1H8TB 3C7HA 3D3AA 2VOWA 1OSGA 1ND2A 1N3OA 1VBD1 2E63A 4RFRB 1JUHA 1CIYA 1RUF1 1YXWA 1W8ZA 1PX4A 3GALA 4XF1A 1UKRA 1CAVA 2D43A 3MW4A 3AKTA 1W6OA 3Q8FA 2MEV3 2Y38A 3VZMA 4DNYA 2VQUA 4Q4W1 5A3MA 5ABJA 3BU0A 2F6BA 4IGQA 3O1RA 2R063 1HIXA 1QXPA 4CA9A 4AL9A 2B7YA 4CP2A 5JSOA 4QGMA 3O7OA 1TQ5A 2W1SA 4B7EA 1IOAA 2ZEXA 1U5ZA 2Q8EA 1EPZA 4GWIA 4IETA 3ES4A 2G9ZA 1QJY2 4I09A 2RR12 4UF0B 4O9EA 2BGOA 1JOPA 2W87A 3LAGA 1EV11 1F31A 1XE0A 4GB33 3A0KA 4HOOA 1UYYA 1ZRRA 2D6MA 3MW2A 4Y33A 4Y1UA 5FY0A 4UFIA 3AXDA 3CJIC 2EVXA 1QH6A 3NKTA 3ZFEB 5J96B 4BQWA 3M7AA 2FZ1A 4GZ9A 1PIV3 4JZRA 2WR9A 3APBA 4B1MA 5J36A 2QDRA 1K5MB 1R1A2 2ZCWA 3CLPA 3ZKYA 3E1F1 4R9CA 5FXWA 1UZZA 2VAUA 5FOBB 4UFLA 1A8DA 2ZGSA 1CAWB 4A42A 1OA2A 4XYXA 3SCHA 4AFBA 5FQ0A 4L0PA 3AMHA 2WAAA 2C4XA 3D5OA 2CU5A 1SBDA 1VBA1 1ZRCA 1FPN3 1SLBA 1YO8A 2OXBA 2JXAA 3R4DB 2C26A 3TOJA 2RS52 4XCBA 3ZN4A 1AR91 1ASJ2 2Y26A 1UMZA 2E32A 3IMNA 3Q8EA 4CVUA 1W8FA 3BTYA 2GH8A 2NLRA 2BNNA 4KBZA 1RVF1 1WMDA 5F32A 5FYIA 3A21A 4B4RA 4K3UA 1YFYA 1A8MA 2EA7A 3SQOA 1H0BA 3VKMA 4YW4A 1IKQA 2XLGA 2JWPA 2ZXQA 1LOEA 5FUPA 2BU9A 4J1XA 2YG0A 1FYUA 2YPDA 1ENQA 2ZGRA 4FTSA 2QJVA 3N9PA 3PUAA 5DZFA 5F5QA 1OQDA 1UNBA 4G4FA 4EQVA 1BK0A 2DU0A 3KGLA 4YWAA 4OYUA 1AYM3 4XHBA 5J48A 3KT1A 4LBNA 2R1DA 1POV0 4EE2A 2GALA 3A0NA 3H1MA 1QH7A 4B1LA 1SLTA 3B9IA 4I0BA 4ZU4A 3IBMA 3VDCA 3J4UH 4RA0A 1X7NA 1GZ9A 1NY72 2D40A 2A5ZA 2ZA9A 5T52A 1UPSA 4XE9A 3VBSC 3RS6A 2CAVA 3WP4A 5GZDA 2WFF1 3Q8BA 4UW4A 4XZUG 4IUGA 1EYBA 3RVHA 5FLJA 4EWAA 4LBQA 4CPBA 2BWCA 2ZZQA 1ODNA 4YM0A 2QQNA 1AJKA 4ATFA 3OPWA 1H2MA 2XONA 1MZEA 5FZEA 3PJQA 1S0FA 1CZTA 1FNZA 1RUD1 1J58A 1YQ6A 4HN1A 4LLFA 2ADDA 3ZMNA 3JD71 1W2AX 3CJIA 3VBOB 1G9BA 2YV8A 2XR4A 3RZJA 1CX4A 2A6XA 2RDNA 2KM2A 2UY9A 3NVCA 3R05A 1LKNA 3B7MA 1V6JA 4P9LA 4XABA 4Q0SA 3ZFGB 1W6MB 4J25A 1LHWA 4L99A 1UO9A 4LO8A 4CDQC 3WP6A 2E6VA 3LKJA 1R1A3 4NPLA 3V56A 4LUMA 4QU1A 2OPWA 3WQ0A 1W9SA 5JOXA 5FY5A 1OF4A 2ZGTA 5IFTA 4V2VA 3ZYRA 3H8OA 2WT1A 4MADA 3T08A 4HVQA 2FZ2A 2ZGLA 4CU6A 1COV3 2XQXA 1ASJ3 1NLQA 4MGKE 1W2OA 2BUKA 4RGGA 5FZIA 4D94A 4LIVA 1OA3A 4PLMA 3KCYA 3P1IA 4RGAA 4MGTA 1RUG3 5I0DA 2PHUA 3I8TA 4LBQD 4RGKA 4W50A 4OI1A 4CPBD 4GQ7A 2WO2A 4NPRA 5LK5A 3N7JA 4NIDA 2JG8C 1MS8A 3GZEA 3OBZA 4DUWA 4OCTA 3SISA 1PM7A 1X8MA 4LR4A 2B8MA 2VVEA 1ENXA 2PAEA 3FLRA 1SLIA 4P9XA 5EV7A 5LRRA 2FDGA 3SH4A 5I0UA 5IAVA 5FYCA 4WVZA 5IT6A 1OKQA 3W9AA 3GF6A 1G86A 2DCJA 4JGYB 1ZRFA 3RPQA 5FRAA 3RWNA 2ARAA 1D2QA 1BHGA 2O8QA 2A6YA 1FV2A 1QKQA 3I7DA 3IDAA 1GP5A 1Q43A 3MLKA 4KU8A 3U11A 1ZX5A 3MEPA 1T2XA 4LBOA 5L73A 4ZZ5A 4C0BA 3VBSA 2N7GA 3WHTA 4YFZA 3K4DA 3VV1A 2NYYA 4YPJA 3SCFA 3T4HB 2VPVA 3WZ1A 5I8SA 2PMWB 5A6XA 1O7FA 2A3YA 2VQAA 1W8WA 2A6VA 1S0DA 4AQ6A 1US3A 4RL7A 3BTXA 4X6QB 4ES9A 4LITA 3IT8A 3OF1A 5AC93 5EJZB 4QX5A 1ZA4A 2D3PA 1MS1A 4BE3A 4PDWB 1WW5A 1FI2A 5FMBA 3KF5A 2VM9A 2J1RA 1LAJA 4NHXA 4PI0A 1J83A 4FPEA 4CUGA 1LNSA 1H6XA 1YFXA 3ZR6A 2C1FA 1T6BX 3GCXA 3MV01 2XJSA 4WVWA 1O4YA 3NV1A 1R081 3AL6A 2PHDA 1DGRA 3MPPG 4YZ3A 5F2WA 3D6EA 5FZKA 5SV8A 4CDQA 2A70A 1YQ2A 3RJRA 2AEZA 1D4VB 4UBGA 5JOWA 2WDBA 4JDMA 1OH3A 5LATA 1W8HA 3J8F2 1O4ZA 2JEMA 3K46A 1LENA 4CU9A 4MUVA 1APNA 4BOWA 1GZWA 3LFMA 5L9VA 4YG3A 1RUC1 2D3RA 2Y33A 3QD6A 1JYCA 4O65A 4HKOA 4AI0A 5F1RA 1RUNA 1SLAA 1AR62 1X8EA 2ENRA 4AFAA 2YC4A 4UFHA 2AENA 3IDEA 4KNCA 4LBJA 1W6PA 1XPWA 2JG8A 3ORJA 5FZGA 4A7YA 3K75B 3CNAA 5HXVA 5K8SA 5A33A 3VL9A 1KGYA 2K0GA 2XGXA 4K7JA 1N3PA 1S2KA 5A3LA 2HWD3 1LESA 1RUI3 3UGFA 2ETEA 2P1BA 4QKDA 2PHTA 4QX8A 1GSLA 3MDPA 5E88A 3WP5A 2XBO2 4PF1A 1ND2B 3ABZA 3PIJA 4XFIA 4PLOA 1ALYA 2D44A 4DS0A 5A3PA 2R041 4E27A 1IS6A 4KGGA 1C8M2 1CAVB 3RQ0A 3LEMA 4CCCA 3BCWA 4A7KA 1W6OB 2LW8A 4BLIA 1J84A 4MHRA 2TEPA 2VMIA 3VD4A 5GZCA 1RUE1 3H7JA 1NCRC 1C5IA 3VHOA 4AFMA 2XWBB 2P3IA 1A6CA 2E33A 4MGSA 2WAOA 3OJBA 4P9WA 1PO11 4Q4X2 2JE7A 2CNAA 3E5QA 1VE0A 1PGW2 4PBOA 1BBT3 1QJU2 2JB4A 2RV9A 3E6BA 1PNFA 5FKCA 2WQZC 4Q0UA 1C3HA 1RHI1 3WG3A 2FDHA 2ZKNA 5A3WA 1QQP1 4Q8KA 2Q0AA 2BGCA 1RB8G 2XJQA 2XVKA 4ARYA 1D0GA 4NRMA 2R32A 2BP6A 4Z8BA 5BY5A 4UOJA 2NQYA 5FYSA 1FATA 2V09A 3BOPA 4WVVA 5F6KA 1PM4A 5CZKA 4AR2A 2DWRA 4XW3A 3KB5A 5KHIA 3WY6A 3UGGA 5FQ0B 2P17A 1JN2P 1YI7A 1I6XA 1BEV1 4Z82A 2UU8A 5JLVA 5E6HA 3D82A 4O7XA 3RSJA 4R9AA 1AL22 2CHHA 2ZHKA 3GJAA 1G9DA 1G9CA 3ILFA 4N7UA 3PTYA 4QDQA 1KJLA 3ZXJA 3NNGA 2YUEA 1U12A 3R4SA 3EXUA 1XBFA 3I2JA 2CWMA 2CGOA 2PHFA 4H55A 1DP0A 1BVP1 1WCQA 4BYYA 4GULA 2IVIB 3FC0A 4ZZ8A 2VTFA 4YSFA 4K40A 5F37A 2BFUS 3POWA 1VMHA 3KZ4C 4QWNA 2IXIA 1J1LA 1K45A 1DCSA 5BNNB 5JXIA 1NZCA 2DBIA 3J26N 2EALA 5KR7A 2IXKA 2OA2A 2BOIA 3ZYIB 2XLAA 2PHLA 1HQWA 3GHNA 5FUIA 3MLLA 2C5DA 4HSJA 1C1LA 4AHXA 1MEC2 2WZPP 1RJ8A 2HYKA 1RUOA 1YCIA 4UAPA 3ZN5A 5FYTA 1XOYA 1F9KA 5IUQA 3K4AA 3UKNA 2Y8KA 4NHKA 2ARBA 4N7IA 3C7GA 5BXXA 4B7KA 1JODA 3M1HA 5FAXA 2I2SA 2ZBJA 1LR5A 3PDQA 4FOWA 4TWTA 4Y4RA 2WRAA 5FV3A 3ROUA 3S30A 3WSOA 3U0ZA 1TMF1 4GMP1 2LUWA 4YW6A 1GNHA 1ENRA 1HRI3 3QCWA 1V6MA 2DVGA 2WT0A 2ZAAA 3C7EA 1NCRA 2WO1A 4OI2A 3ACLA 2RS31 4LBQB 5FUNA 2JX9A 5A3TA 4F8AA 1YIFA 2WQ8A 4UW6A 1WD4A 1PK6C 1Q8PA 4AK3A 4BLJA 2L9LA 1XNDA 1JZ7A 4TXWA 3RZLA 1QJU3 3ZSMA 5A1AA 2VCBA 1S0BA 5CA6A 1IG3A 3CJIB 3OSDA 4YYOA 5L7OC 3VBHB 4BMBA 1VLNA 2K46A 1KS5A 2ZGMA 3L2YA 4XOGA 5CKQA 4XQWA 3U75A 3VBOC 3NO8A 1N47A 1GANA 4Q4V2 2VBBA 1H4HA 3TN91 5JI9A 4L11A 1J59A 1ZVFA 4U2AA 5FP7A 3VZLA 4UT5A 1J3QA 5FJHA 1FMD1 4YW7A 4QQLA 4FXGB 4BK5A 4FAGA 5A3UA 1JZ3A 4LBKA 3SITA 4COZA 5A80A 4UYBA 2A73B 1YJLA 3LEKA 4KG8A 4AI8A 5B4NA 2DURA 3I4IA 1DBNA 1WLDA 4AZZA 2HWE1 5EYXA 1KFUL 2P37A 1ZM1A 3BIEA 3M3EA 1G7YA 3THCA 4PHZA 3VDDC 1S55A 3I3BA 3I2OA 1ST8A 2PLV1 4N9IA 4NR1A 4XIKA 3POGA 1BXHA 1ACCA 3NNFA 3ZIWA 3I2DA 2XMLA 2ZEYA 3J7NA 2PHWA 1D7PM 2B4KA 2D5HA 2XJRA 4Q8LA 1QJX2 4OHWA 3EQEA 2J1EA 1EAH2 3H8UA 3HNYM 1DGWA 1R092 2RJLA 4DXRA 5F7UA 3ZN6A 2HLEA 1UXZA 1JI6A 4Q29A 1AYN3 4QGLA 1DQ1A 2BTVC 5F5AA 1CD3G 5F5IA 3U78A 2FDKA 1IPSA 4P5HA 2GNMA 1RMU1 2A7AA 3CBNA 2VECA 4DFSA 3VUOA 1TEIA 2GH2A 5C4WC 1ZBA2 2P34A 4C1XA 1S2EA 1O8SA 4WM7C 4Y5TA 2ORXA 1VBD2 3WQBA 1VRH3 4BB3A 2HKXA 4CU7A 1ZBE1 3H1YA 3KSCA 1RUF2 3OPZA 2DUOA 2WN2A 2WNUC 4QPGC 1ZYBA 3P3NA 4OQ9A 1HXS1 2UYAA 3FWEA 5ACA3 1Z0HA 1PZ9A 3FX3A 3VBSB 4Z92B 4RHV1 5JI7A 2OUHA 5FPVA 4Q4W2 3K48A 2P5BA 2Y6GA 4W6XA 2WABA 3AJYA 2QTWB 3ST7A 3NL1A 4LQRA 1OURA 1HW5A 3H3UA 1POV3 3WW2A 3SEPA 3TEXA 4ZU5A 3VD5A 3O1PA 1HLCA 2E53A 1H1MA 4QDSA 3WVJA 2QZ2A 1OA4A 4A3XA 1H2KA 1JMUB 4HLTA 5FLIA 1PK6A 5LY2A 1EV12 2VY0A 3AMQA 4UXAA 4YZ2A 3PVOA 1X82A 4QKNA 3DN7A 4P9JA 5IWFA 3LA7A 2WUHA 3AVSA 5A7QA 3MUZ1 5A7OA 5FO9B 2P6CA 5L7OA 1WW4A 5FZ0A 2PYTA 5BNPC 2RDQA 3RFRA 2VU9A 4X8PA 1NUKA 5LA9A 3VBOA 2VJXA 3N9MA 3WP3A 3WF1A 4DY5A 1XYOA 2WNOA 3JXSA 3KT7A 4QKBA 5FP4A 1W28A 3BYWA 5FO7B 4CDQB 4Q4Y2 3BUCA 2R16A 4XDOA 3N35A 4QQHA 3NJVA 1VBA2 2WNEA 3AMPA 3OPTA 1XU2A 4FP2A 4RR3C 5CKMA 1W6QA 1W39A 2B9VA 2ILMA 4XUOA 4DINB 3NV4A 4ES8A 4XTMA 1AX0A 3RZGA 5L9RA 4WBBA 1PMJX 1AR92 1XE7A 4AG4A 2WSVA 3VDDA 2EXKA 3WXPA 4CEYC 4Q5OA 4HONA 1RVF2 3M70A 1KXGA 3PUSA 1D2SA 4ASLA 4QB1A 4OLLA 4S2GA 5FP9A 5CB7A 5HCHA 2ZPXA 4LO5B 2RS11 1JYTA 1AHSA 3O0XA 1IHMA 4GAZA 5FK7A 1GOGA 1W6PB 4AEDC 2JG8B 2VULA 2WC2A 2XUEA 5ANQA 5FPAA 4FTBA 1YI9A 3LA3A 5FDBA 5A33B 1Z7S3 4K8FA 2WFPA 5FPXA 3BN6A 2RVAA 4AVSA 5C4WA 4D7TA 3BVCA 4GMP0 1BMV1 5FYBA 2G19A 5HCFA 4WM7A 4CXWA 4RD7A 4UI9L 1ONAA 5E16A 3MF9A 4XUTA 2WIIB 1P8JA 3CL1A 3PTRB 2WNUA 2IUWA 2RHPA 4FQZA 4QPGA 1Y7BA 5EYYA 2ZX0A 4K1ZA 5FZ6A 1RUF3 2FCVA 3B00A 4LHNA 1NE4A 2QZ3A 2WFF2 4G9SB 4CU8A 5JAXA 2HH9A 5AFBA 3OB8A 1FXZA 1V70A 2HWF1 3DF0A 2AZ5A 2K2SA 2W68A 1KDMA 1OKOA 3E5UA 1UU6A 3M3OA 4V1PA 4EN7B 2DCZA 1VPHA 3JU9A 3WHUA 3VHRA 1PO23 3MICA 1RIRA 2ARCA 1VBC3 4RSUA 5LCWL 3MYXA 4CCMA 3OUIA 4FOQA 5AVAA 2PQSA 5A7WA 1SDDB 3JD72 3RDIA 4ARXA 1GYKA 1HB2A 1M4WA 2WWUA 3JCIA 4V2WA 1EPWA 5A7SA 4AEKA 2R0HA 5BNPA 1C57A 1ND3B 4AI9A 2Q1ZB 4DOUA 4XFBA 4NN0A 3IN9A 4YM2A 3SNMA 3TB0A 3RYRA 2J1VA 2Y6HA 1LCLA 1RUJ2 4LHSA 5IJRA 5C9AC 2PN5A 3SHRA 4Q4V1 1OFNA 4YVWB 4BDVB 3H3ZA 4HPKA 5FYHA 5FPUA 4BPZA 4RR3A 3UESA 4LKFA 5G05L 4Y1VA 1CIWA 4KMQA 4HKWA 3I2KA 4URTA 4QQOA 1WA6X 3UNPA 2JKXA 2Q1MA 5E89A 3POJA 1OXCA 3JBG3 3RJ2X 2UWBA 3BTZA 1H30A 4Q26A 1AR93 4CEYA 3IB3A 3K2OA 4FPGA 2RDSA 3FL7A 4CUBA 1BYHA 4KWKA 1TNRA 4CDUC 4NO4A 2JICA 4QPIC 2BNMA 5G04L 5JIUA 5KXCA 2R071 2ZKLA 5LA1A 1TNFA 4KQ7A 5DDJ1 1NYWA 3HMYA 4JGZC 2X10A 2WLPA 5GKAC 1OUSA 3O5SA 2BVBA 2J1TA 3OCPA 4Q27A 5FMOL 4AEDA 2ZX3A 1QJEA 1BCXA 1AUYA 1PMHX 5IYYA 1AJOA 5BNNC 3ZPYA 4N90A 4AAXA 4YM3A 4AXOA 3ZXDA 2BV4A 3OBAA 2P2KA 3HQRA 3LB9A 5FZMA 4XQ4A 4XFCA 3B5LB 2DUPA 4ZS2A 1IG0A 4PLNA 2P4EA 3AP7A 2ZMKA 4MSVA 1KEXA 1W2TA 3O0VA 2CAUA 1BK1A 2PHXA 5E8AA 3VBUB 4B3NA 3O0WA 1FX5A 1W03A 2XHNA 4HN0A 1HDKA 4TYSA 2O8OA 5J3UA 1UU5A 2ET1A 3A7QA 3NNMA 2E7TA 2HWC3 3DEMA 5IHRA 5I93A 2VMGA 1ULPA 3FUQA 1JYXA 2VGDA 1NCRB 1QOSA 2WFF3 2O1QA 3RGBA 3EO6A 2G9GA 5DAQA 5C3SA 2W39A 3UKTA 1HRV1 1GNZA 3JUUA 3LE0A 4OHVA 5JXHA 4QGNA 3ZFFC 4OVEA 4QM8A 3NAPB 1AVBA 2WZEA 1TME3 5F6LB 3WG4A 3ZXFA 5JR2A 2XG3A 3USSA 1UF2C 1AR73 4XBNA 1VBB1 1RUD3 2EIDA 3LQCA 4BK4A 4QHBA 4QXBA 1QDOA 1GNYA 1Q3EA 1GOFA 3NJYA 1N1YA 3VBHC 3CU7A 1R082 3T2PA 3O1VA 2AC1A 1RYYA 4NWVA 4LJHA 5FMDA 2Z69A 1S1AA 1LOCA 3B01A 4XFHA 1W6NB 4WV8A 5C9AA 4QDRA 3OYWA 1OHFA 2OZJA 5JCTA 2WSUA 1WLWA 3I97A 1QU0A 2DDUA 4A7ZA 1QWRA 4Q4Y1 1V9U3 5D21A 5GLTA 2NZ9A 1BKZA 1RUC2 2WZR1 1VMJA 2D98A 1EY2A 1SFYA 3BI3A 1ULGA 2MPFA 1MR5A 3Q8CA 4CTEA 4R9BA 4CDUA 1JH5A 4DRRA 2DYCA 4DRVA 2B42B 4PQ9A 4QPIA 1SCRA 3INAA 2BFUL 4DQAA 5JPNB 3NQHA 3GGLA 1O8PA 4QX0A 2VNVA 4JGZA 3ZN6B 3VHPA 1E5SA 1X9PA 5BNNA 1Y9GA 4DMIA 4HETA 4LT5A 1GKBA 2GN7A 3OTFA 3T30A 5C33A 5FR3A 1LHOA 1UIKA 1LOBA 3KGZA 2ZEZA 3N9LA 5FCCA 4AGGA 4ZXEA 4HSLA 4Z2WA 2AUYA 1KD7A 1YQCA 5KXBA 1F2NA 5C7GA 2PELA 5BV6A 1VR3A 2R042 4ITCA 4GIQA 4LHKA 5CFCC 4NHMA 4XUPA 4JVAA 2CWSA 4LXLA 2VUJA 3S7EA 5DPNA 2AH2A 1UY1A 1DLLA 5TSWA 1Y9QA 2WA3A 3H7YA 3I2HA 3ACGA 1RUE2 3AX4A 4EWEA 4DUXA 2A71A 2BEOA 3UT0A 1Q8SA 3USUA 4I3GA 5IVFA 5DG2A 5AVPA 1PO12 3S57A 4M00A 4JRAA 1OPOA 4NAMA 3D0SA 3GZTB 4ONUA 4XILA 3VKOA 2VZSA 4IE0A 1YWKA 3KVBA 3M8LA 4YGDA 4NUBA 3PVBB 5LBCA 4LORA 3WF0A 3ZFFA 1PK6B 4XMIA 2ZABA 4YGEA 3N7MA 1V6NA 5FY8A 3T2TA 5LY1A 4XUQA 1JYIA 2D6KA 1RHI2 1IQDC 2H6BA 3E97A 3LFIA 4YG0A 2FMYA 4OMDA 1QQP2 2OW4A 5L7OB 1QJY3 2EXJA 2JE9A 2RR13 1LOFC 2XQRA 4FFIA 3FBYA 5FTTC 2JDNA 4COYA 1BZWA 4MXVA 4PF5A 5GLVA 1B09A 4IGPA 3VBHA 3WDVA 3L2HA 2V73A 3CZJA 1MS9A 2BWAA 2WZ8A 3U10A 1OI6A 2R061 3V0BA 5JOYA 1BEV2 4JRLA 4E2GA 4UBHA 1RUJ1 1W6QB 2Y34A 5E1RA 1MQTC 1OT5A 4AFDA 2VZ1A 1HB4A 5DAPA 4R52A 4D7SA 4LK7A 1G8WA 4P9IA 1CR7A 4GA9A 3VDDB 4GB31 2ZZJA 1OC1A 4ET7A 3OEAA 1OD5A 1RUC3 4BU2A 5C8CB 2RS53 2YC0A 1YYNA 2ZHMA 3VL8A 1AX2A 2ZX4A 2K9ZA 4DXZA 1CJPA 1HKDA 4QXHA 2CY6A 3U37A 5F3GA 3O14A 1WW6A 4B8EA 1ZZ9A 2RE9A 4UW3A 1U5YA 2I45A 1MZ6A 3WNNA 4XJ9A 1V6IA 1FPN1 5C4WB 5KHHA 1T6GC 1CAUA 2W95A 2WS91 3TEYA 4FPLA 4BA6A 4YGCA 5FZ1A 3GZAA 4WM7B 3RYKA 3VBFC 4PJYA 1IS5A 1V6LA 2YBPA 4IV3C 2Q8OA 1QJFA 2VZQA 2VBPA 4E8CA 2Y0IA 5IVBA 1F35A 2WNUB 4QPGB 5FMCA 2IZWA 4XACA 4BJ0A 4DEQA 2W1UA 1NCQC 5IW0A 3NV2A 5CFCA 1KRIA 1DG6A 1TMF2 2R043 5BNQA 3VD9A 4MZUA 5A1FA 4BH9A 1O5LA 1ZNPA 1H1IA 2X29A 4HFSA 1V6OA 4A45A 2W9XA 3C2UA 1GFF2 5FXVA 4AHWA 2RS32 3BU7A 3C7FA 3FJSA 3HIFA 4MGYE 4ZONA 5C3OA 1DZRA 3ME2A 4ISRA 1PNGA 1H8VA 1PO13 3HVDA 4YRDA 2VOKA 1VIWB 4M3CE 1DQ4A 2BYVE 4MOAA 1GP4A 1AYM1 1B35B 2FDFA 2XH6A 3CZUA 1RTVA 2ID4A 5JUVA 3ZIXA 1J3RA 3LZZA 4LO7A 5A7WB 4FSJA 1K42A 1LULA 2WYSA 3J7MA 1NZIA 2F4LA 5EQUA 3AYCA 5C71A 3SXWA 2E7AA 1NA1C 4M01A 1SQ4A 2D7FA 2E7QA 1QQP3 1LOFA 5CYYA 5BNPB 3TN92 4CUAA 2VMFA 3HAGA 4AQ2A 4BQ1A 3B02A 4AVAA 2OIIA 1W9YA 1ND3C 4S2FA 4G3YC 3VKLA 1FMD2 3R0RA 4KH9A 4CCKA 2BPA2 4CXXA 4FPFA 1GICA 2DVAA 4HPKB 4LE3A 2XB6C 4FPCA 4RR3B 4YVWC 4CXYA 4K21A 1MQTA 3D0JA 5H9RA 4LK6A 5FYYA 2HWE2 3V65A 2QQIA 2Y60A 1F5FA 1RXFA 3K4ZA 4QM9A 1AXZA 3B3QE 2PLV2 4CEYB 2F17A 3PU3A 3VD7A 1RXGA 2VNGA 4JC1A 3OGGA 2VUCA 5DN2A 2Q8CA 1X33A 4IEZA 4S2DA 2WJSA 2QUOA 3FZ3A 4NRPA 2IWGB 2XWJB 3FLTA 3O1UA 1W99A 3NNJA 4D8MA 3ZYJB 3CIHA 2FMDA 3LSDA 4LBMA 3AFGA 4OFGA 2FHRA 4JKLA 5FIXA 4AEDB 3M4FA 5FY9A 3DXTA 1Y9MA 3J9SA 4XXPA 3SKVA 4NAOA 1W0PA 3W21A 2GC1A 4A6OA 1RMU2 3EJKA 2JD9A 3WDTA 2EF6A 3KM5A 3MO4A 1QOOA 3U1XA 1LU2A 2VCAA 1SFNA 1DU3D 3I59B 4M3CA 3ILRA 4GWMA 5C5TA 1UOGA 1O3QA 1UX6A 3UV9A 2FDJA 2RMU1 3VBFA 3NRUA 1ZBE2 4NJ4A 5KWRA 4IV3A 5EIYB 3AVRA 4UW5A 1HXS2 2CSGA 1COV1 1DZTA 4JDNA 3POEA 4P9YA 5GLZA 3VHNA 4D6SA 1NCQA 2J22A 4RHV2 3S0MA 1J1TA 3H8XA 3OGSA 3VBUC 1RUG1 5ANNA 3WQ1A 3ZXLA 5FZOA 2ZHLA 3W20A 4FVVA 4D6RA 1TMF3 4FCAA 5LEJA 4FP3A 4FPHA 5LEKA 2UYBA 1LODA 2LM3A 5EZWA 3OD0A 1ENSA 2JDYA 2BBVA 1KQRA 4AF9A 4DXTA 5L36A 1QGLA 1LECA 3NAPC 5LASA 4XTPA 3SKJE 1PHMA 3ZYFA 3N9OA 3WF4A 3ZXKA 4GD4A 5LB6A 3G7DA 4MXWA 3K51A 4JQRA 4FTEA 1VMFA 3N9NA 1NA1A 4FOYA 3HWJA 4FPYA 4ZHNA 4L97A 4KWLA 4EN6B 5CG9A 2ZMNA 2ARXA 5JPMB 5IATA 1ND3A 3TN93 4XCAA 5C9AB 1GMMA 1KITA 3OYWB 1UN1A 4QB6A 4X6RB 2VQTA 3PIGA 4GKXA 3AKPA 3BPSA 4LMFA 2FDIA 1F15A 1WMEA 3O1SA 1UY0A 5CVRA 5FY4A 2CYFA 4Y4YA 4YVWA 5AC91 4O61A 4HZFA 4QPYA 1O5UA 5GLWA 4XMAA 1W2UA 1RL3A 3KV6A 3ACHA 5IVYA 5C3PA 2PFWA 4GXLA 2WWSA 5KC6A 1WMFA 3RYPA 3J8F3 2XOMA 3S7IA 5C8WA 4YLZA 4CDUB 2PLV3 3IAQA 4AYUA 5JWPA 4QPIB 3WUCA 4ZY9A 3I3MA 2YFZA 2RS12 3JB8A 4JGZB 4NWWA 1YFWA 5EJ1B 1CESA 2Z2SB 3ILNA 4B29A 1VJ2A 2HBTA 3LEIA 4MLOA 3POIA 1W06A 4WZCA 4GH4B 2J1UA 2KA3A 4R4XA 1SBEA 3OOXA 1AR63 2ADEA 5JSRA 2VZ3A 1UPIA 1JYVA 1BMV2 2CDOA 5A70A 3OEBA 4QAWA 5CBLA 3RRDA 5F3IA 2G1MA 4EROA 1D4M1 1HN1A 4U36A 5FZAA 1PVC1 1QIQA 4CP1A 2WBKA 1ZBE3 5BYNA 4FO9A 3GZUC 4JHTA 3QH7A 4IW3A 1LEDA 4YW3A 2XBO3 1OF3A 5KC5A 3VBUA 2YY1A 2B46X 3TEWA 1ZRDA 2HWF2 2DTWA 4FQ4A 2NMNA 4AEMA 4PIYA 1Q5OA 1C4RA 4XFAA 5H9PA 3USUB 1WGPA 1C8M3 1DGWX 4UWDA 3OY8A 2KXLA 2DVBA 1QXJA 5LBBA 4JX0A 3ZFFB 4Z07A 5DUXA 3SH5A 1K5JA 3S5AA 2HWD1 4LEJA 5LZ6A 1RUI1 2GSYA 2MHFA 4Q4X3 1DQ0A 4XETA 3NAPA 4BQXA 4ASMB 1MVQA 4NRQA 4Z1VA 1WA4A 2NPIA 2OPKA 3DYMA 3THTA 3U4SA 2Q4SA 2X05A 3KV5A 4D7YA 4H3WA 3O12A 4JTOA 4JDOA 5FOJB 4KG0A 3QACA 3BGAA 1XQNA 5ERLA 1YEWA 3WW1A 5EJ3A 2CDPA 1E5RA 3OBTA 3R4UA 3L9JT 4LA3A 3ZVXA 5HXMA 3V0BB 3T1MA 1AX1A 5A32A 1W6NA 1AR81 1VAVA 3AP4A 1JU3A 4CP9A 3LPFA 2ZX2A 3VZJA 2RJKA 3WCSA 5JZGC 5FZBA 4DEVA 2YB7A 3MFCA 4QQPA 3RWKX 3H8RA 3WNOA 5KXEA 5APAA 1DYPA 2R072 1AL23 4DPNA 5DDJ2 1YQ5A 1XSRA 4OZOA 4Y26A 1Z78A 5C8CC 2CV6A 2Y64A 1PVXA 3T2QA 3N4MA 3ZSLA 2IFWA 1RUH1 3GHMA 3H9AA 1MPXA 1ZRIA 4GJZA 4IEPA 2RG4A 1BJQA 3WQ7A 2TBVA 3ZR5A 4MGZE 1CAUB 3UL2A 1SCSA 4CCJA 1YNAA 2AR6A 2P6HA 1XNBA 2Q5TA 3SMHA 4H7MA 2P3YA 1MEC3 5FYUA 2BQPA 2ZGUA 5CFCB 4IEQA 5EXOA 1VAMA 4DUVA 1XB9A 4EN8B 3ZKUA 4AI1A 1UZ0A 3TYJA 4FOVA 2VZRA 3C7OA 4NIAA 1HRV2 2HWF3 3MW3A 2YDEA 3KD4A 3TRSB 1PGL1 2FQPA 4P02B 2QQPA 2D93A 1JZ6A 1GLHA 3IMMA 3MHZA 3RZHA 1DGRN 2LALA 2R7EB 5EFUA 4S2HA 4J6GA 1B35C 2JDKA 1VBB2 1GV9A 2HBUA 2VZOA 1UXXX 1W8OA 1URXA 5FPLA 2VCMA 1XYPA 1MVEA 3LSEA 2XJPA 5T54A 1O4TA 4W4ZA 4P00B 2HJIA 4KU7A 1WLTA 2OX0A 1S0IA 3CJXA 2DBNA 1OQ1A 1WMXA 4CDWB 2VZPA 3LGRA 1FOD1 2J1SA 1ODMA 5BPXA 1KDKA 2RM21 1GBGA 4CEWC 1D0HA 4RQPC 2XKPA 4AWDA 3OUHA 4Q4V3 1CZVA 1KFXL 2HWB1 2JB8A 2HYXA 3AC0A 1MQTB 3I3EA 5FY1A 3ZSKA 3LWCA 5CADA 2YBKA 5JVVA 3VZKA 1J3PA 1CAXA 4I01A 3FHIB 2WZR2 3HQUA 3LDBA 1SDWA 1SG3A 2QBXA 5HV4A 3AYEA 2DF7A 4YM1A 3ZOIA 5JZGA 4C0HA 4NIHA 2D6OX 3UGHA 2R0FA 3TNQA 4TTGA 4PI2A 3CO2A 4WM8C 3UK9A 4E8DA 1OFSA 1OLRA 1CPNA 1SMVA 5A6ZA 5C8CA 5I8TA 2MNGA 1OOPC 1Q56A 3WDXA 1GQGA 5DXDA 3AYAA 4IGOA 1OD3A 2AREA 4JHZA 1RC6A 3RZZA 2QQJA 1QJX3 3BOWA 1EAH3 3MPBA 4QHOA 4EN9B 2H0BA 1R093 4M3CB 1JHNA 3GNEA 4XBQA 4Y1XA 4HVRA 1I5ZA 2VMCA 5A6YA 5JSPA 5I0TA 1FT9A 3VBFB 3W58A 1FV3A 2OZ6A 1UX7A 4IV3B 3JQXA 5FWJA 1DFQA 1S0EA 4Y24A 3AKSA 3CKHA 3CEWA 1DZQA 1XXNA 3AP9A 5IVCA 1REFA 1ZBA3 1GWLA 1NCQB 2QDNA 4QU2A 3AP6A 1VBD3 3KWVA 2EAKA 3K3NA 4LE4A 4YG6A 4QKFA 5FZOB 1VRBA 2JIJA 5GLUA 1LRHA 1NT0A 3AP5A 2VC9A 2XL9A 4ATEA 4CCNA 1UQXA 3PU8A 4IE4A 4CCLA 1AYN1 3T0DA 2YGLA 5DQ0A 1HQLA 4Q4W3 4AI2A 4XJ8A 4YW1A 1H4GA 1AXKA 1ZA7A 1XU1A 5FP8A 3ZXGA 3ZYPA 2C6SA 2VBDA 4HK8A 1Y43B 4M0HA 2Y6FA 3NNLA 2BGPA 1VALA 3BKZA 1B35A 1VRH1 2V5YA 3DKQA 3HD8B 2BBAA 4MXWB 3MBWA 4XF3A 1F5JA 1W0NA 3B69A 2ZGOA 1VBB3 4C90A 1NA1B 5ACA1 1JOJA 3VN4A 1EV13 3LF7A 1L3JA 2XJTA 4KWUA 2DTYA 2XVGA 4BM8A 1CZSA 4I0AA 1A78A 5T5PA 3S6PA 2R062 4P14A 3WOGA 3MZHA 5FZCA 1LB2A 1E5HA 1F4HA 3CF6E 5JIAA 3W5MA 4CEWA 4EV0A 4RQPA 5AFEA 1HX6A 3S5QA 1XNCA 4D6QA 2GMMA 4I0WB 4NHYA 3LIGA 3GBWA 4W6YA 5DAWA 4MG2A 4I30A 5FZ7A 4B4PA 2QQLA 4Q4Y3 1I9RA 4YARA 3T09A 4GB32 3CDZB 2VTXJ 2LTNA 4AE2A 2Y6LA 1VBA3 4IEWA 1EUTA 4Q2FA 3LDRA 2XPJA 1DLCA 4OHYA 2AGSA 2WZR3 3IPVA 4Y22B 1O6UA 2W08A 4AVTA 3I49A 2GNDA 2IXCA 1PIV2 3PUHA 4WM8A 3HOBA 4CRQA 4C91A 3KMHA 5I0SA 3DXUA 1RVF3 5DG1A 5J1XA 4NVPA 2JG9C 1OOPA 4E4DX 5FYZA 1AXYA 1NXD1 5KHJA 4XDPA 5J7MA 3HNMA 1H2NA 1MS0A 1YUDA 3GYDA 3KQRA 4C8DA 2OUJA 2XJUA 4GH4C 1YFUA 1FPN2 5FP3A 1JYWA 2WS92 1ZZ6A 2D5FA 4PIZA 2AYHA 1YC61 4MGQA 4OULA 3DGTA 5K0UC 1SACA 5IK7A 3WCRA 3I59A 4IV1C 3IZOA 4XAAA 3OG2A 2DCTA 1GOHA 4CDXB 3AZVA 3N7KA 4XPVA 3VBRC 4INDA 3VDAA 2IVJA 4TZDA 2UWCA 4CSWA 2AEYA 1U0AA 1SZBA 1VBE1 3IM0A 3MLJA 1BVVA 2QQUA 1SLCA 5IVJA 1YRZA 3THPA 4LKSA 3OY8B 3PL0A 4FFFA 3WNPA 2BW8A 1Z7S1 3VZOA 1WKYA 1YQ8A 4XHXA 3AM2A 5GZGA 1AYM2 4N43C 5CFDC 3HQXA 1BLZA 2GC0A 4I02A 4MH0E 4BQ4A 4E4HA 1UY4A 3P3PA 3WF3A 5HBAA 4OI0A 3VD3A 4EZHA 1JHJA 5DUUA 4QD2A 2LS6A 3GCWA 3AZWA 4CCOA 4OI4A 1XC6A 2FBEA 4YZ4A 3F2ZA 4FBFA 1Y3TA 1XNTA 3I2FA 2HEYF 2YZ4A 1W90A 3JD73 2GN3A 4QXCA 2IXLA 2JDUA 2X5IC 4LNVA 4QPWA 1S0GA 1OBNA 3ZPOA 4HKLA 4YNIA 4MV2A 5T5OA 2ZX1A 5B4XA 4BIFA 5A32B 4N53C 1AL0G 5FZLA 1PO21 1L7LA 4IE7A 1PX3A 2C0ZA 3T0BA 5FYMA 5GZEA 2VE1A 2UWAA 2UURA 1RUJ3 1LHNA 1DF0A 1VBC1 4CP9B 4H7LA 4JTNA 3AZZA 1HQNA 3RMXA 3LA2A 3WF2A 4W6WA 1UMIA 2W91A 4JV4A 4QX2A 2LRPA 4J1WA 3DPRB 4M4RA 2WWJA 4IXLA 4OUEA 5DABA 3WNKA 2VMDA 5I0RA 4IQPA 3HBZA 5LW9A 3AMNA 2R1BA 1LHUA 1C5HA 1QOTA 3P5BA 3ZYGA 5DAVA 2B45X 2JDPA 4QMAA 3WNLA 5IK8A 2WQ4A 2JG9A 3OGRA 1SLLA 1NLRA 4UFMA 1WWYA 3RMYA 1LOAA 4WZFA 1JZ5A 3WX5A 4GH4A 2XL7A 3RI8A 5FXZA 1UYXA 2ZGNA 4GWNA 1W04A 1WZXA 4MHUA 3F95A 4LBLA 4MX3A 2YPJA 3PLQA 2RMU2 4IDZA 2QNKA 4XJZA 5K0UA 3T3YA 2WS93 3JBG1 4XBLA 4D0QA 1ULDA 4IV1A 5FK8A 1COV2 5D8AC 2W3JA 3VBRA 5F2SA 1DQ2A 1ZZ8A 1RUG2 3QLQA 4HBNA 4Y5SA 4A41A 5CISA 3D4KA 4IEUA 1OPMA 5J98B 4OZXA 3PNAA 5T5JA 4F3JA 5C6CA 4YZ5A 1OVPA 4YZ1A 1S4CA 2HEWF 2NP0A 4YW2A 3W5NA 1RINA 3CHXA 4N43A 5CFDA 2JECA 3KLSA 4K9SA 2G4IA 3NJXA 3POFA 1GUIA 1EP0A 1JUIA 1W8NA 4Z2AA 2J42A 1ULEA 2GP5A 4AEJA 3WV6A 1DIWA 3DCQA 4BXFA 1MZ5A 3HN3A 3NKGA 2SLIA 1YLLA 4W65A 4XF9A 4Y1YA 5A3OA 2EXIA 2WLQA 3ES1A 1IZ3A 3O1TA 4IL7A 2HWC1 1X9TA 3WT3A 2X5IA 3WINE 1IPKA 2XJVA 4EWDA 2PAKA 1W9FA 2VQ0A 3ACFA 3SC7X 3AJZA 4JAAA 1FNYA 2MEV1 4CDWC 1W2NA 1XNKA 1R083 2VL4A 4N53A 5AC92 3PMEA 1UYZA 3PMSA 2E26A 3LOIA 4LHLA 1SEFA 2VXJA 4Q0QA 4WVMA 4K20A 3NSTA 2CGNA 2PTMA 3Q8AA 5IFPA 1CAXB 5JXGA 3V0AA 3KF3A 3KHBA 2VG9A 1TME1 4NOTA 3PJYA 3DYPA 1KS4A 3AK0A 1DQ5A 2VNRA 2QE3A 1AR71 4MVTA 5JZGB 4AHZA 3WEZA 1UOJA 4IE6A 1S0CA 4CE8A 1JZ4A 2Q8DA 1CGPA 1CONA 5FPBA 1UOFA 2EIBA 1XYNA 3LD8A 1OQEA 2I07B 3IKWA 1LOGA 2O14A 3AL5A 5HI0A 4OQ8A 1G6NA 1SBFA 2V4VA 1WLCA 2ERFA 1PIV1 4HVOA 3K77A 4O9GA 5KHGA 3ASIA 4XAEA 2PA7A 3LDKA 4DY3A 5FZ8A 5A6QA 4AGVA 4BZ4A 2ZS6B 1VB2A 1V9U1 1VP6A 4N9HA 3T1LA 5K9YA 4YFWA 2OQ6A 4PBPA 1G9AA 4XF0A 1NE6A 4TLFA 5FZHA 1D4M2 2ES3A 2X53S 1PVC2 2RMU3 1MACA 4MGIE 1STMA 4CZSA 2CGPA 1H1AA 5D8AA 2B9UA 5FZ4A 1F4AA 4JKKA 5FJKA 4ASKA 4F7ZA 4RS5C 5JXJA 3O1OA 1QHDA 4M0NA 1SFPA 1WCUA 1UZWA 5CKNA 3UJQA 3I3DA 1YIPA 4AOCA 4Y20B 4B4QA 2GZWA 3OGJA 5J37A 4L92A 3VB9A 5CAZA 5HV0A 4TLGA 4XEZA 2A3WA 2EAAA 4KGQA 1LU1A 1RUE3 1TVGA 3DUIA 3R6SA 2HWD2 1RUI2 1GR3A 4QX3A 3OUJA 4XZPA 2Z79A 1A3KA 1TZOA 2GC2A 1PZ7A 1NLSA 1W05A 2PQQA 5B2GB 2VUAA 2W0XA 2YC2A 5DUWA 1IGOA 4LTAA 5JMCA 5T50A 1UAIA 4TN7A 1HV1A 2DUQA 1I3HA 2ORZA 3JQWA 4LA2A 4NHLA 3E6DA 4GJYA 5A3NA 1RHI3 3HEIA 2QQVA 1IQAA 3EBRA 4FXKB 2HEVF 3N36A 4K6BA 4P08A 2PAMA 1JZ2A 3FMGA 2Q30A 3ON7A 1CX1A 4Q1RA 2QFEA 4ORFA 2VTXA 4RQPB 2Q1FA 1UY2A 4AW7A 3FBMA 4CDWA 4CEWB 1AR82 2WN3A 2W5FA 3IDBB 1BBT2 2E31A 4XIOA 1IS3A 3OD4A 2WNVB 2ZEWA 4A3ZA 3TBDA 2YYOA 2VMEA 2GDFA 2VD7A 1BEV3 1LJ7A 1Q8VA 1NQDA 4NPMA 3VKNA 5T55A 1POQA 1BQPA 2D97A 1GZTA 1JOBA 3A22A 3IPVB 4E9KA 1HB3A 3WG2A 1QJY1 3EMRA 2GMEA 3UETA 3NW4A 4FPOB 2RR11 1H9PA 4HXCA 4WM8B 1VB4A 1LGBA 2XVLA 4META 4M4PA 4ISQA 4YGBA 4IERA 1OOPB 3TEZA 1JS9A 1RUH2 5I91A 1N1SA 1WBFA 1L7RA 2XXZA 5JMOA 1UCXA 1UL9A 3EB7A 2DVDA 2D6LX 2NN8A 3NMBA 2SBAA 2DCKA 4NE9A 2ZGQA 3FUOA 4SBVA 2JDHA 3QOPA 1R1A1 4GALA 5D2AA 4BHPA 2YXSA 2QKDA 4XQDA 2JJ6A 4MO3M 4AVVA 2OS2A 1HJGA 3BB6A 3PUIA 4ZU7A 2VZVA 3HPNA 4QB2A 1KJRA 1NOVA 3T0AA 1E5IA 3WDYA 2W52A 4XJAA 4P9GA 2W2IA 4L8QA 1D4M3 3MI8A 4ZXKA 2CL2A 1PVC3 2RS51 1GZCA 1QF3A 2XDVA 4CDXC 1DDLA 4RS5A 2ZTNA 1F8VA 3QBQA 1ASJ1 1JU4A 3LEGA 3ZX7A 1YJKA 3I2IA 3RNSA 4A6SA 4Y3OA 4MYEA 3FHQA 1HB1A 2WO3A 1AZDA 3AKQA 1PGL2 2XUMA 5BNOB 4GMP3 3BALA 5SV5A 2P3JA 2VOXA 3AFKA 3PVEA 3TWIA 1AF9A 1GWKA 2W46A 3POSA 1S0JA 4DO0A 5FMOS 1IKPA 4FPJA 4AGRA 4YVSC 3KV4A 4XJWA 3EHKA 2RS33 1OMIA 3WNXA 5H9QA 3WW3A 1LEMA 2TNFA 3I2GA 4PCRA 3G6JB 1Q8OA 2BVVA 1US2A 2QQWA 3WD5A 1H8TC 3ZXEA 2JDZA 4CCDA 2DV9A 5F5CA 5K4LA 2V4AA 4CYDA 1HRI2 1FOD2 1OH4A 1WCKA 1DHKB 3GDBA 5D1IA 5GALA 1O3SA 2RM22 2UY8A 5ABJB 1U5IA 2WA4A 1CVNA 1NY71 2YBSA 3FFQA 3GM8A 2HWB2 5EWSA 5DMYA 2V5DA 4BXSV 5IAXA 4BCUA 3VKFC 3ETQA 4QT6A 2YMZA 1FMD3 1GQPA 4IEOA 3I54A 4XJUA 1AR83 2E9QA 4FPKA 2RJ2A 1DYKA 4E2SA 4EJRA 3BPZA 3FE5A 5F39A 5EHDA 3ZO0B 1K3IA 2IFRA 2Y6JA 4UFJA 1NKGA 4HANA 4OUSA 3M2MA 1CWPA 2A6WA 3NV3A 2HWE3 2GC3A 1C28A 3WG1A 4ZKTB 3DPRC 4HG6B 3ITQA 3KCCA 1JTZX 4Y22A 2QQKA 5JDBA 1RITA 4LUKA 3GBFA 1JW6A 3OGVA 2JG9B 2A6ZA 2AACA 2CTVA 3ZFEC 1W3VA 4BQ5A 3EYPA 1GWMA 4AVCA 4EZ4A 3ETPA 1QY4A 2C9AA 1RUH3 1W8UA 1UOBA 5JR7B 3WLUA 1TE1B 2XKOA 4NIGA 1K5MC 2DFBA 1X50A 2DVFA 1LTEA 4D69A 3KVAA 5DZGA 4FFHA 1WW7A 5K0UB 2ZOEB 3MUY1 2BERA 1RMU3 1N1TA 4IV1B 3AKRA 5H9SA 1SPPA 5BUVA 1DGLA 5LRSA 1ZZCA 1DQ6A 3T2OA 3VBRB 1H2LA 1UYPA 4Q0PA 2A75A 4I3PA 2BZDA 4CDXA 1V00A 2VVDA 4AQSA 3ATGA 2DU1A 4XF4A 3AXEA 1HXS3 2YFUA 3RZKA 3BTAA 4A4AA 2VO5A 4I2OA 1ULFA 1AYN2 1L7QA 4RHV3 1CN1A 2PHRA 2GMPA 2GAUA 1UZYA 3RI9A 3TNPB 1R1ZA 4M3CF 2BRTA 1JBCA 3VZNA 1WCDJ 4N43B 1X36A 4BWOA 5CFDB 3AYDA 5I8YA 4H14A 5L9BA 4RN5A 4YVSA 5LA2A 2VOTA 3PHMA 5FY7A 5LWBA 4BIOA 1VRH2 1G9FA 2WINB 1QEXA 2EIGA 4E4ZA 2GNBA 4X8NA 4LOTA 2YU1A 5ACA2 4PQQA 2QVSB 1UU4A 5L19A 2NMOA 1H8TA 5CU1A 3ZM8A 3V64A 2QQOA 3C8XA 1REDA 2X5IB 4IEXA 4R9DA 1UKGA 3DL3A 1XJAA 3ELNA 4COWA 3M3QA 5FZ3A 5EPAA 1FOD3 4N53B 2RM23 1QMJA 2NM1A 2B5HA 3IIAA 3SEEA 3OBRA 4IEYA 4WVMB 4XC9A 3U07A 1O3TA 2HWB3 3Q9OA 3V0AB
chains in the Genus database with same CATH topology
3P6BA 1YQ2A 1EUUA 2WDBA 2ZEZA 4ZXEA 2BGPA 3K46A 4CU9A 3ECQA 5C7GA 2BBAA 1NX9A 3MBWA 1W0NA 4XUPA 5DPNA 1UY1A 4KWUA 3I2HA 3ACGA 1CZSA 4DUXA 3THDA 2YC4A 1F4HA 1JYNA 3W5MA 1XPWA 4W8JA 2VZSA 3K75B 4LPLA 3WF0A 1KGYA 2QQLA 1O59A 3T09A 3CDZB 4XURA 2Y6LA 4XUQA 3ACIA 1EUTA 1IQDC 1DLCA 4PF1A 4OMDA 3ABZA 3PUHA 3HOBA 2W47A 5J1XA 2LW8A 1J84A 3CZJA 3HNMA 2WZ8A 3VD4A 2E33A 2WAOA 1JYWA 4GWJA 4CUCA 1OT5A 2VZ1A 4MGQA 2RV9A 2KD7A 3OG2A 1GOHA 3FN9A 4ET7A 1I5PA 3OEAA 3VDAA 2V72A 3FHAA 4ARYA 3U37A 4UOJA 1UWWA 4LKSA 5CZKA 3WNPA 4XUNA 1WKYA 3WNNA 2W95A 1UY4A 3WF3A 3VD3A 1JHJA 5LA0A 4PT6A 2LS6A 1ULOA 2VZQA 4QDQA 1XC6A 4E8CA 3F2ZA 3NNGA 4DEQA 1H6YA 1XNTA 3I2FA 4BJ0A 2W1UA 2W94A 3MV11 3I2JA 1JZ8A 3VD9A 1DP0A 4QPWA 1WCQA 2Y6KA 4ZZ8A 3J7HA 2VTFA 3WNMA 4A45A 2W9XA 5B4XA 1K45A 3A23A 3C7FA 5JXIA 3T0BA 1PX3A 3HNBM 3DECA 1DYOA 5FUIA 1UY3A 4MOAA 5HPOA 3CZUA 3WF2A 2ID4A 2J1AA 4UAPA 5JUVA 1UMIA 3IAPA 2W91A 3K4AA 4QX2A 1K42A 3WNKA 2WYSA 4M4RA 4OUEA 5C71A 2VMDA 2Y8KA 3C7GA 5CYYA 4CUAA 3WNLA 5IHRA 2VMFA 2VZUA 3WSOA 1XNAA 3OGRA 2OKXA 2Z4FA 2W92A 3C7EA 4OMCA 2WO1A 1JZ5A 1UYXA 3IIIA 4JKMA 2WQ8A 2QQIA 3DYOA 1GU3A 3K4ZA 2L9LA 4D0QA 2W1WA 1JZ7A 2EICA 4TXWA 3VD7A 2X09A 5A1AA 2W3JA 2VCBA 5DN2A 4A41A 1W99A 4D8MA 3CIHA 2QQMA 1W9WA 4JKLA 3CQOA 3W5NA 3SKVA 4BK5A 1K12A 1JZ3A 4A6OA 2JD9A 2VCCA 3MO4A 2VCAA 3LPGA 4Z2AA 3NJXA 1GUIA 1W8NA 3LEKA 4QX1A 5B4NA 2J7MA 3GXUA 3NRUA 1UMHA 2C9KA 5EIYB 3THCA 3HN3A 3I3BA 2J22A 2W1QA 3OGSA 2ZEYA 1D7PM 2B4KA 1TG7A 2J1EA 4XVHA 3HNYM 3ACFA 4P5YA 5F7UA 4DXRA 2VL4A 2HLEA 1UXZA 1JI6A 2EIEA 1UYZA 4A44A 2E26A 4DXTA 5IFPA 5JXGA 3DYPA 3SKJE 3T0DA 1O8SA 1R64A 2ORXA 3WEZA 3WQBA 1JZ4A 3WF4A 4CU7A 3CMGA 2EIBA 2WN2A 4DXSA 2V4VA 2JDAA 3K77A 2VR4A 2Y6GA 5C70A 2WABA 1W9TA 1GMMA 4QB6A 4LQRA 2VQTA 3SEPA 3VD5A 4FI9A 2VZTA 3HJRA 1UY0A 4QDSA 4KI5M 1SHWB 4RYDA 1NAEA 3VDBA 3ACHA 2JE8A 3D3AA 3C7HA 2XOMA 1F4AA 4JKKA 2WUHA 3IAQA 5JXJA 3MUZ1 4ZY9A 2YFZA 1CIYA 3I3DA 1PX4A 5EJ1B 1NUKA 2VJXA 3LEIA 3WF1A 3JXSA 2J1UA 2VQUA 1TVGA 2VZ3A 3NJVA 4QX3A 2W1SA 4XUOA 2B9VA 2ZEXA 1JYVA 2CDOA 4GWIA 2YC2A 1PMJX 3OEBA 4QAWA 4AG4A 2BGOA 1HN1A 2W87A 2ORZA 2WBKA 1UYYA 3HEIA 4QB1A 1OF3A 4P08A 1JZ2A 4GZ9A 1CX1A 1GOGA 1UY2A 3E1F1 2WN3A 2W5FA 4JX0A 2E31A 4A3ZA 2ZEWA 4A42A 3BN6A 2RVAA 2VMEA 4L0PA 2WAAA 2C4XA 2C26A 3A22A 4UI9L 4CVUA 4XUTA 2E32A 3DYMA 3UETA 1P8JA 2X05A 3A21A 4M4PA 4CU8A 3BGAA 1L7RA 3OB8A 5JMOA 2CDPA 2ZXQA 3EB7A 5HXMA 2DCKA 2YG0A 4MO3M 1JU3A 3PUIA 2VZVA 3HPNA 4QB2A 5LCWL 4OYUA 3T0AA 3LPFA 2PQSA 4DEVA 2YB7A 1SDDB 3WNOA 4ARXA 1JU4A 3LEGA 3VDCA 4OZOA 3I2IA 2Y64A 3T2QA 3FHQA 2WO3A 2J1VA 2Y6HA 1MPXA 4LHSA 5IJRA 2W46A 4BDVB 4XZUG 4IUGA 3UESA 5G05L 4KMQA 3I2KA 2QQNA 3I2GA 3UNPA 2JKXA 2XONA 1CZTA 1US2A 3IB3A 4CUBA 3FL7A 5G04L 4DUVA 1OH4A 5LA1A 3GDBA 1UZ0A 2X10A 2VZRA 3C7OA 2J1TA 3GM8A 5IYYA 1PMHX 2V5DA 4BXSV 5DMYA 4P02B 1JZ6A 1GQPA 4AAXA 2RJ2A 1W9SA 3OBAA 1OF4A 2R7EB 1K3IA 2Y6JA 5IFTA 1NKGA 2VZOA 1UXXX 1W8OA 1KEXA 4MADA 3T08A 4CU6A 4HG6B 2XHNA 2QQKA 2XQXA 4W4ZA 4P00B 3OGVA 3A7QA 3P1IA 3EYPA 5I0DA 4W50A 2VZPA 3ETPA 2J1SA 1ULPA 2WO2A 1JYXA 1CZVA 3AC0A 3I3EA 5JXHA 2HYXA 3LE0A 4DUWA 3MUY1 2BERA 2WZEA 5JR2A 1SG3A 2QBXA 3T2OA 2DCJA 2EIDA 4TTGA 3LQCA 2BZDA 4BK4A 1BHGA 3IDAA 1GNYA 4E8DA 1GOFA 2YFUA 1T2XA 3T2PA 4ZZ5A 4A4AA 2VO5A 1RYYA 1L7QA 3K4DA 1OD3A 4YPJA 4JHZA 2QQJA 4QDRA 3I97A 1US3A 4RN5A 5LA2A 2DDUA 2VOTA 2VMCA 5EJZB 1UX7A 4PQQA 3CKHA 2VM9A 2J1RA 3ZM8A 2QQOA 3C8XA 1J83A 1LNSA 3NQHA 3GGLA 1O8PA 1H6XA 4QX0A 3MV01 2VC9A 5DQ0A 3SEEA 4MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6B A;  1YQ2 A;  1EUU A;  2WDB A;  2ZEZ A;  4ZXE A;  2BGP A;  3K46 A;  4CU9 A;  3ECQ A;  5C7G A;  2BBA A;  1NX9 A;  3MBW A;  1W0N A;  4XUP A;  5DPN A;  1UY1 A;  4KWU A;  3I2H A;  3ACG A;  1CZS A;  4DUX A;  3THD A;  2YC4 A;  1F4H A;  1JYN A;  3W5M A;  1XPW A;  4W8J A;  2VZS A;  3K75 B;  4LPL A;  3WF0 A;  1KGY A;  2QQL A;  1O59 A;  3T09 A;  3CDZ B;  4XUR A;  2Y6L A;  4XUQ A;  3ACI A;  1EUT A;  1IQD C;  1DLC A;  4PF1 A;  4OMD A;  3ABZ A;  3PUH A;  3HOB A;  2W47 A;  5J1X A;  2LW8 A;  1J84 A;  3CZJ A;  3HNM A;  2WZ8 A;  3VD4 A;  2E33 A;  2WAO A;  1JYW A;  4GWJ A;  4CUC A;  1OT5 A;  2VZ1 A;  4MGQ A;  2RV9 A;  2KD7 A;  3OG2 A;  1GOH A;  3FN9 A;  4ET7 A;  1I5P A;  3OEA A;  3VDA A;  2V72 A;  3FHA A;  4ARY A;  3U37 A;  4UOJ A;  1UWW A;  4LKS A;  5CZK A;  3WNP A;  4XUN A;  1WKY A;  3WNN A;  2W95 A;  1UY4 A;  3WF3 A;  3VD3 A;  1JHJ A;  5LA0 A;  4PT6 A;  2LS6 A;  1ULO A;  2VZQ A;  4QDQ A;  1XC6 A;  4E8C A;  3F2Z A;  3NNG A;  4DEQ A;  1H6Y A;  1XNT A;  3I2F A;  4BJ0 A;  2W1U A;  2W94 A;  3MV1 1;  3I2J A;  1JZ8 A;  3VD9 A;  1DP0 A;  4QPW A;  1WCQ A;  2Y6K A;  4ZZ8 A;  3J7H A;  2VTF A;  3WNM A;  4A45 A;  2W9X A;  5B4X A;  1K45 A;  3A23 A;  3C7F A;  5JXI A;  3T0B A;  1PX3 A;  3HNB M;  3DEC A;  1DYO A;  5FUI A;  1UY3 A;  4MOA A;  5HPO A;  3CZU A;  3WF2 A;  2ID4 A;  2J1A A;  4UAP A;  5JUV A;  1UMI A;  3IAP A;  2W91 A;  3K4A A;  4QX2 A;  1K42 A;  3WNK A;  2WYS A;  4M4R A;  4OUE A;  5C71 A;  2VMD A;  2Y8K A;  3C7G A;  5CYY A;  4CUA A;  3WNL A;  5IHR A;  2VMF A;  2VZU A;  3WSO A;  1XNA A;  3OGR A;  2OKX A;  2Z4F A;  2W92 A;  3C7E A;  4OMC A;  2WO1 A;  1JZ5 A;  1UYX A;  3III A;  4JKM A;  2WQ8 A;  2QQI A;  3DYO A;  1GU3 A;  3K4Z A;  2L9L A;  4D0Q A;  2W1W A;  1JZ7 A;  2EIC A;  4TXW A;  3VD7 A;  2X09 A;  5A1A A;  2W3J A;  2VCB A;  5DN2 A;  4A41 A;  1W99 A;  4D8M A;  3CIH A;  2QQM A;  1W9W A;  4JKL A;  3CQO A;  3W5N A;  3SKV A;  4BK5 A;  1K12 A;  1JZ3 A;  4A6O A;  2JD9 A;  2VCC A;  3MO4 A;  2VCA A;  3LPG A;  4Z2A A;  3NJX A;  1GUI A;  1W8N A;  3LEK A;  4QX1 A;  5B4N A;  2J7M A;  3GXU A;  3NRU A;  1UMH A;  2C9K A;  5EIY B;  3THC A;  3HN3 A;  3I3B A;  2J22 A;  2W1Q A;  3OGS A;  2ZEY A;  1D7P M;  2B4K A;  1TG7 A;  2J1E A;  4XVH A;  3HNY M;  3ACF A;  4P5Y A;  5F7U A;  4DXR A;  2VL4 A;  2HLE A;  1UXZ A;  1JI6 A;  2EIE A;  1UYZ A;  4A44 A;  2E26 A;  4DXT A;  5IFP A;  5JXG A;  3DYP A;  3SKJ E;  3T0D A;  1O8S A;  1R64 A;  2ORX A;  3WEZ A;  3WQB A;  1JZ4 A;  3WF4 A;  4CU7 A;  3CMG A;  2EIB A;  2WN2 A;  4DXS A;  2V4V A;  2JDA A;  3K77 A;  2VR4 A;  2Y6G A;  5C70 A;  2WAB A;  1W9T A;  1GMM A;  4QB6 A;  4LQR A;  2VQT A;  3SEP A;  3VD5 A;  4FI9 A;  2VZT A;  3HJR A;  1UY0 A;  4QDS A;  4KI5 M;  1SHW B;  4RYD A;  1NAE A;  3VDB A;  3ACH A;  2JE8 A;  3D3A A;  3C7H A;  2XOM A;  1F4A A;  4JKK A;  2WUH A;  3IAQ A;  5JXJ A;  3MUZ 1;  4ZY9 A;  2YFZ A;  1CIY A;  3I3D A;  1PX4 A;  5EJ1 B;  1NUK A;  2VJX A;  3LEI A;  3WF1 A;  3JXS A;  2J1U A;  2VQU A;  1TVG A;  2VZ3 A;  3NJV A;  4QX3 A;  2W1S A;  4XUO A;  2B9V A;  2ZEX A;  1JYV A;  2CDO A;  4GWI A;  2YC2 A;  1PMJ X;  3OEB A;  4QAW A;  4AG4 A;  2BGO A;  1HN1 A;  2W87 A;  2ORZ A;  2WBK A;  1UYY A;  3HEI A;  4QB1 A;  1OF3 A;  4P08 A;  1JZ2 A;  4GZ9 A;  1CX1 A;  1GOG A;  1UY2 A;  3E1F 1;  2WN3 A;  2W5F A;  4JX0 A;  2E31 A;  4A3Z A;  2ZEW A;  4A42 A;  3BN6 A;  2RVA A;  2VME A;  4L0P A;  2WAA A;  2C4X A;  2C26 A;  3A22 A;  4UI9 L;  4CVU A;  4XUT A;  2E32 A;  3DYM A;  3UET A;  1P8J A;  2X05 A;  3A21 A;  4M4P A;  4CU8 A;  3BGA A;  1L7R A;  3OB8 A;  5JMO A;  2CDP A;  2ZXQ A;  3EB7 A;  5HXM A;  2DCK A;  2YG0 A;  4MO3 M;  1JU3 A;  3PUI A;  2VZV A;  3HPN A;  4QB2 A;  5LCW L;  4OYU A;  3T0A A;  3LPF A;  2PQS A;  4DEV A;  2YB7 A;  1SDD B;  3WNO A;  4ARX A;  1JU4 A;  3LEG A;  3VDC A;  4OZO A;  3I2I A;  2Y64 A;  3T2Q A;  3FHQ A;  2WO3 A;  2J1V A;  2Y6H A;  1MPX A;  4LHS A;  5IJR A;  2W46 A;  4BDV B;  4XZU G;  4IUG A;  3UES A;  5G05 L;  4KMQ A;  3I2K A;  2QQN A;  3I2G A;  3UNP A;  2JKX A;  2XON A;  1CZT A;  1US2 A;  3IB3 A;  4CUB A;  3FL7 A;  5G04 L;  4DUV A;  1OH4 A;  5LA1 A;  3GDB A;  1UZ0 A;  2X10 A;  2VZR A;  3C7O A;  2J1T A;  3GM8 A;  5IYY A;  1PMH X;  2V5D A;  4BXS V;  5DMY A;  4P02 B;  1JZ6 A;  1GQP A;  4AAX A;  2RJ2 A;  1W9S A;  3OBA A;  1OF4 A;  2R7E B;  1K3I A;  2Y6J A;  5IFT A;  1NKG A;  2VZO A;  1UXX X;  1W8O A;  1KEX A;  4MAD A;  3T08 A;  4CU6 A;  4HG6 B;  2XHN A;  2QQK A;  2XQX A;  4W4Z A;  4P00 B;  3OGV A;  3A7Q A;  3P1I A;  3EYP A;  5I0D A;  4W50 A;  2VZP A;  3ETP A;  2J1S A;  1ULP A;  2WO2 A;  1JYX A;  1CZV A;  3AC0 A;  3I3E A;  5JXH A;  2HYX A;  3LE0 A;  4DUW A;  3MUY 1;  2BER A;  2WZE A;  5JR2 A;  1SG3 A;  2QBX A;  3T2O A;  2DCJ A;  2EID A;  4TTG A;  3LQC A;  2BZD A;  4BK4 A;  1BHG A;  3IDA A;  1GNY A;  4E8D A;  1GOF A;  2YFU A;  1T2X A;  3T2P A;  4ZZ5 A;  4A4A A;  2VO5 A;  1RYY A;  1L7Q A;  3K4D A;  1OD3 A;  4YPJ A;  4JHZ A;  2QQJ A;  4QDR A;  3I97 A;  1US3 A;  4RN5 A;  5LA2 A;  2DDU A;  2VOT A;  2VMC A;  5EJZ B;  1UX7 A;  4PQQ A;  3CKH A;  2VM9 A;  2J1R A;  3ZM8 A;  2QQO A;  3C8X A;  1J83 A;  1LNS A;  3NQH A;  3GGL A;  1O8P A;  1H6X A;  4QX0 A;  3MV0 1;  2VC9 A;  5DQ0 A;  3SEE A;  4MGS A; 
#chains in the Genus database with same CATH topology
 3P6B A;  3ZSE A;  3ZYH A;  1VAK A;  3W59 A;  1EUU A;  1O3R A;  2R49 A;  1N1V A;  4N8M A;  3FFZ A;  4AHY A;  1BBT 1;  3N3H A;  1WD3 A;  3IWZ A;  5KBF A;  1OLM E;  3BIW E;  2OQ7 A;  3ECQ A;  2ZJC A;  2BDR A;  1NX9 A;  3KV9 A;  1OVS A;  1HV0 A;  1WCS A;  4UF0 A;  2D6N A;  4IES A;  3DPR A;  2ZML A;  4OHZ A;  4BQY A;  4EN0 A;  3O1M A;  2VW1 A;  5C3R A;  3ZLI A;  2LRO A;  2VXR A;  4JCK A;  4YW5 A;  5GJ6 A;  3UYJ A;  1H9W A;  3ZFE A;  4D3W A;  3MID A;  2E51 A;  3THD A;  2GP3 A;  2RS1 3;  4HMZ A;  2O0O A;  3ZFG C;  5KHK A;  1JYN A;  1K5M A;  4FT8 A;  4LOS A;  4W8J A;  1V6K A;  3MFA A;  4LPL A;  5M0T A;  4L2N A;  4LO6 B;  4Y5Z 0;  2FCU A;  5LBE A;  2B39 A;  3T4V A;  1O59 A;  1CAW A;  3RZM A;  4XUR A;  4OUM A;  3ACI A;  3IDC B;  3M3C A;  2PXJ A;  2XHK A;  3J8F 1;  5D8A B;  4GKY A;  1N3Q A;  5FBZ A;  3ZYB A;  1VBE 2;  3UJO A;  1XE8 A;  2VOV A;  2W47 A;  4TSV A;  4IEV A;  4NMI A;  3WR0 A;  2DCY A;  3ZXA C;  1Z7S 2;  3SCG A;  4NII A;  2YRO A;  3LOB A;  3QH6 A;  2JIG A;  1AR6 1;  3HBK A;  3J7L A;  5C5U A;  3PUR A;  2JDM A;  3KT4 A;  1UZV A;  3BOD A;  4C1W A;  5GM0 A;  3SH3 A;  4GWJ A;  3HN1 A;  4CUC A;  4KL1 A;  3VLB B;  4BIS A;  4DZG A;  5KXD A;  5IK5 A;  2KD7 A;  5DZE A;  4LUL A;  1OLM A;  3MIG A;  5FPZ A;  5HCA A;  3FN9 A;  1I5P A;  2V72 A;  4JGY C;  4QHZ A;  2XBO 1;  5CIR A;  4E2Q A;  3POY A;  2I74 A;  4LKD A;  3K3O A;  3VGI A;  3FHA A;  2ZAH A;  4Q1P A;  1C8M 1;  1HRI 1;  1PO2 2;  1UWW A;  2QCS B;  2VUD A;  4QXK A;  1MS3 A;  4XFG A;  3DKW A;  3RG0 A;  3NWK A;  4F83 A;  1FAY A;  4XXA A;  3U4X A;  2FD8 A;  1VBC 2;  4FFG A;  3GJB A;  4XUN A;  1XRU A;  1MS5 A;  2YHJ A;  3ZDV A;  1ZRE A;  2JD4 A;  4Q4X 1;  3H1W A;  1UIJ A;  2WNV C;  2OT7 A;  5GZF A;  1O91 A;  2A3X A;  1LGC A;  5FRE A;  1HN0 A;  4COV A;  5LA0 A;  1PGW 1;  4PT6 A;  4PDW C;  1ULO A;  3E6C C;  1QJU 1;  3N9Q A;  4JQT A;  1IPJ A;  2R30 A;  1H6Y A;  4AQT A;  2X8K A;  2IXH A;  4DB5 A;  2W94 A;  3H50 A;  3MV1 1;  1OLQ A;  1JZ8 A;  3KHC A;  5T5L A;  3M3I A;  3H3L A;  2BJS A;  5F3E A;  2ATF A;  1QXR A;  2R07 3;  2Y6K A;  3J7H A;  5FFO C;  5DDJ 3;  3WNM A;  2VMH A;  3ALQ A;  4L9B A;  3B93 A;  4RFT 0;  3PVN A;  1W6M A;  3A23 A;  1UD1 A;  3AB0 A;  1PZ8 A;  4Q0V A;  3ZFG A;  3TAY A;  4OHX A;  3HNB M;  1LGN A;  4XDQ A;  3WDU A;  5JOZ A;  3DEC A;  1C1F A;  1DYO A;  2H6C A;  1UY3 A;  3HT1 A;  3JBG 2;  5HPO A;  1NXM A;  2VVF A;  4FAH A;  2J1A A;  1GZW B;  1PMI A;  2F4P A;  2D6P A;  2JEN A;  3IAP A;  3JZV A;  4IE5 A;  5FBJ A;  5ISL A;  1AL2 1;  4URA A;  3B94 A;  4R8H A;  4RS5 B;  2R6Q A;  2WL1 A;  1QNW A;  5CEH A;  1S2B A;  2IC1 A;  1IS4 A;  4R4Z A;  1E57 A;  1VBE 3;  3AMM A;  2VZU A;  1XNA A;  5A1L A;  2OKX A;  4PIX A;  1MZF A;  2Z4F A;  1Y4W A;  2BOJ A;  1RGS A;  2OYZ A;  2W92 A;  4NRO A;  4Y20 A;  1XSQ A;  4ZS3 A;  4UFK A;  4AFC A;  3KS7 A;  4OMC A;  5FWE A;  1U5X A;  2A1X A;  3H0O A;  4SLI A;  5BNO C;  1NG0 A;  2WYF A;  2XLF A;  3LIH A;  2H0V A;  1HRV 3;  5FYV A;  3III A;  4XFF A;  4JKM A;  1MS4 A;  5IVE A;  1PGS A;  3MIE A;  4LO4 B;  3WUD A;  3DYO A;  1GU3 A;  2GU9 A;  3X29 B;  4K1Y A;  4EYU A;  2W1W A;  5DAX A;  1MEC 1;  2EIC A;  2ZGK A;  1REE A;  3MIF A;  1V0A A;  2Z5W A;  2X09 A;  4LKE A;  3MIH A;  2KR2 A;  2OVU A;  1ND2 C;  3DV8 A;  4QX7 A;  1W0O A;  2HWC 2;  2WO7 A;  4JGY A;  5EP9 A;  3WDW A;  5LK7 B;  3C3V A;  5FKB A;  1CQ9 A;  5CG8 A;  4K8R B;  3JB4 C;  1RJ7 A;  4AVB A;  1OUX A;  5K7P A;  1WBL A;  2MEV 2;  2VH9 A;  4A2U A;  2QQM A;  1GQH A;  1W9W A;  1ZZB A;  1A34 A;  4LIU A;  3CQO A;  2ZGP A;  1W3X A;  4H2A A;  5ABJ C;  3A4U A;  1ZZ7 A;  3UKV A;  1POV 1;  1C8N A;  5F8P A;  1K12 A;  4BQ3 A;  3WW4 A;  2VCC A;  1TME 2;  3ZMO A;  3LPG A;  1CJD A;  4KWJ A;  5FO8 B;  4QX1 A;  1AR7 2;  2WNV A;  1HJF A;  1RUD 2;  5DUV A;  2J7M A;  3AZY A;  4KBB A;  3GBG A;  3GXU A;  1UMH A;  2C9K A;  2JKB A;  4PDW A;  5A7P A;  1CPM A;  3SLI A;  3HT2 A;  2G9F A;  1I1E A;  4CCE A;  2W1Q A;  1GP6 A;  1YHF A;  2GNT A;  2YU2 A;  2VNO A;  1TG7 A;  1ULC A;  5LBF A;  3I3Q A;  1Q8Q A;  4XVH A;  4Y1Z A;  4E4S A;  3ZSJ A;  4BME A;  5T3N A;  2ZHN A;  1NQJ A;  2Y0O A;  4P5Y A;  3KQ4 B;  1V9U 2;  2EIE A;  5F9T A;  2YGM A;  4A44 A;  3LCP A;  3POB A;  4HT1 T;  3HR9 A;  3NJZ A;  1WUV A;  2WKK A;  5IVV A;  2WT2 A;  1SPP B;  1R64 A;  3N7L A;  3MIB A;  2EXH A;  2ET7 A;  2RDR A;  4COU A;  4DIQ A;  5F3C A;  1W8T A;  2BNO A;  2D3S A;  2DFC A;  3B9C A;  3CMG A;  3U14 A;  4AAP A;  3AZX A;  5C3Q A;  4DXS A;  2P3K A;  3ZDS A;  5FZD A;  2ZAC A;  1QJZ A;  4LLO A;  2JDA A;  4HL0 A;  2TUN A;  2C24 A;  1QNY A;  4QQ2 A;  5FZF A;  5FZ9 A;  2VR4 A;  3ENR A;  5FXX A;  1UW8 A;  3URF A;  4CP0 A;  5C70 A;  5A7N A;  1QJX 1;  1JXN A;  1W9T A;  4ZPI A;  3PUQ A;  1EAH 1;  4AI3 A;  5J09 A;  3E5X A;  4HK9 A;  2VW0 A;  5BNO A;  1R09 1;  2FCT A;  3H42 B;  4FI9 A;  4YVS B;  2VZT A;  3HJR A;  3MF6 A;  4KI5 M;  3FLP A;  1SHW B;  4RYD A;  1M06 G;  1NAE A;  3MGU A;  5HCB A;  5IK4 A;  2IXJ A;  2VW2 A;  3KCX A;  1LHV A;  5CNA A;  3VDB A;  3D8C A;  5FLH A;  2JE8 A;  1QDC A;  1ZBA 1;  4BQ2 A;  2Z42 A;  1H8T B;  3C7H A;  3D3A A;  2VOW A;  1OSG A;  1ND2 A;  1N3O A;  1VBD 1;  2E63 A;  4RFR B;  1JUH A;  1CIY A;  1RUF 1;  1YXW A;  1W8Z A;  1PX4 A;  3GAL A;  4XF1 A;  1UKR A;  1CAV A;  2D43 A;  3MW4 A;  3AKT A;  1W6O A;  3Q8F A;  2MEV 3;  2Y38 A;  3VZM A;  4DNY A;  2VQU A;  4Q4W 1;  5A3M A;  5ABJ A;  3BU0 A;  2F6B A;  4IGQ A;  3O1R A;  2R06 3;  1HIX A;  1QXP A;  4CA9 A;  4AL9 A;  2B7Y A;  4CP2 A;  5JSO A;  4QGM A;  3O7O A;  1TQ5 A;  2W1S A;  4B7E A;  1IOA A;  2ZEX A;  1U5Z A;  2Q8E A;  1EPZ A;  4GWI A;  4IET A;  3ES4 A;  2G9Z A;  1QJY 2;  4I09 A;  2RR1 2;  4UF0 B;  4O9E A;  2BGO A;  1JOP A;  2W87 A;  3LAG A;  1EV1 1;  1F31 A;  1XE0 A;  4GB3 3;  3A0K A;  4HOO A;  1UYY A;  1ZRR A;  2D6M A;  3MW2 A;  4Y33 A;  4Y1U A;  5FY0 A;  4UFI A;  3AXD A;  3CJI C;  2EVX A;  1QH6 A;  3NKT A;  3ZFE B;  5J96 B;  4BQW A;  3M7A A;  2FZ1 A;  4GZ9 A;  1PIV 3;  4JZR A;  2WR9 A;  3APB A;  4B1M A;  5J36 A;  2QDR A;  1K5M B;  1R1A 2;  2ZCW A;  3CLP A;  3ZKY A;  3E1F 1;  4R9C A;  5FXW A;  1UZZ A;  2VAU A;  5FOB B;  4UFL A;  1A8D A;  2ZGS A;  1CAW B;  4A42 A;  1OA2 A;  4XYX A;  3SCH A;  4AFB A;  5FQ0 A;  4L0P A;  3AMH A;  2WAA A;  2C4X A;  3D5O A;  2CU5 A;  1SBD A;  1VBA 1;  1ZRC A;  1FPN 3;  1SLB A;  1YO8 A;  2OXB A;  2JXA A;  3R4D B;  2C26 A;  3TOJ A;  2RS5 2;  4XCB A;  3ZN4 A;  1AR9 1;  1ASJ 2;  2Y26 A;  1UMZ A;  2E32 A;  3IMN A;  3Q8E A;  4CVU A;  1W8F A;  3BTY A;  2GH8 A;  2NLR A;  2BNN A;  4KBZ A;  1RVF 1;  1WMD A;  5F32 A;  5FYI A;  3A21 A;  4B4R A;  4K3U A;  1YFY A;  1A8M A;  2EA7 A;  3SQO A;  1H0B A;  3VKM A;  4YW4 A;  1IKQ A;  2XLG A;  2JWP A;  2ZXQ A;  1LOE A;  5FUP A;  2BU9 A;  4J1X A;  2YG0 A;  1FYU A;  2YPD A;  1ENQ A;  2ZGR A;  4FTS A;  2QJV A;  3N9P A;  3PUA A;  5DZF A;  5F5Q A;  1OQD A;  1UNB A;  4G4F A;  4EQV A;  1BK0 A;  2DU0 A;  3KGL A;  4YWA A;  4OYU A;  1AYM 3;  4XHB A;  5J48 A;  3KT1 A;  4LBN A;  2R1D A;  1POV 0;  4EE2 A;  2GAL A;  3A0N A;  3H1M A;  1QH7 A;  4B1L A;  1SLT A;  3B9I A;  4I0B A;  4ZU4 A;  3IBM A;  3VDC A;  3J4U H;  4RA0 A;  1X7N A;  1GZ9 A;  1NY7 2;  2D40 A;  2A5Z A;  2ZA9 A;  5T52 A;  1UPS A;  4XE9 A;  3VBS C;  3RS6 A;  2CAV A;  3WP4 A;  5GZD A;  2WFF 1;  3Q8B A;  4UW4 A;  4XZU G;  4IUG A;  1EYB A;  3RVH A;  5FLJ A;  4EWA A;  4LBQ A;  4CPB A;  2BWC A;  2ZZQ A;  1ODN A;  4YM0 A;  2QQN A;  1AJK A;  4ATF A;  3OPW A;  1H2M A;  2XON A;  1MZE A;  5FZE A;  3PJQ A;  1S0F A;  1CZT A;  1FNZ A;  1RUD 1;  1J58 A;  1YQ6 A;  4HN1 A;  4LLF A;  2ADD A;  3ZMN A;  3JD7 1;  1W2A X;  3CJI A;  3VBO B;  1G9B A;  2YV8 A;  2XR4 A;  3RZJ A;  1CX4 A;  2A6X A;  2RDN A;  2KM2 A;  2UY9 A;  3NVC A;  3R05 A;  1LKN A;  3B7M A;  1V6J A;  4P9L A;  4XAB A;  4Q0S A;  3ZFG B;  1W6M B;  4J25 A;  1LHW A;  4L99 A;  1UO9 A;  4LO8 A;  4CDQ C;  3WP6 A;  2E6V A;  3LKJ A;  1R1A 3;  4NPL A;  3V56 A;  4LUM A;  4QU1 A;  2OPW A;  3WQ0 A;  1W9S A;  5JOX A;  5FY5 A;  1OF4 A;  2ZGT A;  5IFT A;  4V2V A;  3ZYR A;  3H8O A;  2WT1 A;  4MAD A;  3T08 A;  4HVQ A;  2FZ2 A;  2ZGL A;  4CU6 A;  1COV 3;  2XQX A;  1ASJ 3;  1NLQ A;  4MGK E;  1W2O A;  2BUK A;  4RGG A;  5FZI A;  4D94 A;  4LIV A;  1OA3 A;  4PLM A;  3KCY A;  3P1I A;  4RGA A;  4MGT A;  1RUG 3;  5I0D A;  2PHU A;  3I8T A;  4LBQ D;  4RGK A;  4W50 A;  4OI1 A;  4CPB D;  4GQ7 A;  2WO2 A;  4NPR A;  5LK5 A;  3N7J A;  4NID A;  2JG8 C;  1MS8 A;  3GZE A;  3OBZ A;  4DUW A;  4OCT A;  3SIS A;  1PM7 A;  1X8M A;  4LR4 A;  2B8M A;  2VVE A;  1ENX A;  2PAE A;  3FLR A;  1SLI A;  4P9X A;  5EV7 A;  5LRR A;  2FDG A;  3SH4 A;  5I0U A;  5IAV A;  5FYC A;  4WVZ A;  5IT6 A;  1OKQ A;  3W9A A;  3GF6 A;  1G86 A;  2DCJ A;  4JGY B;  1ZRF A;  3RPQ A;  5FRA A;  3RWN A;  2ARA A;  1D2Q A;  1BHG A;  2O8Q A;  2A6Y A;  1FV2 A;  1QKQ A;  3I7D A;  3IDA A;  1GP5 A;  1Q43 A;  3MLK A;  4KU8 A;  3U11 A;  1ZX5 A;  3MEP A;  1T2X A;  4LBO A;  5L73 A;  4ZZ5 A;  4C0B A;  3VBS A;  2N7G A;  3WHT A;  4YFZ A;  3K4D A;  3VV1 A;  2NYY A;  4YPJ A;  3SCF A;  3T4H B;  2VPV A;  3WZ1 A;  5I8S A;  2PMW B;  5A6X A;  1O7F A;  2A3Y A;  2VQA A;  1W8W A;  2A6V A;  1S0D A;  4AQ6 A;  1US3 A;  4RL7 A;  3BTX A;  4X6Q B;  4ES9 A;  4LIT A;  3IT8 A;  3OF1 A;  5AC9 3;  5EJZ B;  4QX5 A;  1ZA4 A;  2D3P A;  1MS1 A;  4BE3 A;  4PDW B;  1WW5 A;  1FI2 A;  5FMB A;  3KF5 A;  2VM9 A;  2J1R A;  1LAJ A;  4NHX A;  4PI0 A;  1J83 A;  4FPE A;  4CUG A;  1LNS A;  1H6X A;  1YFX A;  3ZR6 A;  2C1F A;  1T6B X;  3GCX A;  3MV0 1;  2XJS A;  4WVW A;  1O4Y A;  3NV1 A;  1R08 1;  3AL6 A;  2PHD A;  1DGR A;  3MPP G;  4YZ3 A;  5F2W A;  3D6E A;  5FZK A;  5SV8 A;  4CDQ A;  2A70 A;  1YQ2 A;  3RJR A;  2AEZ A;  1D4V B;  4UBG A;  5JOW A;  2WDB A;  4JDM A;  1OH3 A;  5LAT A;  1W8H A;  3J8F 2;  1O4Z A;  2JEM A;  3K46 A;  1LEN A;  4CU9 A;  4MUV A;  1APN A;  4BOW A;  1GZW A;  3LFM A;  5L9V A;  4YG3 A;  1RUC 1;  2D3R A;  2Y33 A;  3QD6 A;  1JYC A;  4O65 A;  4HKO A;  4AI0 A;  5F1R A;  1RUN A;  1SLA A;  1AR6 2;  1X8E A;  2ENR A;  4AFA A;  2YC4 A;  4UFH A;  2AEN A;  3IDE A;  4KNC A;  4LBJ A;  1W6P A;  1XPW A;  2JG8 A;  3ORJ A;  5FZG A;  4A7Y A;  3K75 B;  3CNA A;  5HXV A;  5K8S A;  5A33 A;  3VL9 A;  1KGY A;  2K0G A;  2XGX A;  4K7J A;  1N3P A;  1S2K A;  5A3L A;  2HWD 3;  1LES A;  1RUI 3;  3UGF A;  2ETE A;  2P1B A;  4QKD A;  2PHT A;  4QX8 A;  1GSL A;  3MDP A;  5E88 A;  3WP5 A;  2XBO 2;  4PF1 A;  1ND2 B;  3ABZ A;  3PIJ A;  4XFI A;  4PLO A;  1ALY A;  2D44 A;  4DS0 A;  5A3P A;  2R04 1;  4E27 A;  1IS6 A;  4KGG A;  1C8M 2;  1CAV B;  3RQ0 A;  3LEM A;  4CCC A;  3BCW A;  4A7K A;  1W6O B;  2LW8 A;  4BLI A;  1J84 A;  4MHR A;  2TEP A;  2VMI A;  3VD4 A;  5GZC A;  1RUE 1;  3H7J A;  1NCR C;  1C5I A;  3VHO A;  4AFM A;  2XWB B;  2P3I A;  1A6C A;  2E33 A;  4MGS A;  2WAO A;  3OJB A;  4P9W A;  1PO1 1;  4Q4X 2;  2JE7 A;  2CNA A;  3E5Q A;  1VE0 A;  1PGW 2;  4PBO A;  1BBT 3;  1QJU 2;  2JB4 A;  2RV9 A;  3E6B A;  1PNF A;  5FKC A;  2WQZ C;  4Q0U A;  1C3H A;  1RHI 1;  3WG3 A;  2FDH A;  2ZKN A;  5A3W A;  1QQP 1;  4Q8K A;  2Q0A A;  2BGC A;  1RB8 G;  2XJQ A;  2XVK A;  4ARY A;  1D0G A;  4NRM A;  2R32 A;  2BP6 A;  4Z8B A;  5BY5 A;  4UOJ A;  2NQY A;  5FYS A;  1FAT A;  2V09 A;  3BOP A;  4WVV A;  5F6K A;  1PM4 A;  5CZK A;  4AR2 A;  2DWR A;  4XW3 A;  3KB5 A;  5KHI A;  3WY6 A;  3UGG A;  5FQ0 B;  2P17 A;  1JN2 P;  1YI7 A;  1I6X A;  1BEV 1;  4Z82 A;  2UU8 A;  5JLV A;  5E6H A;  3D82 A;  4O7X A;  3RSJ A;  4R9A A;  1AL2 2;  2CHH A;  2ZHK A;  3GJA A;  1G9D A;  1G9C A;  3ILF A;  4N7U A;  3PTY A;  4QDQ A;  1KJL A;  3ZXJ A;  3NNG A;  2YUE A;  1U12 A;  3R4S A;  3EXU A;  1XBF A;  3I2J A;  2CWM A;  2CGO A;  2PHF A;  4H55 A;  1DP0 A;  1BVP 1;  1WCQ A;  4BYY A;  4GUL A;  2IVI B;  3FC0 A;  4ZZ8 A;  2VTF A;  4YSF A;  4K40 A;  5F37 A;  2BFU S;  3POW A;  1VMH A;  3KZ4 C;  4QWN A;  2IXI A;  1J1L A;  1K45 A;  1DCS A;  5BNN B;  5JXI A;  1NZC A;  2DBI A;  3J26 N;  2EAL A;  5KR7 A;  2IXK A;  2OA2 A;  2BOI A;  3ZYI B;  2XLA A;  2PHL A;  1HQW A;  3GHN A;  5FUI A;  3MLL A;  2C5D A;  4HSJ A;  1C1L A;  4AHX A;  1MEC 2;  2WZP P;  1RJ8 A;  2HYK A;  1RUO A;  1YCI A;  4UAP A;  3ZN5 A;  5FYT A;  1XOY A;  1F9K A;  5IUQ A;  3K4A A;  3UKN A;  2Y8K A;  4NHK A;  2ARB A;  4N7I A;  3C7G A;  5BXX A;  4B7K A;  1JOD A;  3M1H A;  5FAX A;  2I2S A;  2ZBJ A;  1LR5 A;  3PDQ A;  4FOW A;  4TWT A;  4Y4R A;  2WRA A;  5FV3 A;  3ROU A;  3S30 A;  3WSO A;  3U0Z A;  1TMF 1;  4GMP 1;  2LUW A;  4YW6 A;  1GNH A;  1ENR A;  1HRI 3;  3QCW A;  1V6M A;  2DVG A;  2WT0 A;  2ZAA A;  3C7E A;  1NCR A;  2WO1 A;  4OI2 A;  3ACL A;  2RS3 1;  4LBQ B;  5FUN A;  2JX9 A;  5A3T A;  4F8A A;  1YIF A;  2WQ8 A;  4UW6 A;  1WD4 A;  1PK6 C;  1Q8P A;  4AK3 A;  4BLJ A;  2L9L A;  1XND A;  1JZ7 A;  4TXW A;  3RZL A;  1QJU 3;  3ZSM A;  5A1A A;  2VCB A;  1S0B A;  5CA6 A;  1IG3 A;  3CJI B;  3OSD A;  4YYO A;  5L7O C;  3VBH B;  4BMB A;  1VLN A;  2K46 A;  1KS5 A;  2ZGM A;  3L2Y A;  4XOG A;  5CKQ A;  4XQW A;  3U75 A;  3VBO C;  3NO8 A;  1N47 A;  1GAN A;  4Q4V 2;  2VBB A;  1H4H A;  3TN9 1;  5JI9 A;  4L11 A;  1J59 A;  1ZVF A;  4U2A A;  5FP7 A;  3VZL A;  4UT5 A;  1J3Q A;  5FJH A;  1FMD 1;  4YW7 A;  4QQL A;  4FXG B;  4BK5 A;  4FAG A;  5A3U A;  1JZ3 A;  4LBK A;  3SIT A;  4COZ A;  5A80 A;  4UYB A;  2A73 B;  1YJL A;  3LEK A;  4KG8 A;  4AI8 A;  5B4N A;  2DUR A;  3I4I A;  1DBN A;  1WLD A;  4AZZ A;  2HWE 1;  5EYX A;  1KFU L;  2P37 A;  1ZM1 A;  3BIE A;  3M3E A;  1G7Y A;  3THC A;  4PHZ A;  3VDD C;  1S55 A;  3I3B A;  3I2O A;  1ST8 A;  2PLV 1;  4N9I A;  4NR1 A;  4XIK A;  3POG A;  1BXH A;  1ACC A;  3NNF A;  3ZIW A;  3I2D A;  2XML A;  2ZEY A;  3J7N A;  2PHW A;  1D7P M;  2B4K A;  2D5H A;  2XJR A;  4Q8L A;  1QJX 2;  4OHW A;  3EQE A;  2J1E A;  1EAH 2;  3H8U A;  3HNY M;  1DGW A;  1R09 2;  2RJL A;  4DXR A;  5F7U A;  3ZN6 A;  2HLE A;  1UXZ A;  1JI6 A;  4Q29 A;  1AYN 3;  4QGL A;  1DQ1 A;  2BTV C;  5F5A A;  1CD3 G;  5F5I A;  3U78 A;  2FDK A;  1IPS A;  4P5H A;  2GNM A;  1RMU 1;  2A7A A;  3CBN A;  2VEC A;  4DFS A;  3VUO A;  1TEI A;  2GH2 A;  5C4W C;  1ZBA 2;  2P34 A;  4C1X A;  1S2E A;  1O8S A;  4WM7 C;  4Y5T A;  2ORX A;  1VBD 2;  3WQB A;  1VRH 3;  4BB3 A;  2HKX A;  4CU7 A;  1ZBE 1;  3H1Y A;  3KSC A;  1RUF 2;  3OPZ A;  2DUO A;  2WN2 A;  2WNU C;  4QPG C;  1ZYB A;  3P3N A;  4OQ9 A;  1HXS 1;  2UYA A;  3FWE A;  5ACA 3;  1Z0H A;  1PZ9 A;  3FX3 A;  3VBS B;  4Z92 B;  4RHV 1;  5JI7 A;  2OUH A;  5FPV A;  4Q4W 2;  3K48 A;  2P5B A;  2Y6G A;  4W6X A;  2WAB A;  3AJY A;  2QTW B;  3ST7 A;  3NL1 A;  4LQR A;  1OUR A;  1HW5 A;  3H3U A;  1POV 3;  3WW2 A;  3SEP A;  3TEX A;  4ZU5 A;  3VD5 A;  3O1P A;  1HLC A;  2E53 A;  1H1M A;  4QDS A;  3WVJ A;  2QZ2 A;  1OA4 A;  4A3X A;  1H2K A;  1JMU B;  4HLT A;  5FLI A;  1PK6 A;  5LY2 A;  1EV1 2;  2VY0 A;  3AMQ A;  4UXA A;  4YZ2 A;  3PVO A;  1X82 A;  4QKN A;  3DN7 A;  4P9J A;  5IWF A;  3LA7 A;  2WUH A;  3AVS A;  5A7Q A;  3MUZ 1;  5A7O A;  5FO9 B;  2P6C A;  5L7O A;  1WW4 A;  5FZ0 A;  2PYT A;  5BNP C;  2RDQ A;  3RFR A;  2VU9 A;  4X8P A;  1NUK A;  5LA9 A;  3VBO A;  2VJX A;  3N9M A;  3WP3 A;  3WF1 A;  4DY5 A;  1XYO A;  2WNO A;  3JXS A;  3KT7 A;  4QKB A;  5FP4 A;  1W28 A;  3BYW A;  5FO7 B;  4CDQ B;  4Q4Y 2;  3BUC A;  2R16 A;  4XDO A;  3N35 A;  4QQH A;  3NJV A;  1VBA 2;  2WNE A;  3AMP A;  3OPT A;  1XU2 A;  4FP2 A;  4RR3 C;  5CKM A;  1W6Q A;  1W39 A;  2B9V A;  2ILM A;  4XUO A;  4DIN B;  3NV4 A;  4ES8 A;  4XTM A;  1AX0 A;  3RZG A;  5L9R A;  4WBB A;  1PMJ X;  1AR9 2;  1XE7 A;  4AG4 A;  2WSV A;  3VDD A;  2EXK A;  3WXP A;  4CEY C;  4Q5O A;  4HON A;  1RVF 2;  3M70 A;  1KXG A;  3PUS A;  1D2S A;  4ASL A;  4QB1 A;  4OLL A;  4S2G A;  5FP9 A;  5CB7 A;  5HCH A;  2ZPX A;  4LO5 B;  2RS1 1;  1JYT A;  1AHS A;  3O0X A;  1IHM A;  4GAZ A;  5FK7 A;  1GOG A;  1W6P B;  4AED C;  2JG8 B;  2VUL A;  2WC2 A;  2XUE A;  5ANQ A;  5FPA A;  4FTB A;  1YI9 A;  3LA3 A;  5FDB A;  5A33 B;  1Z7S 3;  4K8F A;  2WFP A;  5FPX A;  3BN6 A;  2RVA A;  4AVS A;  5C4W A;  4D7T A;  3BVC A;  4GMP 0;  1BMV 1;  5FYB A;  2G19 A;  5HCF A;  4WM7 A;  4CXW A;  4RD7 A;  4UI9 L;  1ONA A;  5E16 A;  3MF9 A;  4XUT A;  2WII B;  1P8J A;  3CL1 A;  3PTR B;  2WNU A;  2IUW A;  2RHP A;  4FQZ A;  4QPG A;  1Y7B A;  5EYY A;  2ZX0 A;  4K1Z A;  5FZ6 A;  1RUF 3;  2FCV A;  3B00 A;  4LHN A;  1NE4 A;  2QZ3 A;  2WFF 2;  4G9S B;  4CU8 A;  5JAX A;  2HH9 A;  5AFB A;  3OB8 A;  1FXZ A;  1V70 A;  2HWF 1;  3DF0 A;  2AZ5 A;  2K2S A;  2W68 A;  1KDM A;  1OKO A;  3E5U A;  1UU6 A;  3M3O A;  4V1P A;  4EN7 B;  2DCZ A;  1VPH A;  3JU9 A;  3WHU A;  3VHR A;  1PO2 3;  3MIC A;  1RIR A;  2ARC A;  1VBC 3;  4RSU A;  5LCW L;  3MYX A;  4CCM A;  3OUI A;  4FOQ A;  5AVA A;  2PQS A;  5A7W A;  1SDD B;  3JD7 2;  3RDI A;  4ARX A;  1GYK A;  1HB2 A;  1M4W A;  2WWU A;  3JCI A;  4V2W A;  1EPW A;  5A7S A;  4AEK A;  2R0H A;  5BNP A;  1C57 A;  1ND3 B;  4AI9 A;  2Q1Z B;  4DOU A;  4XFB A;  4NN0 A;  3IN9 A;  4YM2 A;  3SNM A;  3TB0 A;  3RYR A;  2J1V A;  2Y6H A;  1LCL A;  1RUJ 2;  4LHS A;  5IJR A;  5C9A C;  2PN5 A;  3SHR A;  4Q4V 1;  1OFN A;  4YVW B;  4BDV B;  3H3Z A;  4HPK A;  5FYH A;  5FPU A;  4BPZ A;  4RR3 A;  3UES A;  4LKF A;  5G05 L;  4Y1V A;  1CIW A;  4KMQ A;  4HKW A;  3I2K A;  4URT A;  4QQO A;  1WA6 X;  3UNP A;  2JKX A;  2Q1M A;  5E89 A;  3POJ A;  1OXC A;  3JBG 3;  3RJ2 X;  2UWB A;  3BTZ A;  1H30 A;  4Q26 A;  1AR9 3;  4CEY A;  3IB3 A;  3K2O A;  4FPG A;  2RDS A;  3FL7 A;  4CUB A;  1BYH A;  4KWK A;  1TNR A;  4CDU C;  4NO4 A;  2JIC A;  4QPI C;  2BNM A;  5G04 L;  5JIU A;  5KXC A;  2R07 1;  2ZKL A;  5LA1 A;  1TNF A;  4KQ7 A;  5DDJ 1;  1NYW A;  3HMY A;  4JGZ C;  2X10 A;  2WLP A;  5GKA C;  1OUS A;  3O5S A;  2BVB A;  2J1T A;  3OCP A;  4Q27 A;  5FMO L;  4AED A;  2ZX3 A;  1QJE A;  1BCX A;  1AUY A;  1PMH X;  5IYY A;  1AJO A;  5BNN C;  3ZPY A;  4N90 A;  4AAX A;  4YM3 A;  4AXO A;  3ZXD A;  2BV4 A;  3OBA A;  2P2K A;  3HQR A;  3LB9 A;  5FZM A;  4XQ4 A;  4XFC A;  3B5L B;  2DUP A;  4ZS2 A;  1IG0 A;  4PLN A;  2P4E A;  3AP7 A;  2ZMK A;  4MSV A;  1KEX A;  1W2T A;  3O0V A;  2CAU A;  1BK1 A;  2PHX A;  5E8A A;  3VBU B;  4B3N A;  3O0W A;  1FX5 A;  1W03 A;  2XHN A;  4HN0 A;  1HDK A;  4TYS A;  2O8O A;  5J3U A;  1UU5 A;  2ET1 A;  3A7Q A;  3NNM A;  2E7T A;  2HWC 3;  3DEM A;  5IHR A;  5I93 A;  2VMG A;  1ULP A;  3FUQ A;  1JYX A;  2VGD A;  1NCR B;  1QOS A;  2WFF 3;  2O1Q A;  3RGB A;  3EO6 A;  2G9G A;  5DAQ A;  5C3S A;  2W39 A;  3UKT A;  1HRV 1;  1GNZ A;  3JUU A;  3LE0 A;  4OHV A;  5JXH A;  4QGN A;  3ZFF C;  4OVE A;  4QM8 A;  3NAP B;  1AVB A;  2WZE A;  1TME 3;  5F6L B;  3WG4 A;  3ZXF A;  5JR2 A;  2XG3 A;  3USS A;  1UF2 C;  1AR7 3;  4XBN A;  1VBB 1;  1RUD 3;  2EID A;  3LQC A;  4BK4 A;  4QHB A;  4QXB A;  1QDO A;  1GNY A;  1Q3E A;  1GOF A;  3NJY A;  1N1Y A;  3VBH C;  3CU7 A;  1R08 2;  3T2P A;  3O1V A;  2AC1 A;  1RYY A;  4NWV A;  4LJH A;  5FMD A;  2Z69 A;  1S1A A;  1LOC A;  3B01 A;  4XFH A;  1W6N B;  4WV8 A;  5C9A A;  4QDR A;  3OYW A;  1OHF A;  2OZJ A;  5JCT A;  2WSU A;  1WLW A;  3I97 A;  1QU0 A;  2DDU A;  4A7Z A;  1QWR A;  4Q4Y 1;  1V9U 3;  5D21 A;  5GLT A;  2NZ9 A;  1BKZ A;  1RUC 2;  2WZR 1;  1VMJ A;  2D98 A;  1EY2 A;  1SFY A;  3BI3 A;  1ULG A;  2MPF A;  1MR5 A;  3Q8C A;  4CTE A;  4R9B A;  4CDU A;  1JH5 A;  4DRR A;  2DYC A;  4DRV A;  2B42 B;  4PQ9 A;  4QPI A;  1SCR A;  3INA A;  2BFU L;  4DQA A;  5JPN B;  3NQH A;  3GGL A;  1O8P A;  4QX0 A;  2VNV A;  4JGZ A;  3ZN6 B;  3VHP A;  1E5S A;  1X9P A;  5BNN A;  1Y9G A;  4DMI A;  4HET A;  4LT5 A;  1GKB A;  2GN7 A;  3OTF A;  3T30 A;  5C33 A;  5FR3 A;  1LHO A;  1UIK A;  1LOB A;  3KGZ A;  2ZEZ A;  3N9L A;  5FCC A;  4AGG A;  4ZXE A;  4HSL A;  4Z2W A;  2AUY A;  1KD7 A;  1YQC A;  5KXB A;  1F2N A;  5C7G A;  2PEL A;  5BV6 A;  1VR3 A;  2R04 2;  4ITC A;  4GIQ A;  4LHK A;  5CFC C;  4NHM A;  4XUP A;  4JVA A;  2CWS A;  4LXL A;  2VUJ A;  3S7E A;  5DPN A;  2AH2 A;  1UY1 A;  1DLL A;  5TSW A;  1Y9Q A;  2WA3 A;  3H7Y A;  3I2H A;  3ACG A;  1RUE 2;  3AX4 A;  4EWE A;  4DUX A;  2A71 A;  2BEO A;  3UT0 A;  1Q8S A;  3USU A;  4I3G A;  5IVF A;  5DG2 A;  5AVP A;  1PO1 2;  3S57 A;  4M00 A;  4JRA A;  1OPO A;  4NAM A;  3D0S A;  3GZT B;  4ONU A;  4XIL A;  3VKO A;  2VZS A;  4IE0 A;  1YWK A;  3KVB A;  3M8L A;  4YGD A;  4NUB A;  3PVB B;  5LBC A;  4LOR A;  3WF0 A;  3ZFF A;  1PK6 B;  4XMI A;  2ZAB A;  4YGE A;  3N7M A;  1V6N A;  5FY8 A;  3T2T A;  5LY1 A;  4XUQ A;  1JYI A;  2D6K A;  1RHI 2;  1IQD C;  2H6B A;  3E97 A;  3LFI A;  4YG0 A;  2FMY A;  4OMD A;  1QQP 2;  2OW4 A;  5L7O B;  1QJY 3;  2EXJ A;  2JE9 A;  2RR1 3;  1LOF C;  2XQR A;  4FFI A;  3FBY A;  5FTT C;  2JDN A;  4COY A;  1BZW A;  4MXV A;  4PF5 A;  5GLV A;  1B09 A;  4IGP A;  3VBH A;  3WDV A;  3L2H A;  2V73 A;  3CZJ A;  1MS9 A;  2BWA A;  2WZ8 A;  3U10 A;  1OI6 A;  2R06 1;  3V0B A;  5JOY A;  1BEV 2;  4JRL A;  4E2G A;  4UBH A;  1RUJ 1;  1W6Q B;  2Y34 A;  5E1R A;  1MQT C;  1OT5 A;  4AFD A;  2VZ1 A;  1HB4 A;  5DAP A;  4R52 A;  4D7S A;  4LK7 A;  1G8W A;  4P9I A;  1CR7 A;  4GA9 A;  3VDD B;  4GB3 1;  2ZZJ A;  1OC1 A;  4ET7 A;  3OEA A;  1OD5 A;  1RUC 3;  4BU2 A;  5C8C B;  2RS5 3;  2YC0 A;  1YYN A;  2ZHM A;  3VL8 A;  1AX2 A;  2ZX4 A;  2K9Z A;  4DXZ A;  1CJP A;  1HKD A;  4QXH A;  2CY6 A;  3U37 A;  5F3G A;  3O14 A;  1WW6 A;  4B8E A;  1ZZ9 A;  2RE9 A;  4UW3 A;  1U5Y A;  2I45 A;  1MZ6 A;  3WNN A;  4XJ9 A;  1V6I A;  1FPN 1;  5C4W B;  5KHH A;  1T6G C;  1CAU A;  2W95 A;  2WS9 1;  3TEY A;  4FPL A;  4BA6 A;  4YGC A;  5FZ1 A;  3GZA A;  4WM7 B;  3RYK A;  3VBF C;  4PJY A;  1IS5 A;  1V6L A;  2YBP A;  4IV3 C;  2Q8O A;  1QJF A;  2VZQ A;  2VBP A;  4E8C A;  2Y0I A;  5IVB A;  1F35 A;  2WNU B;  4QPG B;  5FMC A;  2IZW A;  4XAC A;  4BJ0 A;  4DEQ A;  2W1U A;  1NCQ C;  5IW0 A;  3NV2 A;  5CFC A;  1KRI A;  1DG6 A;  1TMF 2;  2R04 3;  5BNQ A;  3VD9 A;  4MZU A;  5A1F A;  4BH9 A;  1O5L A;  1ZNP A;  1H1I A;  2X29 A;  4HFS A;  1V6O A;  4A45 A;  2W9X A;  3C2U A;  1GFF 2;  5FXV A;  4AHW A;  2RS3 2;  3BU7 A;  3C7F A;  3FJS A;  3HIF A;  4MGY E;  4ZON A;  5C3O A;  1DZR A;  3ME2 A;  4ISR A;  1PNG A;  1H8V A;  1PO1 3;  3HVD A;  4YRD A;  2VOK A;  1VIW B;  4M3C E;  1DQ4 A;  2BYV E;  4MOA A;  1GP4 A;  1AYM 1;  1B35 B;  2FDF A;  2XH6 A;  3CZU A;  1RTV A;  2ID4 A;  5JUV A;  3ZIX A;  1J3R A;  3LZZ A;  4LO7 A;  5A7W B;  4FSJ A;  1K42 A;  1LUL A;  2WYS A;  3J7M A;  1NZI A;  2F4L A;  5EQU A;  3AYC A;  5C71 A;  3SXW A;  2E7A A;  1NA1 C;  4M01 A;  1SQ4 A;  2D7F A;  2E7Q A;  1QQP 3;  1LOF A;  5CYY A;  5BNP B;  3TN9 2;  4CUA A;  2VMF A;  3HAG A;  4AQ2 A;  4BQ1 A;  3B02 A;  4AVA A;  2OII A;  1W9Y A;  1ND3 C;  4S2F A;  4G3Y C;  3VKL A;  1FMD 2;  3R0R A;  4KH9 A;  4CCK A;  2BPA 2;  4CXX A;  4FPF A;  1GIC A;  2DVA A;  4HPK B;  4LE3 A;  2XB6 C;  4FPC A;  4RR3 B;  4YVW C;  4CXY A;  4K21 A;  1MQT A;  3D0J A;  5H9R A;  4LK6 A;  5FYY A;  2HWE 2;  3V65 A;  2QQI A;  2Y60 A;  1F5F A;  1RXF A;  3K4Z A;  4QM9 A;  1AXZ A;  3B3Q E;  2PLV 2;  4CEY B;  2F17 A;  3PU3 A;  3VD7 A;  1RXG A;  2VNG A;  4JC1 A;  3OGG A;  2VUC A;  5DN2 A;  2Q8C A;  1X33 A;  4IEZ A;  4S2D A;  2WJS A;  2QUO A;  3FZ3 A;  4NRP A;  2IWG B;  2XWJ B;  3FLT A;  3O1U A;  1W99 A;  3NNJ A;  4D8M A;  3ZYJ B;  3CIH A;  2FMD A;  3LSD A;  4LBM A;  3AFG A;  4OFG A;  2FHR A;  4JKL A;  5FIX A;  4AED B;  3M4F A;  5FY9 A;  3DXT A;  1Y9M A;  3J9S A;  4XXP A;  3SKV A;  4NAO A;  1W0P A;  3W21 A;  2GC1 A;  4A6O A;  1RMU 2;  3EJK A;  2JD9 A;  3WDT A;  2EF6 A;  3KM5 A;  3MO4 A;  1QOO A;  3U1X A;  1LU2 A;  2VCA A;  1SFN A;  1DU3 D;  3I59 B;  4M3C A;  3ILR A;  4GWM A;  5C5T A;  1UOG A;  1O3Q A;  1UX6 A;  3UV9 A;  2FDJ A;  2RMU 1;  3VBF A;  3NRU A;  1ZBE 2;  4NJ4 A;  5KWR A;  4IV3 A;  5EIY B;  3AVR A;  4UW5 A;  1HXS 2;  2CSG A;  1COV 1;  1DZT A;  4JDN A;  3POE A;  4P9Y A;  5GLZ A;  3VHN A;  4D6S A;  1NCQ A;  2J22 A;  4RHV 2;  3S0M A;  1J1T A;  3H8X A;  3OGS A;  3VBU C;  1RUG 1;  5ANN A;  3WQ1 A;  3ZXL A;  5FZO A;  2ZHL A;  3W20 A;  4FVV A;  4D6R A;  1TMF 3;  4FCA A;  5LEJ A;  4FP3 A;  4FPH A;  5LEK A;  2UYB A;  1LOD A;  2LM3 A;  5EZW A;  3OD0 A;  1ENS A;  2JDY A;  2BBV A;  1KQR A;  4AF9 A;  4DXT A;  5L36 A;  1QGL A;  1LEC A;  3NAP C;  5LAS A;  4XTP A;  3SKJ E;  1PHM A;  3ZYF A;  3N9O A;  3WF4 A;  3ZXK A;  4GD4 A;  5LB6 A;  3G7D A;  4MXW A;  3K51 A;  4JQR A;  4FTE A;  1VMF A;  3N9N A;  1NA1 A;  4FOY A;  3HWJ A;  4FPY A;  4ZHN A;  4L97 A;  4KWL A;  4EN6 B;  5CG9 A;  2ZMN A;  2ARX A;  5JPM B;  5IAT A;  1ND3 A;  3TN9 3;  4XCA A;  5C9A B;  1GMM A;  1KIT A;  3OYW B;  1UN1 A;  4QB6 A;  4X6R B;  2VQT A;  3PIG A;  4GKX A;  3AKP A;  3BPS A;  4LMF A;  2FDI A;  1F15 A;  1WME A;  3O1S A;  1UY0 A;  5CVR A;  5FY4 A;  2CYF A;  4Y4Y A;  4YVW A;  5AC9 1;  4O61 A;  4HZF A;  4QPY A;  1O5U A;  5GLW A;  4XMA A;  1W2U A;  1RL3 A;  3KV6 A;  3ACH A;  5IVY A;  5C3P A;  2PFW A;  4GXL A;  2WWS A;  5KC6 A;  1WMF A;  3RYP A;  3J8F 3;  2XOM A;  3S7I A;  5C8W A;  4YLZ A;  4CDU B;  2PLV 3;  3IAQ A;  4AYU A;  5JWP A;  4QPI B;  3WUC A;  4ZY9 A;  3I3M A;  2YFZ A;  2RS1 2;  3JB8 A;  4JGZ B;  4NWW A;  1YFW A;  5EJ1 B;  1CES A;  2Z2S B;  3ILN A;  4B29 A;  1VJ2 A;  2HBT A;  3LEI A;  4MLO A;  3POI A;  1W06 A;  4WZC A;  4GH4 B;  2J1U A;  2KA3 A;  4R4X A;  1SBE A;  3OOX A;  1AR6 3;  2ADE A;  5JSR A;  2VZ3 A;  1UPI A;  1JYV A;  1BMV 2;  2CDO A;  5A70 A;  3OEB A;  4QAW A;  5CBL A;  3RRD A;  5F3I A;  2G1M A;  4ERO A;  1D4M 1;  1HN1 A;  4U36 A;  5FZA A;  1PVC 1;  1QIQ A;  4CP1 A;  2WBK A;  1ZBE 3;  5BYN A;  4FO9 A;  3GZU C;  4JHT A;  3QH7 A;  4IW3 A;  1LED A;  4YW3 A;  2XBO 3;  1OF3 A;  5KC5 A;  3VBU A;  2YY1 A;  2B46 X;  3TEW A;  1ZRD A;  2HWF 2;  2DTW A;  4FQ4 A;  2NMN A;  4AEM A;  4PIY A;  1Q5O A;  1C4R A;  4XFA A;  5H9P A;  3USU B;  1WGP A;  1C8M 3;  1DGW X;  4UWD A;  3OY8 A;  2KXL A;  2DVB A;  1QXJ A;  5LBB A;  4JX0 A;  3ZFF B;  4Z07 A;  5DUX A;  3SH5 A;  1K5J A;  3S5A A;  2HWD 1;  4LEJ A;  5LZ6 A;  1RUI 1;  2GSY A;  2MHF A;  4Q4X 3;  1DQ0 A;  4XET A;  3NAP A;  4BQX A;  4ASM B;  1MVQ A;  4NRQ A;  4Z1V A;  1WA4 A;  2NPI A;  2OPK A;  3DYM A;  3THT A;  3U4S A;  2Q4S A;  2X05 A;  3KV5 A;  4D7Y A;  4H3W A;  3O12 A;  4JTO A;  4JDO A;  5FOJ B;  4KG0 A;  3QAC A;  3BGA A;  1XQN A;  5ERL A;  1YEW A;  3WW1 A;  5EJ3 A;  2CDP A;  1E5R A;  3OBT A;  3R4U A;  3L9J T;  4LA3 A;  3ZVX A;  5HXM A;  3V0B B;  3T1M A;  1AX1 A;  5A32 A;  1W6N A;  1AR8 1;  1VAV A;  3AP4 A;  1JU3 A;  4CP9 A;  3LPF A;  2ZX2 A;  3VZJ A;  2RJK A;  3WCS A;  5JZG C;  5FZB A;  4DEV A;  2YB7 A;  3MFC A;  4QQP A;  3RWK X;  3H8R A;  3WNO A;  5KXE A;  5APA A;  1DYP A;  2R07 2;  1AL2 3;  4DPN A;  5DDJ 2;  1YQ5 A;  1XSR A;  4OZO A;  4Y26 A;  1Z78 A;  5C8C C;  2CV6 A;  2Y64 A;  1PVX A;  3T2Q A;  3N4M A;  3ZSL A;  2IFW A;  1RUH 1;  3GHM A;  3H9A A;  1MPX A;  1ZRI A;  4GJZ A;  4IEP A;  2RG4 A;  1BJQ A;  3WQ7 A;  2TBV A;  3ZR5 A;  4MGZ E;  1CAU B;  3UL2 A;  1SCS A;  4CCJ A;  1YNA A;  2AR6 A;  2P6H A;  1XNB A;  2Q5T A;  3SMH A;  4H7M A;  2P3Y A;  1MEC 3;  5FYU A;  2BQP A;  2ZGU A;  5CFC B;  4IEQ A;  5EXO A;  1VAM A;  4DUV A;  1XB9 A;  4EN8 B;  3ZKU A;  4AI1 A;  1UZ0 A;  3TYJ A;  4FOV A;  2VZR A;  3C7O A;  4NIA A;  1HRV 2;  2HWF 3;  3MW3 A;  2YDE A;  3KD4 A;  3TRS B;  1PGL 1;  2FQP A;  4P02 B;  2QQP A;  2D93 A;  1JZ6 A;  1GLH A;  3IMM A;  3MHZ A;  3RZH A;  1DGR N;  2LAL A;  2R7E B;  5EFU A;  4S2H A;  4J6G A;  1B35 C;  2JDK A;  1VBB 2;  1GV9 A;  2HBU A;  2VZO A;  1UXX X;  1W8O A;  1URX A;  5FPL A;  2VCM A;  1XYP A;  1MVE A;  3LSE A;  2XJP A;  5T54 A;  1O4T A;  4W4Z A;  4P00 B;  2HJI A;  4KU7 A;  1WLT A;  2OX0 A;  1S0I A;  3CJX A;  2DBN A;  1OQ1 A;  1WMX A;  4CDW B;  2VZP A;  3LGR A;  1FOD 1;  2J1S A;  1ODM A;  5BPX A;  1KDK A;  2RM2 1;  1GBG A;  4CEW C;  1D0H A;  4RQP C;  2XKP A;  4AWD A;  3OUH A;  4Q4V 3;  1CZV A;  1KFX L;  2HWB 1;  2JB8 A;  2HYX A;  3AC0 A;  1MQT B;  3I3E A;  5FY1 A;  3ZSK A;  3LWC A;  5CAD A;  2YBK A;  5JVV A;  3VZK A;  1J3P A;  1CAX A;  4I01 A;  3FHI B;  2WZR 2;  3HQU A;  3LDB A;  1SDW A;  1SG3 A;  2QBX A;  5HV4 A;  3AYE A;  2DF7 A;  4YM1 A;  3ZOI A;  5JZG A;  4C0H A;  4NIH A;  2D6O X;  3UGH A;  2R0F A;  3TNQ A;  4TTG A;  4PI2 A;  3CO2 A;  4WM8 C;  3UK9 A;  4E8D A;  1OFS A;  1OLR A;  1CPN A;  1SMV A;  5A6Z A;  5C8C A;  5I8T A;  2MNG A;  1OOP C;  1Q56 A;  3WDX A;  1GQG A;  5DXD A;  3AYA A;  4IGO A;  1OD3 A;  2ARE A;  4JHZ A;  1RC6 A;  3RZZ A;  2QQJ A;  1QJX 3;  3BOW A;  1EAH 3;  3MPB A;  4QHO A;  4EN9 B;  2H0B A;  1R09 3;  4M3C B;  1JHN A;  3GNE A;  4XBQ A;  4Y1X A;  4HVR A;  1I5Z A;  2VMC A;  5A6Y A;  5JSP A;  5I0T A;  1FT9 A;  3VBF B;  3W58 A;  1FV3 A;  2OZ6 A;  1UX7 A;  4IV3 B;  3JQX A;  5FWJ A;  1DFQ A;  1S0E A;  4Y24 A;  3AKS A;  3CKH A;  3CEW A;  1DZQ A;  1XXN A;  3AP9 A;  5IVC A;  1REF A;  1ZBA 3;  1GWL A;  1NCQ B;  2QDN A;  4QU2 A;  3AP6 A;  1VBD 3;  3KWV A;  2EAK A;  3K3N A;  4LE4 A;  4YG6 A;  4QKF A;  5FZO B;  1VRB A;  2JIJ A;  5GLU A;  1LRH A;  1NT0 A;  3AP5 A;  2VC9 A;  2XL9 A;  4ATE A;  4CCN A;  1UQX A;  3PU8 A;  4IE4 A;  4CCL A;  1AYN 1;  3T0D A;  2YGL A;  5DQ0 A;  1HQL A;  4Q4W 3;  4AI2 A;  4XJ8 A;  4YW1 A;  1H4G A;  1AXK A;  1ZA7 A;  1XU1 A;  5FP8 A;  3ZXG A;  3ZYP A;  2C6S A;  2VBD A;  4HK8 A;  1Y43 B;  4M0H A;  2Y6F A;  3NNL A;  2BGP A;  1VAL A;  3BKZ A;  1B35 A;  1VRH 1;  2V5Y A;  3DKQ A;  3HD8 B;  2BBA A;  4MXW B;  3MBW A;  4XF3 A;  1F5J A;  1W0N A;  3B69 A;  2ZGO A;  1VBB 3;  4C90 A;  1NA1 B;  5ACA 1;  1JOJ A;  3VN4 A;  1EV1 3;  3LF7 A;  1L3J A;  2XJT A;  4KWU A;  2DTY A;  2XVG A;  4BM8 A;  1CZS A;  4I0A A;  1A78 A;  5T5P A;  3S6P A;  2R06 2;  4P14 A;  3WOG A;  3MZH A;  5FZC A;  1LB2 A;  1E5H A;  1F4H A;  3CF6 E;  5JIA A;  3W5M A;  4CEW A;  4EV0 A;  4RQP A;  5AFE A;  1HX6 A;  3S5Q A;  1XNC A;  4D6Q A;  2GMM A;  4I0W B;  4NHY A;  3LIG A;  3GBW A;  4W6Y A;  5DAW A;  4MG2 A;  4I30 A;  5FZ7 A;  4B4P A;  2QQL A;  4Q4Y 3;  1I9R A;  4YAR A;  3T09 A;  4GB3 2;  3CDZ B;  2VTX J;  2LTN A;  4AE2 A;  2Y6L A;  1VBA 3;  4IEW A;  1EUT A;  4Q2F A;  3LDR A;  2XPJ A;  1DLC A;  4OHY A;  2AGS A;  2WZR 3;  3IPV A;  4Y22 B;  1O6U A;  2W08 A;  4AVT A;  3I49 A;  2GND A;  2IXC A;  1PIV 2;  3PUH A;  4WM8 A;  3HOB A;  4CRQ A;  4C91 A;  3KMH A;  5I0S A;  3DXU A;  1RVF 3;  5DG1 A;  5J1X A;  4NVP A;  2JG9 C;  1OOP A;  4E4D X;  5FYZ A;  1AXY A;  1NXD 1;  5KHJ A;  4XDP A;  5J7M A;  3HNM A;  1H2N A;  1MS0 A;  1YUD A;  3GYD A;  3KQR A;  4C8D A;  2OUJ A;  2XJU A;  4GH4 C;  1YFU A;  1FPN 2;  5FP3 A;  1JYW A;  2WS9 2;  1ZZ6 A;  2D5F A;  4PIZ A;  2AYH A;  1YC6 1;  4MGQ A;  4OUL A;  3DGT A;  5K0U C;  1SAC A;  5IK7 A;  3WCR A;  3I59 A;  4IV1 C;  3IZO A;  4XAA A;  3OG2 A;  2DCT A;  1GOH A;  4CDX B;  3AZV A;  3N7K A;  4XPV A;  3VBR C;  4IND A;  3VDA A;  2IVJ A;  4TZD A;  2UWC A;  4CSW A;  2AEY A;  1U0A A;  1SZB A;  1VBE 1;  3IM0 A;  3MLJ A;  1BVV A;  2QQU A;  1SLC A;  5IVJ A;  1YRZ A;  3THP A;  4LKS A;  3OY8 B;  3PL0 A;  4FFF A;  3WNP A;  2BW8 A;  1Z7S 1;  3VZO A;  1WKY A;  1YQ8 A;  4XHX A;  3AM2 A;  5GZG A;  1AYM 2;  4N43 C;  5CFD C;  3HQX A;  1BLZ A;  2GC0 A;  4I02 A;  4MH0 E;  4BQ4 A;  4E4H A;  1UY4 A;  3P3P A;  3WF3 A;  5HBA A;  4OI0 A;  3VD3 A;  4EZH A;  1JHJ A;  5DUU A;  4QD2 A;  2LS6 A;  3GCW A;  3AZW A;  4CCO A;  4OI4 A;  1XC6 A;  2FBE A;  4YZ4 A;  3F2Z A;  4FBF A;  1Y3T A;  1XNT A;  3I2F A;  2HEY F;  2YZ4 A;  1W90 A;  3JD7 3;  2GN3 A;  4QXC A;  2IXL A;  2JDU A;  2X5I C;  4LNV A;  4QPW A;  1S0G A;  1OBN A;  3ZPO A;  4HKL A;  4YNI A;  4MV2 A;  5T5O A;  2ZX1 A;  5B4X A;  4BIF A;  5A32 B;  4N53 C;  1AL0 G;  5FZL A;  1PO2 1;  1L7L A;  4IE7 A;  1PX3 A;  2C0Z A;  3T0B A;  5FYM A;  5GZE A;  2VE1 A;  2UWA A;  2UUR A;  1RUJ 3;  1LHN A;  1DF0 A;  1VBC 1;  4CP9 B;  4H7L A;  4JTN A;  3AZZ A;  1HQN A;  3RMX A;  3LA2 A;  3WF2 A;  4W6W A;  1UMI A;  2W91 A;  4JV4 A;  4QX2 A;  2LRP A;  4J1W A;  3DPR B;  4M4R A;  2WWJ A;  4IXL A;  4OUE A;  5DAB A;  3WNK A;  2VMD A;  5I0R A;  4IQP A;  3HBZ A;  5LW9 A;  3AMN A;  2R1B A;  1LHU A;  1C5H A;  1QOT A;  3P5B A;  3ZYG A;  5DAV A;  2B45 X;  2JDP A;  4QMA A;  3WNL A;  5IK8 A;  2WQ4 A;  2JG9 A;  3OGR A;  1SLL A;  1NLR A;  4UFM A;  1WWY A;  3RMY A;  1LOA A;  4WZF A;  1JZ5 A;  3WX5 A;  4GH4 A;  2XL7 A;  3RI8 A;  5FXZ A;  1UYX A;  2ZGN A;  4GWN A;  1W04 A;  1WZX A;  4MHU A;  3F95 A;  4LBL A;  4MX3 A;  2YPJ A;  3PLQ A;  2RMU 2;  4IDZ A;  2QNK A;  4XJZ A;  5K0U A;  3T3Y A;  2WS9 3;  3JBG 1;  4XBL A;  4D0Q A;  1ULD A;  4IV1 A;  5FK8 A;  1COV 2;  5D8A C;  2W3J A;  3VBR A;  5F2S A;  1DQ2 A;  1ZZ8 A;  1RUG 2;  3QLQ A;  4HBN A;  4Y5S A;  4A41 A;  5CIS A;  3D4K A;  4IEU A;  1OPM A;  5J98 B;  4OZX A;  3PNA A;  5T5J A;  4F3J A;  5C6C A;  4YZ5 A;  1OVP A;  4YZ1 A;  1S4C A;  2HEW F;  2NP0 A;  4YW2 A;  3W5N A;  1RIN A;  3CHX A;  4N43 A;  5CFD A;  2JEC A;  3KLS A;  4K9S A;  2G4I A;  3NJX A;  3POF A;  1GUI A;  1EP0 A;  1JUI A;  1W8N A;  4Z2A A;  2J42 A;  1ULE A;  2GP5 A;  4AEJ A;  3WV6 A;  1DIW A;  3DCQ A;  4BXF A;  1MZ5 A;  3HN3 A;  3NKG A;  2SLI A;  1YLL A;  4W65 A;  4XF9 A;  4Y1Y A;  5A3O A;  2EXI A;  2WLQ A;  3ES1 A;  1IZ3 A;  3O1T A;  4IL7 A;  2HWC 1;  1X9T A;  3WT3 A;  2X5I A;  3WIN E;  1IPK A;  2XJV A;  4EWD A;  2PAK A;  1W9F A;  2VQ0 A;  3ACF A;  3SC7 X;  3AJZ A;  4JAA A;  1FNY A;  2MEV 1;  4CDW C;  1W2N A;  1XNK A;  1R08 3;  2VL4 A;  4N53 A;  5AC9 2;  3PME A;  1UYZ A;  3PMS A;  2E26 A;  3LOI A;  4LHL A;  1SEF A;  2VXJ A;  4Q0Q A;  4WVM A;  4K20 A;  3NST A;  2CGN A;  2PTM A;  3Q8A A;  5IFP A;  1CAX B;  5JXG A;  3V0A A;  3KF3 A;  3KHB A;  2VG9 A;  1TME 1;  4NOT A;  3PJY A;  3DYP A;  1KS4 A;  3AK0 A;  1DQ5 A;  2VNR A;  2QE3 A;  1AR7 1;  4MVT A;  5JZG B;  4AHZ A;  3WEZ A;  1UOJ A;  4IE6 A;  1S0C A;  4CE8 A;  1JZ4 A;  2Q8D A;  1CGP A;  1CON A;  5FPB A;  1UOF A;  2EIB A;  1XYN A;  3LD8 A;  1OQE A;  2I07 B;  3IKW A;  1LOG A;  2O14 A;  3AL5 A;  5HI0 A;  4OQ8 A;  1G6N A;  1SBF A;  2V4V A;  1WLC A;  2ERF A;  1PIV 1;  4HVO A;  3K77 A;  4O9G A;  5KHG A;  3ASI A;  4XAE A;  2PA7 A;  3LDK A;  4DY3 A;  5FZ8 A;  5A6Q A;  4AGV A;  4BZ4 A;  2ZS6 B;  1VB2 A;  1V9U 1;  1VP6 A;  4N9H A;  3T1L A;  5K9Y A;  4YFW A;  2OQ6 A;  4PBP A;  1G9A A;  4XF0 A;  1NE6 A;  4TLF A;  5FZH A;  1D4M 2;  2ES3 A;  2X53 S;  1PVC 2;  2RMU 3;  1MAC A;  4MGI E;  1STM A;  4CZS A;  2CGP A;  1H1A A;  5D8A A;  2B9U A;  5FZ4 A;  1F4A A;  4JKK A;  5FJK A;  4ASK A;  4F7Z A;  4RS5 C;  5JXJ A;  3O1O A;  1QHD A;  4M0N A;  1SFP A;  1WCU A;  1UZW A;  5CKN A;  3UJQ A;  3I3D A;  1YIP A;  4AOC A;  4Y20 B;  4B4Q A;  2GZW A;  3OGJ A;  5J37 A;  4L92 A;  3VB9 A;  5CAZ A;  5HV0 A;  4TLG A;  4XEZ A;  2A3W A;  2EAA A;  4KGQ A;  1LU1 A;  1RUE 3;  1TVG A;  3DUI A;  3R6S A;  2HWD 2;  1RUI 2;  1GR3 A;  4QX3 A;  3OUJ A;  4XZP A;  2Z79 A;  1A3K A;  1TZO A;  2GC2 A;  1PZ7 A;  1NLS A;  1W05 A;  2PQQ A;  5B2G B;  2VUA A;  2W0X A;  2YC2 A;  5DUW A;  1IGO A;  4LTA A;  5JMC A;  5T50 A;  1UAI A;  4TN7 A;  1HV1 A;  2DUQ A;  1I3H A;  2ORZ A;  3JQW A;  4LA2 A;  4NHL A;  3E6D A;  4GJY A;  5A3N A;  1RHI 3;  3HEI A;  2QQV A;  1IQA A;  3EBR A;  4FXK B;  2HEV F;  3N36 A;  4K6B A;  4P08 A;  2PAM A;  1JZ2 A;  3FMG A;  2Q30 A;  3ON7 A;  1CX1 A;  4Q1R A;  2QFE A;  4ORF A;  2VTX A;  4RQP B;  2Q1F A;  1UY2 A;  4AW7 A;  3FBM A;  4CDW A;  4CEW B;  1AR8 2;  2WN3 A;  2W5F A;  3IDB B;  1BBT 2;  2E31 A;  4XIO A;  1IS3 A;  3OD4 A;  2WNV B;  2ZEW A;  4A3Z A;  3TBD A;  2YYO A;  2VME A;  2GDF A;  2VD7 A;  1BEV 3;  1LJ7 A;  1Q8V A;  1NQD A;  4NPM A;  3VKN A;  5T55 A;  1POQ A;  1BQP A;  2D97 A;  1GZT A;  1JOB A;  3A22 A;  3IPV B;  4E9K A;  1HB3 A;  3WG2 A;  1QJY 1;  3EMR A;  2GME A;  3UET A;  3NW4 A;  4FPO B;  2RR1 1;  1H9P A;  4HXC A;  4WM8 B;  1VB4 A;  1LGB A;  2XVL A;  4MET A;  4M4P A;  4ISQ A;  4YGB A;  4IER A;  1OOP B;  3TEZ A;  1JS9 A;  1RUH 2;  5I91 A;  1N1S A;  1WBF A;  1L7R A;  2XXZ A;  5JMO A;  1UCX A;  1UL9 A;  3EB7 A;  2DVD A;  2D6L X;  2NN8 A;  3NMB A;  2SBA A;  2DCK A;  4NE9 A;  2ZGQ A;  3FUO A;  4SBV A;  2JDH A;  3QOP A;  1R1A 1;  4GAL A;  5D2A A;  4BHP A;  2YXS A;  2QKD A;  4XQD A;  2JJ6 A;  4MO3 M;  4AVV A;  2OS2 A;  1HJG A;  3BB6 A;  3PUI A;  4ZU7 A;  2VZV A;  3HPN A;  4QB2 A;  1KJR A;  1NOV A;  3T0A A;  1E5I A;  3WDY A;  2W52 A;  4XJA A;  4P9G A;  2W2I A;  4L8Q A;  1D4M 3;  3MI8 A;  4ZXK A;  2CL2 A;  1PVC 3;  2RS5 1;  1GZC A;  1QF3 A;  2XDV A;  4CDX C;  1DDL A;  4RS5 A;  2ZTN A;  1F8V A;  3QBQ A;  1ASJ 1;  1JU4 A;  3LEG A;  3ZX7 A;  1YJK A;  3I2I A;  3RNS A;  4A6S A;  4Y3O A;  4MYE A;  3FHQ A;  1HB1 A;  2WO3 A;  1AZD A;  3AKQ A;  1PGL 2;  2XUM A;  5BNO B;  4GMP 3;  3BAL A;  5SV5 A;  2P3J A;  2VOX A;  3AFK A;  3PVE A;  3TWI A;  1AF9 A;  1GWK A;  2W46 A;  3POS A;  1S0J A;  4DO0 A;  5FMO S;  1IKP A;  4FPJ A;  4AGR A;  4YVS C;  3KV4 A;  4XJW A;  3EHK A;  2RS3 3;  1OMI A;  3WNX A;  5H9Q A;  3WW3 A;  1LEM A;  2TNF A;  3I2G A;  4PCR A;  3G6J B;  1Q8O A;  2BVV A;  1US2 A;  2QQW A;  3WD5 A;  1H8T C;  3ZXE A;  2JDZ A;  4CCD A;  2DV9 A;  5F5C A;  5K4L A;  2V4A A;  4CYD A;  1HRI 2;  1FOD 2;  1OH4 A;  1WCK A;  1DHK B;  3GDB A;  5D1I A;  5GAL A;  1O3S A;  2RM2 2;  2UY8 A;  5ABJ B;  1U5I A;  2WA4 A;  1CVN A;  1NY7 1;  2YBS A;  3FFQ A;  3GM8 A;  2HWB 2;  5EWS A;  5DMY A;  2V5D A;  4BXS V;  5IAX A;  4BCU A;  3VKF C;  3ETQ A;  4QT6 A;  2YMZ A;  1FMD 3;  1GQP A;  4IEO A;  3I54 A;  4XJU A;  1AR8 3;  2E9Q A;  4FPK A;  2RJ2 A;  1DYK A;  4E2S A;  4EJR A;  3BPZ A;  3FE5 A;  5F39 A;  5EHD A;  3ZO0 B;  1K3I A;  2IFR A;  2Y6J A;  4UFJ A;  1NKG A;  4HAN A;  4OUS A;  3M2M A;  1CWP A;  2A6W A;  3NV3 A;  2HWE 3;  2GC3 A;  1C28 A;  3WG1 A;  4ZKT B;  3DPR C;  4HG6 B;  3ITQ A;  3KCC A;  1JTZ X;  4Y22 A;  2QQK A;  5JDB A;  1RIT A;  4LUK A;  3GBF A;  1JW6 A;  3OGV A;  2JG9 B;  2A6Z A;  2AAC A;  2CTV A;  3ZFE C;  1W3V A;  4BQ5 A;  3EYP A;  1GWM A;  4AVC A;  4EZ4 A;  3ETP A;  1QY4 A;  2C9A A;  1RUH 3;  1W8U A;  1UOB A;  5JR7 B;  3WLU A;  1TE1 B;  2XKO A;  4NIG A;  1K5M C;  2DFB A;  1X50 A;  2DVF A;  1LTE A;  4D69 A;  3KVA A;  5DZG A;  4FFH A;  1WW7 A;  5K0U B;  2ZOE B;  3MUY 1;  2BER A;  1RMU 3;  1N1T A;  4IV1 B;  3AKR A;  5H9S A;  1SPP A;  5BUV A;  1DGL A;  5LRS A;  1ZZC A;  1DQ6 A;  3T2O A;  3VBR B;  1H2L A;  1UYP A;  4Q0P A;  2A75 A;  4I3P A;  2BZD A;  4CDX A;  1V00 A;  2VVD A;  4AQS A;  3ATG A;  2DU1 A;  4XF4 A;  3AXE A;  1HXS 3;  2YFU A;  3RZK A;  3BTA A;  4A4A A;  2VO5 A;  4I2O A;  1ULF A;  1AYN 2;  1L7Q A;  4RHV 3;  1CN1 A;  2PHR A;  2GMP A;  2GAU A;  1UZY A;  3RI9 A;  3TNP B;  1R1Z A;  4M3C F;  2BRT A;  1JBC A;  3VZN A;  1WCD J;  4N43 B;  1X36 A;  4BWO A;  5CFD B;  3AYD A;  5I8Y A;  4H14 A;  5L9B A;  4RN5 A;  4YVS A;  5LA2 A;  2VOT A;  3PHM A;  5FY7 A;  5LWB A;  4BIO A;  1VRH 2;  1G9F A;  2WIN B;  1QEX A;  2EIG A;  4E4Z A;  2GNB A;  4X8N A;  4LOT A;  2YU1 A;  5ACA 2;  4PQQ A;  2QVS B;  1UU4 A;  5L19 A;  2NMO A;  1H8T A;  5CU1 A;  3ZM8 A;  3V64 A;  2QQO A;  3C8X A;  1RED A;  2X5I B;  4IEX A;  4R9D A;  1UKG A;  3DL3 A;  1XJA A;  3ELN A;  4COW A;  3M3Q A;  5FZ3 A;  5EPA A;  1FOD 3;  4N53 B;  2RM2 3;  1QMJ A;  2NM1 A;  2B5H A;  3IIA A;  3SEE A;  3OBR A;  4IEY A;  4WVM B;  4XC9 A;  3U07 A;  1O3T A;  2HWB 3;  3Q9O A;  3V0A B; 
#chains in the Genus database with same CATH homology
 3P6B A;  1YQ2 A;  1EUU A;  2WDB A;  2ZEZ A;  4ZXE A;  2BGP A;  3K46 A;  4CU9 A;  3ECQ A;  5C7G A;  2BBA A;  1NX9 A;  3MBW A;  1W0N A;  4XUP A;  5DPN A;  1UY1 A;  4KWU A;  3I2H A;  3ACG A;  1CZS A;  4DUX A;  3THD A;  2YC4 A;  1F4H A;  1JYN A;  3W5M A;  1XPW A;  4W8J A;  2VZS A;  3K75 B;  4LPL A;  3WF0 A;  1KGY A;  2QQL A;  1O59 A;  3T09 A;  3CDZ B;  4XUR A;  2Y6L A;  4XUQ A;  3ACI A;  1EUT A;  1IQD C;  1DLC A;  4PF1 A;  4OMD A;  3ABZ A;  3PUH A;  3HOB A;  2W47 A;  5J1X A;  2LW8 A;  1J84 A;  3CZJ A;  3HNM A;  2WZ8 A;  3VD4 A;  2E33 A;  2WAO A;  1JYW A;  4GWJ A;  4CUC A;  1OT5 A;  2VZ1 A;  4MGQ A;  2RV9 A;  2KD7 A;  3OG2 A;  1GOH A;  3FN9 A;  4ET7 A;  1I5P A;  3OEA A;  3VDA A;  2V72 A;  3FHA A;  4ARY A;  3U37 A;  4UOJ A;  1UWW A;  4LKS A;  5CZK A;  3WNP A;  4XUN A;  1WKY A;  3WNN A;  2W95 A;  1UY4 A;  3WF3 A;  3VD3 A;  1JHJ A;  5LA0 A;  4PT6 A;  2LS6 A;  1ULO A;  2VZQ A;  4QDQ A;  1XC6 A;  4E8C A;  3F2Z A;  3NNG A;  4DEQ A;  1H6Y A;  1XNT A;  3I2F A;  4BJ0 A;  2W1U A;  2W94 A;  3MV1 1;  3I2J A;  1JZ8 A;  3VD9 A;  1DP0 A;  4QPW A;  1WCQ A;  2Y6K A;  4ZZ8 A;  3J7H A;  2VTF A;  3WNM A;  4A45 A;  2W9X A;  5B4X A;  1K45 A;  3A23 A;  3C7F A;  5JXI A;  3T0B A;  1PX3 A;  3HNB M;  3DEC A;  1DYO A;  5FUI A;  1UY3 A;  4MOA A;  5HPO A;  3CZU A;  3WF2 A;  2ID4 A;  2J1A A;  4UAP A;  5JUV A;  1UMI A;  3IAP A;  2W91 A;  3K4A A;  4QX2 A;  1K42 A;  3WNK A;  2WYS A;  4M4R A;  4OUE A;  5C71 A;  2VMD A;  2Y8K A;  3C7G A;  5CYY A;  4CUA A;  3WNL A;  5IHR A;  2VMF A;  2VZU A;  3WSO A;  1XNA A;  3OGR A;  2OKX A;  2Z4F A;  2W92 A;  3C7E A;  4OMC A;  2WO1 A;  1JZ5 A;  1UYX A;  3III A;  4JKM A;  2WQ8 A;  2QQI A;  3DYO A;  1GU3 A;  3K4Z A;  2L9L A;  4D0Q A;  2W1W A;  1JZ7 A;  2EIC A;  4TXW A;  3VD7 A;  2X09 A;  5A1A A;  2W3J A;  2VCB A;  5DN2 A;  4A41 A;  1W99 A;  4D8M A;  3CIH A;  2QQM A;  1W9W A;  4JKL A;  3CQO A;  3W5N A;  3SKV A;  4BK5 A;  1K12 A;  1JZ3 A;  4A6O A;  2JD9 A;  2VCC A;  3MO4 A;  2VCA A;  3LPG A;  4Z2A A;  3NJX A;  1GUI A;  1W8N A;  3LEK A;  4QX1 A;  5B4N A;  2J7M A;  3GXU A;  3NRU A;  1UMH A;  2C9K A;  5EIY B;  3THC A;  3HN3 A;  3I3B A;  2J22 A;  2W1Q A;  3OGS A;  2ZEY A;  1D7P M;  2B4K A;  1TG7 A;  2J1E A;  4XVH A;  3HNY M;  3ACF A;  4P5Y A;  5F7U A;  4DXR A;  2VL4 A;  2HLE A;  1UXZ A;  1JI6 A;  2EIE A;  1UYZ A;  4A44 A;  2E26 A;  4DXT A;  5IFP A;  5JXG A;  3DYP A;  3SKJ E;  3T0D A;  1O8S A;  1R64 A;  2ORX A;  3WEZ A;  3WQB A;  1JZ4 A;  3WF4 A;  4CU7 A;  3CMG A;  2EIB A;  2WN2 A;  4DXS A;  2V4V A;  2JDA A;  3K77 A;  2VR4 A;  2Y6G A;  5C70 A;  2WAB A;  1W9T A;  1GMM A;  4QB6 A;  4LQR A;  2VQT A;  3SEP A;  3VD5 A;  4FI9 A;  2VZT A;  3HJR A;  1UY0 A;  4QDS A;  4KI5 M;  1SHW B;  4RYD A;  1NAE A;  3VDB A;  3ACH A;  2JE8 A;  3D3A A;  3C7H A;  2XOM A;  1F4A A;  4JKK A;  2WUH A;  3IAQ A;  5JXJ A;  3MUZ 1;  4ZY9 A;  2YFZ A;  1CIY A;  3I3D A;  1PX4 A;  5EJ1 B;  1NUK A;  2VJX A;  3LEI A;  3WF1 A;  3JXS A;  2J1U A;  2VQU A;  1TVG A;  2VZ3 A;  3NJV A;  4QX3 A;  2W1S A;  4XUO A;  2B9V A;  2ZEX A;  1JYV A;  2CDO A;  4GWI A;  2YC2 A;  1PMJ X;  3OEB A;  4QAW A;  4AG4 A;  2BGO A;  1HN1 A;  2W87 A;  2ORZ A;  2WBK A;  1UYY A;  3HEI A;  4QB1 A;  1OF3 A;  4P08 A;  1JZ2 A;  4GZ9 A;  1CX1 A;  1GOG A;  1UY2 A;  3E1F 1;  2WN3 A;  2W5F A;  4JX0 A;  2E31 A;  4A3Z A;  2ZEW A;  4A42 A;  3BN6 A;  2RVA A;  2VME A;  4L0P A;  2WAA A;  2C4X A;  2C26 A;  3A22 A;  4UI9 L;  4CVU A;  4XUT A;  2E32 A;  3DYM A;  3UET A;  1P8J A;  2X05 A;  3A21 A;  4M4P A;  4CU8 A;  3BGA A;  1L7R A;  3OB8 A;  5JMO A;  2CDP A;  2ZXQ A;  3EB7 A;  5HXM A;  2DCK A;  2YG0 A;  4MO3 M;  1JU3 A;  3PUI A;  2VZV A;  3HPN A;  4QB2 A;  5LCW L;  4OYU A;  3T0A A;  3LPF A;  2PQS A;  4DEV A;  2YB7 A;  1SDD B;  3WNO A;  4ARX A;  1JU4 A;  3LEG A;  3VDC A;  4OZO A;  3I2I A;  2Y64 A;  3T2Q A;  3FHQ A;  2WO3 A;  2J1V A;  2Y6H A;  1MPX A;  4LHS A;  5IJR A;  2W46 A;  4BDV B;  4XZU G;  4IUG A;  3UES A;  5G05 L;  4KMQ A;  3I2K A;  2QQN A;  3I2G A;  3UNP A;  2JKX A;  2XON A;  1CZT A;  1US2 A;  3IB3 A;  4CUB A;  3FL7 A;  5G04 L;  4DUV A;  1OH4 A;  5LA1 A;  3GDB A;  1UZ0 A;  2X10 A;  2VZR A;  3C7O A;  2J1T A;  3GM8 A;  5IYY A;  1PMH X;  2V5D A;  4BXS V;  5DMY A;  4P02 B;  1JZ6 A;  1GQP A;  4AAX A;  2RJ2 A;  1W9S A;  3OBA A;  1OF4 A;  2R7E B;  1K3I A;  2Y6J A;  5IFT A;  1NKG A;  2VZO A;  1UXX X;  1W8O A;  1KEX A;  4MAD A;  3T08 A;  4CU6 A;  4HG6 B;  2XHN A;  2QQK A;  2XQX A;  4W4Z A;  4P00 B;  3OGV A;  3A7Q A;  3P1I A;  3EYP A;  5I0D A;  4W50 A;  2VZP A;  3ETP A;  2J1S A;  1ULP A;  2WO2 A;  1JYX A;  1CZV A;  3AC0 A;  3I3E A;  5JXH A;  2HYX A;  3LE0 A;  4DUW A;  3MUY 1;  2BER A;  2WZE A;  5JR2 A;  1SG3 A;  2QBX A;  3T2O A;  2DCJ A;  2EID A;  4TTG A;  3LQC A;  2BZD A;  4BK4 A;  1BHG A;  3IDA A;  1GNY A;  4E8D A;  1GOF A;  2YFU A;  1T2X A;  3T2P A;  4ZZ5 A;  4A4A A;  2VO5 A;  1RYY A;  1L7Q A;  3K4D A;  1OD3 A;  4YPJ A;  4JHZ A;  2QQJ A;  4QDR A;  3I97 A;  1US3 A;  4RN5 A;  5LA2 A;  2DDU A;  2VOT A;  2VMC A;  5EJZ B;  1UX7 A;  4PQQ A;  3CKH A;  2VM9 A;  2J1R A;  3ZM8 A;  2QQO A;  3C8X A;  1J83 A;  1LNS A;  3NQH A;  3GGL A;  1O8P A;  1H6X A;  4QX0 A;  3MV0 1;  2VC9 A;  5DQ0 A;  3SEE A;  4MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...