4QBNA

Vrr_nuc domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
ATKEGRVQKYAKERFEALGGLVRKLSYEGRSGAPDLLVILPRGVIWFVEVKKDENTKPDPHQLREHERFRKRGANVFVVGSFKQVDKLIEHYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAN1 activity on asymmetric repair intermediates is mediated by an atypical monomeric virus-type replication-repair nuclease domain.
pubmed doi rcsb
source organism Salmonella phage setp3
molecule tags Hydrolase
molecule keywords Nuclease
total genus 29
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08774 VRR_NUC VRR-NUC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1350.10 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4qbnA00
2GJWA 2WIZA 1OB9A 1R0VA 2WCWA 2CV8A 3AJVB 4TKDA 1T0FA 1XMXA 1R11A 1Y1OA 3AJVA 3FOVA 2EO0A 1A79A 1F1ZA 2OSTA 3P1YA 2FCOA 2GW6A 3P1ZB 2OKFA 3P1ZA 1ZP7A 1OB8A 1RLVA 1Y88A 3DNXA 2WCZA 2ZYZA 2VLDA 4QBNA 1GEFA 2ZYZB 3IEYA 1HH1A 1IPIA 4QBLA 2WIWA 2INBA 5FDKA 2WJ0A 4QBOA 4TKKA 1RZNA
chains in the Genus database with same CATH superfamily
4DAPA 4EV1A 1OB9A 2WIZA 2FLCA 1R0VA 2WCWA 2FKHB 2GJWA 2CV8A 4G6VA 3AJVB 4TKDA 1T0FA 2CZRA 1XMXA 1UWVA 1R11A 1Y1OA 1YNMA 2EO0A 3AJVA 1A79A 3FOVA 1F1ZA 2OSTA 3P1YA 2FCOA 2GW6A 2DBSA 2FKCA 3P1ZB 2JJQA 2OKFA 3P1ZA 1ZP7A 1OB8A 2FL3A 1RLVA 1Y88A 3DNXA 2BH2A 2W8MA 2WCZA 4DA2A 2IXSA 2ZYZA 3IEYB 2VS1A 2VLDA 4QBNA 1GEFA 2ZYZB 3IEYA 4G6UA 4TKKA 3BT7A 1HH1A 4E6ZA 1IPIA 2Z0RA 4QBLA 2WIWA 2INBA 3IF0X 4DAVA 4ZQUA 5FDKA 2WJ0A 4QBOA 4LQEA 1RZNA
chains in the Genus database with same CATH topology
4DAPA 4EV1A 1OB9A 2WIZA 2FLCA 1R0VA 2WCWA 2FKHB 2GJWA 2CV8A 4G6VA 3AJVB 4TKDA 1T0FA 2CZRA 1XMXA 1UWVA 1R11A 1Y1OA 1YNMA 2EO0A 3AJVA 1A79A 3FOVA 1F1ZA 2OSTA 3P1YA 2FCOA 2GW6A 2DBSA 2FKCA 3P1ZB 2JJQA 2OKFA 3P1ZA 1ZP7A 1OB8A 2FL3A 1RLVA 1Y88A 3DNXA 2BH2A 2W8MA 2WCZA 4DA2A 2IXSA 2ZYZA 3IEYB 2VS1A 2VLDA 4QBNA 1GEFA 2ZYZB 3IEYA 4G6UA 4TKKA 3BT7A 1HH1A 4E6ZA 1IPIA 2Z0RA 4QBLA 2WIWA 2INBA 3IF0X 4DAVA 4ZQUA 5FDKA 2WJ0A 4QBOA 4LQEA 1RZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJW A;  2WIZ A;  1OB9 A;  1R0V A;  2WCW A;  2CV8 A;  3AJV B;  4TKD A;  1T0F A;  1XMX A;  1R11 A;  1Y1O A;  3AJV A;  3FOV A;  2EO0 A;  1A79 A;  1F1Z A;  2OST A;  3P1Y A;  2FCO A;  2GW6 A;  3P1Z B;  2OKF A;  3P1Z A;  1ZP7 A;  1OB8 A;  1RLV A;  1Y88 A;  3DNX A;  2WCZ A;  2ZYZ A;  2VLD A;  4QBN A;  1GEF A;  2ZYZ B;  3IEY A;  1HH1 A;  1IPI A;  4QBL A;  2WIW A;  2INB A;  5FDK A;  2WJ0 A;  4QBO A;  4TKK A;  1RZN A; 
#chains in the Genus database with same CATH topology
 4DAP A;  4EV1 A;  1OB9 A;  2WIZ A;  2FLC A;  1R0V A;  2WCW A;  2FKH B;  2GJW A;  2CV8 A;  4G6V A;  3AJV B;  4TKD A;  1T0F A;  2CZR A;  1XMX A;  1UWV A;  1R11 A;  1Y1O A;  1YNM A;  2EO0 A;  3AJV A;  1A79 A;  3FOV A;  1F1Z A;  2OST A;  3P1Y A;  2FCO A;  2GW6 A;  2DBS A;  2FKC A;  3P1Z B;  2JJQ A;  2OKF A;  3P1Z A;  1ZP7 A;  1OB8 A;  2FL3 A;  1RLV A;  1Y88 A;  3DNX A;  2BH2 A;  2W8M A;  2WCZ A;  4DA2 A;  2IXS A;  2ZYZ A;  3IEY B;  2VS1 A;  2VLD A;  4QBN A;  1GEF A;  2ZYZ B;  3IEY A;  4G6U A;  4TKK A;  3BT7 A;  1HH1 A;  4E6Z A;  1IPI A;  2Z0R A;  4QBL A;  2WIW A;  2INB A;  3IF0 X;  4DAV A;  4ZQU A;  5FDK A;  2WJ0 A;  4QBO A;  4LQE A;  1RZN A; 
#chains in the Genus database with same CATH homology
 4DAP A;  4EV1 A;  1OB9 A;  2WIZ A;  2FLC A;  1R0V A;  2WCW A;  2FKH B;  2GJW A;  2CV8 A;  4G6V A;  3AJV B;  4TKD A;  1T0F A;  2CZR A;  1XMX A;  1UWV A;  1R11 A;  1Y1O A;  1YNM A;  2EO0 A;  3AJV A;  1A79 A;  3FOV A;  1F1Z A;  2OST A;  3P1Y A;  2FCO A;  2GW6 A;  2DBS A;  2FKC A;  3P1Z B;  2JJQ A;  2OKF A;  3P1Z A;  1ZP7 A;  1OB8 A;  2FL3 A;  1RLV A;  1Y88 A;  3DNX A;  2BH2 A;  2W8M A;  2WCZ A;  4DA2 A;  2IXS A;  2ZYZ A;  3IEY B;  2VS1 A;  2VLD A;  4QBN A;  1GEF A;  2ZYZ B;  3IEY A;  4G6U A;  4TKK A;  3BT7 A;  1HH1 A;  4E6Z A;  1IPI A;  2Z0R A;  4QBL A;  2WIW A;  2INB A;  3IF0 X;  4DAV A;  4ZQU A;  5FDK A;  2WJ0 A;  4QBO A;  4LQE A;  1RZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...