4QBMA

Crystal structure of human baz2a bromodomain in complex with a diacetylated histone 4 peptide (h4k16ack20ac)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
106
structure length
106
Chain Sequence
SMHSDLTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain adjacent to zinc finger domain protein 2A
publication title Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qbmA00
4IORA 4YBMA 4NUDA 2L5EA 4NR7A 5DFDA 5E9YA 5IIDA 5C7NA 5EQ1A 3HMEA 4TS8A 3U5KA 4TQNA 5EA1A 5KTWA 5G4RA 5F1LA 5EISA 5COIA 4BW4A 2RI7A 4PTBA 4O72A 5DYUA 5EM3A 4MENA 4J0RA 4IR5A 5FE5A 4HXRA 3D7CA 5LVRA 3AQAA 5H1UA 5HJCA 5HFQA 5I7XA 5CQ6A 4LYIA 4MR4A 5EWCA 4MEQA 5FH6A 5ENGA 4HBWA 5HRVA 5CS8A 4KCXA 4YYGA 5CQTA 4A9OA 3JVJA 1F68A 2R0YA 4BJXA 4KV1A 4Y03A 4QBMA 4HXSA 4QC1A 4Q0OA 4CUPA 4XUBA 4YYHA 3TLPA 4OUFA 5FDZA 1ZS5A 3DWYA 4WHWA 2OUOA 5CRZA 4TT6A 4YYIA 2RNYA 4J1PA 5KHMA 3P5OA 4UYHA 5A5RA 4HXPA 4QYDA 3DAIA 5HENA 5KO4A 3UV5A 4Z6IA 5HRXA 5EP7A 5AD3A 3LQIA 4UIXA 4A9LA 4NR4A 4A9FA 5EWVA 4IOOA 4A9HA 4ZW1A 2R10A 5E74A 4HXLA 4QUUA 4QSTA 4Z6HA 4NS5A 4ZC9A 1EQFA 5ENFA 2DWWA 5D3SA 2RNXA 5LKXA 4QSVA 5D3LA 5FB0A 2L85A 4CUTA 4NQMA 5IGMA 3UV4A 3MXFA 4NQNA 5BT4A 2RS9B 4Q0NA 5CY9A 5F63A 3AADA 4YY6A 5C87A 1X0JA 3I3JA 5F3AA 4YATA 3G0LA 5I83A 5FE3A 3RCWA 4TU6A 3LQHA 5EWDA 4BHWA 5CGPA 5CUCA 4BW2A 2R0SA 4HBVA 5TCMA 4PS5A 5ENIA 3S92A 4F3IA 5JI8A 5A82A 5LUUA 3O35A 4YAXA 5H1VA 4UIVA 2G4AA 4QEVA 2LSPB 4QEWA 4LYWA 5EGUA 5FE4A 5ACYA 5EK9A 5FFVA 5II1A 4HXNA 4QY4A 3UVDA 4C66A 4LYSA 5G4SA 5FE8A 5I29A 5FFYA 5C8GA 1E6IA 5DKDA 5I1QA 3QZSA 2D9EA 5I88A 5LJ0A 2E7OA 5ENJA 5D26A 4QEUA 4CUQA 3GG3A 4QR3A 4LZRA 4N4GA 5D0CA 2WP2A 4NYXA 5L96A 5BT5A 5DKCA 4ALHA 5F36A 4NR8A 3MB3A 3Q2EA 5DY7A 4ALGA 5ENBA 4O78A 4UIWA 4NUCA 5L8UA 4HBXA 5CUGA 2DVVA 5CUDA 4NRCA 2R0VA 5FE7A 5CQ5A 4CL9A 4BW3A 2YYNA 5E9VA 5EU1A 4HBYA 3S91A 5H85A 2RNWA 4IR3A 5HQ5A 3O37A 3SVFA 2YEMA 5CP5A 5A5SA 3UVWA 2YELA 5DLXA 4O7CA 5EICA 3U5OA 4Z93A 4QSRA 4UIZA 5CQ3A 5LJ1A 2NXBA 4AKNA 4CFLA 4PKLA 5EVAA 2DKWA 4CUSA 1JM4B 2N9GA 3SVHA 4A9JA 4RVRA 2DVQA 5F5ZA 4LRGA 5CTLA 4UITA 5ENEA 2FSAA 5D7XA 2OO1A 4QC3A 2F6JA 3Q2FA 4X2IA 4UIUA 4MR6A 4TZ8A 5EWWA 4YYKA 4J0SA 5LKZA 5HQ6A 3UVXA 5D3NA 5FE1A 5L99A 4UYDA 4TYLA 1WUMA 4QSUA 4O7AA 5A5OA 2H60A 4YYJA 4MR3A 3U5JA 3IU5A 4A9MA 3NXBA 5IGLA 5FG4A 5A85A 5FFWA 4QR4A 2YQDA 4LZSA 5AMEA 5E3DA 2I8NA 5CFWA 4MR5A 5D3RA 5DYCA 4XYAA 5F25A 4TT4A 4WIVA 4A9NA 4YC9A 5DX4A 5A5NA 2GRCA 5KU3A 4A9KA 5F62A 4YY4A 5LJ2A 4LC2A 5LKTA 4YH3A 4YADA 2I7KA 3P1EA 4UYEA 5HLSA 4QYLA 5F60A 5A7CA 5IGKA 2F6NA 5EV9A 5D3TA 3ZYUA 5EPRA 3JVKA 4HXKA 5DYXA 1WUGA 3MUKA 3QZTA 4UIYA 3O36A 3LJWA 4IOQA 4N4IA 4NR5A 2RO1A 4PCEA 4OGJA 5FE0A 5FH8A 5EWHA 5HFRA 4NR9A 3P1FA 4YBSA 4HXOA 5A81A 3U5PA 4TU4A 3O34A 2DATA 5CRMA 2DVSA 4O75A 4TT2A 5J0DA 5HEMA 5I40A 5ENCA 5HELA 5HM0A 5DW2A 3HMFA 5DKHA 3HMHA 4O74A 5FE6A 5I89A 5A5QA 5F2PA 4HXMA 4MEPA 5IGNA 5E7DA 4NRAA 4O76A 2RFJA 5IBNA 4BW1A 2YDWA 5CU8A 5E0RA 3JVMA 5D3PA 2OSSA 4YYNA 4FLPA 4XUAA 4N3WA 4QNSA 5DBMA 3O33A 5LVQA 3MQMA 4QR5A 5LKUA 5EI4A 4YK0A 5CQ4A 4DONA 5FBXA 5C89A 5I80A 5CQ7A 5C85A 5TB6A 4QZSA 4O77A 4N4FA 4IR4A 5ETBA 5DFBA 3LXJA 4O70A 5E3GA 5CQ8A 4PY6A 5FE2A 2YEKA 4QSSA 4YYMA 4CURA 4TTEA 2D82A 4NYWA 5AD2A 2L84A 5A5PA 3QZVA 5JWMA 5E9KA 5CUEA 5E9LA 1JSPB 4A9IA 4NYVA 5D3HA 2DVRA 5KTXA 4Z1QA 2E7NA 5K29A 4XY8A 4UYGA 4E96A 4TZ2A 5DFCA 2YW5A 4NRBA 5HRWA 5DLZA 5DYAA 4O71A 4LZ2A 3G0JA 4CFKA 3K2JA 4A9EA 4LDFA 3LQJA 5FB1A 3SVGA 4QB3A 4QSXA 5CPEA 2WP1A 5II2A 5CQAA 4YABA 4YH4A 5D24A 5IG6A 5EPSA 3JVLA 4UYFB 5AMFA 4QSQA 3U5NA 4OGIA 5FG5A 4J3IA 2E3KA 2MJVB 5ENHA 4O7EA 5I7YA 4ZQLA 3UW9A 5F1HA 4PCIA 5E9IA 5E73A 4UYFA 4NUEA 5KTUA 4C67A 3UV2A 3MULA 4NXJA 5F61A 3UVYA 5H1TA 4QSPA 4XY9A 3U5LA 3IU6A 5BT3A 3U5MA 3FKMX 4O7BA 4QSWA 4KV4A 4N4HA 4GPJA 4IR6A 5L8TA 4CLBA 4YBTA 4NR6A 5ETDA 3ONIA 4YYDA 5C4QA 5D3JA 4CUUA 1N72A 4MEOA 5HCLA 5DW1A 4QUTA 5D25A 5CZGA 5L98A 5A83A 5EPBA 5HQ7A 5FE9A 5CUAA 3P1DA 3MB4A 4LR6A 4WHUA 3P1CA 4O7FA 2KTBB 5E9MA 5L97A 5FG6A 4Z1SA 5FH7A 5CUBA 5I86A
chains in the Genus database with same CATH superfamily
4IORA 4YBMA 4NUDA 2L5EA 4NR7A 5DFDA 5E9YA 5IIDA 5C7NA 5EQ1A 3HMEA 4TS8A 3U5KA 4TQNA 5EA1A 5KTWA 5G4RA 5F1LA 5EISA 5COIA 4BW4A 2RI7A 4PTBA 4O72A 5DYUA 5EM3A 4MENA 4J0RA 3D1BA 4IR5A 5FE5A 4HXRA 3D7CA 1ZKRA 5LVRA 3AQAA 5H1UA 5HJCA 5HFQA 5I7XA 5CQ6A 4LYIA 4MR4A 5EWCA 4MEQA 5FH6A 5ENGA 4HBWA 4AKHA 5HRVA 5CS8A 4KCXA 4YYGA 5CQTA 4A9OA 3JVJA 1F68A 2R0YA 4BJXA 4KV1A 4Y03A 4QBMA 4HXSA 4QC1A 4Q0OA 4CUPA 4XUBA 4YYHA 3TLPA 4OUFA 5FDZA 1ZS5A 3DWYA 4WHWA 2OUOA 5CRZA 4TT6A 4YYIA 2RNYA 4J1PA 5KHMA 3P5OA 4UYHA 5A5RA 4HXPA 4QYDA 3DAIA 5HENA 5KO4A 3UV5A 3ERRA 4Z6IA 5HRXA 5EP7A 5AD3A 3LQIA 4UIXA 4A9LA 4NR4A 4A9FA 5EWVA 4IOOA 4A9HA 4ZW1A 2R10A 5E74A 4HXLA 4QUUA 4QSTA 4Z6HA 4NS5A 4ZC9A 1EQFA 5ENFA 2DWWA 5D3SA 2RNXA 5LKXA 4QSVA 5D3LA 5FB0A 2L85A 4CUTA 4NQMA 5IGMA 3UV4A 3MXFA 4NQNA 5BT4A 2RS9B 4Q0NA 5CY9A 5F63A 3AADA 4YY6A 5C87A 1X0JA 3I3JA 5F3AA 4YATA 3G0LA 5I83A 5FE3A 3RCWA 4TU6A 3LQHA 5EWDA 4BHWA 5CGPA 5CUCA 4BW2A 2R0SA 4HBVA 5TCMA 4PS5A 5ENIA 3S92A 4F3IA 5JI8A 5A82A 5LUUA 3O35A 4YAXA 5H1VA 4UIVA 2G4AA 4QEVA 2LSPB 4QEWA 4LYWA 5EGUA 5FE4A 5ACYA 5EK9A 5FFVA 5II1A 4HXNA 4QY4A 3UVDA 4C66A 4LYSA 5G4SA 5FE8A 5I29A 5FFYA 5C8GA 1E6IA 5DKDA 5I1QA 3QZSA 2D9EA 5I88A 4AKGA 5LJ0A 2E7OA 5ENJA 5D26A 4QEUA 4CUQA 3GG3A 4QR3A 4LZRA 4N4GA 5D0CA 2WP2A 4NYXA 5L96A 5BT5A 5DKCA 4ALHA 5F36A 4NR8A 3MB3A 3Q2EA 5DY7A 4ALGA 5ENBA 4O78A 4UIWA 4NUCA 5L8UA 4HBXA 5CUGA 2DVVA 5CUDA 4NRCA 2R0VA 5FE7A 5CQ5A 4CL9A 4BW3A 2YYNA 5E9VA 5EU1A 4HBYA 3S91A 5H85A 2RNWA 4IR3A 5HQ5A 3O37A 3SVFA 2YEMA 5CP5A 5A5SA 3UVWA 2YELA 5DLXA 4O7CA 5EICA 3U5OA 4Z93A 4QSRA 4UIZA 5CQ3A 5LJ1A 2NXBA 4AKNA 4CFLA 4PKLA 5EVAA 2DKWA 4CUSA 1JM4B 2N9GA 3SVHA 4A9JA 4RVRA 2DVQA 5F5ZA 4LRGA 5CTLA 4UITA 5ENEA 2FSAA 5D7XA 2OO1A 4QC3A 2F6JA 3Q2FA 4X2IA 4UIUA 4MR6A 4TZ8A 5EWWA 4YYKA 4J0SA 5LKZA 5HQ6A 3UVXA 5D3NA 5FE1A 5L99A 4UYDA 4TYLA 1WUMA 4QSUA 4O7AA 5A5OA 2H60A 4YYJA 4MR3A 3U5JA 3IU5A 4A9MA 3NXBA 5IGLA 5FG4A 5A85A 5FFWA 4QR4A 2YQDA 4LZSA 5AMEA 5E3DA 2I8NA 5CFWA 4MR5A 5D3RA 5DYCA 4XYAA 5F25A 4TT4A 4WIVA 4A9NA 4YC9A 5DX4A 5A5NA 2GRCA 5KU3A 4A9KA 5F62A 4YY4A 5LJ2A 4LC2A 5LKTA 4YH3A 4YADA 2I7KA 3P1EA 4UYEA 5HLSA 4QYLA 5F60A 5A7CA 3D1DA 5IGKA 2F6NA 5EV9A 5D3TA 3ZYUA 5EPRA 3JVKA 4HXKA 5DYXA 1PUOA 1WUGA 3MUKA 3QZTA 4UIYA 3O36A 3LJWA 4IOQA 4N4IA 4NR5A 4AI6A 2RO1A 4PCEA 4OGJA 5FE0A 5FH8A 5EWHA 5HFRA 4NR9A 3P1FA 4YBSA 4HXOA 5A81A 3U5PA 4TU4A 3O34A 2DATA 5CRMA 2DVSA 3VKGA 4O75A 4TT2A 5J0DA 5HEMA 5I40A 5ENCA 5HELA 5HM0A 5DW2A 3HMFA 5DKHA 3HMHA 4O74A 5FE6A 5I89A 5A5QA 5F2PA 4HXMA 4MEPA 5IGNA 5E7DA 4NRAA 4O76A 2RFJA 5IBNA 4BW1A 2YDWA 5CU8A 5E0RA 3JVMA 5D3PA 2OSSA 4YYNA 4FLPA 2EJNA 4XUAA 4N3WA 4QNSA 5DBMA 3O33A 4AKIA 5LVQA 3MQMA 4QR5A 5LKUA 5EI4A 4YK0A 5CQ4A 4DONA 5FBXA 5C89A 5I80A 5CQ7A 5C85A 5TB6A 4QZSA 4O77A 4N4FA 4IR4A 5ETBA 5DFBA 3LXJA 4O70A 5E3GA 5CQ8A 4PY6A 5FE2A 2YEKA 4QSSA 4YYMA 4CURA 4TTEA 2D82A 4NYWA 5AD2A 2L84A 5A5PA 3QZVA 5JWMA 3VKHA 5E9KA 5CUEA 5E9LA 1JSPB 4A9IA 4NYVA 5D3HA 2DVRA 5KTXA 4Z1QA 2E7NA 5K29A 4XY8A 4UYGA 4E96A 4TZ2A 5DFCA 2YW5A 4NRBA 5HRWA 5DLZA 5DYAA 4O71A 4LZ2A 3G0JA 4CFKA 3K2JA 4A9EA 4LDFA 3LQJA 5FB1A 3SVGA 4QB3A 4QSXA 5CPEA 2WP1A 5II2A 5CQAA 4YABA 4YH4A 5D24A 5IG6A 5EPSA 3JVLA 4UYFB 5AMFA 4QSQA 3U5NA 4OGIA 5FG5A 4J3IA 2E3KA 2MJVB 5ENHA 4O7EA 5I7YA 4ZQLA 3UW9A 5F1HA 4PCIA 5E9IA 5E73A 4UYFA 4NUEA 5KTUA 4C67A 3UV2A 3MULA 4NXJA 5F61A 3UVYA 5H1TA 4QSPA 4XY9A 3U5LA 3IU6A 5BT3A 3U5MA 3FKMX 4O7BA 4QSWA 4KV4A 4N4HA 4GPJA 4IR6A 5L8TA 4CLBA 4YBTA 4NR6A 5ETDA 3ONIA 4YYDA 5C4QA 5D3JA 4CUUA 1N72A 4MEOA 5HCLA 5DW1A 4QUTA 5D25A 5CZGA 5L98A 5A83A 5EPBA 5HQ7A 5FE9A 5CUAA 3P1DA 3MB4A 4LR6A 4WHUA 3P1CA 4O7FA 2KTBB 5E9MA 5L97A 5FG6A 4Z1SA 5FH7A 5CUBA 5I86A
chains in the Genus database with same CATH topology
4IORA 4YBMA 4NUDA 2L5EA 4NR7A 5DFDA 5E9YA 5IIDA 5C7NA 5EQ1A 3HMEA 4TS8A 3U5KA 4TQNA 5EA1A 5KTWA 5G4RA 5F1LA 5EISA 5COIA 4BW4A 2RI7A 4PTBA 4O72A 5DYUA 5EM3A 4MENA 4J0RA 4IR5A 5FE5A 4HXRA 3D7CA 5LVRA 3AQAA 5H1UA 5HJCA 5HFQA 5I7XA 5CQ6A 4LYIA 4MR4A 5EWCA 4MEQA 5FH6A 5ENGA 4HBWA 5HRVA 5CS8A 4KCXA 4YYGA 5CQTA 4A9OA 3JVJA 1F68A 2R0YA 4BJXA 4KV1A 4Y03A 4QBMA 4HXSA 4QC1A 4Q0OA 4CUPA 4XUBA 4YYHA 3TLPA 4OUFA 5FDZA 1ZS5A 3DWYA 4WHWA 2OUOA 5CRZA 4TT6A 4YYIA 2RNYA 4J1PA 5KHMA 3P5OA 4UYHA 5A5RA 4HXPA 4QYDA 3DAIA 5HENA 5KO4A 3UV5A 4Z6IA 5HRXA 5EP7A 5AD3A 3LQIA 4UIXA 4A9LA 4NR4A 4A9FA 5EWVA 4IOOA 4A9HA 4ZW1A 2R10A 5E74A 4HXLA 4QUUA 4QSTA 4Z6HA 4NS5A 4ZC9A 1EQFA 5ENFA 2DWWA 5D3SA 2RNXA 5LKXA 4QSVA 5D3LA 5FB0A 2L85A 4CUTA 4NQMA 5IGMA 3UV4A 3MXFA 4NQNA 5BT4A 2RS9B 4Q0NA 5CY9A 5F63A 3AADA 4YY6A 5C87A 1X0JA 3I3JA 5F3AA 4YATA 3G0LA 5I83A 5FE3A 3RCWA 4TU6A 3LQHA 5EWDA 4BHWA 5CGPA 5CUCA 4BW2A 2R0SA 4HBVA 5TCMA 4PS5A 5ENIA 3S92A 4F3IA 5JI8A 5A82A 5LUUA 3O35A 4YAXA 5H1VA 4UIVA 2G4AA 4QEVA 2LSPB 4QEWA 4LYWA 5EGUA 5FE4A 5ACYA 5EK9A 5FFVA 5II1A 4HXNA 4QY4A 3UVDA 4C66A 4LYSA 5G4SA 5FE8A 5I29A 5FFYA 5C8GA 1E6IA 5DKDA 5I1QA 3QZSA 2D9EA 5I88A 5LJ0A 2E7OA 5ENJA 5D26A 4QEUA 4CUQA 3GG3A 4QR3A 4LZRA 4N4GA 5D0CA 2WP2A 4NYXA 5L96A 5BT5A 5DKCA 4ALHA 5F36A 4NR8A 3MB3A 3Q2EA 5DY7A 4ALGA 5ENBA 4O78A 4UIWA 4NUCA 5L8UA 4HBXA 5CUGA 2DVVA 5CUDA 4NRCA 2R0VA 5FE7A 5CQ5A 4CL9A 4BW3A 2YYNA 5E9VA 5EU1A 4HBYA 3S91A 5H85A 2RNWA 4IR3A 5HQ5A 3O37A 3SVFA 2YEMA 5CP5A 5A5SA 3UVWA 2YELA 5DLXA 4O7CA 5EICA 3U5OA 4Z93A 4QSRA 4UIZA 5CQ3A 5LJ1A 2NXBA 4AKNA 4CFLA 4PKLA 5EVAA 2DKWA 4CUSA 1JM4B 2N9GA 3SVHA 4A9JA 4RVRA 2DVQA 5F5ZA 4LRGA 5CTLA 4UITA 5ENEA 2FSAA 5D7XA 2OO1A 4QC3A 2F6JA 3Q2FA 4X2IA 4UIUA 4MR6A 4TZ8A 5EWWA 4YYKA 4J0SA 5LKZA 5HQ6A 3UVXA 5D3NA 5FE1A 5L99A 4UYDA 4TYLA 1WUMA 4QSUA 4O7AA 5A5OA 2H60A 4YYJA 4MR3A 3U5JA 3IU5A 4A9MA 3NXBA 5IGLA 5FG4A 5A85A 5FFWA 4QR4A 2YQDA 4LZSA 5AMEA 5E3DA 2I8NA 5CFWA 4MR5A 5D3RA 5DYCA 4XYAA 5F25A 4TT4A 4WIVA 4A9NA 4YC9A 5DX4A 5A5NA 2GRCA 5KU3A 4A9KA 5F62A 4YY4A 5LJ2A 4LC2A 5LKTA 4YH3A 4YADA 2I7KA 3P1EA 4UYEA 5HLSA 4QYLA 5F60A 5A7CA 5IGKA 2F6NA 5EV9A 5D3TA 3ZYUA 5EPRA 3JVKA 4HXKA 5DYXA 1WUGA 3MUKA 3QZTA 4UIYA 3O36A 3LJWA 4IOQA 4N4IA 4NR5A 2RO1A 4PCEA 4OGJA 5FE0A 5FH8A 5EWHA 5HFRA 4NR9A 3P1FA 4YBSA 4HXOA 5A81A 3U5PA 4TU4A 3O34A 2DATA 5CRMA 2DVSA 4O75A 4TT2A 5J0DA 5HEMA 5I40A 5ENCA 5HELA 5HM0A 5DW2A 3HMFA 5DKHA 3HMHA 4O74A 5FE6A 5I89A 5A5QA 5F2PA 4HXMA 4MEPA 5IGNA 5E7DA 4NRAA 4O76A 2RFJA 5IBNA 4BW1A 2YDWA 5CU8A 5E0RA 3JVMA 5D3PA 2OSSA 4YYNA 4FLPA 4XUAA 4N3WA 4QNSA 5DBMA 3O33A 5LVQA 3MQMA 4QR5A 5LKUA 5EI4A 4YK0A 5CQ4A 4DONA 5FBXA 5C89A 5I80A 5CQ7A 5C85A 5TB6A 4QZSA 4O77A 4N4FA 4IR4A 5ETBA 5DFBA 3LXJA 4O70A 5E3GA 5CQ8A 4PY6A 5FE2A 2YEKA 4QSSA 4YYMA 4CURA 4TTEA 2D82A 4NYWA 5AD2A 2L84A 5A5PA 3QZVA 5JWMA 5E9KA 5CUEA 5E9LA 1JSPB 4A9IA 4NYVA 5D3HA 2DVRA 5KTXA 4Z1QA 2E7NA 5K29A 4XY8A 4UYGA 4E96A 4TZ2A 5DFCA 2YW5A 4NRBA 5HRWA 5DLZA 5DYAA 4O71A 4LZ2A 3G0JA 4CFKA 3K2JA 4A9EA 4LDFA 3LQJA 5FB1A 3SVGA 4QB3A 4QSXA 5CPEA 2WP1A 5II2A 5CQAA 4YABA 4YH4A 5D24A 5IG6A 5EPSA 3JVLA 4UYFB 5AMFA 4QSQA 3U5NA 4OGIA 5FG5A 4J3IA 2E3KA 2MJVB 5ENHA 4O7EA 5I7YA 4ZQLA 3UW9A 5F1HA 4PCIA 5E9IA 5E73A 4UYFA 4NUEA 5KTUA 4C67A 3UV2A 3MULA 4NXJA 5F61A 3UVYA 5H1TA 4QSPA 4XY9A 3U5LA 3IU6A 5BT3A 3U5MA 3FKMX 4O7BA 4QSWA 4KV4A 4N4HA 4GPJA 4IR6A 5L8TA 4CLBA 4YBTA 4NR6A 5ETDA 3ONIA 4YYDA 5C4QA 5D3JA 4CUUA 1N72A 4MEOA 5HCLA 5DW1A 4QUTA 5D25A 5CZGA 5L98A 5A83A 5EPBA 5HQ7A 5FE9A 5CUAA 3P1DA 3MB4A 4LR6A 4WHUA 3P1CA 4O7FA 2KTBB 5E9MA 5L97A 5FG6A 4Z1SA 5FH7A 5CUBA 5I86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOR A;  4YBM A;  4NUD A;  2L5E A;  4NR7 A;  5DFD A;  5E9Y A;  5IID A;  5C7N A;  5EQ1 A;  3HME A;  4TS8 A;  3U5K A;  4TQN A;  5EA1 A;  5KTW A;  5G4R A;  5F1L A;  5EIS A;  5COI A;  4BW4 A;  2RI7 A;  4PTB A;  4O72 A;  5DYU A;  5EM3 A;  4MEN A;  4J0R A;  4IR5 A;  5FE5 A;  4HXR A;  3D7C A;  5LVR A;  3AQA A;  5H1U A;  5HJC A;  5HFQ A;  5I7X A;  5CQ6 A;  4LYI A;  4MR4 A;  5EWC A;  4MEQ A;  5FH6 A;  5ENG A;  4HBW A;  5HRV A;  5CS8 A;  4KCX A;  4YYG A;  5CQT A;  4A9O A;  3JVJ A;  1F68 A;  2R0Y A;  4BJX A;  4KV1 A;  4Y03 A;  4QBM A;  4HXS A;  4QC1 A;  4Q0O A;  4CUP A;  4XUB A;  4YYH A;  3TLP A;  4OUF A;  5FDZ A;  1ZS5 A;  3DWY A;  4WHW A;  2OUO A;  5CRZ A;  4TT6 A;  4YYI A;  2RNY A;  4J1P A;  5KHM A;  3P5O A;  4UYH A;  5A5R A;  4HXP A;  4QYD A;  3DAI A;  5HEN A;  5KO4 A;  3UV5 A;  4Z6I A;  5HRX A;  5EP7 A;  5AD3 A;  3LQI A;  4UIX A;  4A9L A;  4NR4 A;  4A9F A;  5EWV A;  4IOO A;  4A9H A;  4ZW1 A;  2R10 A;  5E74 A;  4HXL A;  4QUU A;  4QST A;  4Z6H A;  4NS5 A;  4ZC9 A;  1EQF A;  5ENF A;  2DWW A;  5D3S A;  2RNX A;  5LKX A;  4QSV A;  5D3L A;  5FB0 A;  2L85 A;  4CUT A;  4NQM A;  5IGM A;  3UV4 A;  3MXF A;  4NQN A;  5BT4 A;  2RS9 B;  4Q0N A;  5CY9 A;  5F63 A;  3AAD A;  4YY6 A;  5C87 A;  1X0J A;  3I3J A;  5F3A A;  4YAT A;  3G0L A;  5I83 A;  5FE3 A;  3RCW A;  4TU6 A;  3LQH A;  5EWD A;  4BHW A;  5CGP A;  5CUC A;  4BW2 A;  2R0S A;  4HBV A;  5TCM A;  4PS5 A;  5ENI A;  3S92 A;  4F3I A;  5JI8 A;  5A82 A;  5LUU A;  3O35 A;  4YAX A;  5H1V A;  4UIV A;  2G4A A;  4QEV A;  2LSP B;  4QEW A;  4LYW A;  5EGU A;  5FE4 A;  5ACY A;  5EK9 A;  5FFV A;  5II1 A;  4HXN A;  4QY4 A;  3UVD A;  4C66 A;  4LYS A;  5G4S A;  5FE8 A;  5I29 A;  5FFY A;  5C8G A;  1E6I A;  5DKD A;  5I1Q A;  3QZS A;  2D9E A;  5I88 A;  5LJ0 A;  2E7O A;  5ENJ A;  5D26 A;  4QEU A;  4CUQ A;  3GG3 A;  4QR3 A;  4LZR A;  4N4G A;  5D0C A;  2WP2 A;  4NYX A;  5L96 A;  5BT5 A;  5DKC A;  4ALH A;  5F36 A;  4NR8 A;  3MB3 A;  3Q2E A;  5DY7 A;  4ALG A;  5ENB A;  4O78 A;  4UIW A;  4NUC A;  5L8U A;  4HBX A;  5CUG A;  2DVV A;  5CUD A;  4NRC A;  2R0V A;  5FE7 A;  5CQ5 A;  4CL9 A;  4BW3 A;  2YYN A;  5E9V A;  5EU1 A;  4HBY A;  3S91 A;  5H85 A;  2RNW A;  4IR3 A;  5HQ5 A;  3O37 A;  3SVF A;  2YEM A;  5CP5 A;  5A5S A;  3UVW A;  2YEL A;  5DLX A;  4O7C A;  5EIC A;  3U5O A;  4Z93 A;  4QSR A;  4UIZ A;  5CQ3 A;  5LJ1 A;  2NXB A;  4AKN A;  4CFL A;  4PKL A;  5EVA A;  2DKW A;  4CUS A;  1JM4 B;  2N9G A;  3SVH A;  4A9J A;  4RVR A;  2DVQ A;  5F5Z A;  4LRG A;  5CTL A;  4UIT A;  5ENE A;  2FSA A;  5D7X A;  2OO1 A;  4QC3 A;  2F6J A;  3Q2F A;  4X2I A;  4UIU A;  4MR6 A;  4TZ8 A;  5EWW A;  4YYK A;  4J0S A;  5LKZ A;  5HQ6 A;  3UVX A;  5D3N A;  5FE1 A;  5L99 A;  4UYD A;  4TYL A;  1WUM A;  4QSU A;  4O7A A;  5A5O A;  2H60 A;  4YYJ A;  4MR3 A;  3U5J A;  3IU5 A;  4A9M A;  3NXB A;  5IGL A;  5FG4 A;  5A85 A;  5FFW A;  4QR4 A;  2YQD A;  4LZS A;  5AME A;  5E3D A;  2I8N A;  5CFW A;  4MR5 A;  5D3R A;  5DYC A;  4XYA A;  5F25 A;  4TT4 A;  4WIV A;  4A9N A;  4YC9 A;  5DX4 A;  5A5N A;  2GRC A;  5KU3 A;  4A9K A;  5F62 A;  4YY4 A;  5LJ2 A;  4LC2 A;  5LKT A;  4YH3 A;  4YAD A;  2I7K A;  3P1E A;  4UYE A;  5HLS A;  4QYL A;  5F60 A;  5A7C A;  5IGK A;  2F6N A;  5EV9 A;  5D3T A;  3ZYU A;  5EPR A;  3JVK A;  4HXK A;  5DYX A;  1WUG A;  3MUK A;  3QZT A;  4UIY A;  3O36 A;  3LJW A;  4IOQ A;  4N4I A;  4NR5 A;  2RO1 A;  4PCE A;  4OGJ A;  5FE0 A;  5FH8 A;  5EWH A;  5HFR A;  4NR9 A;  3P1F A;  4YBS A;  4HXO A;  5A81 A;  3U5P A;  4TU4 A;  3O34 A;  2DAT A;  5CRM A;  2DVS A;  4O75 A;  4TT2 A;  5J0D A;  5HEM A;  5I40 A;  5ENC A;  5HEL A;  5HM0 A;  5DW2 A;  3HMF A;  5DKH A;  3HMH A;  4O74 A;  5FE6 A;  5I89 A;  5A5Q A;  5F2P A;  4HXM A;  4MEP A;  5IGN A;  5E7D A;  4NRA A;  4O76 A;  2RFJ A;  5IBN A;  4BW1 A;  2YDW A;  5CU8 A;  5E0R A;  3JVM A;  5D3P A;  2OSS A;  4YYN A;  4FLP A;  4XUA A;  4N3W A;  4QNS A;  5DBM A;  3O33 A;  5LVQ A;  3MQM A;  4QR5 A;  5LKU A;  5EI4 A;  4YK0 A;  5CQ4 A;  4DON A;  5FBX A;  5C89 A;  5I80 A;  5CQ7 A;  5C85 A;  5TB6 A;  4QZS A;  4O77 A;  4N4F A;  4IR4 A;  5ETB A;  5DFB A;  3LXJ A;  4O70 A;  5E3G A;  5CQ8 A;  4PY6 A;  5FE2 A;  2YEK A;  4QSS A;  4YYM A;  4CUR A;  4TTE A;  2D82 A;  4NYW A;  5AD2 A;  2L84 A;  5A5P A;  3QZV A;  5JWM A;  5E9K A;  5CUE A;  5E9L A;  1JSP B;  4A9I A;  4NYV A;  5D3H A;  2DVR A;  5KTX A;  4Z1Q A;  2E7N A;  5K29 A;  4XY8 A;  4UYG A;  4E96 A;  4TZ2 A;  5DFC A;  2YW5 A;  4NRB A;  5HRW A;  5DLZ A;  5DYA A;  4O71 A;  4LZ2 A;  3G0J A;  4CFK A;  3K2J A;  4A9E A;  4LDF A;  3LQJ A;  5FB1 A;  3SVG A;  4QB3 A;  4QSX A;  5CPE A;  2WP1 A;  5II2 A;  5CQA A;  4YAB A;  4YH4 A;  5D24 A;  5IG6 A;  5EPS A;  3JVL A;  4UYF B;  5AMF A;  4QSQ A;  3U5N A;  4OGI A;  5FG5 A;  4J3I A;  2E3K A;  2MJV B;  5ENH A;  4O7E A;  5I7Y A;  4ZQL A;  3UW9 A;  5F1H A;  4PCI A;  5E9I A;  5E73 A;  4UYF A;  4NUE A;  5KTU A;  4C67 A;  3UV2 A;  3MUL A;  4NXJ A;  5F61 A;  3UVY A;  5H1T A;  4QSP A;  4XY9 A;  3U5L A;  3IU6 A;  5BT3 A;  3U5M A;  3FKM X;  4O7B A;  4QSW A;  4KV4 A;  4N4H A;  4GPJ A;  4IR6 A;  5L8T A;  4CLB A;  4YBT A;  4NR6 A;  5ETD A;  3ONI A;  4YYD A;  5C4Q A;  5D3J A;  4CUU A;  1N72 A;  4MEO A;  5HCL A;  5DW1 A;  4QUT A;  5D25 A;  5CZG A;  5L98 A;  5A83 A;  5EPB A;  5HQ7 A;  5FE9 A;  5CUA A;  3P1D A;  3MB4 A;  4LR6 A;  4WHU A;  3P1C A;  4O7F A;  2KTB B;  5E9M A;  5L97 A;  5FG6 A;  4Z1S A;  5FH7 A;  5CUB A;  5I86 A; 
#chains in the Genus database with same CATH topology
 4IOR A;  4YBM A;  4NUD A;  2L5E A;  4NR7 A;  5DFD A;  5E9Y A;  5IID A;  5C7N A;  5EQ1 A;  3HME A;  4TS8 A;  3U5K A;  4TQN A;  5EA1 A;  5KTW A;  5G4R A;  5F1L A;  5EIS A;  5COI A;  4BW4 A;  2RI7 A;  4PTB A;  4O72 A;  5DYU A;  5EM3 A;  4MEN A;  4J0R A;  3D1B A;  4IR5 A;  5FE5 A;  4HXR A;  3D7C A;  1ZKR A;  5LVR A;  3AQA A;  5H1U A;  5HJC A;  5HFQ A;  5I7X A;  5CQ6 A;  4LYI A;  4MR4 A;  5EWC A;  4MEQ A;  5FH6 A;  5ENG A;  4HBW A;  4AKH A;  5HRV A;  5CS8 A;  4KCX A;  4YYG A;  5CQT A;  4A9O A;  3JVJ A;  1F68 A;  2R0Y A;  4BJX A;  4KV1 A;  4Y03 A;  4QBM A;  4HXS A;  4QC1 A;  4Q0O A;  4CUP A;  4XUB A;  4YYH A;  3TLP A;  4OUF A;  5FDZ A;  1ZS5 A;  3DWY A;  4WHW A;  2OUO A;  5CRZ A;  4TT6 A;  4YYI A;  2RNY A;  4J1P A;  5KHM A;  3P5O A;  4UYH A;  5A5R A;  4HXP A;  4QYD A;  3DAI A;  5HEN A;  5KO4 A;  3UV5 A;  3ERR A;  4Z6I A;  5HRX A;  5EP7 A;  5AD3 A;  3LQI A;  4UIX A;  4A9L A;  4NR4 A;  4A9F A;  5EWV A;  4IOO A;  4A9H A;  4ZW1 A;  2R10 A;  5E74 A;  4HXL A;  4QUU A;  4QST A;  4Z6H A;  4NS5 A;  4ZC9 A;  1EQF A;  5ENF A;  2DWW A;  5D3S A;  2RNX A;  5LKX A;  4QSV A;  5D3L A;  5FB0 A;  2L85 A;  4CUT A;  4NQM A;  5IGM A;  3UV4 A;  3MXF A;  4NQN A;  5BT4 A;  2RS9 B;  4Q0N A;  5CY9 A;  5F63 A;  3AAD A;  4YY6 A;  5C87 A;  1X0J A;  3I3J A;  5F3A A;  4YAT A;  3G0L A;  5I83 A;  5FE3 A;  3RCW A;  4TU6 A;  3LQH A;  5EWD A;  4BHW A;  5CGP A;  5CUC A;  4BW2 A;  2R0S A;  4HBV A;  5TCM A;  4PS5 A;  5ENI A;  3S92 A;  4F3I A;  5JI8 A;  5A82 A;  5LUU A;  3O35 A;  4YAX A;  5H1V A;  4UIV A;  2G4A A;  4QEV A;  2LSP B;  4QEW A;  4LYW A;  5EGU A;  5FE4 A;  5ACY A;  5EK9 A;  5FFV A;  5II1 A;  4HXN A;  4QY4 A;  3UVD A;  4C66 A;  4LYS A;  5G4S A;  5FE8 A;  5I29 A;  5FFY A;  5C8G A;  1E6I A;  5DKD A;  5I1Q A;  3QZS A;  2D9E A;  5I88 A;  4AKG A;  5LJ0 A;  2E7O A;  5ENJ A;  5D26 A;  4QEU A;  4CUQ A;  3GG3 A;  4QR3 A;  4LZR A;  4N4G A;  5D0C A;  2WP2 A;  4NYX A;  5L96 A;  5BT5 A;  5DKC A;  4ALH A;  5F36 A;  4NR8 A;  3MB3 A;  3Q2E A;  5DY7 A;  4ALG A;  5ENB A;  4O78 A;  4UIW A;  4NUC A;  5L8U A;  4HBX A;  5CUG A;  2DVV A;  5CUD A;  4NRC A;  2R0V A;  5FE7 A;  5CQ5 A;  4CL9 A;  4BW3 A;  2YYN A;  5E9V A;  5EU1 A;  4HBY A;  3S91 A;  5H85 A;  2RNW A;  4IR3 A;  5HQ5 A;  3O37 A;  3SVF A;  2YEM A;  5CP5 A;  5A5S A;  3UVW A;  2YEL A;  5DLX A;  4O7C A;  5EIC A;  3U5O A;  4Z93 A;  4QSR A;  4UIZ A;  5CQ3 A;  5LJ1 A;  2NXB A;  4AKN A;  4CFL A;  4PKL A;  5EVA A;  2DKW A;  4CUS A;  1JM4 B;  2N9G A;  3SVH A;  4A9J A;  4RVR A;  2DVQ A;  5F5Z A;  4LRG A;  5CTL A;  4UIT A;  5ENE A;  2FSA A;  5D7X A;  2OO1 A;  4QC3 A;  2F6J A;  3Q2F A;  4X2I A;  4UIU A;  4MR6 A;  4TZ8 A;  5EWW A;  4YYK A;  4J0S A;  5LKZ A;  5HQ6 A;  3UVX A;  5D3N A;  5FE1 A;  5L99 A;  4UYD A;  4TYL A;  1WUM A;  4QSU A;  4O7A A;  5A5O A;  2H60 A;  4YYJ A;  4MR3 A;  3U5J A;  3IU5 A;  4A9M A;  3NXB A;  5IGL A;  5FG4 A;  5A85 A;  5FFW A;  4QR4 A;  2YQD A;  4LZS A;  5AME A;  5E3D A;  2I8N A;  5CFW A;  4MR5 A;  5D3R A;  5DYC A;  4XYA A;  5F25 A;  4TT4 A;  4WIV A;  4A9N A;  4YC9 A;  5DX4 A;  5A5N A;  2GRC A;  5KU3 A;  4A9K A;  5F62 A;  4YY4 A;  5LJ2 A;  4LC2 A;  5LKT A;  4YH3 A;  4YAD A;  2I7K A;  3P1E A;  4UYE A;  5HLS A;  4QYL A;  5F60 A;  5A7C A;  3D1D A;  5IGK A;  2F6N A;  5EV9 A;  5D3T A;  3ZYU A;  5EPR A;  3JVK A;  4HXK A;  5DYX A;  1PUO A;  1WUG A;  3MUK A;  3QZT A;  4UIY A;  3O36 A;  3LJW A;  4IOQ A;  4N4I A;  4NR5 A;  4AI6 A;  2RO1 A;  4PCE A;  4OGJ A;  5FE0 A;  5FH8 A;  5EWH A;  5HFR A;  4NR9 A;  3P1F A;  4YBS A;  4HXO A;  5A81 A;  3U5P A;  4TU4 A;  3O34 A;  2DAT A;  5CRM A;  2DVS A;  3VKG A;  4O75 A;  4TT2 A;  5J0D A;  5HEM A;  5I40 A;  5ENC A;  5HEL A;  5HM0 A;  5DW2 A;  3HMF A;  5DKH A;  3HMH A;  4O74 A;  5FE6 A;  5I89 A;  5A5Q A;  5F2P A;  4HXM A;  4MEP A;  5IGN A;  5E7D A;  4NRA A;  4O76 A;  2RFJ A;  5IBN A;  4BW1 A;  2YDW A;  5CU8 A;  5E0R A;  3JVM A;  5D3P A;  2OSS A;  4YYN A;  4FLP A;  2EJN A;  4XUA A;  4N3W A;  4QNS A;  5DBM A;  3O33 A;  4AKI A;  5LVQ A;  3MQM A;  4QR5 A;  5LKU A;  5EI4 A;  4YK0 A;  5CQ4 A;  4DON A;  5FBX A;  5C89 A;  5I80 A;  5CQ7 A;  5C85 A;  5TB6 A;  4QZS A;  4O77 A;  4N4F A;  4IR4 A;  5ETB A;  5DFB A;  3LXJ A;  4O70 A;  5E3G A;  5CQ8 A;  4PY6 A;  5FE2 A;  2YEK A;  4QSS A;  4YYM A;  4CUR A;  4TTE A;  2D82 A;  4NYW A;  5AD2 A;  2L84 A;  5A5P A;  3QZV A;  5JWM A;  3VKH A;  5E9K A;  5CUE A;  5E9L A;  1JSP B;  4A9I A;  4NYV A;  5D3H A;  2DVR A;  5KTX A;  4Z1Q A;  2E7N A;  5K29 A;  4XY8 A;  4UYG A;  4E96 A;  4TZ2 A;  5DFC A;  2YW5 A;  4NRB A;  5HRW A;  5DLZ A;  5DYA A;  4O71 A;  4LZ2 A;  3G0J A;  4CFK A;  3K2J A;  4A9E A;  4LDF A;  3LQJ A;  5FB1 A;  3SVG A;  4QB3 A;  4QSX A;  5CPE A;  2WP1 A;  5II2 A;  5CQA A;  4YAB A;  4YH4 A;  5D24 A;  5IG6 A;  5EPS A;  3JVL A;  4UYF B;  5AMF A;  4QSQ A;  3U5N A;  4OGI A;  5FG5 A;  4J3I A;  2E3K A;  2MJV B;  5ENH A;  4O7E A;  5I7Y A;  4ZQL A;  3UW9 A;  5F1H A;  4PCI A;  5E9I A;  5E73 A;  4UYF A;  4NUE A;  5KTU A;  4C67 A;  3UV2 A;  3MUL A;  4NXJ A;  5F61 A;  3UVY A;  5H1T A;  4QSP A;  4XY9 A;  3U5L A;  3IU6 A;  5BT3 A;  3U5M A;  3FKM X;  4O7B A;  4QSW A;  4KV4 A;  4N4H A;  4GPJ A;  4IR6 A;  5L8T A;  4CLB A;  4YBT A;  4NR6 A;  5ETD A;  3ONI A;  4YYD A;  5C4Q A;  5D3J A;  4CUU A;  1N72 A;  4MEO A;  5HCL A;  5DW1 A;  4QUT A;  5D25 A;  5CZG A;  5L98 A;  5A83 A;  5EPB A;  5HQ7 A;  5FE9 A;  5CUA A;  3P1D A;  3MB4 A;  4LR6 A;  4WHU A;  3P1C A;  4O7F A;  2KTB B;  5E9M A;  5L97 A;  5FG6 A;  4Z1S A;  5FH7 A;  5CUB A;  5I86 A; 
#chains in the Genus database with same CATH homology
 4IOR A;  4YBM A;  4NUD A;  2L5E A;  4NR7 A;  5DFD A;  5E9Y A;  5IID A;  5C7N A;  5EQ1 A;  3HME A;  4TS8 A;  3U5K A;  4TQN A;  5EA1 A;  5KTW A;  5G4R A;  5F1L A;  5EIS A;  5COI A;  4BW4 A;  2RI7 A;  4PTB A;  4O72 A;  5DYU A;  5EM3 A;  4MEN A;  4J0R A;  4IR5 A;  5FE5 A;  4HXR A;  3D7C A;  5LVR A;  3AQA A;  5H1U A;  5HJC A;  5HFQ A;  5I7X A;  5CQ6 A;  4LYI A;  4MR4 A;  5EWC A;  4MEQ A;  5FH6 A;  5ENG A;  4HBW A;  5HRV A;  5CS8 A;  4KCX A;  4YYG A;  5CQT A;  4A9O A;  3JVJ A;  1F68 A;  2R0Y A;  4BJX A;  4KV1 A;  4Y03 A;  4QBM A;  4HXS A;  4QC1 A;  4Q0O A;  4CUP A;  4XUB A;  4YYH A;  3TLP A;  4OUF A;  5FDZ A;  1ZS5 A;  3DWY A;  4WHW A;  2OUO A;  5CRZ A;  4TT6 A;  4YYI A;  2RNY A;  4J1P A;  5KHM A;  3P5O A;  4UYH A;  5A5R A;  4HXP A;  4QYD A;  3DAI A;  5HEN A;  5KO4 A;  3UV5 A;  4Z6I A;  5HRX A;  5EP7 A;  5AD3 A;  3LQI A;  4UIX A;  4A9L A;  4NR4 A;  4A9F A;  5EWV A;  4IOO A;  4A9H A;  4ZW1 A;  2R10 A;  5E74 A;  4HXL A;  4QUU A;  4QST A;  4Z6H A;  4NS5 A;  4ZC9 A;  1EQF A;  5ENF A;  2DWW A;  5D3S A;  2RNX A;  5LKX A;  4QSV A;  5D3L A;  5FB0 A;  2L85 A;  4CUT A;  4NQM A;  5IGM A;  3UV4 A;  3MXF A;  4NQN A;  5BT4 A;  2RS9 B;  4Q0N A;  5CY9 A;  5F63 A;  3AAD A;  4YY6 A;  5C87 A;  1X0J A;  3I3J A;  5F3A A;  4YAT A;  3G0L A;  5I83 A;  5FE3 A;  3RCW A;  4TU6 A;  3LQH A;  5EWD A;  4BHW A;  5CGP A;  5CUC A;  4BW2 A;  2R0S A;  4HBV A;  5TCM A;  4PS5 A;  5ENI A;  3S92 A;  4F3I A;  5JI8 A;  5A82 A;  5LUU A;  3O35 A;  4YAX A;  5H1V A;  4UIV A;  2G4A A;  4QEV A;  2LSP B;  4QEW A;  4LYW A;  5EGU A;  5FE4 A;  5ACY A;  5EK9 A;  5FFV A;  5II1 A;  4HXN A;  4QY4 A;  3UVD A;  4C66 A;  4LYS A;  5G4S A;  5FE8 A;  5I29 A;  5FFY A;  5C8G A;  1E6I A;  5DKD A;  5I1Q A;  3QZS A;  2D9E A;  5I88 A;  5LJ0 A;  2E7O A;  5ENJ A;  5D26 A;  4QEU A;  4CUQ A;  3GG3 A;  4QR3 A;  4LZR A;  4N4G A;  5D0C A;  2WP2 A;  4NYX A;  5L96 A;  5BT5 A;  5DKC A;  4ALH A;  5F36 A;  4NR8 A;  3MB3 A;  3Q2E A;  5DY7 A;  4ALG A;  5ENB A;  4O78 A;  4UIW A;  4NUC A;  5L8U A;  4HBX A;  5CUG A;  2DVV A;  5CUD A;  4NRC A;  2R0V A;  5FE7 A;  5CQ5 A;  4CL9 A;  4BW3 A;  2YYN A;  5E9V A;  5EU1 A;  4HBY A;  3S91 A;  5H85 A;  2RNW A;  4IR3 A;  5HQ5 A;  3O37 A;  3SVF A;  2YEM A;  5CP5 A;  5A5S A;  3UVW A;  2YEL A;  5DLX A;  4O7C A;  5EIC A;  3U5O A;  4Z93 A;  4QSR A;  4UIZ A;  5CQ3 A;  5LJ1 A;  2NXB A;  4AKN A;  4CFL A;  4PKL A;  5EVA A;  2DKW A;  4CUS A;  1JM4 B;  2N9G A;  3SVH A;  4A9J A;  4RVR A;  2DVQ A;  5F5Z A;  4LRG A;  5CTL A;  4UIT A;  5ENE A;  2FSA A;  5D7X A;  2OO1 A;  4QC3 A;  2F6J A;  3Q2F A;  4X2I A;  4UIU A;  4MR6 A;  4TZ8 A;  5EWW A;  4YYK A;  4J0S A;  5LKZ A;  5HQ6 A;  3UVX A;  5D3N A;  5FE1 A;  5L99 A;  4UYD A;  4TYL A;  1WUM A;  4QSU A;  4O7A A;  5A5O A;  2H60 A;  4YYJ A;  4MR3 A;  3U5J A;  3IU5 A;  4A9M A;  3NXB A;  5IGL A;  5FG4 A;  5A85 A;  5FFW A;  4QR4 A;  2YQD A;  4LZS A;  5AME A;  5E3D A;  2I8N A;  5CFW A;  4MR5 A;  5D3R A;  5DYC A;  4XYA A;  5F25 A;  4TT4 A;  4WIV A;  4A9N A;  4YC9 A;  5DX4 A;  5A5N A;  2GRC A;  5KU3 A;  4A9K A;  5F62 A;  4YY4 A;  5LJ2 A;  4LC2 A;  5LKT A;  4YH3 A;  4YAD A;  2I7K A;  3P1E A;  4UYE A;  5HLS A;  4QYL A;  5F60 A;  5A7C A;  5IGK A;  2F6N A;  5EV9 A;  5D3T A;  3ZYU A;  5EPR A;  3JVK A;  4HXK A;  5DYX A;  1WUG A;  3MUK A;  3QZT A;  4UIY A;  3O36 A;  3LJW A;  4IOQ A;  4N4I A;  4NR5 A;  2RO1 A;  4PCE A;  4OGJ A;  5FE0 A;  5FH8 A;  5EWH A;  5HFR A;  4NR9 A;  3P1F A;  4YBS A;  4HXO A;  5A81 A;  3U5P A;  4TU4 A;  3O34 A;  2DAT A;  5CRM A;  2DVS A;  4O75 A;  4TT2 A;  5J0D A;  5HEM A;  5I40 A;  5ENC A;  5HEL A;  5HM0 A;  5DW2 A;  3HMF A;  5DKH A;  3HMH A;  4O74 A;  5FE6 A;  5I89 A;  5A5Q A;  5F2P A;  4HXM A;  4MEP A;  5IGN A;  5E7D A;  4NRA A;  4O76 A;  2RFJ A;  5IBN A;  4BW1 A;  2YDW A;  5CU8 A;  5E0R A;  3JVM A;  5D3P A;  2OSS A;  4YYN A;  4FLP A;  4XUA A;  4N3W A;  4QNS A;  5DBM A;  3O33 A;  5LVQ A;  3MQM A;  4QR5 A;  5LKU A;  5EI4 A;  4YK0 A;  5CQ4 A;  4DON A;  5FBX A;  5C89 A;  5I80 A;  5CQ7 A;  5C85 A;  5TB6 A;  4QZS A;  4O77 A;  4N4F A;  4IR4 A;  5ETB A;  5DFB A;  3LXJ A;  4O70 A;  5E3G A;  5CQ8 A;  4PY6 A;  5FE2 A;  2YEK A;  4QSS A;  4YYM A;  4CUR A;  4TTE A;  2D82 A;  4NYW A;  5AD2 A;  2L84 A;  5A5P A;  3QZV A;  5JWM A;  5E9K A;  5CUE A;  5E9L A;  1JSP B;  4A9I A;  4NYV A;  5D3H A;  2DVR A;  5KTX A;  4Z1Q A;  2E7N A;  5K29 A;  4XY8 A;  4UYG A;  4E96 A;  4TZ2 A;  5DFC A;  2YW5 A;  4NRB A;  5HRW A;  5DLZ A;  5DYA A;  4O71 A;  4LZ2 A;  3G0J A;  4CFK A;  3K2J A;  4A9E A;  4LDF A;  3LQJ A;  5FB1 A;  3SVG A;  4QB3 A;  4QSX A;  5CPE A;  2WP1 A;  5II2 A;  5CQA A;  4YAB A;  4YH4 A;  5D24 A;  5IG6 A;  5EPS A;  3JVL A;  4UYF B;  5AMF A;  4QSQ A;  3U5N A;  4OGI A;  5FG5 A;  4J3I A;  2E3K A;  2MJV B;  5ENH A;  4O7E A;  5I7Y A;  4ZQL A;  3UW9 A;  5F1H A;  4PCI A;  5E9I A;  5E73 A;  4UYF A;  4NUE A;  5KTU A;  4C67 A;  3UV2 A;  3MUL A;  4NXJ A;  5F61 A;  3UVY A;  5H1T A;  4QSP A;  4XY9 A;  3U5L A;  3IU6 A;  5BT3 A;  3U5M A;  3FKM X;  4O7B A;  4QSW A;  4KV4 A;  4N4H A;  4GPJ A;  4IR6 A;  5L8T A;  4CLB A;  4YBT A;  4NR6 A;  5ETD A;  3ONI A;  4YYD A;  5C4Q A;  5D3J A;  4CUU A;  1N72 A;  4MEO A;  5HCL A;  5DW1 A;  4QUT A;  5D25 A;  5CZG A;  5L98 A;  5A83 A;  5EPB A;  5HQ7 A;  5FE9 A;  5CUA A;  3P1D A;  3MB4 A;  4LR6 A;  4WHU A;  3P1C A;  4O7F A;  2KTB B;  5E9M A;  5L97 A;  5FG6 A;  4Z1S A;  5FH7 A;  5CUB A;  5I86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...