4QC2A

Crystal structure of lipopolysaccharide transport protein lptb in complex with atp and magnesium ions
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of conserved nucleotide-binding protein LptB in lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC transporter related protein
total genus 78
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qc2A00
3DZDA 2OLJA 2AD5A 5JWRA 2JJ1A 3T34A 1RRGA 2PZFA 4A82A 3NVAA 3TUZC 1DAFA 3GPLA 3THWB 4YMTA 5DLQC 1W0KD 2BKUA 1D2MA 1BIFA 4HLDA 1DO0A 1NSFA 2I4IA 3NBYC 1M2OB 3MJRA 3SHFA 4DLRA 3X1XA 2VF8A 4D25A 2W6JA 4EFMA 2ZRHA 2J3EA 3X1WA 1NG1A 2WOJA 1JJ7A 1TF5A 5BWMA 1UM8A 1XPOA 4JKIA 5BYKA 2HCBA 5JHGB 3KDSE 3NBFA 1E2FA 3LAWA 5G53C 2ZVPX 1GZSA 2REBA 1B0UA 3IIMA 4Z54A 2GEDA 4RZUA 4HLCA 1Q3HA 4MKFA 3SJCA 4Q4JA 4V0OA 1E9EA 2ZS9A 2ZE6A 4QC2A 5FPKA 1CJTC 3EZ6A 4HB0A 3BS4A 2V1UA 3MD0A 1XBTA 3EIEA 2ZJ8A 3LY5A 2YHSA 4LHXA 4W5JA 5EJEA 1QHGA 4MGKR 1BMFD 2LCFA 2JLQA 4LOAA 1XPRA 1IJFA 3ETLA 2WPDD 3PEUA 5CK5A 1TPZA 2OBNA 3JVVA 2W6IA 3KJHA 1F3OA 3I8XA 3O8DA 4PZLA 3TLXA 3A6PC 121PA 1E0JA 4NCJA 5JWOA 2HDNB 4Q4HB 4WXPA 5FPSA 3TSOA 2JJ2A 4U00A 4OHZA 2GTPA 2JLWA 1X86B 4RVCA 4OI2A 4R71A 2Y8EA 5FUWA 3TUIC 3M4YA 4HDCA 4PAOA 5FBQB 2WWIA 5FPHA 2D06A 4JLJA 4LHVA 1CR2A 2RGDA 3DDCA 4Q1CA 2ZRMA 3U60B 2A3RA 1MH1A 4O25A 4OL0A 2FSIA 1U0LA 1YKSA 2BV3A 3OIYA 1TTTA 3W8RA 2O8DA 2QP3A 3EARA 1N6PA 3LQQA 1XEWX 2ZU0C 3RRYA 5CM9C 2VSOA 1ZP6A 4MKHA 1N6LA 3SYLA 4C4PA 4QNMA 5KNDA 2HLDA 2PT7A 1ZM7A 4C2UA 2OFWA 3GJ3A 1AZTA 1F60A 3G0HA 3C7KA 4Q4HA 4CT5A 4IHQA 1CR4A 5FTMA 1EK0A 2O8EA 2QI9C 3CPHA 3B1XA 5CM8B 4DCSA 4LBZA 1Q44A 1UDWA 3TNFA 4BLQA 2CJWB 2ZTSA 4IDHA 3QVVA 3K70C 2CVFA 3AP2A 4G1UC 1SVLA 2Z4SA 4M1YA 1TUIA 3DKPA 3CRRA 3ASZA 1OH7A 3LFUA 2GILA 2RAPA 3BIFA 3KZ1E 3U6KA 1MR3F 3OAAA 2V6JA 4WZAE 5DHFA 3W6OA 2O8BA 4DSNA 4HUQA 1SXJB 4TSFA 1HV8A 1T3HA 4YDSA 5CLLA 2IYXA 5AUNB 2IYZA 2OHFA 4PZYA 5LD2C 1JR6A 1GITA 4A0GA 4AY2A 2Z6VA 2ZI7A 2EU8A 4TYWA 2X19A 5FPYA 2QGZA 3FOZA 2F1HA 2GJKA 3CW2A 1U98A 1R6BX 3DMDA 2H1LA 3GJXC 3TVDA 5FBRB 5L3QB 2NZ8A 1G17A 4ABYA 1XEXB 3QKRA 1ZNYA 2DYKA 2FZLA 3LV8A 3SBDA 1SXJC 2IYUA 1ONBA 1FL9A 1KI1A 4GSYA 3PEVA 2OBLA 4QFMA 4EQ6A 4BUJA 4US2R 2G1KA 3B5JA 3IUYA 3ONWA 5JWHA 4BFZA 2HV8A 5KSPA 1P7CA 2OCAA 1AS2A 4ACAA 4UQOA 4DEXA 4HUQB 3N70A 1MO4A 4WZBE 2NO7A 1UKYA 2NGRA 3HU1A 5HE8A 2GCNA 4AWXA 5KU1A 3AEZA 1JXOA 1LY1A 1X1SA 1E6CA 1GRRA 2FFAA 1G6HA 3CF0A 2ATXA 1W2HA 5J4KA 3R9XA 3VR3A 3GCGA 5DE3A 3EZ9A 4F38A 4NMMA 1OW3B 1XEXA 3QKRB 5EXXA 2XZLA 4BEBA 3UWOA 2ZR7A 4TLDA 3IO5A 4CF7A 4GP6A 1UADA 2Z43A 3I8SA 4PAQA 1MRNA 2X2FA 2FSGA 4BFTA 4URWR 2YOHA 1LTQA 3ZJYA 2XAUA 4OHWA 3A4MA 1YR8A 3SJAA 3TH5A 4POAA 2J7KA 3I32A 4H1UA 1YVDA 4OHYA 4BPBA 2BJVA 4NE2A 4HAWA 2NZJA 3K09C 1CLUA 2IYSA 4OI1A 3GD7A 4PC6A 2XB2A 4IDNA 3CNLA 4ZDJA 4AG6A 2QP9X 2NO0A 3CIOA 5BW8A 1NF3A 5BQ5A 2W83A 2ZJZA 2VHTA 2OBMA 4BLTA 4U02A 4ESHA 4NYMQ 2N1BA 4ZI3A 2WHXA 2QTFA 4KCGA 5JS7A 1X3SA 1OSNA 3DMNA 5FOUA 4TMXA 2W6JD 2A9KA 1KI9A 5K8IA 1E9AA 3K1JA 4FN5A 1KMHA 2HJVA 1XMJA 1NMXA 1ZD9A 4RFSB 3OE7D 1TMKA 1WQ1R 1KIMA 1UKZA 5JJIA 4US1R 2PZEA 2QPTA 1W5TA 2ODBA 3KKNA 4NHOA 2WMOB 4E22A 1JI0A 1F2UB 2IHBA 4NYJR 4DBLC 2OV2A 4IEEA 3RS2A 3ADCA 1ZRHA 3KKOA 3NHAA 4XD7A 2ONJA 3RS3A 1IXZA 4HAZA 2JIZA 4PXAA 1BOFA 5KDLA 5SZJA 1KDPA 1S2MA 1DELA 1W48A 5CYOA 1E0AA 4F91B 1E9FA 1QHHB 4X8OA 1C1YA 3K53A 1XRJA 3T12A 2GCPA 1NKTA 3MLEA 2DCUA 4HZUB 2EQBA 2BJWA 1II8A 1AK2A 1QVRA 2QUZA 5FOWA 4GMDA 1X1RA 2FG5A 1AQUA 2WJJA 4OHVA 3GP8A 3KFVA 1KSJA 4GI7A 2PX3A 4EPTA 3U6BA 2ZYTX 5K8LA 3CLVA 4B33A 2ZVQX 5A4JA 1G9XA 1CIPA 5E7JA 3CNNA 3B2EA 1C9KA 4JLOA 2R9VA 1MT0A 2CMKA 3DM5A 2E87A 4LJ8A 5DIFA 1GDDA 3RWMB 4L16A 1UBEA 3ZZTA 1OXXK 1R0ZA 1UKEA 4C0JA 4AYTA 1G8PA 2YWGA 2MMGA 4E5UA 4IFBA 5JI3E 4B48A 2CCGA 3FVQA 2IYRA 2O0KA 1IN4A 2C96A 2VP5A 1IJEA 1KTVA 3BERA 4MRPA 4TYYA 2GVDC 1TEXA 4JLBA 5AR1A 4DDVA 4OK5A 3AF0A 4PR0A 3IQWA 1UBFA 4FMDF 4Q9KA 1E2GA 4Q00A 1BKDR 2ZRFA 2IS2A 1EXMA 1A2KC 1YJ5A 2NTYC 2CE2X 3I72A 1Z2AA 5CDFA 4YLGA 2GZHA 2ORWA 421PA 4B73A 1CJUC 1ZCAA 3RABA 3BB1A 2GBLC 2O8FA 4KO8A 4TMTA 2NG1A 1G3RA 2R6FA 1Z3IX 4TT3A 4MGZR 1DG1G 2ZANA 4R2IA 5AWFC 2VHUA 2KJQA 3ASYA 4LCBA 2XNSA 3T06B 1QHYA 2J87A 3HR8A 3U3RA 3PFIA 1LS1A 1PJRA 2F1JA 2AR7A 4EDHA 4QM7A 3HP1A 4XH9B 2IS6A 1UEJA 3PUYA 4Z8XA 5DN6D 1ZM9A 4Q03A 4KVAA 2NMVA 3I5XA 3THOA 4XSGA 1G3QA 4LYAA 2KE5A 4HLQB 3S1AA 1TNDA 1Z0JA 3THWA 3L0IB 3X2SA 3UWKA 4K46A 3L8ZA 2QAGC 5JCZA 4EPXA 3TAHA 3AH8A 2MSEB 1KI6B 5AUQA 1WE2A 3BFVA 5CYPA 1IY2A 3PVSA 2QN6A 1KI8A 1J8MF 1T0JB 2P5SA 1WRBA 3DZ8A 3TW8B 4L9WA 4BWYA 5C2JB 1KI3A 4HYYA 3IHWA 3IHLA 2F1RA 2F43A 4Q7MB 1FUUA 1G5TA 4GZMA 2PLFA 5CITA 4Q9JA 2W58A 1KDTA 5AJYA 3WP0A 2BBTA 2OCBA 2O0HA 4TMKA 2XXAB 2YKGA 3FMIA 4LJ7A 3CF6R 4Q7LA 2RMKA 2Q21A 2ZIAA 3B9PA 2H92A 4EUNA 1NRJB 4N1AA 1G18A 5KSOA 3CUEF 1GSIA 3RS7A 3SFZA 3CRQA 1IAQA 4P4SA 4A2QA 2AK2A 2ZRCA 4IJMA 4WXRA 3PR1A 2R6GA 4DCNA 4KFTA 2J7PA 4IDQA 2PH1A 4TL8A 4QXAA 1M74A 3LBNA 2ZI6A 1JQJC 4PPFA 1IQPA 2C99A 2VBCA 4RJLA 3TQFA 4ZIRB 3K0FA 2PX0A 5CK4A 1WB9A 4CGZA 2JJ2D 1JR3D 5LBIA 2JCSA 4LRWA 2PZGA 1Z29A 4WW0A 3A1TA 3REGA 2GKSA 5BXQC 5FUVA 2LKDA 3CPEA 1JECA 1FUKA 1KAOA 4HB2A 3BGWA 3THXB 2PCJA 3AGPA 4OHXA 3F8TA 3H84A 5KPDA 4PZZA 1YR7A 4B47A 1JNYA 4IFEA 3T61A 4YC7A 3TRFA 3AP1A 2YZ2A 3P20A 3R7WB 3TIFA 2DFKB 3QEJA 2PJRA 3GLIB 5FBWB 2ERYA 3FFAA 2WVJA 3MMPA 2FA9A 2QQ0A 1RE0A 4D82A 2CCJA 4P32A 3JZMA 4S35A 4I1UA 4LPKA 1M1YE 3H86A 3N5CA 5M04A 2GAOA 1SHZA 1VG0B 1N6NA 3WNCA 3B9QA 2OE2A 4LGMA 3SJBA 2QA5A 1UKVY 1GL6A 3GLGE 3DHWC 1G20E 1E2LA 4CEIA 1XDBA 3SFVA 2VA8A 4Q1FA 2P5TB 2FDCA 3A37A 2NPFA 1CJMA 1D9ZA 2AFHE 1P2UA 2GEUA 2REOA 5GJWC 1SVMA 3MFYA 4F93B 3AP3A 3GLFA 1RIFA 3CNOA 1XXHA 2RHMA 4URVR 4JBYA 3UPUA 3T1VA 1E79D 1BS1A 3KKMA 2CHQA 3W6NA 3KQUA 2QGNA 1IXRC 1DARA 1IHUA 3VR2A 3VX3A 1NJFA 2HCJB 1DEKA 1G4AE 1EG7A 1RFLA 3PEWA 3UKDA 1W49A 2Q3MA 5LD2B 1G1MA 1N5IA 3KXKA 1OXTA 3IKJA 1YE8A 1T6NA 2OZEA 2ZPTX 5JCPA 1GVNB 1ZMXA 2YWFA 1JXMA 1QVAA 3KTAB 3T5DA 1G5PA 4UJ5A 1RPZA 4B74A 4CDGA 5TXGA 2RGNC 1E2NA 1P61B 3TQCA 2NO1A 1PUJA 721PA 3K70B 1XD2B 1VYTA 1PLLA 2X77A 3AKEA 3VKWA 1FNNA 1ZJ6A 1G21E 4Y0VA 2A5JA 1W36D 2EYUA 2P2LA 5EE5B 4Q21A 1D8TA 5C46F 1FMJA 2D2EA 2VIIA 1R2QA 3CR7A 2NO9A 3LBHA 3SYKA 4D4LA 1SULA 4LWZA 3ZYCA 4LUCA 4CZ2A 2DHRA 3VR4A 4ILEA 1BMFA 1D9XA 1Z6GA 1U8YA 3VAAA 1S8FA 1E2QA 2EFEB 1NBMA 1T91A 1SGWA 4DIDA 1OXVA 4B2IA 4AURA 2ZRLA 1R7RA 3BE4A 4QKQA 3R9WA 1JPJA 4G0NA 4YMSA 3UG7A 1VCNA 5DH9A 5FR2A 4Q1EA 4C0LA 2GAAA 4P4TA 1CR1A 4JZKA 4RD6A 1G41A 1DVRA 2WICA 2G77B 3L8YA 1FFHA 1SXJD 4MYUA 5UKDA 2DR3A 4Q01A 1ZC4A 4AIIA 3T1TA 3WHKA 2GETA 2QTVB 5GJCA 1OLOA 2QSYA 4AKEA 1U9IC 2X2EA 4V0NA 3KQNA 1ZUIA 2BIFA 2IW3A 5EP3A 2BM1A 2KB0A 2ZE5A 3GLHB 4IRUB 2YJTD 1J99A 3GEHA 4PO1A 1NP6A 2CEAA 5AUPB 5KO2A 1T8UA 4DVGA 1VPLA 2J0SA 2B7CA 4M9SA 4Q1AA 4JVNA 3TR5A 1XTRA 2BC9A 1EFCA 1KO8A 2C77A 1OT3A 4BLRA 4CW7A 1G7RA 5FTJA 5KPJA 4EJSB 2YC4C 2HLDD 2C04A 1KK1A 4LV5B 5HZHA 1HEIA 2HUPA 2JIZD 3IBYA 3Q5DA 3WRXC 4FCWA 3W34A 3RHFA 1IN8A 2JLZA 4V0KA 2GJ8A 2ODNA 3RYTC 1E69A 4EKDA 2ZJYA 5EZ6B 3VFDA 4D6PA 1YQTA 2IF0A 4KVGA 1AKEA 3MWYW 4TMZA 3BOSA 4RD0A 1SHKA 4M1KA 4C0KA 4Q48A 4B3CA 4D4KA 4PPQA 3QUSA 2F6RA 4MRNA 1N5KA 1G19A 1S1CA 2IYLD 4AK9A 3ZGXA 2C9YA 3U7FB 3RANA 1GKYA 5B2ZA 1AS3A 4A0HA 3B85A 3GJ4A 1E2IA 5KDOA 1E3MA 2DFTA 1VG1A 3IIKA 4JSTA 3QBTA 4ARZB 1RZ3A 4AI6A 2R6DA 3SOPA 3ZVMA 3GJ5A 3QKSB 4HB4A 2ZITA 2AK3A 4MUBA 1AN0A 1DAGA 5JSZA 4OBEA 1KDOA 2JLRA 2PLRA 2QBYA 2O8FB 8OHMA 3DOEA 3BC1A 4RKEA 3K9GA 4Z8YA 4JLVA 4RKFA 1T9HA 2FSHA 1P73A 2J0UB 3NXSA 4IDOA 2ZYWX 1R8QA 4ZCIA 1E99A 1KZGB 3T15A 1XCMA 1S0UA 1FP6A 1OE0A 3PENA 4HLUA 4AC9A 2BDTA 1KZ7B 3MWJA 3SDZA 3LLMA 2RGBA 4BGDA 4G01B 4BFUA 3A1SA 1E0KA 3A36A 4TQ9A 3LH5A 1N0VC 1VIYA 4ARZA 2GESA 4DLYA 4GZLA 5IRCD 1VMAA 2V55B 1F2TA 1G3UA 4N0EA 2BMJA 4I1VA 4JL6A 4H1VA 3NDPA 4LSGA 1DG3A 2C03A 3CBQA 3KJIA 4TWZA 1P72A 4PO8A 4YDHB 4Z1MA 5JRJA 3F0TA 1J2JA 1UEIA 4PHTA 1EX6A 3ZDQA 5DYIA 3EIQA 1L7VC 2FEMA 3I73A 2VEDA 3LLUA 4PQRA 4WIAA 3UIEA 4TQAA 2ZI5A 2OSBA 1YZQA 3D3QA 2F43B 1XFAA 2BMDA 1WCV1 1JEEA 2BWJA 3TR0A 1MO5A 1MRSA 2XNDA 4MA4A 4KLNA 4QNRA 2L0XA 4RZ3A 2J0VA 2VTKA 2DWOA 2ZU6A 2BEJA 2FOLA 3U2QA 1TQ4A 2A2ZA 3VR5A 5B30A 2FU5C 4I4LA 2YVUA 3IILA 1ZD8A 1UF9A 2ZJOA 4GOJA 1DTSA 3WRYC 5EP4A 3A58B 2N46A 4ITRC 1KJZA 3Q9LA 4LYHA 4CIDA 4D0NA 4M1SA 2QRZA 5E3HA 1MO6A 1EGAA 1XJQA 1RYFA 2MSCB 3HDTA 1TQDA 5JEEA 3C15C 2Q6TA 1XTQA 2WAYA 2WWHA 4PSKA 4XWAA 4PHGA 1N5JA 2WAXA 3I92A 3RDPA 3SQXA 4NYJQ 1ESMA 4B6FA 3AVXA 2R8RA 1NL3A 5L3SA 1FX0B 2XTZA 4YMUA 3UMSA 2ZRPA 1KSFX 3K9LA 4DB2A 4WA7A 2EFCB 1SKYE 3RSLA 1KI2A 1OF1A 4GFDA 1JR3A 1Q22A 5FL3A 2GBLA 821PA 1KK3A 3I5YA 4MYCA 4EFNA 5JHHB 3W90A 4B3BA 3THYB 2OG2A 4UNNA 4NYMR 2OM2A 2RKOA 1SXJA 1M7GA 2QMHA 4GT1A 4QBIA 1Z6TA 3AVPA 5D3QA 5HR5A 4KFUA 3H1TA 2QORA 1W0JD 1SZPA 2HT6A 4V0LA 2XSZD 4GP7A 5HPYB 2AL7A 5JFGA 2ZRIA 4DSOA 4B75A 3CO5A 5FI0B 2O5VA 3GLHE 2QMUA 1DADA 4OK6A 3HJNA 1M6NA 1DOAA 4JMPA 3WBJA 2AD1A 2E1RA 4HAXA 1XD9A 1CJVC 4LDJA 3EZFA 2ZRBA 1N6KA 1YZUA 2ZEJA 3DO6A 4HSEA 5L3SB 1ZCBA 2AN9A 2CLDX 2R62A 3VU9B 3QE0A 1EWRA 3FHCB 5J40A 4B43A 1N6HA 2J46A 4X8HA 1Q57A 3Q72A 4L15A 4NCIA 4C7OA 2ZAOA 5DISB 2IX3A 2ZYUX 2PBRA 4IDPA 4RD2A 5D3MA 2KWIA 2IYYA 2DPXA 4Q18A 3VX4A 4EPVA 3DL0A 2OXCA 3A4LA 2FNAA 3K09A 3QQ5A 3CR8A 3WBKA 3VKHA 2F3TA 3V4RA 4MDFA 3E70C 3RRMA 4QM6A 2Q9BA 3B78A 1Z0IA 4ASUD 4KXFB 4IW3B 3SHWA 1ZVQA 4M0LA 3WP1B 3IIJA 4B2LA 5KUTA 2WWGA 3H4MA 3TSZA 3ADDA 3A1WA 3Q85A 2HXSA 4P31A 2F9MA 4L5BA 1EX7A 3NHBA 1N0UA 3QOFA 3BORA 4MH0R 1Z06A 4LYJA 1CF4A 2ZRKA 5EE0A 1XCGB 1QHSA 1T3LA 1SVKA 3MWLA 4JLAA 2VSXA 3DVLA 4M1OA 3AQ4A 1OH5A 3Q7PA 1G7CA 2EW1A 3ZQ6A 1DBSA 2F9LA 1YZNA 4Q7JB 4OQXA 4QHSA 2Q9CA 5FL7A 2W2TA 1G291 2DFLA 5L8VA 4ZV4A 1U8ZA 3T1QA 5JJLA 2D74A 5TMPA 1EESA 4O2LA 3C41J 3FTQA 3A1UA 1KDRA 2JEOA 3ND8A 4LK2A 4TZ0A 2SHKA 2GZAA 1D5CA 3C4JA 3EXAA 2RGCA 4LJ5A 5FI1B 4QBFA 1KO5A 1TQ6A 2GK7A 2KBFA 2P6RA 1X8LA 1S96A 2UZ3A 1JBKA 3CONA 5DI3A 4D4MA 4Q4AB 5EXSA 3DM9B 3GLIE 4C30A 2QRNA 1YHNA 1CULC 3PXGA 2KSQA 1Q1EA 1HY3A 3F5FA 3QF4A 5LB4A 1VYUA 4NONA 4HAVA 4DCTA 2DY1A 1U90A 1E2KA 2A5YB 1A7JA 3ZS9A 2DB3A 3BB3A 4I99A 2WM9B 1OYYA 4LV6A 1XX6A 3RVBA 5E7MA 4G3XA 3GJ6A 4BZQA 3AGQA 3LW8A 3QXSA 3AV0B 1NBMD 1U8AA 3AF4A 1PUIA 2ZSDA 4LBWA 1DPFA 5EUQB 1FZQA 2QP4A 3OFNA 1NVXQ 3OIUA 3CRMA 1OHHA 2EYQA 1G5RA 2H7VA 4C0HA 2FFHA 5DI3B 2AWNA 1IONA 3EWAA 2WSMA 4UXHA 3SBEA 3OIWA 2TMKA 3ZH9B 4D4JA 1HE1C 3GJ7A 4NCNA 2CK3D 5EE3A 5FTKA 5EUMA 4KI0A 4KJZA 5J5CA 2RGEA 4LJ9A 2P65A 1B23P 4DZZA 2DWPA 5HKKD 1TF2A 2XJ9A 2AKAB 1Z22A 3EX7C 4RY2A 1P6XA 2ZUCA 1ELOA 3KB2A 3CZQA 2WSSA 4BQSA 1OXSC 2AXNA 1EFTA 1R0XA 3N2IA 5F98A 3DPUA 3GMTA 2GCOB 5JEDA 4FIDA 1ZUHA 4E03A 3K0CC 1CS4C 4KYIB 3TKLA 3AVTA 3OEHD 3SU8A 2GNOA 4Q02A 2B8WA 4AYXA 2CL0X 1RRPA 1CP2A 1NLFA 2BOVA 4DT1B 2JJ1D 4TL6A 2ZRDA 4GNKA 4W5WA 4ASUA 2XNDD 2QE7A 5KNCA 1NMYA 4DCVA 4A8JC 4EFLA 4LYFA 3G82C 4KFSA 2ZRJA 4QG7A 3SZRA 3U7GA 3ZZ0A 3K0EA 4IOKA 3LDAA 2I3BA 4KV9A 4NL4H 1JAIA 3D8BA 3O8BA 4ZO4A 2HJGA 1GG2A 4F7WA 1GM5A 1E2PA 1XEFA 1T8TA 1HE8B 2G88A 4F4JA 3VTKA 1TADA 3E5HA 3FMFA 5FBLB 3EG5A 5CJ2A 2YC2C 5LB2A 4A2PA 3QXJA 4HLUC 1NKSA 2KI5A 2AX4A 5EXTA 4GBMA 1W36B 4OI4A 1ZD1A 2P0EA 1YZKA 3HYRA 4Q47A 3VMFA 3P1JA 1P2VA 1US8B 4BRUA 4PC2A 1F48A 1NSTA 2QENA 3S1AB 3CX6A 4MDEA 2J45A 2IEYA 1R5OA 4URZR 3FFBA 2IYVA 3QPWA 5JSZB 1VKJA 2VH5R 4ZKEA 3LVQE 1U0HC 1P2TA 2QBYB 3QEOA 3B1VA 1KI6A 2WWXA 5TDHA 3L43A 3TW4A 4URYR 2PEZA 4QGGA 4PPGA 4TLBA 2B21A 4PHHA 4B3DA 2VHQA 1TF7A 1QG4A 3SEAA 4HAYA 4ZCMA 3K9HA 5H70A 4UNRA 4MYTA 4PHFA 5JECA 3NH9A 3WNDA 1BO6A 1W46A 2GXQA 4FMDB 2WWFA 5J4VA 4PFSA 4M1MA 1OH8A 1I4TD 2C78A 3W5JA 2ZS8A 3ZVLA 1XD8A 3G5UA 3UATA 3QPVA 3C14C 1US8A 1KO4A 1U9IA 1UFQA 3FKSD 3GFOA 1TX4B 5FOSA 5LPNA 4MGYR 3EWSA 1WBBA 3B1YA 2CHVA 1I2MA 4GOXA 5EE1A 2B7BA 4JT2A 2J41A 2ONKA 4JJZA 2F1IA 4ON9A 1XMVA 5AJWA 1IY1A 1RVDA 2UVQA 4B76A 2A7QA 3BB4A 5DNYB 3RS5A 1TEVA 3K0SA 3PITA 1CKEA 3U3JA 3TE6A 2ANCA 1A1VA 1YZGA 2H16A 2VRWA 2ZUBA 1E1RA 3J81k 3PIRA 2Q3HA 5KHOC 3E1SA 3Q7QA 4DJTA 1Q21A 3BH7A 2C8VA 4JLPA 2OAP1 2QU8A 1OB5A 3QF7A 4HDOB 5FBVB 4FD2A 1LFDB 1U81A 1W4AA 4K81B 3X1DA 3LRPA 4NYIR 2CL7X 4Q1DA 2GHIA 1GRNA 2DBYA 3HU3A 3U7EB 2JLUA 2ZJ5A 4QBHA 2IK8A 3SN6A 4OKSA 4K8OA 3BH0A 2ZI3A 2QNRA 4XVRA 4PANA 1RRFA 2C9OA 4IOLA 4QJ3A 4PC3A 3R7WA 5GADl 1GWNA 1N2CE 5SZHB 3GLIA 3AKCA 2XZOA 3LD9A 4Q9IA 1TU3A 4LPSA 3BXZA 4NZYA 3RNLA 4WOPA 5KSYA 2Q9AA 3ADKA 2OCYC 1Q1BA 4W5HA 3ZQJA 5L3QA 4HATA 3GFTA 1NY5A 3DEFA 2QT0A 4D26A 3CF2A 4HUTA 4BZXA 3QNUA 1ZC3A 2A5FA 2FN4A 2Z83A 3FYHA 1Z63A 2CNWA 1E9SA 2J9RA 2GK6A 5HE9A 1AIPA 4D2IA 4CEIB 1GNPA 1JJVA 4PTLA 2QZ4A 1L2TA 1G7SA 2ZR9A 4F4CA 1VIAA 2CE7A 3ZD7A 1E9RA 1SVIA 2D4HA 3RSOA 2V3CC 4E09A 1RRCA 1N25A 1OFHA 4TMWA 1RJ9B 2GXSA 2ZQ5A 3C16C 3D7MA 3MUFA 1XTIA 2ASEA 2FX3A 2C9CA 3CPJB 5CDFE 2BM0A 2AHOA 3HPRA 5FOVA 4A6PA 3O8RA 4HZIA 3B82A 4IXNA 3PEYA 4G5RA 4RZ2A 2WV9A 1CRQA 4IOMA 4JVSB 1XF9A 3WMFA 1OB2A 2A78A 3UK6A 5CIQA 3L0SA 1ZNWA 3QJYA 1II9A 1ODFA 1VHLA 5E95A 4J0QA 5G40A 3P4YA 2PMKA 2FH5B 1DAEA 5G3YA 1Z0AA 2ZR0A 2BBSA 1ZBDA 3KTAA 3A4NA 1KJWA 4M53A 1G3IA 2BBOA 2C5LA 2ZSBA 4KBFA 2MSDB 2CLSA 2GJ9A 4RFVA 3GJ0A 1S1MA 2ZRAA 3IGFA 4RD4A 5FOXA 3AB3A 3PUVA 2IL1A 1RJ9A 2GEVA 3SJZA 1ETUA 2ZE7A 4XTCS 1KNQA 4UJ3A 2IUUA 4IEIA 1XD2A 1XTJA 1Z8FA 4D81A 4RZXA 2V6IA 4BZPA 4F92B 2Z5FA 2IEZA 3QXHA 3R8FA 2EFHB 1QRAA 1VCIA 2W0MA 2WKPA 4FI3C 5HKKA 4MRRA 2BMEA 4DUGD 1KK0A 2WIAA 3R8CA 4DDWA 4R9UC 3D6TB 4TYPA 3OF5A 4BFXA 1XPUA 5J4LA 3LXRA 3WXMA 4EQ6B 3B7GA 4RFSA 4B44A 1UPTA 3WMEA 4GMXA 4XOIA 1T4GA 2IWRA 1VDZA 5HCNA 1R4AA 4KAXA 3EIHA 4P0TA 2HYIC 3CH4B 4U5XA 2B92A 1L8QA 4IVQA 5L3VA 2JJ8A 3REFA 5EQTA 3NEYA 1IM2A 3QI2A 4QL3A 2IT1A 3SC3A 3KJEA 4LBYA 4O2RA 2GZDA 2O0JA 2PCLA 1AGPA 1A82A 4TT3D 1QBKC 1E98A 2FE4A 3BAFA 4HZUA 3CRW1 3ICQB 2ECKA 1II8B 3HYTA 3KFXA 4QJ4A 5K8TA 2YOGA 4LJ4A 4RD1A 1MO3A 3C5HA 4GPTA 4ZDKA 4FMCF 1KI4A 4JL5A 3TJZA 2G83A 1P60A 1OJLA 2XOKD 1XP8A 1M7BA 3W9YA 4Q4AA 3V9PA 2XX3A 3CZPA 4JSYA 1FOEB 4CEHA 4YMWA 4ZPXA 2CXXA 1N6IA 1ZAKA 1OFTA 5P21A 1MKYA 3QKTA 3IPXA 3KXLA 3QG1A 4NH0A 3OESA 2YYZA 2J5XA 2FGJA 5BN4A 1G8YA 1NN0A 2OO7A 1LNZA 4QGFA 1RKBA 4CEJB 1AZSC 3HWSA 2K5UA 2GXUA 1GTVA 3U3OA 2ZRNA 3WMGA 1KAGA 3KUDA 5KOYA 1AM4D 4M8NE 4UXJA 1SQ5A 3NBXX 4NP6A 2X1VA 1NN5A 2GWHA 5KDDA 1WF3A 4P3YA 1G3MA 1CR0A 2CBZA 3Q3JB 2PMDA 3U3MA 5CLQA 1AGRA 2VP0A 1NY6A 4M2LA 4KITB 4NYIQ 1HQYE 1VTKA 1KMHB 4A0RA 3AVWA 1NI3A 4YONB 3A8TA 4ZDIA 4CT4B 4FXPA 2GA8A 3M6AA 2Z0MA 3GFPA 3NWJA 2D7CA 1NIPA 4CEJA 4GOKA 4LI0A 2V7QD 1QHHA 4BFYA 1KO1A 2BCGY 3LA6A 1JALA 1E4VA 3P4XA 5IDVA 1P62B 2GF9A 2IA5A 1XCPA 3BWDD 5BYJA 5AUOB 4BFWA 4D0LB 3KXIA 5TB5A 1QZXA 3LNCA 3MWKA 4ZDWA 2UZIR 2VHCA 1CJKC 2RCNA 3WNBA 3W6PA 2QM8A 2YWHA 3MCAA 1QHIA 3I62A 4DLVA 2JLVA 1QDEA 2GRJA 3LBIA 1N6OA 2EVWX 3AUYA 4X8MA 4YXWD 1H8HD 1ZNXA 1ANKA 1GKIA 3WYFA 2J0UA 2ZM5A 3HPQA 1GNRA 3LO5A 1YU9A 1C4OA 5E7IA 1T0HB 4R2HA 3NDBB 2GXAA 5F9FA 1E2DA 1N5LA 3TBKA 1HA3A 1Z07A 1XB2A 2ZSFA 1Y63A 1IY0A 2QE7D 4P4UA 2J7PD 2OFXA 2UKDA 4LZZA 1KJYA 1S4QA 5B57C 3ZIAD 3GQBA 3BFKA 3HU2A 3QBVA 4M9QA 2BHRA 3PV0A 3QIAA 2HF8A 1R10A 2WJHA 2G1JA 2QROA 4JVLA 1JQLB 1FPMA 1WP9A 4IOJA 4V02A 2VF7A 2OESA 4TYNA 1S9DA 1NJGA 4LX0A 1GFIA 3UMFA 2R44A 1OXUA 3WHLA 1M7HA 4PSVA 3B13B 1I4DD 2FGKA 4LHZA 2JASA 4EPWA 1FW6A 4C0BA 3KQLA 1R8SA 2ZSEA 1CTQA 1Z2CA 4EJSC 2D62A 2NO6A 3JZAA 1G8HA 1OV4A 3GEIA 2IS1A 3CB4A 3MJHA 4DXAA 4HEJA 3NC1C 1BYIA 1TQ2A 4B34A 5JI2E 5DGXA 2QPOA 3K9NA 2ODWA 5FL7D 4TL9A 4RCZA 1JEDA 3QKUA 4LHWA 1U2RA 3P32A 1N0WA 2RB4A 2R2AA 3V00A 4RCYA 5DO9A 4XWKA 3BRWD 4D80A 2PT5A 2I1QA 4AYWA 4TTPA 3MG9A 2EFDB 2OLKA 2DFNA 2G6BA 3B60A 2VSFA 1Z5ZA 4OQFA 2OXRA 2A5GA 3THXA 4JYCA 3W3ZB 2Q0HA 1GIAA 1ZINA 2VO1A 1BYUA 2LKCA 3FPAA 4C2TA 2P67A 5J4YA 4DB4A 1G8GA 3ZD6A 4NU0A 4A92A 1WDTA 4UNQA 3BD9A 2WKQA 4DLTA 1PLKA 4LJ6A 2CHGA 2IBMA 4R98A 3K8YA 1P3JA 1U0JA 1SKQA 3DKVA 3KQHA 1PV4A 1SKYB 1A4RA 2C2HA 4HDQB 4MKIA 4XTRA 3L0PA 4M9ZA 2H5EA 3ZS8A 4G5SA 4LJYA 4E07A 5BN3A 3U7HB 1IXSB 4DRZA 2FEOA 1DS6A 3NC0C 2GDJA 4LHYA 5IK2A 4A4DA 2FF7A 4Q9HA 2FPLA 4QHTA 4Q4LA 2XJ4A 3W3AA 4QGAA 4QRHA 3T1OA 2VLIA 4YMVA 2XXAA 2OFOA 2C98A 3KB1A 1E9DA 1OIXA 4KBGA 1IN5A 1L4YA 1Q3TA 3THYA 2VL7A 4HAUA 3DOFA 4R7ZA 1KOFA 2FFQA 4TTQA 4BEJA 5GJVC 2D3WA 5ANRB 3B6EA 3FHTA 5HTKA 5SZKB 3GLFB 1OFIA 2RGXA 1LVGA 1XJCA 2W0SA 3W8NA 3AKDA 3EA0A 1S3SA 3BBPA 2ZXUA 1K5DA 4OJKA 3SNHA 4B35A 4ZIRA 2CJWA 1D2NA 2V9PA 3PUXA 4C0QC 1A5TA 2ZI9A 3NKVA 2ODEA 3B1ZA 5B64A 1E2EA 1HTWA 3OHMA 1KK2A 2EWWA 3TSWA 1KNXA 3KX2A 4YQFA 1NLZA 1P75A 1IOZA 4US0R 3TUJC 4TMVA 3GLFE 4L9SA 1E2HA 1HT1E 3U3KA 2OEPA 3NG1A 2WWYA 4C7OB 2YV5A 4KODA 2CNWD 5SZIA 1UAAA 1KY2A 1KKMA 4OK3A 3NH6A 3FKQA 1F6BA 4WAUA 1RW4A 4TL7A 4KLZA 2O8BB 1FTNA 4WVFA 1VCMA 1R5BA 2AWOA 2VP2A 2V4ZA 3GLGA 3O8CA 4TTRA 3CKLA 4EPYA 1LB1B 2AXPA 2BKEA 1AA9A 5J4HA 1HYQA 4JL8A 1PZNA 2ERXA 4IXMA 2B8TA 4WBSA 4DDTA 5CIWA 3VHLB 1GRQA 2OUKA 1Z47A 2XITA 3N2EA 4HI0E 4UNSA 3K70D 4YXWA 1AS0A 2J1LA 2QG6A 1Z6YA 3OEEA 2HXYA 1Z0DA 3FMOB 1XXHE 5G41A 2JDID 4LY6A 1JB1A 2ZJAA 4BLOA 4BFSA 3I3SR 2F7SA 3RRZA 3OFND 4DLUA 4PQFA 4LC0A 1NVUQ 2ZAMA 1RYHA 1D2EA 5C1BA 4ZCLA 4BE7B 1IN7A 2JDIA 5DYGA 1K8RA 2GJSA 1ZW6A 1W4BA 3RS0A 3TK1A 3AF2A 3UANA 4M1WA 3ZIAA 5JJKA 1E0SA 3M0EA 2H57A 4NBSA 1W2GA 1IBRA 1AQYA 4CRWB 3K0AA 2WOOA 3NTUA 4Q9LA 3LX5A 3QPUA 4Q19A 5A5GA 4OI0A 3AM1A 3EPHA 1ZM4A 3JVUA 3GJ8A 1ZU4A 2ORIA 3KKQA 1NVVQ 3CRVA 4KSBA 2Z4RA 1W36C 5C4MA 1X8JA 2G0NA 3Q5EA 1J70A 4B32A 2EWVA 4RD3A 2WPDA 4JYBA 5BN5A 2IXEA 4DLZA 4AD8A 5EP2A 2WBLC 2NOAA 3TVTA 4N0DA 1E2MA 2JLYA 4FWTA 1VCOA 1WA5A 3TMKA 1Q1ZA 4URXR 1D6JA 5IHPA 1G7TA 2JGNA 2O52A 4I1OA 4L8GA 5IT5A 4JLNA 1DAMA 2XTMA 1NG9A 4ACBA 3H2YA 1WMSA 3FWYA 5CB6A 2QT1A 2ZE8A 3K0AB 1COWD 3QXXA 3R9IA 2V8OA 4QGHA 1HUQA 2ATVA 4MUAA 4XIGS 5KTYA 4UNPA 3X1YA 3EAQA 1NBME 4D0GA 2CLCX 2YWEA 3OAAD 5CB8A 2YNMA 2FZ4A 621PA 1PVOA 5TY0A 3EPLA 3WYGA 3QSYA 4M9XA 1YZLA 2C95A 3K0CA 5HZKA 3P27A 2RGNA 4UXIA 4LBVA 1G16A 1MOZA 1NN1A 3EC1A 3LW7A 1J8YF 2Q3FA 2IXGA 2YINC 1UJ2A 3AVOA 4JLDA 1W4CA 1CRPA 1F2UA 2LWIA 1E79A 3VNVA 3RRNA 4CYMA 4ZKDA 3NBZC 4Q5IA 2IHYA 4M1TA 3EC2A 2IWHA 5FUYA 5A0FA 3B1WA 4NDZA 4Z1MD 2J0QA 3U5ZB 4ZI2A 3UXMA 5F3WB 2O8CB 1XZPA 3IBGA 5GVSA 4A8JA 2JLSA 3AVVA 4URUR 5FTNA 1W47A 2NQ2C 4TSFD 1R5NA 2IF2A 2ZREA 2VPPA 2ZJ2A 3RLFA 4BRWA 4C0SA 4DEYA 1U99A 4BECA 3VQTA 1WBDA 5AJZA 3QKSA 4A6XA 4DT1A 3BJIC 2ZJBA 2ORVA 3M1IA 3KUCA 2P3SA 2QAJA 1W0KA 1W5SA 4IVPA 3OEHA 4QOSA 4A15A 3X1ZA 4AKHA 4XVQA 1XTKA 5TARA 4V03A 5KNBA 1P9RA 1OYWA 3GLHA 4LV8B 5JRZA 3SQWA 2QMOA 1Z28A 5C18A 2FWRA 3MRSA 3MGCA 1ZM2A 5GVRA 3EASA 1KSHA 3ZLJA 1K5GA 3SE0A 1XEWY 2QSZA 1KKLA 2PL3A 3RWOA 4GDFA 5DSZA 1R0WA 4IKEA 2ZS7A 4B3XA 1YZTA 2CK3A 2WWWA 4DLWA 4ERNA 2J59A 2NIPA 3IQXA 4QHYA 5FFMA 1S9HA 2G3YA 5F2EA 3ZVRA 4EJSA 4NCHA 1FTSA 1V43A 1G64A 4A0FA 1QF9A 1QG2A 3IDQA 3BH6A 5JLJA 3RC3A 1F2TB 2QL6A 4JT4A 4EAQA 2EFGA 4V0ME 5G3ZA 1LW7A 1EFRA 1E96A 1OIVA 4AKIA 2VHJA 1YR6A 3NEJA 3EPKA 3LVRE 5TVKA 2XZPA 2A5DA 1H65A 5FPTA 4TZ6A 4IVRA 4BLSA 5DN6A 1P4SA 1FQKA 4QBGB 5FR1A 4P33A 1TL7C 2V7QA 2XB4A 4V0MA 1LF5A 3VNUA 4XSHA 1Z6AA 4FINA 2ZRGA 4MQBA 4Q4JB 2OT3B 5JBQA 4W7SA 4B2PA 3B8HA 5DI9A 1ZYUA 1EFRD 1T3SA 5B58C 2CDNA 3AVYA 4PX9A 2WTUA 3SR0A 3SI7A 3U4QA 2QY9A 4EIWA 4G5GA 2IS4A 1P9WA 2HEIA 2I1VB 2WIBA 1UDXA 4XJXA 1JAHA 2H18A 4B3GA 1XZQA 1N3BA 2G9NA 4Q7KA 1W4RA 5IF9A 1E9BA 3ND9A 3GEEA 4JIMA 4PSAA 2D2FA 1XNJA 3RS4A 1FP7A 4A9AA 5H8WA 1I2DA 1DAKA 4M4SA 4PC1A 1KYIA 1H8HA 3TGPA 1J90A 3VR6A 5H1YA 1OPXA 1VG9B 2F3RA 3ZZUA 4B3FX 1DAIA 2QAGA 4GRAA 1OH6A 2YOFA 4FMBB 4XD7D 1S3GA 3CM0A 3EPJA 4PO9A 2WZQA 5EP1A 2OAQ1 2QTHA 1XMIA 1M34E 3OE7A 3T35A 2IYQA 3IPYA 3PJRA 2O8DB 1I4LD 2ZYVX 4BASA 3U4QB 1RC8A 1E94E 5FH9A 1HH4A 2VP6A 3QY0A 2AFIE 1VHTA 2W2XA 1J7KA 1NVVR 1W7AA 1Q20A 3I1FA 4TQUS 1KSGA 1O3YA 1Q1QA 1ZUNB 4A2WA 4P4SB 4A1FA 3ECCA 1UBCA 4DWJA 4U7DA 4TN1A 2WJGA 5KYKA 4AKGA 1GP2A 2GF0A 1SVOA 4H9GA 5GJBA 4JVMA 4DSTA 4OJQA 5FTLA 3LQRA 3H0KA 2O8EB 3F3YA 2ZI4A 1WXQA 1XMSA 3AUXA 2QEQA 4MKGA 1ESNA 5DHAA 5FUXA 3SS8A 1LS6A 4FCTA 2D7DA 2F55A 4M22A 2R6AA 3QG5A 1Y3AA 4S2EA 1NNEA 4MITA 1EWQA 3K0FB 2QAGB 4TLCA 2FV8A 4FWIB 3O47A 4Y0AA 1II0A 4ESVA 3TAUA 1KGDA 2BMFA 4L4UA 2GVZC 3FGNA 4DHEA 3ADBA 4KU4A 2XGJA 5IK2D 3CX7A 2XTNA 1MV5A 1UBGA 3BFXA 4JLMA 1HQCA 1O87A 2ZROA 3U44B 5D3MB 1XU4A 3VR1A 3U61B 1E1QA 4II7A 2BVNA 2IXFA 2R65A 5AJVB 4DLXA 1TUEA 2WJVA 4JKYA 2ZETA 1CXZA 1N6RA 4TLEA 2MMCA 2JLXA 1FQJA 1GNQA 3V4FA 3CX8A 1W1WA 5KSZA 5H68A 3BK7A 3FDIA 2P6UA 3C5CA 1NVWQ 4OQMA 1JPNA 2WMNB 1LF0A 4DKXA 1ZU5A 1GAJA 1SXJE 4EPRA 3I4LA 3IEUA 2N42A 1P5ZB 2HF9A 1E1QD 3LX8A 1FX0A 2RH5A 1KHTA 1Q12A 4WZ6A 1ZNZA 3IO3A 1GOTA 1SVWA 2FJUA 3ZVNA 4MGIR 1KMQA 1QHNA 3KKPA 4TLAA 2PJZA 3U44A 1OHHD 3L2OB 4OYHA 3UG6A 4O3MA 6Q21A 2FPMA 1OKKA 2BBWA 3ICEA 2X8AA 5JMTA 3I61A 3GLGB 3CH5A 1EFHA 1W44A 4BFVA 3LXXA 3PCRB 1XXHB 3PQCA 3EW9A 5L3RA 4C0AC 4I1SA 4KFRA 5AJXA 5HCIA 3PUWA 2FSFA 4OQNA 2ZSAA 1SVSA 4O0MA 2IYWA 2OILA 2RHDA 3EZ2A 1CU1A 2W00A 2FFBA 2V54A 1PLJA 2CCKA 1FNMA 3QENA 3P26A 5EXPA 1NIJA 3VU9A 2PEYA 1GUAA 4XWOA 1Z0FA 3E2IA 1GILA 4G5OA 4BLPA 3KQKA 2REXB 1DAHA 3QF4B 2H17A 1Z08A 3UMRA 1L4UA 1X6VA 3KJGA 3MSXA 4PQYA 1KO7A 3R20A 3OEED 1DE0A 2BEKA 2QM7A 5J47A 4W9MC 1E32A 1P9NA 4XVUA 1E4YA 4B71A 3FHOA 1EFUA 2VP4A 1TU4A 5EZ5A 1GL9B 1NMZA 3PUZA 5K8UA 2V1XA 4KHZA 3CWZA 1NN3A 1Z83A 4PAMA 1T5IA 2R6CA 1OKKD 4M21A 2DWQA 1KY3A 3C8UA 4CVNA 4JJKA 2VP9A 2FPKA 4PC7A 1K6MA 4Q1BA 1E9CA 2P6NA 5LDDC 4KSCA 3MAAC 4QJ5A 1E2JA 3AKYA 2FMXA 3L0OA 5JZVA 4CEHB 1G6OA 1KI7A 4Q66C 1M8PA 2WJIA 4I81A 4MYHA 2XOKA 4DUGA 4F4IA 2VQSA 5ELXA 1HT2E 1U94A 4DCUA 2NPIA 2JA1A 3AF3A 1F5NA 1AJEA 3NIBA 4DIEA 2AKYA 3OZXA 4C3ZA 1X8KA 3W5IA 5JS8A 2QPAA 4FCVA 1W0JA 221PA 1Q0UA 3FE2A 4NTZA 1V5WA 2XSZA 3AF1A 2HT1A 1AKYA 2WSSD 2RGAA 4JBWA 2GCOA 1TAGA 1OFUX 1P2SA 4LC1A 2B6HA 1GL7A 2HYDA 2ZUDA 3VHXA 2GJAA 3LWNA 3A1VA 2IC5A 1DO2A 3WY9A 4DC9A 3AVQA 5EE9A 3FKSA 1Z0KA 1CBUA 1ZIOA 1YRBA 1MABA 2WKRA 4B6EA 3CWQA 1VECA 4NPHA 2G0TA 1Z6XA 3QVUA 5FOTA 3IEVA 2WJYA 3T5GA 2CVHA 4X8LA 3WYAA 1HURA 521PA 2RGGA 3OIVA 1VG8A 1XWIA 2KBEA 4MRSA 1A2BA 1OIWA 5E4FA 1ZIPA 1XJ0A 4JS0A 4PPNA 5CJPA 1BH2A 5AK0A 3HR7A 3QXCA 1E1RD 4A36A 3SYNA 2ANBA 4GL2A 1T5LA 1YRAA 1COWA 2O8CA 1ZM3A 3RAPR 3AVUA 4A8JB 3EA5A 4RSGA 2IUTA 1QHXA 1G8FA 3KL4A 2H8KA 4AG5A 4FMCB 4NKRA 4Z51A 1GKUB 3Q8XB 2W2VA 5C4GB 1MABB 2IYTA 4OQLA 4JLKA 1VYVA 4DLSA 2QMEA 2IUSA 3D31A 4HB3A 4DDUA 3FMPB 1H8EA 4NCKA 1JR3E 2CL6X 2OCPA 2VYFA 4G5QA 1CEEA 4UKDA 2E9SA 4DSUA 3FB4A 3RC8A 4MRVA 1G4UR 2A30A 3PG5A 3EZ7A 1H8ED 4TYQA 1IN6A 1YR9A 4JBXA 2JATA 2W6ID 1XTSA 1LV7A 2BCJQ 1FMLA 4LJAA 2JAQA 3L82B 5TV2A 4FW9A 2QQEA 3VKGA 4N3NA 4C9BA 4KYUA 1R0YA 5F9HA 1NLYA 2XEXA
chains in the Genus database with same CATH superfamily
3NM4A 4BO5A 2R5NA 2ZIWB 3RKRA 3GLSA 1JKXA 2JJ1A 3STHA 2F1OA 1SURA 2PZFA 3FGZA 3H11B 3GVXA 1UDBA 4L4SA 1HKUA 3OU6A 4A82A 3GPLA 3HZOA 2B2XA 4PLTA 1W0KD 2BKUA 2RARA 3MAJA 4CEIB 4HLDA 1J9GA 1NSFA 2Y68A 3HKEA 2Z8XA 1KETA 3MJRA 3AR5A 3NBYC 3VVBA 1Q11A 2W6JA 3R6WA 2ZRHA 3X1WA 3ANTA 4EFMA 2RAUA 1RHJA 4HWRA 4E0BA 3QHQA 1NE7A 1UM8A 1BD4A 2VT3A 3FSRA 3H3FA 3Q7TA 3Q98A 2LBPA 4RY9A 4AZWA 3L4BA 4FJ1A 3CUYA 1B14A 3NBFA 5BT8A 5KTTA 1UINA 2ZVPX 2XUGA 3S1LA 1GZSA 4YCNA 3MJ4A 1A2QA 1BWRA 2BUBA 4EB6A 3N75A 4HLCA 1Q3HA 3DKRA 1XU9A 3SJCA 4YUZA 1E9EA 5ARCA 3I8OA 2GZMA 1PYGA 2GFIA 2EZ9A 4QC2A 3OHPA 4WFQA 1PJCA 1KEZA 2V1UA 3MD0A 2I9KA 4KXXA 2WF5A 3RK1A 4F3KA 3ZZMA 3D59A 4HJRA 1BMFD 2LCFA 2C83A 1JIJA 2ZJ7A 3HYSA 4P81A 3WMXA 4M8LA 3TLCA 2PGNA 2I4OA 1L5WA 1D7OA 2IGBA 2Q8NA 2TMYA 1F3OA 3HRHA 4IS2A 3RHTA 3WYNA 5I7EA 3A9WA 3LT5A 3OOJA 4IIJA 1LDBA 4JYMA 4MVJM 1RAIA 3HI6A 4M1EA 2IFTA 2YIVX 1X86B 3T9DA 3ZDZB 1JFRA 2FW8A 4DM3A 1W25A 2WUGA 5I47A 2C9BA 2WYVA 1UODA 4PYMA 5FBQB 2ZUFA 1YL6A 1S2OA 3KPUA 4QDZA 5FPHA 3S8YA 3MB8A 4O33A 4Q1CA 1EHIA 2OXFA 5K3FA 5BW4A 2E5LB 4QDXA 4NH4A 2YYSA 4R1SA 2EERA 4XYEA 1YZ3A 1YE3A 4HTAA 2BV3A 2I6GA 4F56A 1WO8A 2QP3A 1N6PA 3CSUA 3LQQA 3PFHA 4N49A 4UEKA 5BWLA 2DMRA 5CM9C 3WTBA 1ZP6A 3D2BA 3NO4A 3MPOA 4MKHA 4TV9B 1XXLA 3SYLA 3PVZA 3T7JA 5F64A 3HJUA 1RC0A 1WSDA 2EKQA 2HLDA 4KW7A 3V2HA 1ZUNA 1VPWA 2FN7A 1VA5A 1F60A 1AY0A 1PT6A 1NNI1 3C7KA 3D8NA 3PUKA 4G0ZA 4IHQA 1J2UA 2CLFB 2HOQA 2YHBA 3L8EA 5U1PA 3LUBA 1Y5IA 1EK0A 3UXEA 1R18A 1YFKA 3CPHA 5FPPA 1VHWA 1JU4A 1O6BA 2FX5A 1D0SA 2IYOA 3PDIA 3TNFA 2H4HA 2W8BA 3NPAA 5JCZA 4GF5A 1ABEA 1I3MA 2AOXA 5KQRA 5AMXA 3QX9A 1CUUA 2ZZNA 2QMZA 4JFRA 2Q4TA 4WNCA 2SKEA 4G1UC 5ETJA 1BEZA 2O48X 1K7CA 1PJLA 2IY7A 4NBVA 3D3JA 4IDDA 3BJMA 3ME5A 5JXIA 1QIGA 2JCXA 2RAPA 2FUKA 3KZ1E 4WLOA 3SSAA 3U6KA 1TZCA 4M0FA 1JP7A 3LECA 3H9GA 3Q7RA 4LYGA 1RS0A 5FWYA 1A5AB 3JV7A 1GR1A 4PG4A 4TS4A 4TSFA 5ALPA 2WB4A 1DJQA 1N2EA 1J97A 4BVJA 1N2IA 3DD5A 1BQ3A 2IYXA 4JJIA 5C8YA 3T9BA 1Q17A 1OWOA 1RPNA 2GO1A 4AY2A 2ZI7A 1H0RA 3DV2A 4W6ZA 2EU8A 4TYWA 5G1OA 2YZGA 4OJMX 1IXYA 3ZQ4A 3FOZA 2F1HA 3CW2A 3Q3VA 2Y0EA 1U8CB 3A6DA 2JH8A 2FJ0A 4MQFB 3TVDA 1X13A 1VMEA 4W9NA 2FZWA 3UB3A 5I8PA 3K2EA 1MG5A 1G17A 4ABYA 4NBLA 2C82A 4YR9A 3GAZA 1DJMA 4YJHA 3ZCRA 1PYDA 2NZVG 3D8UA 1T2DA 2UU9B 2IYUA 3D4PA 1ONBA 4XIFA 2O2IA 4GSYA 5L6MB 2PVCA 1UR5A 5JWHA 4BFZA 1B0ZA 1QH1A 1P7CA 3FCXA 4OTZA 4V2UA 5ED4A 1T8PA 2FPWA 2VPIA 3BHNA 1HNNA 5A4KA 2RB5A 5DNAA 2ACWA 4RHCA 1NXPA 4OG2A 4GDMA 2RIPA 3ZHBA 4QTXA 5TQ2A 3N70A 1M10A 4H16A 4ZTUB 2Z2JA 1PR6A 1EFDN 1B15A 1Y7TA 2GCNA 2AQ8A 2BR3A 5LOVF 4UATA 2G4LA 1J8FA 3EXFA 1X1SA 3JQFC 1GRRA 2FFAA 1G6HA 3RB8A 3ZK9A 5HP4A 3ER8A 4AN0A 1DBPA 2BONA 3FPCA 1W2HA 1D03A 2PKEA 3K1TA 3GCGA 5J4KA 1BXRB 3KZVA 1WEHA 3NKLA 3MWGA 3UMJA 4DIOA 4E1AA 4NMMA 4FX5A 2L18A 1PBTA 1SZDA 4UOQA 5CCDA 4I3FA 3RAGA 3UWOA 4NZZA 2H2WA 3I2IA 4WERA 1KRHA 4MR8A 5CYFA 2VRBA 3I8SA 4C7KA 3UF0A 2X2FA 4XUDA 1IULA 1JFTA 1AH2A 2YOHA 1LTQA 2I1WA 5IBQA 4PCVA 4X90A 4WV3A 4OHWA 4U3JA 4O4IA 3SJAA 4POAA 3T0FA 2RGWA 3TGWA 1BKSB 2VH1A 3I32A 4PG7A 3BWCA 2HA6A 4H31A 3ZI7A 3Q3HA 4D0SA 2XXBA 2IYSA 4M0MA 4OI1A 4PC6A 1NVFA 2V8BA 1KRWA 4EHBA 4CBVA 1HZZC 2PGDA 1ZH4A 3OF2A 4PICA 4ZDJA 3CIOA 1RHUA 3L6RA 1NF3A 3AM5A 1SZCA 4OLFA 1V8FA 2P2GA 4YBRA 4F97A 5B6PA 4RGBA 5JATA 5JPCA 2ZJZA 3V8BA 2AN1A 4DCMA 1JHPA 4FC7A 3UM9A 4BLTA 1JE0A 4ESHA 9LDBA 1XNRB 1NUPA 2IYPA 3RS9A 1J0BA 1BXRA 2WKSA 5JS7A 4YRNA 1EFVA 4TMXA 3U13A 1KI9A 5K8IA 2PS3A 3N8GA 5COAA 2I6TA 2QTVA 4ZP1A 3SM9A 1O03A 2WFMA 4IYJA 2V9ZA 4BYMA 1ZD9A 1H2EA 1RXYA 3D8RA 3OE7D 3F7TA 4LJSA 1UK6A 1ZD4A 2ODBA 1W5TA 3COSA 3WO1A 2LIVA 3DGFC 4O4IB 3O8QB 1SA0A 3ZWOA 3UV3A 4N7RA 4IEEA 4RH3A 3NHAA 5F5NA 4XD7A 3RS3A 5JSKA 1K4YA 3OQIA 1BCSB 4DVJA 1FMTA 1L5MA 2NO5A 4F91B 1E9FA 1P33A 1Z7WA 1TD9A 1C1YA 5K3OA 1ZGCA 1DX6A 2GCPA 1NKTA 3ESQA 4KQ2A 3LUDA 3ENKA 4EO7A 3VH4A 2EQBA 3PNYA 1II8A 3G0CA 1QVRA 4E4YA 2QRQA 1Y7HA 1E18A 2WJJA 1EQAA 4WESB 1BVHA 5CPBA 4BO9A 4G85A 3WLQA 1VI2A 5I6DA 4N5DA 3LF1A 1ZL2A 3H99A 4TXJA 4XD2A 4FM9A 4X3CA 3FPHA 2ZCVA 3KZMA 4B33A 3FCSB 5KOHB 3C3EA 4YFYA 4H77A 4MR7A 1MT0A 1TVMA 1XQVA 1GGMA 1SUCA 2E87A 3DM5A 4BP3A 3PIIA 3DYIA 5DIFA 2GBGA 1OYVA 4BX8A 2B1QA 1UBEA 4KNWA 1UC5B 3NBMA 4F9FA 1OXXK 4ZHQF 4C0JA 3E9QA 2ON6A 4FGSA 3TIXB 2Q41A 4B48A 4G8CA 3ZLUA 3SLKA 1O9HA 3NBQA 5CA0F 1ZRMA 2VP5A 2XQIA 3BERA 1FSPA 1IJEA 2E6UX 3BIWA 1O0BA 3KC2A 4UEWA 3V8NA 1SUSA 3PRKE 1WV0A 1T1IA 3A06A 3WKBA 1P6QA 3ZJUA 3IEKA 3ZDAA 4UU1A 2AJCA 1UBFA 3IQWA 4YP6A 4BX2A 1BKDR 1WDMA 3QBEA 2KPOA 1G2QA 4MUMA 3UJ6A 3LQFA 4YLGA 2GZHA 2XUKA 2Q3LA 1NFQA 3G5TA 3GNQA 1OQAA 3JWGA 4Q9AA 5DLDA 3WLHA 421PA 5MN6A 1ZCAA 1GUDA 1YB7A 5CEFA 3LT0A 1ZSYA 3E8XA 4CKBB 4G07A 4RSRA 3ROZA 2NG1A 5BSWA 3LCRA 4AJ4A 4DPMA 2ZM6B 1AT1A 1FDOA 3PC3A 4FBMA 3TVYA 5LA6F 4BJ1A 3DAOA 3ENWA 2J08A 3U56A 2ZANA 5AWFC 1W5FA 3GZTB 5LCXA 2VHUA 4TVSA 2C94A 4L1KA 4LCBA 4LGYA 4R3UC 1QJCA 1E9VA 2J87A 1UWVA 1Y42X 2HQ1A 3PFIA 1SH7A 1UMDB 2F1JA 4GVLA 4EDHA 2YDXA 3RV3A 3NTRA 1WBJB 2BUAA 3PSAA 4FYYA 2L69A 1NVAA 2HSZA 1MT3A 2AQHA 4Q03A 3KKKA 3IE2A 3IVGA 3S28A 2JB9A 1Y8ZA 1I7PA 3P0JA 2HM7A 3AR6A 3TJMA 3ZCXA 3OCYA 3IHTA 4PQGA 3VISA 2KE5A 2O3QA 3GEGA 1TNDA 1Z0JA 1KIFA 4K1XA 4OIMA 3S1AA 3LWBA 4S12A 3SIRA 1JHQA 5AI4A 3X2SA 3WSTA 1XYYA 1BG6A 2ICAA 5ALEA 1K7SN 4E7PA 3BCUA 3GDOA 4Z99A 1GJRA 1MQAA 2BKAA 4EPXA 5L4NA 2PZMA 4FFSA 4O4LF 3N2KA 3BL6A 4AVYA 3BFVA 1NVMB 4ANFA 3PE3A 1KI8A 1QHEA 1M0EA 3W1EA 3A9RA 2ZATA 2ZDQA 1AX9A 3A32A 3M3PA 1MJFA 3Q0TA 4QWWA 4QTYA 1M34A 1DL5A 4RAOA 2F1RA 4Q7MB 2PSFA 4GIBA 3QX8A 3COPA 4XI9A 5KAPA 4KE9A 1RC1A 3ZWWA 4AL4A 1G5TA 3OX3A 1UFOA 5CAEA 1XZBA 2GN2A 2JLBA 2ZBPA 4BLWA 3T3NA 1TM4E 2PS9A 2WI8A 3CV3A 1ISIA 3STXA 3SXJA 3UHPA 4QPJC 2O0HA 4P1ZA 1N75A 2YKGA 1LI4A 2RHHA 3GDFA 2MINA 5KHAA 4Q7LA 3IUNA 2ZIAA 1ADCA 1J9ZA 1H93A 1GGFA 1GYQA 4U7JA 3OZTA 4PV7A 4BCCA 2ETVA 1N2SA 1T13A 2BR5A 1JEYA 2OXTA 1R8XA 1IAQA 1FNDA 4P4SA 3QPDA 4TRRA 2R11A 3EMBA 3HNRA 2H2FA 2VNJA 3MMNA 3PR1A 1I5EA 1BSVA 4RU1A 2J7PA 1AMUA 3OM9A 4YRRA 2PH1A 4BPRA 4ZU6X 2WNSA 3AETB 3EVGA 4TXMA 2ZI6A 4LDRA 1JWAB 3KT6A 3P2IA 3E3NA 4TS3A 3C5VA 4L0DA 3PXCX 1WXWA 4PX3A 4PPFA 4YV2A 4ZIRB 5JMWA 2B5OA 5HEKA 3OQVA 2PX0A 1WB9A 5KYUA 2E49A 1IRXA 3QA9A 1NA5A 1RTTA 2OMEA 2PZGA 2BGTA 3GGCA 3H9BA 1FJGB 2HMUA 4Q3CA 3A1TA 4UHFA 4KRFA 4YMHA 5BXQC 1LPOA 4L28A 4TMFA 5CW2A 4FS8A 4V0RA 1SG6A 3I0ZA 5YASA 4AF7A 1FUKA 4WJLA 4BIMA 3BGWA 3THXB 2DQZA 3ZLBA 3NVKI 2VJBA 2PKQP 3AGPA 4KXWA 4OHXA 3F8TA 4TV9A 1Q16A 3AY0A 1PP4A 3JPYA 4W9NC 4B47A 3I6QA 1WETA 1JNYA 3EODA 3JQEA 3PXXA 3TW0A 2OYRA 1XSEA 3R7WB 1QE3A 2CDBA 4YAEA 4EGFA 2SKCA 2WR8A 4PLWA 2PJRA 1J1UA 4LZOA 1E1NA 1RQPA 4Z9BA 2WVJA 2AYYA 2W6MA 5LP1A 2ACVA 3WIVA 2QQ0A 3I2FA 4DG9A 4H15A 4D82A 7ADHA 2WUFA 3JYPA 4W8OA 1Z15A 3ERCA 5GIOE 1CRLA 4HWTA 4LPKA 4S35A 4WDRA 5HKOA 2IU6A 2WTNA 2WTBA 1XG5A 1LQ2A 5M04A 4KTVE 3TKAA 3CO0S 2H65A 2BGLA 4S2UA 1Z5PA 2CFIA 2GBIA 3WRVA 2XUZA 2VJKA 4ES6A 5KC8A 2PJDA 2GEKA 4I5DA 2PS1A 6CHYA 3AEKA 5TGZA 4FC6A 5KMGA 1OWPA 3NOVA 5JIBA 5BR4A 4Y2XA 3LP8A 1Y7IA 3N1UA 3E5RA 4KWTA 4NJOA 1MORA 3A37A 1CJMA 4FLEA 4CT0A 5FWYB 1MC1A 3C3YA 3FZQA 5BNWA 3WWZA 1DJOA 1T9ZA 1GQFA 2GK4A 2REOA 3AI7A 1AXRA 3E18A 3R5TA 4MI1A 4EBFA 4Z1OA 5DXFA 1XU7A 1HDXA 2EC5A 1JFFA 2GZRA 2J4DA 4TWIA 1RIFA 1UPXA 3CNOA 4URVR 3OLWA 1L7PA 3QU5A 5A3SA 2OMKA 3UPUA 5SYMA 5F3DA 1SFRA 5GONB 3KHUA 4RELA 3IEPA 2J5KA 4F46A 5KNDD 3VR2A 3P2EA 5EJFA 1NJFA 2ZSUA 1RHRA 1DEKA 3MCUA 4MVJP 3IE0A 5CD1A 1RFLA 2P4QA 3PEWA 3MLAA 5B2EA 3KAKA 1VB3A 5BN5B 4P86A 4OQ4A 1GN9A 4PIMA 3VH3A 5MN4A 3N6VA 1A9PA 1YE8A 3LG2A 3RF6A 2ZPTX 3SC2B 2XMRA 3AR8A 2OK8A 1ONNA 2Z9DA 3TX6A 5AD1A 2WSIA 1WB6A 4NECA 1CUEA 4CODB 1G5IA 2H4ZA 2OK7A 4I6GA 4B74A 1FC0A 5TXGA 4MJ3A 4OATA 3U39A 1GZVA 1PSZA 2GZSA 1EDOA 2RGNC 4Z9AA 1E2NA 1NP3A 3TQCA 2OQIA 3K70B 1XD2B 2C2MA 1JFFB 3RSFA 4MVYA 3FVTA 2EATA 2J3MA 2H06A 2OGSA 1ZJ6A 2IZ7A 3ZXIA 4JH0A 4MULA 2XYVA 2A5JA 2PWPA 2V7EA 1D3AA 4IJKA 1TCVA 1ML4A 4NSNA 4U2KA 4X94A 4HGZA 2H6EA 2C5EA 3ZJ5A 3P45A 1HGXA 2G17A 1R2QA 3CR7A 5G02A 1R4MB 4PQEA 4OFWA 2I65A 3FB1A 4RYDA 1LJ8A 3AJ8A 5HIKA 2MDTA 2FPUA 1NV9A 4ILEA 3VR4A 1EE2A 3IT1A 1DQPA 1YC5A 3JQBA 5A3VA 2ATIA 2F17A 2JC3A 1Z6GA 1ESZA 1S8FA 4C14A 3Q6IA 4HY3A 4LG1A 1T91A 2HRRA 3FYTA 4G5YA 1GZ7A 3ANLA 1FMCA 4B2IA 4DIDA 5HTOA 1K6IA 3UEOA 3CTPA 3BE4A 4QKQA 1JLLA 1F0YA 1PR4A 3RTEA 4WBNF 1JPJA 3MA0A 5H81A 3PGMA 5A0VA 5DH9A 1L7AA 3E2PA 2GAAA 4HP8A 4DV5B 2XYPA 4FQ8A 1A9YA 5CT5A 5LUAA 4I36A 4KKXB 1SXJD 3LYUA 2C9ZA 5BO5A 4YIHA 4GW3A 1QF7A 2Q6IA 3CE6A 4Q01A 3OUUA 1F0KA 1Y5MA 1U5BB 2NSYA 3RU2A 1KAHA 1YB6A 3PYXA 1M6HA 1QFYA 4XUGB 5AIAA 3H05A 3QVKA 4LZPA 3VI4B 4XCXA 5CVUA 4YHBA 2X2EA 3WXBA 4ZMRA 2BIFA 2X7XA 2WFZA 3CF4G 5AM4A 1U3CA 3U40A 3UAXA 3W9BA 2DPGA 1EEHA 3NR2A 3OQHA 4DZTA 1A9SA 1XZKA 3GEHA 3K4HA 4AUKA 1T15A 1U04A 3DFIA 4BVBA 3LCUA 5C35A 5KO2A 3DC2A 4DVGA 4GLJA 4LK3A 1VPLA 4BL5A 3H16A 5G0SA 5LNK6 4RDHA 1E61A 1NT2A 1YKFA 4ENSA 1GPBA 1RWPA 4OOEA 5DM4A 4LOLA 2CVOA 2B7CA 1OX6A 1QANA 2RGYA 4IQ0A 4M9SA 4Q1AA 3ZN2A 3EVZA 4R3NA 1GGJA 1PFUA 4CW7A 1OBVA 3Q0IA 1PX2A 5BNTA 4PYOA 1TUGA 1TVEA 2HA4A 2PZKA 4EJSB 4LV5B 2HUPA 3HU5A 1WZCA 1L5SA 1JU9A 1G55A 2XUFA 3PNLA 1GCIA 1TPYA 3R4CA 3M5WA 4NF2A 1A50B 1IN8A 3SQDA 1G6Q1 2R84A 4OLHA 1N0IA 4OB6A 1ONSA 4ZCPA 5IFKA 1GPUA 1KH3A 1VBMA 4PSCA 3WAGA 1OI4A 1QRSA 4R69A 1R6TA 2CFSA 2IGTA 3LPNA 1OA0A 2FWIA 4DV6B 1AKEA 3WYBA 1U7XA 2UZ4A 4F2DA 3UB2A 2OQRA 2DHQA 4M1KA 5IANA 4B3CA 2ZT6A 3ZV4A 1CUBA 1OLXA 2X9LA 3BHJA 3E5NA 1VJCA 3IOEA 3A1NA 2ODTX 3CX3A 3KR1A 4AK9A 5SICE 4RUKA 1GKYA 3QU4A 2WVHA 2IP1A 4WPGA 4D79A 1UWLA 1TM5E 1SU7A 5GZ1A 5LSAA 2I99A 4JEMA 2JFFA 1LH0A 5JJCA 1F9EA 2ZBGA 4ARZB 2XDQA 5GZ6A 4K8RB 1AZWA 5DMXA 3ANSA 2R6DA 4EKYA 3RAJA 4Z7QB 3DULA 5CH8A 2C1EA 1M5TA 2GKGA 3R6DA 2V7GA 3Q3GE 1NYLA 4HB4A 5K8UA 1DAGA 1QLWA 3PB3A 2ADOA 2JLRA 2O8FB 1FVXA 1DLJA 2B7LA 2QRHA 1U2TA 3SVZA 8OHMA 3BF7A 3BC1A 4RKEA 2I4RA 3K9GA 4JLVA 2I7DA 3KPVA 4JR0A 4JI6B 3ZDRA 2XHZA 1P73A 3AEYA 3NXSA 3ZTTA 4IDOA 3I9FA 2FQ1A 4NBTA 5ARBA 4Q3LA 1MJGA 3TWOA 3WLRA 1H6CA 1GG9A 3I9V1 4D3ZA 5AHKA 4BNNA 1C80A 1L4MA 2FMKA 1TIBA 2A9QA 1AUPA 1JA0A 3LTEA 1QR2A 3RYFA 2JEZA 3ANMA 3DWEX 4I1IA 5FDFA 3JSAA 4GXTA 3MWJA 3SDZA 1WXFA 1XZLA 2NU7B 2QVBA 3LLMA 4WNAB 3EZYA 4KR3A 3A1SA 3TXYA 1E0KA 3P9CA 4DDHA 3OLQA 2DUWA 1VIYA 3A4VA 4ARZA 5IRCD 1NBWB 4ER3A 3E23A 9ATCA 16PKA 3QE9Y 1F2TA 1G3UA 2B9EA 3U37A 3VAYA 3JQ6A 4F4UA 5JQGA 4Y2VA 3MTAA 4LSGA 2UYOA 4YDHB 5JRJA 4FI3F 2LDBA 3WGJA 4Y3UA 3F0TA 1J2JA 1N2OA 3VNRA 1R12A 1EX6A 4BLUA 3L46A 3ZDQA 2XZTA 5BSHA 5BR7A 3MRTA 2YTZA 2FEMA 3IUJA 4MKXA 3LLUA 1C14A 1GNTA 1O94D 4LNAA 4PQRA 3VUEA 2WQZA 3UJCA 2Z8YM 4YMLA 1H2XA 2A1IA 2H1VA 1V71A 2A1TR 4NE7A 3BJZA 1ULUA 1SB8A 4KXVA 1A2OA 1XFAA 2BMDA 4ZV9A 3RW9A 1FFSA 2BWJA 3HWX1 3SYTA 3ZY6A 1MRSA 2XNDA 2ZJ4A 5CAEB 4GPEA 2P9FA 1OJ7A 3H19A 2J0VA 5DVZA 2DWOA 2BEJA 2Z56A 5J5AA 3RODA 3T94A 3OE1A 1NGSA 1WULS 2V7UA 3OZUA 3U2QA 1DAOA 1FY2A 2M1XA 3LE8A 2AI1A 5AXDA 4EZIA 3VZPA 1JQKA 3QHAA 1BE8A 1UF9A 4FT2A 2L82A 3VRHA 1DTSA 3R5SA 2FR0A 1X7WA 1BZYA 2BAGA 3L7MA 3NHRA 2N46A 3D6MA 1AN9A 1KJZA 4D0NA 2CXSA 4C07A 2NNLD 1MO6A 4KXMA 1RYFA 3T4UA 3Q6NA 2FZVA 3AT1A 3C15C 2Q6TA 1XTQA 1BDIA 3JQAA 3RSHA 3A3NA 1PCXA 1SCUA 1AKNA 1JHXA 3CLSD 4JEUA 3EULA 3QUCA 4NV3A 4QFDA 4XPIA 4PSKA 5A5VA 3HK2A 2IEBA 3CEPB 3K6KA 4PHGA 2HQBA 2GZ3A 2WAXA 3SQXA 1JEQB 2P9CA 3ORQA 1EBBA 5D5QA 3U7JA 3LUAA 4K9OA 1TGVA 4UMEA 3OCWA 3BL5A 4HX9A 1TFRA 4WZAA 4EYSA 5L3SA 1Z33A 4IZ6A 4D9BA 1Z4KA 1KSFX 2Z9BA 3K9LA 3DLTA 3N59A 4DB2A 3GNSA 4M7RA 2PGJA 1SKYE 2Z04A 3HYCA 4YRIA 5J2TB 1I9CA 1OF1A 1V3TA 1Q22A 1JFVA 4AG3A 1JMKC 1VLQA 2UYCA 1UMKA 3ZIUA 1A5BB 1U9YA 821PA 2FLVA 4LMAA 1YTLA 2CDRA 4MYCA 4EFNA 1HG1A 3W90A 5CDSA 4TV9F 2NP6A 1ODCA 2YJ6A 4FHGA 1SXJA 3W6UA 4QBIA 2HHAA 1CWUA 3AVPA 2AOTB 3FPJA 4TTJA 3PCXA 2FE1A 4KFUA 2QORA 4BMNA 2UUOA 2VJDA 4WSOA 4A5SA 4EVQA 4G1VA 3T5CA 3K4QA 2BZ0A 4K5QA 4BKQA 4QUBA 5HPYB 1K3FA 4B75A 3FDFA 4NBUA 3Q2OA 1Z4NA 3L8HA 1M6NA 3ZWAA 2XKAA 2VDQB 1XD9A 2IJGX 4IDGA 2G9VA 4AJHA 3EZFA 1N6KA 1YZUA 1OX4A 2ZEJA 4HSEA 4QGSA 2CLDX 3M4NA 4FFMA 2E3JA 4DA6A 2OORA 3S0JA 3GHHA 3THRA 3PHBE 1CQIB 1N2HA 1OX5A 3Q72A 4KDFA 4EATA 3VZCA 1ZI6A 4H7IA 4C7OA 3S70A 3D8TA 5CD9A 1QZTA 3LHKA 3QWBA 4RD2A 2H1OA 5DTQA 4Q18A 4YJGA 1SD5A 2QRUA 4DQLA 4NOMA 5EIWA 1DT5A 1HETA 1D4FA 1ST3A 1XL0A 4WLFA 3CR8A 1EFPB 4E5MA 2OVBA 5L4LA 3T1NA 2P78A 1QYDA 3VKHA 1JZSA 1MDFA 3FR8A 3E70C 1WW3A 4FDTA 1UDCA 2C4HA 4L5IA 1Z0IA 2VJLA 3N2LA 5DGTA 1O0CA 5EZYB 2J5RA 3BXFA 1FLVA 4KXFB 3GZNB 2JRCA 2K87A 4IW3B 4WKGA 3UHJA 4PCUA 5IKEA 3WP1B 3V2IA 4B4WA 3EDMA 3TSZA 3WK7A 3WGUA 4P31A 3ADDA 1H6AA 2HXSA 4L5BA 5GGXA 3ZWMA 3NHBA 1QMGA 4EY7A 1NZFA 3ZHVA 4B81A 2HRZA 2XIQA 4PNZA 4ZVNA 2PFKA 3ZNOA 4X7RA 1T1JA 1ISRA 4KNYA 1YFZA 2WJWA 3GPIA 1J07A 4YRPA 1SVKA 1SUPA 4JLAA 3CB2A 4K3VA 2NTJA 1VJ5A 1U3DA 2BM9A 2K4MA 2RK6A 4GYWA 3LKZA 1MC5A 4M1OA 4TKUA 1XMOB 1QTRA 3VYUB 1DBSA 2WFLB 1CP3A 1YZNA 1D2HA 3H2SA 4QHSA 4DQKA 4KN8A 2DETA 3O91A 1BN7A 5F4ZA 2I80A 4U9IS 9MHTA 2UAGA 4ALMA 3VUFA 2XYQA 4IG9A 3R3XA 3BWVA 1T1RA 3BAZA 3I1IA 4V38A 3BBLA 4YS6A 4HDSA 1SHLA 1EESA 3FTQA 1EP9A 4JA0A 2BGMA 2JEOA 2YV3A 4JV5B 4LK2A 3F7OA 2SHKA 3QLUA 4XKJA 1PT8A 13PKA 1I2AA 2DRIA 3C4JA 4GVPA 4N39A 2ZIEA 4QBFA 4UC0A 1TQ6A 2QL5A 2B4YA 2KBFA 1XJ5A 4RMHA 7REQA 2NV6A 1ZK4A 3R3VA 4D4MA 4GI1A 1E59A 1UZAA 1WD7A 2ZRQA 3Q3EA 4Q4AB 5EXSA 3W8EA 4RXTA 4UDXX 4TWBA 1IJBA 4FONA 2H7CA 1IRIA 2W2MA 3ZC3A 1Y5NA 3F5FA 1I7DA 1FFAA 4KK3A 2EJVA 4HAVA 3DT6A 1D2CA 4NONA 4DCTA 4FFBB 2WP0A 4X60A 1A7JA 2HDHA 2O7NA 4JX9A 2WZBA 3W4JA 4I4TF 2Q5QA 1KS9A 4NZ9A 3GU3A 4R1QA 5JY6A 5LYJB 3AW9A 3AZPA 2PMEA 1OYYA 2OO3A 1A4UA 1XX6A 2OZVA 3DG9A 1U0EA 2VATA 1NLMA 4G3XA 2FDRA 2PGLA 3AGQA 3G5LA 3THSA 3QXSA 2GTHA 4G56A 2IHKA 4KL8S 3AF4A 3VPSA 4DM4A 3UY4A 3ZW8A 1J4AA 4GEGA 3U4DA 4BBJA 2V96A 2RBGA 3KUUA 1JIIA 3L05A 5ALQA 3TZQA 3UCEA 1H5NA 1OHHA 3UAGA 1RZUA 3T6KA 1UT5A 6GPBA 2IHVA 3UFBA 5AQEA 2FFHA 2N3ZA 1T6YA 3DZJA 3T7RA 5JAMA 3HBJA 1GGVA 2H5JA 4C2AA 3LHSA 1H94A 3VR5H 4F3YA 4MUGA 2G71A 2ZW9A 3IVXA 3N2GB 3OIWA 3C3BA 1HE1C 3WK6A 3GJ7A 3ZH9B 4EAAA 2CK3D 3G2MA 5K8VA 5EMKA 5J5CA 1ENPA 4CFYA 2RGEA 3ED1A 4LJ9A 3FPFA 1JS1X 2QX9A 2W71A 1JQEA 4RMJA 2GVNA 3W5VA 3NDJA 4PLHA 2AKAB 3GLKA 4IG4A 4CMIA 4BDSA 4D1YA 4C88A 4UCFA 1WW8A 1P6XA 3I76A 3OBBA 1ELOA 3SY8A 1CPYA 4UMVA 5CFZA 2P9YA 2AS0A 1JHUA 3G13A 3OEYA 1EFTA 1R0XA 5BSMA 3DPUA 3GMTA 2MSKA 4FIDA 4MJLA 3PWKA 4FOLA 5BV2P 4K6FA 3NRJA 3RYIA 3SU8A 1RM3A 1Y7PA 1XO1A 1WTCA 2M1ZA 3FUVA 4P3XA 3VPFA 4BO4A 5C53B 1CP2A 3DNFA 2R60A 1MC8A 1T5BA 2JJ1D 4FYXA 4O2BA 5E4YA 5AKGA 2ZWMA 1E6MA 1Z7BA 3A6JA 2OR3A 3U80A 4WLNA 4US2R 3K6JA 1P1KA 4ZVKA 5K0EA 1L5OA 3K3PA 3WK4A 4O63O 3EG9A 1GG2A 3D1LA 2P3OA 2LUOA 2BISA 3QKIA 4F7WA 1G0OA 4OXIA 4UPDA 4GOND 1KBZA 3V1MA 1HE8B 4CN9A 5JW6A 5KX5F 4W5QA 2C61A 3FG9A 3HB5X 5FBLB 3KM0A 1KYWA 3EG5A 3OSZA 2YC2C 3SHVA 5ECGC 4GUAA 3QXJA 2HQSA 3FUUA 3MGGA 2AX4A 1ZMBA 3VMFA 5H0IA 2Y99A 3DWGA 3SEFA 2V6GA 4WFJA 3HCBA 1U7OA 3WMWA 5LZ2A 1CT9A 4OHPA 5HFAA 2C0PA 1Z73A 1M6EX 3EFOB 1RI2A 2QENA 3S1AB 4BRUA 1HNXB 2OG1A 2W9XA 1SUIA 3NM6B 2WE7A 4NFLA 4YPVA 2VH5R 4ZKEA 3LVQE 1U0HC 1U2DA 2WV7A 4J0CA 1KYZA 7MDHA 4UASA 1SK9A 1TC2A 3H0EA 3NNNA 7YASA 2QX7A 4TGLA 4URYR 5DSXA 4D43A 2B21A 3Q5GA 4CR8A 4HEQA 3NNSA 2JVKA 3DAFA 4KPYA 4YJKA 3EG9B 2J9GA 2J31A 3LPAA 4GMFA 3SEAA 4LXHA 3H75A 4X64B 1NR5A 5KWEA 1JA1A 2ZXFA 2H1IA 3FROA 3OC6A 1GPH1 4E6EA 3SLGA 4MYTA 4PHFA 4MB0A 3L4SO 3NH9A 2D1SA 3WNDA 1FP4A 4ENVA 1W46A 2GXQA 1EZ4A 2WWFA 2RAVA 2XVXA 4WECA 3RFTA 4E5SA 1OH8A 1WCWA 2W7TA 1I36A 4F60A 2ZS8A 4RF4A 1XD8A 3PNQA 2BGJA 3DOOA 4M0KA 1YQ9A 4IQGA 3ROTA 2ZVJA 3FOFC 3Q88A 2PX6A 4B7CA 1KO4A 1JHYA 3VPGA 3ZNNA 5K09A 5BVGB 1MX9A 5JQGB 3DF9A 5I7FA 4HV4A 2EBUA 4NFSA 1J09A 1V6SA 1EYZA 5LXTF 2CEKA 1I2MA 2CHVA 3ITKA 4GI3A 2B7BA 1SQ0A 2MYUA 2LCIA 4JT2A 2J41A 1I24A 1X1QA 4WY5A 4ON9A 4MPJA 4BX3A 5AJWA 5BVHB 2UVQA 4B76A 1ZOSA 1EI9A 2A7QA 2R87A 2C3PA 3BB4A 5IABA 5DNYB 1T2NA 4LVOA 1CKEA 4Y2JA 5IMBA 3FTCA 4UVEA 4YRQA 4M0CA 4YGYA 5HJEA 4NS4A 2H31A 2OBYA 2W11A 4EL0A 5BN3B 3J81k 3UNXA 3ELWA 4RANA 4WN9A 5EVJA 5HF9A 1PV1A 3PQ7A 1QU3A 4DNFA 3R77A 4COOA 4IF4A 4JLPA 3R7FA 4JI2B 3HKBA 3HUUA 1O2DA 2JG3A 3QF7A 1PR1A 4BKOA 4DREA 1CUCA 2E37A 1W4AA 5EHNA 1NUTA 1MMFB 2JA2A 2XV1A 1P91A 3HDJA 1ENYA 4NNJA 5AW5A 2IK8A 4OKSA 4TTAA 2A0KA 2HWXA 2ZI3A 4OQYA 2QNRA 2WD8A 1SIOA 2CNDA 2XHEA 1RRFA 4JJ8A 4UM9D 3X1KA 3TCNA 3W3AD 3JQGB 4J1TA 2XUJA 5AVSA 3KZXA 3DH0A 3AKCA 3L6BA 3EVEA 2VQ6A 1L7EA 1NQTA 2Q1WA 3U31A 4MUJA 1LTKA 1TU3A 4NZYA 1F20A 7GPBA 1N8TA 1QE5A 4KREA 1ZH8A 4FKZA 2Q9AA 5KSYA 3WDSA 2OCYC 4W5HA 5F5XA 4WNYA 4Z4IA 3ER6A 4CM9D 4LY0A 4RESA 3F49S 5DBHX 3T5AA 3DONA 2QT0A 4FZ3A 4DSAA 3CF2A 1I10A 4RK0A 4HUTA 4BZXA 4C87A 2A5FA 4X6XA 2Y0DA 1DO8A 3MUNA 3GDHA 4UM8B 1TO2E 4DC1A 1RDFA 2GK6A 2J9RA 2XT6A 4OBXA 4D2IA 5J2TA 5LKRA 1GO2A 1JJVA 1P4GA 3ND6A 1L2TA 4V0QA 5JYBA 2X5XA 1T0BA 4P84A 1SVIA 2Q6OA 3KLNA 1RRCA 3LHDA 5MHTA 3PVCA 4O4LA 3WNQA 4DV1B 2R00C 4BO8A 1RJ9B 2OLEA 5TPZA 2XWSA 5LKAA 5G0VA 4MW0A 2ZUEA 2H2AA 1XDDA 1ORHA 3O4FA 4YO7A 5CDFE 4YP5A 5HUQA 4Y67A 3EXFB 4CNQA 1KAQA 4IX9A 1PFYA 1NU6A 4CM4B 4IXNA 3MOIA 4TTVA 3M6VA 2Q27A 4G5RA 4I4IA 3R7NA 3AG5A 3MYYA 4NR0A 2WV9A 1JG7A 3ETNA 3G89A 2Q0SA 3HEAA 3QWFA 5CIQA 1Y1QA 5CTJA 2EWMA 1CUDA 5JH7F 3V3TA 5E95A 1A69A 3DGEC 2I2XB 2QT9A 1O6GA 4JELA 4PM4A 3MT7A 1DAEA 5DLEA 1RXEA 2XNKA 2XLCA 2ZR0A 3K5PA 1PG2A 3KTAA 3A4NA 2IIBA 2CJYA 2BBOA 4RK4A 2ZSBA 3RUDA 1BHO1 1VMKA 2GJ9A 2RONA 1NW9B 2ZRAA 3CLUD 4NVRA 4RD4A 4QOJA 4TN5A 4D4HA 3ICVA 2GEVA 4IH9A 4M37A 4XTCS 3K9FC 1H1LB 2YASA 1B0PA 1T9BA 3ESXA 2BHLA 4ID3A 1OZGA 4TTSA 4UJ3A 4PG8A 3A1DA 3IDSA 4B4VA 2BT4A 3RIHA 3C39A 2AG6A 3R8FA 4I1RA 2EFHB 4CR7A 1VCIA 3WJAA 3ICOA 4L6CA 1F6DA 2W0MA 2WKPA 5HKKA 1CQJB 1TKAA 2R85A 4JOBA 1KK0A 1J21A 2WIAA 4JI5B 5KJ1A 4DDWA 2PUAA 1W