4QC2A

Crystal structure of lipopolysaccharide transport protein lptb in complex with atp and magnesium ions
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
b'ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
molecule tags Transport protein
source organism Escherichia coli
publication title Structural and functional studies of conserved nucleotide-binding protein LptB in lipopolysaccharide transport.
pubmed doi rcsb
total genus 78
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qc2A00
1L4YA 1S8FA 1YU9A 2FJUA 3QE0A 2IYTA 1G5PA 1FOEB 3A4NA 1W46A 1J8YF 1D2EA 3CZPA 3BB1A 3THYB 5JEEA 1WE2A 4PAMA 3KUCA 4A1FA 4LRWA 3GJ8A 3TUIC 1JECA 1OFTA 4TTPA 1TF2A 2HF9A 1G19A 3OE7D 4JLAA 1NBMA 1KIMA 4LI0A 2Z0MA 5EP1A 5FTNA 4D0LB 4ASUA 3TRFA 3N2IA 5GJVC 3MD0A 4UXJA 4JSYA 1AS2A 1E4VA 2R6GA 3EC1A 1E1QD 4IKEA 1MOZA 2Q9AA 4ON9A 1R0XA 1X1RA 1VYUA 3TW4A 2PLRA 4DKXA 1JR3D 4KYIB 1R6BX 4G5RA 2XEXA 4DWJA 2BEJA 2WV9A 5D3QA 3RS3A 5BN4A 4OI0A 2QP3A 2P5TB 4FWIB 3BC1A 1K5GA 3LH5A 4XWKA 1W49A 4HLUA 1SKYB 3GJ4A 4G0NA 4RJLA 3UIEA 3A1UA 1QBKC 5EE0A 4IDOA 1P2VA 2GZHA 1Z06A 3ADKA 1DARA 2C77A 3GLIE 1U8AA 2HEIA 5EP4A 2P67A 4DC9A 2DFKB 2KBFA 2MSCB 1YE8A 4MUAA 1ZIPA 4AK9A 3QKRA 4DZZA 3VNVA 4EQ6A 2ZM5A 5BYKA 2ODNA 1N6NA 1SZPA 3CH5A 5F98A 1LB1B 4K81B 3FKQA 1OIWA 2F55A 1G9XA 3X1YA 2VHCA 2ZI4A 3BWDD 4GL2A 1QHHB 3QVUA 3L0PA 4D81A 1TPZA 3EZ7A 3BB3A 4FCVA 4FCWA 1T3HA 4ARZB 1G291 2WZQA 3QSYA 5F9HA 1E2JA 1Z0KA 3LD9A 3TE6A 4ZI3A 2GHIA 3L0OA 3ND8A 3U61B 4DT1A 2OE2A 3RDPA 3QF4B 3TH5A 2HF8A 2W2XA 4OKSA 1J7KA 2O8EB 1JXOA 2YHSA 4PHTA 3AVTA 4B48A 4URYR 1UBGA 1L8QA 1HQCA 4I1OA 4BLOA 2FN4A 4B32A 5DNYB 3FPAA 1KOFA 1TTTA 2CEAA 2RGBA 4QGHA 1OB2A 2IF0A 1XXHA 2F6RA 3HDTA 4L9WA 1E94E 4D0NA 2OG2A 2G0NA 2QEQA 1TU4A 1XD9A 2V3CC 1ZYUA 3GEIA 2G0TA 2J1LA 3LW8A 5D3MB 3R20A 2CCKA 3DM5A 2QM7A 1HE1C 3PEUA 1W0JA 4U00A 4Z8YA 3IEVA 3KL4A 3AF3A 1VG9B 4UNSA 2QAGA 3LQRA 5B2ZA 3B7GA 4A2PA 2HT6A 3IILA 5CYOA 2REOA 2RMKA 4URWR 1KKLA 1NBMD 1GKIA 3V9PA 4D82A 1IBRA 1WRBA 3KUDA 2EYQA 2C96A 2W83A 3PUYA 2IUUA 1UKYA 1LY1A 4ZIRA 1JI0A 3CB4A 1N5JA 4WZ6A 2WJJA 1GITA 3B1YA 1EGAA 3UWKA 3BAFA 1ZUNB 2VH5R 1RFLA 2AFHE 3OZXA 2UVQA 1ODFA 1X8LA 1I4DD 3EPLA 2ZJ5A 4R98A 4OJQA 2AHOA 3R9WA 4BGDA 1CTQA 2MMCA 2XSZA 1OXUA 4Q4JB 1GL6A 4ABYA 4EPRA 5ELXA 1W36D 3NBZC 2LKDA 4WVFA 2BV3A 3A1SA 2ZE6A 3KFXA 4LY6A 1G17A 2BJWA 2HUPA 5B58C 1SVIA 3M0EA 1W4AA 5CB6A 2KWIA 1E69A 3FB4A 1SVMA 4Q1BA 4B71A 4LWZA 5FPSA 4KFRA 4DUGD 5JBQA 3DZ8A 4O2LA 4RZXA 3TGPA 2V9PA 1W48A 5UKDA 4DSNA 3I5YA 3EIHA 5C4MA 3I72A 3K53A 4RVCA 3IHWA 4EJSA 1NN3A 1W0KD 3CPEA 4EKDA 5JJIA 3L8ZA 4JJKA 1NY6A 1XZQA 4NYIQ 2VSXA 3ZS9A 4DDTA 2VP5A 4D25A 2QRZA 2ZTSA 1ZMXA 5DN6A 3RS2A 4A8JA 3EPHA 4GPTA 4X8LA 1QF9A 4JVLA 2G9NA 4Q19A 4I99A 1D9ZA 1W2HA 1ZP6A 1GOTA 2WMNB 3KXIA 3VKWA 1HT2E 1SVSA 5BXQC 2WWXA 5A0FA 3TNFA 3GJ0A 1QZXA 3NH9A 3R8FA 2V6IA 4BLSA 4I1UA 2Q6TA 1RYFA 2ZUBA 2WJHA 2ONKA 2QTFA 4LHZA 1KDRA 1Z2AA 3NWJA 4MRNA 1YZLA 3CF2A 1W4RA 1N0WA 1G3RA 2VP0A 2HJVA 1L4UA 2BWJA 1FZQA 2ORWA 3BE4A 4ZV4A 5L3VA 2GXAA 1R0WA 2FMXA 1KI9A 3B6EA 3B82A 2BJVA 5G53C 3TIFA 1R10A 2AKAB 3KX2A 3PFIA 4HZUB 3RABA 1BMFD 2P6UA 1PZNA 5IT5A 1AQYA 2PEYA 2CK3A 4HUQA 2YVUA 2ZRMA 3DZDA 4QRHA 1XMIA 2ZSDA 1W5SA 2H7VA 4NYJQ 4ESHA 3VFDA 4KITB 4HAWA 4ZO4A 3CR8A 4TLCA 4MDEA 1H65A 3UPUA 4A82A 2DYKA 4BFSA 2XOKA 4KO8A 2BOVA 4CF7A 4UXHA 3B5JA 2ZR7A 4BFVA 3B1VA 3NC1C 4CEIA 3QBVA 3NH6A 1WXQA 4UXIA 2PT7A 3B13B 2IK8A 2V8OA 4TL9A 5HE8A 4BLQA 2HLDA 2GK7A 2WJYA 3GJ7A 1XPOA 3BRWD 1XMJA 3VR5A 3HWSA 1DAEA 3EZ6A 4B3BA 4LSGA 5FL7D 2B7CA 3QXXA 4JL6A 4LCBA 4Q4HB 3VKGA 5C2JB 5KHOC 3SQWA 1FUKA 2D62A 2OCAA 1XTJA 2DPXA 4DEYA 5HCNA 3SC3A 1FQJA 3Q9LA 1VTKA 4UKDA 3ZQJA 2AK2A 3OEHA 2G6BA 2F9MA 2AK3A 2PH1A 2IT1A 3EZFA 1LF0A 2VP2A 2KB0A 1SKQA 1UDWA 4B6EA 4X8OA 5LDDC 2ZVQX 4KVGA 2CJWB 6Q21A 1S9HA 1ZAKA 4A36A 4D80A 2A78A 5ANRB 1GTVA 1UF9A 2VPPA 2WICA 1OXSC 1E2EA 1BIFA 3CZQA 1HQYE 2W00A 3GEHA 3ZS8A 1YJ5A 1E2KA 2AXPA 4LPSA 3OIYA 2OXRA 2BDTA 3TKLA 3HU1A 4KI0A 1E9EA 1JB1A 4TSFA 4MKGA 2RGGA 4JYCA 5FPHA 1E2NA 2FG5A 2G1JA 5HR5A 4LGMA 4XVQA 4DIEA 1PVOA 2KE5A 1VCIA 3CO5A 2F43A 4GI7A 3SJAA 4JLBA 4V0OA 5EXPA 1KO8A 2OV2A 1YRAA 3C5HA 3X1DA 2GAOA 2JLRA 3CR7A 1WDTA 2CBZA 1UKZA 1DAMA 4BRUA 1FMLA 2EW1A 4OYHA 4WAUA 2PX0A 3EA5A 4G5SA 4MYHA 1W47A 2EWWA 4ACAA 1GRQA 2CHGA 2V4ZA 3HR8A 1GRNA 4IOKA 4JVMA 4PO1A 4EPVA 1D5CA 4E07A 1DADA 4TLBA 3G5UA 2C9OA 4DLWA 1HURA 4FD2A 2IUSA 2JASA 1YZUA 4Q7MB 2ZJOA 5CJ2A 1N0UA 1VYTA 3EPKA 2PZEA 1B23P 2CMKA 4LJ5A 4NP6A 4IXMA 1P61B 1C9KA 3GFOA 4LDJA 4AYWA 5KNCA 1P72A 3U3OA 1G6OA 2C8VA 4KBGA 5G3ZA 1W7AA 2EFEB 4LBZA 4Q4JA 2Q9BA 3KQUA 4NTZA 4XH9B 4PPFA 3B85A 3L2OB 1KHTA 4BLPA 2FEMA 1KK2A 4WOPA 2ATVA 1XX6A 4YXWD 4AKEA 2TMKA 4BZXA 1Z0DA 2BBTA 1ZW6A 2QTVB 4Q00A 2XTMA 4Q4AB 3RNLA 4JLKA 2VRWA 3DKVA 3THXA 1CXZA 4MKHA 1AS3A 3T35A 4C9BA 4E22A 2EFCB 1MABA 2GXUA 4AKHA 4WXRA 3QENA 3VHXA 1Q0UA 1KO4A 5DI3B 1G64A 3BOSA 1MV5A 1G5RA 4OHWA 3EASA 3MUFA 1DG3A 2N1BA 4CIDA 1N0VC 2WOJA 1RVDA 4NCKA 3THWA 1EESA 4PTLA 1XP8A 3AKCA 5DYIA 1KNQA 2GJKA 1HEIA 1A5TA 4QHYA 4XOIA 5E95A 5J4VA 4PC7A 1COWD 4TMXA 1XDBA 2V55B 4QJ4A 2UZIR 1NG1A 4WA7A 4OQNA 5P21A 2B6HA 3HYRA 4M1YA 3THWB 2Q3FA 4I1VA 2A5GA 4KCGA 4MRVA 1WBBA 3A8TA 5DE3A 3X2SA 3LX5A 1JAIA 1BMFA 2PEZA 4DB4A 4DLVA 3BB4A 2NO0A 3LDAA 3QEJA 4TT3D 4B3DA 1KAOA 3AGPA 1HY3A 4PR0A 3CONA 5CLLA 5KSZA 4KU4A 1G7SA 5FOUA 5A4JA 1A82A 4DB2A 1E2HA 2REXB 1M7HA 3C14C 4C3ZA 3REFA 3GP8A 5FUVA 5EZ6B 3GLFE 5CDFA 3AKDA 4V0ME 5JRJA 1RJ9A 5KDLA 2V6JA 2Z4RA 5FFMA 1P7CA 1WB9A 4JSTA 1EFRA 1MO5A 1TADA 1NJFA 1N25A 2C95A 4JVNA 3H1TA 2H92A 5G41A 2B8WA 5L3QB 2WBLC 1E9BA 1KZGB 1NL3A 2FSHA 1CU1A 4H1VA 1JR6A 3FFAA 1TAGA 4CZ2A 5E4FA 4FIDA 5TB5A 4DEXA 1G7CA 5B57C 1N6KA 1YZGA 1F3OA 2OESA 2PLFA 3KKQA 4Z54A 5SZHB 3EX7C 3NTUA 2VSFA 5GJWC 5L3SB 4JIMA 1MT0A 2ZETA 3NBFA 4F93B 4MQBA 2MSDB 4OI2A 2JAQA 2QBYA 4IOJA 3MCAA 5GADl 3ZVMA 4V0LA 2HYIC 1G3QA 1ZBDA 1UKVY 3AUYA 3RYTC 4D4KA 2JEOA 2QMHA 3KFVA 4TTRA 4DLUA 4Q9IA 2XZPA 5J4LA 2OHFA 2Z5FA 4JLNA 5K8TA 2F43B 4C4PA 1FL9A 1Q3HA 4IOMA 1H8EA 3QKRB 1DO2A 2Z83A 2QSYA 4A92A 4PXAA 3IUYA 1SHZA 2MSEB 4MRSA 1S3GA 3LAWA 2QU8A 3NEYA 1WBDA 1YZKA 3PEVA 2FNAA 1J70A 2RCNA 1G8GA 4KLZA 3GMTA 4M1WA 2JIZA 3FHTA 3VX3A 4KSCA 3QF7A 4C0LA 3TUZC 2ZRJA 3TR5A 4ASUD 2OUKA 3MG9A 4C0SA 4M9SA 4E5UA 2KI5A 1P6XA 1OLOA 4FMCB 4PZYA 2HLDD 1E9AA 3C8UA 2ZJBA 4ZDWA 4N1AA 2NO9A 4MGZR 1NVVQ 3FHOA 2L0XA 5AJYA 3LQQA 2R6CA 3QPWA 4L8GA 4PSVA 1TQ4A 4TZ0A 3TQCA 3U44A 4QGAA 3U4QB 2FSFA 1RJ9B 3RS0A 1TEXA 1MRNA 2J7PD 4B3FX 5EE3A 4XVUA 1XJQA 3FE2A 5AK0A 1N5IA 2AL7A 4US1R 2OZEA 4PPNA 2FWRA 3H0KA 2PBRA 1Z83A 2BBSA 4JLOA 2B21A 1ZD9A 1CP2A 3CW2A 2C99A 3Q72A 4B74A 1E0SA 3WMGA 5BQ5A 1MR3F 4BECA 5DI9A 5JHGB 2H5EA 2XTZA 2CL6X 2WIBA 4CRWB 3M1IA 1E98A 4LBYA 4FN5A 1KO5A 5IRCD 5FBRB 1SXJD 3THYA 3AF0A 5EXTA 1FUUA 2WHXA 1JBKA 2IEZA 1NG9A 3ZZ0A 2VF7A 1W36C 5JMTA 1OJLA 4ESVA 4PPGA 3IO5A 1P2UA 2QM8A 4YLGA 3GJ3A 1A2BA 2FX3A 2IXGA 4LV6A 3PJRA 3HYTA 1Z6TA 3WNBA 2JA1A 3PG5A 4KSBA 2YWGA 1EWRA 1P62B 3UMFA 1ZUIA 1IXZA 1OH5A 1OH6A 3ICEA 2IXFA 1KZ7B 4FXPA 4EFMA 1WMSA 3OE7A 2LWIA 2A3RA 4M1TA 3UKDA 3MWKA 3R9XA 3CLVA 1SXJC 1KAGA 4QM6A 2O8CB 1L7VC 2GKSA 5JCZA 1NLFA 4UNPA 1KO1A 3I8SA 1XRJA 3L8YA 1W2GA 1VIYA 3K1JA 3KDSE 4GP6A 3VTKA 3ZVRA 4EUNA 3I62A 1DEKA 3R7WA 3T34A 3GFPA 1AA9A 3FMPB 1XPRA 1P75A 5KDDA 1XEXB 1OHHD 2YV5A 1I4TD 4TTQA 1IHUA 3WMEA 4B43A 4RD3A 2BCGY 1F60A 1FX0B 5FOXA 2GJ9A 4U5XA 2ZJAA 4G5GA 4AG6A 1ZRHA 5FI0B 2QQEA 1IONA 621PA 3GLGB 5KSPA 4OBEA 3ZH9B 1CS4C 1KI4A 4F4JA 3K0FA 3TVDA 2JLYA 1ONBA 1IN8A 4RD0A 2YWFA 3ZD7A 1Z0AA 4B2PA 3L82B 1Z6YA 2WSSA 3FOZA 4NCJA 3ZVNA 1KJWA 4Q9LA 3CRMA 1E3MA 1IJFA 1XJ0A 2J7KA 1M6NA 3K0AA 3P20A 3BFKA 2FFHA 3SYNA 4B76A 2JIZD 2PMDA 3W90A 4PAOA 2CCJA 1NI3A 2QNRA 521PA 2ZRHA 1YHNA 5FPTA 3QJYA 2WWHA 4Q5IA 4QGFA 4GOXA 2H17A 2O52A 4E09A 3EARA 4Z8XA 3PITA 3T5GA 8OHMA 3NBYC 5FOWA 1T91A 4ZI2A 1EXMA 3RSLA 2K5UA 3ASZA 4AD8A 3OF5A 4NPHA 1U0JA 2IUTA 3U44B 3U4QA 3DKPA 1KI8A 3TR0A 3RS7A 3KKOA 2ZS8A 1TX4B 2R8RA 4CT5A 2PCLA 3FVQA 1QHSA 3IQWA 4F4CA 4Q01A 2CLDX 4K8OA 3K9NA 4OHZA 1XFAA 4MGIR 3T61A 4HSEA 2YOFA 5F2EA 2PJRA 2GF9A 2BVNA 1KYIA 4BPBA 4NYMQ 3RRMA 3X1ZA 3MGCA 1R5BA 4NCIA 2FGKA 1E2GA 1ZD1A 1AKEA 1GKYA 2QAGC 3QI2A 1T6NA 3GLHB 3QKTA 1OFHA 4G5QA 4R71A 5FR1A 2CVHA 3VR2A 1U81A 1E2FA 1F2TB 3KJGA 3TMKA 2KBEA 4TYQA 1DO0A 2ZSEA 2GAAA 4BFXA 3SI7A 1XEWY 2WWYA 2ODEA 3AF1A 1E9FA 1CJMA 2GZAA 1GNRA 1R0YA 1FPMA 1KK1A 2FE4A 5FBLB 3LLUA 4LZZA 4Q4HA 5JWHA 5DN6D 1ZNWA 1P3JA 4P4UA 3HJNA 2AX4A 4LC1A 4TLEA 2W0SA 1IY1A 1XF9A 4PC2A 5EP2A 3ECCA 4ZDIA 4L9SA 1S1MA 5CK5A 1A2KC 2CVFA 1SVWA 5FUYA 2ZXUA 2H8KA 4BQSA 3QQ5A 2BHRA 4AG5A 121PA 2IHYA 1IM2A 1K8RA 4P31A 4M1KA 1TQDA 3NIBA 3OFND 4LC0A 2P0EA 4N0EA 2AD5A 3O8DA 1XTQA 3FTQA 3WHLA 2FU5C 4A0HA 4GBMA 4M21A 1UKEA 5FOSA 3OIVA 3CWQA 4PC3A 1IXSB 2XSZD 3RVBA 2XNSA 3VX4A 2NTYC 3ZYCA 3BORA 1XEXA 3ZVLA 4QJ3A 2DFLA 4DBLC 3P32A 1E96A 4N3NA 3IIJA 3CF6R 3P26A 3Q7QA 4TWZA 3WRYC 2WOOA 4TN1A 2NOAA 1BS1A 221PA 5BWMA 1R4AA 1Z2CA 1VIAA 3RRNA 4IOLA 4AWXA 1XBTA 3DVLA 1D8TA 4URXR 3RRZA 1JQLB 3AP3A 2BMFA 2CNWD 2I1VB 2NO7A 3HU3A 1Y3AA 4DLTA 3DMNA 2WWIA 2BEKA 4KAXA 4TYWA 5FPKA 3A1TA 5CM8B 1VCOA 2ZU0C 1TQ6A 2C98A 5J4KA 5IF9A 3Q8XB 1R8SA 5AJXA 3QPVA 4KBFA 2E1RA 4FCTA 3W9YA 1HYQA 1US8A 3K9GA 2DWPA 1KI1A 4BEJA 1OPXA 3QG1A 4XJXA 1TF7A 5FPYA 3FHCB 4F92B 3B1XA 4F38A 2Q0HA 2CL0X 3TVTA 3H4MA 3CRRA 2NIPA 2VIIA 2VF8A 4LV8B 5B64A 3SYKA 4QNRA 4B47A 2OFXA 1XD8A 3NBXX 2I4IA 3U3KA 2IYRA 4ZKDA 1C4OA 4NL4H 4KV9A 3M4YA 2JCSA 3TAUA 3HU2A 4JLVA 1QDEA 4PANA 2QBYB 4AY2A 2GJSA 2ORVA 1OHHA 5DI3A 1UBFA 3OAAD 3GLGE 2XGJA 1X86B 4DSUA 2VP6A 5EJEA 2VHJA 4EPTA 5J4HA 4TL6A 4ZDKA 2ZROA 4DXAA 3GCGA 1XEWX 2C9CA 3U7EB 1KNXA 1Y63A 5EXSA 2J46A 4IFBA 1JALA 2PT5A 2V7QA 4HAUA 4Q4AA 1K6MA 3DMDA 1QRAA 2A5YB 5GVSA 1DELA 3MFYA 4RCYA 5L3QA 4JMPA 2ZRPA 4M9ZA 4LHXA 3GLFA 3WYGA 5DLQC 3GJXC 4R9UC 2I3BA 1N5LA 3RRYA 2RKOA 1IJEA 1OYYA 1OT3A 1II9A 3C7KA 4OHXA 4Q1CA 4DLYA 2GA8A 1P4SA 2XITA 1Q1QA 1OW3B 1A4RA 2KSQA 3DHWC 4BWYA 5DGXA 1FQKA 1KMQA 1U9IA 4C0QC 1Z08A 2XNDA 4WIAA 3K70D 4JL8A 3UG7A 4GOJA 2JLZA 1KK0A 2WPDD 3I3SR 1QHYA 4A0FA 5FR2A 3NC0C 2GRJA 1SULA 1EG7A 1LVGA 2GBLA 2FSGA 3EWAA 2JDIA 2VBCA 3MJRA 3AUXA 2ZJ2A 3CNOA 3I8XA 2P65A 3GLIB 3K9HA 3OEHD 5C1BA 2AFIE 4C30A 4RKFA 2O0KA 1BH2A 1W4BA 1Z6AA 2EWVA 4UNRA 4QHSA 2C04A 3UMRA 3KXKA 5CIQA 1E1RD 1ELOA 3D8BA 2AWNA 3WBKA 3AEZA 5DSZA 4LJ7A 1G8PA 4DLZA 1JPNA 3JVVA 3N2EA 1E0KA 3SFZA 3GPLA 4H9GA 5HKKD 4BFZA 1E0JA 2OFOA 3V4FA 1M8PA 4LOAA 4NMMA 4F7WA 3ADBA 1T3SA 1VPLA 3CBQA 1ZC3A 1G8FA 5AUOB 1UEJA 4B34A 1N6LA 1XEFA 3C16C 1FFHA 4TSFD 2IS2A 3GEEA 4HEJA 1M74A 1W36B 1N6OA 1XZPA 4GMXA 1HA3A 4PAQA 4Q18A 3UK6A 2ZI9A 5CITA 1XXHE 1OF1A 3A1VA 3TK1A 2QP4A 1X1SA 3K0SA 1YZNA 4DDWA 3VAAA 4PX9A 3NVAA 2B92A 5FH9A 3SZRA 2EFHB 4AKIA 3CNLA 4LJ4A 4EQ6B 5JHHB 3D3QA 2IX3A 3OFNA 4GZLA 4JS0A 1T4GA 2IS6A 1ZD8A 3F5FA 2C5LA 1Z47A 5LB2A 2Z4SA 3BD9A 3N5CA 821PA 3THOA 5HCIA 3THXB 3RWOA 5JEDA 3QY0A 4ITRC 4EPWA 3IQXA 2YYZA 1JQJC 5HPYB 5EE9A 1AK2A 3KJEA 2ZRKA 4P4SA 3U3MA 1G20E 3KKMA 4DCSA 2RB4A 3IGFA 2ZJZA 4KODA 1V5WA 5AUPB 1NSTA 5LB4A 421PA 3P27A 4HB2A 3TQFA 2VYFA 3CUEF 1FP7A 2GJ8A 2G83A 4XWOA 2O8BA 2PMKA 2E9SA 3SJBA 3TSWA 2A2ZA 2OXCA 3KZ1E 1LS1A 2Q21A 2RHDA 2RGNA 4LYHA 3KTAB 3ETLA 3WHKA 2IYUA 1XWIA 1ZM9A 4X8HA 3RWMB 2R65A 1T9HA 4IDHA 1E79D 5A5GA 2H1LA 3IBGA 1KK3A 4EIWA 1OIVA 1M7GA 3TW8B 4NYIR 4WZAE 2GJAA 1M2OB 2XNDD 3QOFA 4O2RA 5IHPA 2ERXA 3DOFA 1DVRA 3IHLA 2FA9A 5EUQB 5FTMA 4AKGA 2QT0A 4MRRA 2IXEA 3T5DA 1XPUA 3WNDA 4MKIA 3WY9A 1D9XA 1SXJE 3WXMA 5FTJA 3OAAA 3QPUA 1ZIOA 4UNNA 5G3YA 4BEBA 1COWA 4B6FA 4HLQB 4RKEA 3U2QA 4UJ5A 1CBUA 2DHRA 1DOAA 4JLPA 5TMPA 5JLJA 2C78A 3T15A 3BFXA 4PFSA 3LXXA 3PEWA 3QNUA 3B9QA 3EZ2A 3RHFA 2FOLA 4TYNA 5HZKA 5H8WA 2JLQA 2ZRIA 2HCJB 3EG5A 1J8MF 1T0HB 2F9LA 3X1XA 4YXWA 1CR1A 1NVWQ 1OV4A 2HYDA 3K09A 5TVKA 1X8KA 3VR4A 4YMWA 1OSNA 4P4TA 3EW9A 5JSZB 3E2IA 1G3MA 3X1WA 3NXSA 3GJ6A 3TSOA 2CHVA 3GLGA 4LJ9A 3HPQA 1Z5ZA 2WMOB 4JKYA 4JBWA 2HV8A 3BBPA 3IO3A 3KJIA 4FMDF 1XTSA 5FI1B 4NE2A 1KGDA 2MMGA 2GK6A 4V02A 1NP6A 1B0UA 4GSYA 5FOTA 1W44A 5KTYA 3UATA 1VECA 2A30A 2J41A 1MO3A 4HB4A 4MUBA 1Q44A 2QL6A 2ZEJA 3A58B 4MYCA 2ZSAA 5C46F 4TMKA 5DHFA 3A37A 2C2HA 2LCFA 1E0AA 2VLIA 1G6HA 2X2FA 3GD7A 3BJIC 4ILEA 5AJWA 1AKYA 1KO7A 1XD2A 3O8BA 4F91B 4RCZA 2F3TA 1GP2A 3GLHE 3MWYW 2J9RA 1DAGA 2AXNA 2CCGA 4I1SA 2X1VA 4A4DA 2GXSA 1OB5A 5FTKA 4HLCA 4DVGA 5CJPA 4LPKA 2BCJQ 2QMUA 3UMSA 2VHQA 1F6BA 3A4LA 2FPKA 1T8TA 5JZVA 2ZSFA 4H1UA 3AB3A 1HV8A 2RAPA 4M22A 4WZBE 5JSZA 3SS8A 3PVSA 4QBGB 3G0HA 2JJ1A 4LHWA 4W5WA 3CM0A 4MA4A 3QUSA 4NONA 1O3YA 3D6TB 3OEEA 4NYJR 1KSGA 4PQFA 4EJSB 2W58A 1NVVR 2OBLA 1XXHB 3B2EA 4QFMA 4AIIA 1CEEA 2JGNA 1MO6A 3RLFA 2NGRA 3QKSA 1WP9A 3QEOA 1G5TA 4WXPA 3C5CA 3KKPA 1VG0B 2H57A 3K0FB 2WKRA 1XCPA 1JAHA 4JBXA 4YMUA 1HTWA 1T0JB 5LD2C 1Q3TA 1OFIA 3DL0A 2VEDA 2ZU6A 2EYUA 1GL7A 4RFSA 1RW4A 3CKLA 3TAHA 2OBNA 1MKYA 1GZSA 1R0ZA 3AH8A 2J7PA 4KVAA 1L2TA 4MKFA 5JS8A 2WJGA 1Q12A 3R8CA 1VCNA 4QM7A 2CHQA 4ARZA 4M1OA 2G88A 4Y0AA 2OM2A 4QKQA 2NZJA 3K0CA 3LY5A 1VHTA 1RYHA 4DDVA 1GL9B 1JJ7A 4B75A 3VU9B 4PPQA 3A6PC 3VKHA 4G5OA 2O8DA 3NDPA 5LBIA 4BASA 5JS7A 2YC4C 3KTAA 1DS6A 4LBVA 3FKSA 2ZYWX 5DISB 3DEFA 1EFTA 1MH1A 3RAPR 2ERYA 1M1YE 1XCGB 5JJLA 3IPYA 1IN4A 3EIQA 4JYBA 2GCOA 4Q02A 4C2TA 3AQ4A 4O25A 5CIWA 1NY5A 2BIFA 5FL3A 5KNBA 3F0TA 3D31A 4C7OA 5CLQA 4B2IA 4JBYA 1H8HA 3LBIA 4BE7B 5LPNA 1Z63A 3FWYA 4P32A 1TL7C 2V1UA 1NBME 1ESMA 1KDPA 3OESA 1KSHA 4KHZA 2WAXA 2YZ2A 2CL7X 4W7SA 1TMKA 3FYHA 2ZRGA 2D3WA 3LBNA 2ZRBA 2GXQA 2ZUCA 1OKKD 4D6PA 1E2IA 5L3SA 4RD2A 3PV0A 1DPFA 3NG1A 3J81k 4Q7KA 4LBWA 2ZVPX 3PIRA 1U0LA 3SBEA 3R9IA 2JJ2D 2X8AA 2SHKA 2QPAA 3I32A 4UJ3A 5JECA 1AGPA 3BERA 1U8YA 5JFGA 4JL5A 3VQTA 1ZM4A 3R7WB 3UWOA 5CB8A 1E2QA 3BIFA 4OK3A 3T1VA 2GETA 1E9SA 2Q3HA 2ZJYA 4L15A 3U6KA 4C2UA 1JPJA 4BZPA 1FNNA 1II0A 1KI6A 4TLDA 4YQFA 1DE0A 4URZR 1EX7A 4DUGA 1SKYE 2BMEA 3IBYA 1CJTC 1OIXA 1H8ED 2GILA 2FH5B 3B1ZA 2B7BA 3BH7A 4NKRA 2RGDA 3NHAA 1CR0A 3TJZA 4P0TA 4TMZA 1W0KA 5DO9A 1XU4A 1XMVA 1UBEA 2QAGB 3MWLA 5H68A 4OL0A 4LYAA 3LLMA 4RY2A 4UQOA 4B33A 2XB4A 3JZMA 5DH9A 1W5TA 1YVDA 5HE9A 1CR4A 4PSAA 1OFUX 3IIKA 4ZCIA 2OEPA 2F3RA 2GCPA 1AS0A 4UNQA 1LV7A 5HZHA 3VNUA 2FV8A 3RANA 3U5ZB 1GVNB 3I61A 1V43A 2IC5A 2IYVA 3PR1A 3E1SA 4LUCA 1PV4A 4I81A 3OHMA 3DM9B 1KI7A 3AP1A 4BFYA 1E32A 4QGGA 2RGEA 2HT1A 3T12A 2AKYA 1NKSA 4GOKA 4YONB 4B73A 2A5FA 5FUWA 1AQUA 4LYFA 2RH5A 1P9RA 1RRPA 4V03A 3RC3A 1KMHB 2CNWA 1X3SA 2Y8EA 1G18A 5GJBA 1Z28A 4EPXA 5JRZA 3HPRA 1WQ1R 4CYMA 4JLDA 3OEED 2QT1A 4GNKA 5KPJA 4V0NA 3RSOA 2F1JA 4XSHA 1EFUA 3O47A 4LJ6A 4TMTA 3ZD6A 1GSIA 2WKPA 1S9DA 2FZ4A 2FSIA 1JR3E 2GEVA 1LS6A 2IWRA 3WRXC 1UDXA 1KMHA 2XOKD 4URVR 4M53A 1IN6A 2OT3B 4BLRA 2OCPA 4C7OB 3PUVA 3W3ZB 2QRNA 2GNOA 1IN7A 2ODWA 2W0MA 2ZAMA 3I4LA 3JVUA 4RSGA 3REGA 4V0MA 2W6IA 4C0AC 1U9IC 1R2QA 3T1QA 2ZIAA 1E9DA 1SQ5A 2Z43A 3LWNA 2ZITA 4HLDA 3CX7A 2WJIA 4TYYA 2VP4A 4KXFB 2GWHA 1ZINA 3RS4A 5JJKA 5L8VA 4BLTA 4HUTA 4IRUB 5KPDA 1HE8B 1KDOA 1OKKA 5JWRA 5AUQA 2QTHA 3KQKA 2G3YA 2GVDC 3Q85A 3W3AA 5KOYA 1KI3A 2F1HA 5H70A 1E6CA 2CDNA 4OQLA 2QMEA 4NCNA 5D3MA 1ESNA 1G4AE 1S0UA 1EFCA 2QA5A 2QENA 5G40A 1U8ZA 3KXLA 3U60B 2HCBA 2QZ4A 5FBVB 3FGNA 1IQPA 4JT2A 3EXAA 4YMVA 4XTCS 1Q22A 2ORIA 4TZ6A 4LHYA 1JNYA 5E7IA 2BMJA 1F5NA 1BKDR 1G3UA 1NN5A 2ZUDA 4D4JA 4E03A 2O8FB 1AZSC 1E99A 2JJ1D 4IDNA 2XXAA 1D2MA 3WNCA 4LX0A 3SBDA 2IYLD 5EUMA 3SU8A 3AVYA 2IS1A 2DBYA 3QKSB 4LHVA 4M2LA 2NMVA 4TQAA 5J5CA 1SXJB 3ONWA 4PHHA 1RRGA 1R7RA 1F2UA 2R9VA 5K8LA 5IK2D 4IVPA 4D0GA 5KU1A 1RZ3A 3MWJA 4HDQB 2JLVA 2QY9A 5BYJA 4QL3A 4Q4LA 3PUXA 2JLUA 2IWHA 4O0MA 2JDID 2ZSBA 1NMZA 2VHTA 2ZRDA 1HH4A 1PUIA 1G8YA 2FFAA 4ACBA 2YOGA 4M4SA 3QXJA 1QG4A 4GP7A 1VG8A 5FOVA 4BRWA 5H1YA 3I1FA 4BFWA 4ERNA 2G77B 4CEJB 2R44A 5IDVA 4LJAA 3SE0A 1U98A 5KYKA 2W2VA 1MO4A 3F3YA 3I92A 3K8YA 2VHUA 4AI6A 1Q21A 4QOSA 3QKUA 1T5IA 4IEEA 5KSOA 3LVQE 4Q9KA 3W6OA 3O8CA 4OHVA 2IBMA 4HLUC 4IDPA 3ADDA 3QXCA 2VQSA 4M0LA 4S2EA 5BN5A 1US8B 4AYTA 2WM9B 4HUQB 3EA0A 1EFRD 1T8UA 2D7CA 3K0EA 1Z6XA 2IEYA 2JATA 2QPTA 3A4MA 3ZIAA 1YRBA 2AD1A 1ZCBA 3UG6A 2ODBA 4URUR 4C0HA 1PJRA 2ONJA 3AVVA 4JZKA 4DSOA 3CH4B 5LD2B 2O8DB 3VU9A 2J0SA 4PHGA 2W6ID 2ZS9A 3TBKA 2J3EA 3P4YA 4XVRA 4D2IA 2JJ8A 2QI9C 1Z22A 4XWAA 2JLSA 2W2TA 3WP0A 1Q1EA 1ZCAA 4PZLA 1OH7A 2VA8A 2A7QA 1YZQA 2WJVA 2ZAOA 3C41J 3IIMA 4A6XA 2OBMA 1NLYA 1G3IA 3ADCA 4W9MC 4CEJA 4QBHA 1UPTA 5KSYA 1FTNA 5JI2E 1JEDA 1FTSA 4TQUS 1I2DA 4PQRA 4A8JC 2IYZA 4FMCF 4Q21A 1VCMA 2P5SA 3ZQ6A 1IXRC 1XTKA 2PZGA 4PC6A 4XD7A 5KNDA 5AUNB 1GAJA 1II8A 1OXVA 5GVRA 4DDUA 4YDSA 3T06B 2DFTA 3DDCA 2E87A 4G1UC 1RKBA 2GDJA 2J0VA 2REBA 2XJ9A 4EAQA 3E5HA 3VMFA 3H84A 3G82C 4DSTA 4RD6A 3AKEA 2DWQA 3KB2A 2OFWA 3P1JA 2J87A 4Z1MA 2FFQA 4CVNA 2CE2X 1KSJA 2FGJA 4B35A 4G3XA 2ZRAA 1N5KA 4OI1A 1NLZA 4FMBB 1OXXK 3WYFA 2R6AA 2BM1A 1TNDA 3S1AA 1X6VA 2ZRLA 2QGZA 2R6DA 1SHKA 4FMDB 2FDCA 4Q9JA 5F9FA 4OK6A 2ZI6A 4CGZA 4D4MA 2FPMA 2O0HA 4NYMR 3MMPA 1VKJA 4B44A 2GF0A 2WTUA 1DAHA 3ZZUA 3LVRE 3NEJA 4A9AA 5C4GB 2QPOA 3S1AB 2FFBA 1DBSA 4PC1A 3V00A 3RC8A 1ZJ6A 3ZDQA 2DR3A 1P2SA 3CWZA 4MH0R 4NZYA 3C15C 1G7RA 4QJ5A 3W34A 2JLWA 3AP2A 2QROA 1TUIA 2BKUA 2CJWA 4US2R 2J5XA 1Z6GA 1JR3A 1YZTA 4US0R 2IL1A 3AV0B 3CX6A 3W6PA 3GJ5A 2D7DA 2CLSA 2LKCA 1N6RA 4M8NE 2EQBA 3SJCA 1XMSA 4HI0E 1SVLA 4QXAA 3SN6A 4B2LA 3PUZA 4MITA 4Y0VA 1KTVA 2D2EA 3EZ9A 1G21E 2PL3A 4A15A 2A5DA 5J47A 1T3LA 1Z0JA 1GILA 2EVWX 4HZIA 5SZJA 2JLXA 2BMDA 4Q1EA 1Z07A 2QG6A 3U3RA 2DCUA 3SNHA 1NNEA 1P73A 1W0JD 3ICQB 5FBQB 1U2RA 1KSFX 1ZNZA 1A7JA 4HAXA 1G7TA 1YQTA 4OK5A 4QHTA 1R5NA 4IJMA 5SZKB 2GCNA 2GESA 2ZYVX 3MRSA 2OAQ1 2ZJ8A 2YC2C 3B8HA 3AKYA 5IK2A 2XX3A 4Q03A 4KJZA 1JXMA 4KFSA 2F1IA 4KLNA 1BYUA 2GEUA 4IHQA 5EXXA 2XXAB 4PHFA 4Q1FA 1G16A 2UKDA 1CULC 1VHLA 4PSKA 5TARA 1AGRA 2R2AA 4N0DA 3AVOA 1UM8A 1WF3A 2D74A 2ZPTX 1RE0A 2HXSA 4QNMA 2H18A 5JWOA 5TDHA 2C9YA 2OO7A 5EZ5A 1RPZA 2X19A 1P2TA 4OQXA 3GFTA 2XB2A 1P9NA 2GEDA 3CPHA 3I5XA 1G4UR 2XTNA 1ZM2A 2J0UA 1Z8FA 2WPDA 4PO8A 3W5IA 3AVWA 2J59A 1YKSA 2EFDB 5EP3A 4IFEA 2RGXA 5AJVB 2A5JA 4YMTA 4U7DA 4RFVA 1NJGA 2DB3A 2IHBA 4W5HA 3EAQA 5AJZA 2ATXA 3AVPA 3T1TA 2OSBA 3CNNA 4HB3A 1NRJB 1VG1A 4RZ3A 1Q1ZA 3H86A 1OYWA 2FEOA 2R62A 4YMSA 1NIPA 1U99A 2WSSD 3L0IB 3DOEA 4PZZA 4GT1A 3SYLA 4D4LA 4DCVA 3N70A 4IDQA 1IY0A 1KKMA 2CK3D 2WVJA 2J45A 3V4RA 1VDZA 2X77A 2ZYUX 1FNMA 4A0GA 2Q9CA 5HKKA 3CRW1 3LXRA 3UXMA 2C03A 1S4QA 4WBSA 3IDQA 3ND9A 1HT1E 1O87A 1WCV1 3FDIA 1Z29A 3QBTA 4ZPXA 4O3MA 2HJGA 1QHNA 3IEUA 2NO6A 3B1WA 1KI6B 4P4SB 4NH0A 4MRPA 3FFBA 3FMOB 4CT4B 3LX8A 4FWTA 1ZU4A 1E79A 1NSFA 2F7SA 4K46A 3GLFB 3SQXA 4YC7A 1GG2A 1U90A 3SJZA 3VR1A 2IYWA 3CPJB 3RS5A 5F3WB 2ZRNA 2OCBA 5FL7A 1OE0A 4CDGA 1LFDB 2UZ3A 2ZYTX 4POAA 3A1WA 3FMFA 1OXTA 4MYTA 5C18A 3B78A 1QVRA 1XB2A 3CRQA 3ASYA 3W5JA 2GVZC 2GZDA 2OAP1 4JVSB 2VP9A 4DLXA 1ZM7A 1ANKA 4B3CA 2IYXA 5B30A 2O8FA 4L4UA 1P60A 4WW0A 4JJZA 5CDFE 4A6PA 1I2MA 3VR3A 4XD7D 1CF4A 5DYGA 1CRQA 4P3YA 1NVUQ 5K8UA 1XCMA 4DLRA 4XIGS 5KDOA 4P33A 1K5DA 2DY1A 4LJ8A 3FKSD 1SVOA 1XNJA 2QP9X 3PCRB 4FI3C 2A9KA 1ZU5A 1C1YA 1E2DA 2ZI5A 5DHAA 4A2QA 3B60A 2QUZA 3U7GA 3VHLB 1F48A 3CRVA 1NMYA 4GRAA 2F1RA 2I1QA 3HR7A 2D06A 1KY3A 3LO5A 2YJTD 2ANBA 1QHHA 1R8QA 1TQ2A 2ZI3A 3PQCA 4Q7LA 1U0HC 1JJVA 1D2NA 1E2LA 1VMAA 4ZIRB 3Q7PA 5JI3E 1W4CA 4Q47A 5SZIA 3SHFA 2IYQA 4DJTA 1LTQA 1DG1G 3WYAA 3K9LA 4M9QA 1TEVA 1N3BA 2ECKA 4M9XA 2XJ4A 4ZCLA 1N6IA 1J2JA 3SHWA 4JLJA 1KDTA 1KJYA 2NG1A 4LK2A 2PZFA 1NMXA 1E9RA 2FZLA 5EE5B 5TXGA 1G1MA 2PX3A 4QG7A 1ETUA 2IYSA 3H2YA 4RD1A 4EFNA 1CJUC 3PXGA 4LYJA 4R2IA 3GLIA 2ZR9A 1E4YA 2IA5A 4HAYA 3ZZTA 1FW6A 2O0JA 2W6JD 3IKJA 2P6RA 1CIPA 1G41A 2OLJA 2V1XA 1RRFA 3AVUA 2ZI7A 1UBCA 2O5VA 4PO9A 4C0JA 2P2LA 2P6NA 2QGNA 1CR2A 2WKQA 4AC9A 1Q1BA 4TL8A 4OHYA 1FMJA 4KFTA 2NPIA 2N42A 4DHEA 4JT4A 1S1CA 3GQBA 4Q48A 1BO6A 2YKGA 3QVVA 1NF3A 4GDFA 1ZNYA 4C0KA 2O8EA 5CM9C 2PJZA 4TMVA 5DIFA 2RGNC 5GJCA 3QF4A 3KKNA 1PLJA 1EWQA 1EX6A 2NZ8A 1NN0A 3LFUA 3IPXA 1LW7A 2QE7D 2ZANA 4G01B 2IYYA 1Z0FA 4IXNA 4YDHB 5EE1A 4DCTA 4W5JA 4GFDA 2ZR0A 3NKVA 5E3HA 4B3GA 2GBLC 2WIAA 1IAQA 3BH0A 1A1VA 3M6AA 2EFGA 3A36A 1NIJA 5J40A 1BYIA 4DRZA 2AR7A 3LBHA 1II8B 4GZMA 5FUXA 3ZLJA 1EFHA 1N6PA 1LNZA 1RIFA 4FW9A 4BUJA 3SR0A 2Q3MA 3PENA 1GM5A 1Z0IA 3SEAA 5AWFC 2QQ0A 3U6BA 3C4JA 3AVXA 2OLKA 3KQHA 3KJHA 2AWOA 4NBSA 4R7ZA 3BS4A 4QBIA 2WWFA 3SFVA 5E7JA 4LJYA 4HDOB 4BFTA 4C0BA 1MRSA 2PCJA 3HP1A 2HXYA 2ANCA 4DLSA 2GTPA 3K09C 2IS4A 3FMIA 1QHXA 5BN3A 3AF4A 1ZUHA 3AF2A 3NHBA 3TUJC 2ZE8A 1AZTA 1PLKA 2J0QA 5TV2A 4TT3A 4RFSB 4TMWA 3PUWA 1XTIA 2BM0A 2N46A 3W8RA 2XZLA 3Q3JB 1J99A 1AM4D 2BC9A 1MABB 1GUAA 3BGWA 4XSGA 1GKUB 4MGYR 2YNMA 3DO6A 5FTLA 2YWHA 4AURA 4Z51A 4CEHA 4A2WA 3CX8A 1XTRA 2BKEA 1PUJA 3K70C 1QVAA 4U02A 3B9PA 4D26A 1QHIA 3PEYA 4Q66C 1H8HD 2KJQA 4RD4A 2OCYC 1HUQA 4HDCA 4IVRA 4MGKR 5KUTA 4FINA 2DWOA 1W1WA 4AYXA 2WWGA 3D7MA 1CJVC 4S35A 4MDFA 2VL7A 3L0SA 1VYVA 2EU8A 5EQTA 5KO2A 2VTKA 3QXHA 4OQFA 1YR6A 3BFVA 3Q5EA 4TYPA 3MAAC 1TUEA 1R5OA 2YINC 2VSOA 3LV8A 1S3SA 3BH6A 4HAVA 3BXZA 4ZCMA 2GCOB 1F2TA 1ZC4A 1IOZA 4I4LA 1FX0A 3MJHA 5E7MA 3CIOA 4JKIA 2JJ2A 1E2PA 2H16A 1F2UB 2QAJA 3MSXA 3AM1A 1KY2A 5JCPA 2QSZA 3LW7A 1SXJA 1WA5A 4BZQA 4QC2A 3AGQA 2CE7A 4TQ9A 3K70B 1CRPA 3EWSA 3EIEA 4F4IA 3P4XA 3L43A 3LRPA 1AIPA 3VR6A 2V7QD 1G8HA 2OILA 4HAZA 3T1OA 3WMFA 1GFIA 2NPFA 4OI4A 1UEIA 3E70C 1GRRA 2WSMA 3I73A 2J0UB 2VO1A 4ZDJA 4XTRA 1IY2A 1KJZA 3SOPA 1M34E 1XJCA 3GLHA 4IVQA 1DAIA 1ZVQA 3U7FB 2BBOA 2YWEA 4RZ2A 1P9WA 3U3JA 5L3RA 4V0KA 1ZM3A 4L5BA 4CW7A 2AN9A 3NDBB 1CJKC 1YR9A 1GNPA 4GMDA 1LF5A 4A0RA 4DCUA 4TLAA 3KQLA 3W8NA 3K0CC 4NCHA 3WBJA 3ZJYA 1E2MA 2IW3A 2RHMA 1Q57A 2V54A 1E1QA 4HATA 1AN0A 3BK7A 5AR1A 5FBWB 1PLLA 5J4YA 3K0AB 1T5LA 2QN6A 4X8MA 3EPJA 2NO1A 4M1MA 4R2HA 1YR7A 2HDNB 5CK4A 1BOFA 3TSZA 1GWNA 3DPUA 4KFUA 5BW8A 3W6NA 1UFQA 3Q5DA 4II7A 4Q1AA 1N6HA 1UAAA 4EPYA 5TY0A 1IN5A 2WAYA 4RZUA 2YOHA 1UADA 2NQ2C 4BFUA 3KQNA 3JZAA 1EK0A 4EDHA 1E1RA 1UJ2A 1DAFA 1TF5A 2FPLA 3OIWA 1NN1A 2ASEA 1NVXQ 1XD2B 1S96A 4QBFA 2X2EA 2D2FA 2Z6VA 1TU3A 4CEIB 4M1SA 3QIAA 3ZIAD 1P5ZB 2D4HA 4EJSC 2XZOA 4LV5B 2RGCA 4CEHB 4NU0A 1CKEA 3WP1B 5K8IA 1SVKA 2ZQ5A 5CYPA 4B3XA 1S2MA 1KI2A 4HB0A 1N2CE 1OH8A 1DTSA 4L16A 1JEEA 2ZREA 2CXXA 3LNCA 3ZGXA 1CLUA 1SGWA 4TL7A 2ZRFA 2P3SA 4DIDA 4MYUA 2O8BB 1GIAA 4KYUA 1ZNXA 3LA6A 3KB1A 4Q1DA 5M04A 3QG5A 4OJKA 2DFNA 2ZE5A 2ZE7A 1I4LD 4HZUA 4ZKEA 3SDZA 4IEIA 4HYYA 1U94A 4NHOA 4OQMA 5HTKA 3OIUA 2G1KA 2QMOA 2IF2A 3TLXA 4NDZA 2W6JA 3EC2A 3F8TA 2O8CA 3QXSA 1GNQA 2R6FA 3AVQA 1E9CA 4PQYA 1RRCA 1QG2A 4DCNA 4IW3B 1QHGA 2FF7A 1AJEA 4Q9HA 1X8JA 4Q7JB 1D6JA 1Q20A 2B8TA 2BBWA 2CLCX 3O8RA 3U7HB 4EFLA 1FP6A 4JLMA 1J90A 1YR8A 1M7BA 1Z3IX 2QORA 2ZS7A 2ZRCA 3CF0A 721PA 2WWWA 3MLEA 2RGAA 4Z1MD 1GDDA 3UANA 2XAUA 4A8JB 1DAKA 4J0QA 1RC8A 1NKTA 4DT1B 2QE7A
chains in the Genus database with same CATH superfamily
1L4YA 1YIOA 3MUEA 2QF7A 5D8DA 5CB4A 3EF0A 5A0VA 2FLKA 1JQAA 1RVV1 4IHJF 3QE0A 1CCWA 1G5PA 2FZCA 2IHTA 1BQ4A 4ER6A 1IIRA 2AN4A 3BB1A 1BXGA 1MIOB 4PAMA 3FPEA 3GJ8A 3TUIC 3JPWA 3VI4B 2WFLB 3H0CA 3ZDYB 4HX2A 4DJ5X 1UJCA 3MHTA 4LI0A 1G19A 2REQB 2CXQA 2VBGA 1RP7A 3OE7D 4J1TA 4O2BB 5EP1A 5C7YA 4EBBA 2J30A 4FC7A 3HYNA 1AGXA 3HB1A 9LDTA 5GJVC 1PNRA 1M76A 1H9CA 4UXJA 3NNSA 5FA5A 2C3OA 5LQJA 4MPTA 3T4PA 2VRBA 4LZLA 1EXDA 3H7AA 1MOZA 2W8BA 3O8QA 4GLJA 2N3ZA 3H6KA 4TVOA 5J2TF 4HL6A 2HJ9A 3Q6NA 4RPIA 3L5OA 3EGIA 1YFJA 3GFVA 2AFIA 2V3WA 4G5RA 1HX7A 2AOXA 2XEXA 1XR3A 2BEJA 3IEIA 4ZXPA 2FMHA 4KNVA 5BN4A 3T3DA 2ZWMA 2P5TB 4PY2A 3BC1A 5CFOA 5EHGA 3VDQA 5GPBA 4EEKA 2I6XA 4RJLA 4A91A 2B78A 1HDZA 3ONFA 1EX9A 3VYSB 4IDOA 1P2VA 4OMUA 4C6SA 1QH8B 2HTEA 3ZC3A 4F85A 2YYAA 2OWDA 3PGLA 5ALEA 5JFTA 4Z3OA 2AFIB 5LVAA 2P67A 2GN9A 2DFKB 4HQLA 2XYQA 4EG4A 3LPDA 4KP7A 4HNGA 5SYMA 3FX2A 3FCSB 3QKRA 3ZI7A 1P6QA 4EQ6A 2ZM5A 1XELA 2PUDA 3ILHA 1OBCA 5TE9A 1N6NA 3PFHA 3CH5A 3VYVA 3VR4D 1LB1B 4PWYA 3RKRA 2C2KA 4RHEA 1G9XA 3NBAA 4IS3A 4TKUA 5M29A 1XTVA 5LA6F 3SBXA 2WINI 3R0XA 4ILKA 4JJ4A 3TBHA 1C0PA 3BB3A 2C4MA 2RARA 4FCVA 1A9RA 1WL8A 1T3HA 1KVRA 3G1TA 2JFYA 1E6UA 4N39A 3O9MA 3QSYA 1QS0B 1E2JA 3FDXA 1N0HA 3IUQA 4X95A 3L4BA 5JJ5A 4RACA 5AK4A 3RVNA 1QYVA 4JC0A 1QZZA 3ITKA 4FX5A 2QLJA 3WLAA 5I7FA 3IE2A 4V0QA 1YOBA 4DT1A 4LFAB 4MV4A 4WY5A 1PG2A 2HCTA 1XDDA 1VI6A 1G0NA 2HF8A 2P91A 3M81A 5B4TA 1J22A 1J7KA 4QUJA 2O8EB 4MPRA 5G0VA 2R68A 5IASA 2QV0A 1FFCA 3OQHA 4PHTA 3DUWA 4RTOA 3ZKWA 1EJ0A 4AECA 2EOAA 4MOWA 2VWGA 1DC8A 1UBGA 1WPQA 3H5OA 4OHRA 4URYR 5FP0A 5I9MA 3F7NA 4OHFA 3KJQA 3S2SA 1Z5NA 2LIPA 4HGNA 2R8BA 1KOFA 1E77A 2FQYA 2KQUA 1O03A 1ZIYA 4PBRA 3C43A 2FEKA 1VOTA 4E5KA 3TLEA 1LJUA 2YVQA 5AKLA 2XGOA 1HKUA 4BVHA 4G0UA 2OG2A 2J48A 4QGBA 1XD9A 4RIIA 4ZJYA 2C4HA 4PXYA 2X42A 5IAJA 5F52A 1PFWA 1J49A 3IE0A 5H0IA 1I3CA 2YWCA 1H3NA 3BREA 3DFUA 5EI5A 4U00A 4Z8YA 3KL4A 1TYAE 1YQ9A 4K3VA 1ND5A 3E61A 3GFGA 2Z58A 4MVJD 1PKEA 4IHJA 4XR4A 1ONPA 4H6WA 4MUEA 3E7PA 1PR2A 3ZG6A 3EC7A 5BMVA 5I8WA 5CYOA 2B8EA 4W9NC 4DAOA 3NM4A 1KDVA 2VJDA 4KMMA 1NBMD 3AMVA 4KQMA 1ORHA 3W5UA 1Z4NA 2WP0A 3G8YA 4ZA2A 3PUYA 1MX3A 2W83A 3CN7A 4OXQA 2IUUA 2V7BA 4EF5A 1N5JA 5BW4A 4N5DA 4LVCA 1EGAA 1NF2A 3OZIA 1ISGA 3EDQA 4MV0A 3BAFA 3IIIA 4YJDA 1ZUNB 2WQ6A 3J7AC 1KR5A 1QF7A 4CM8B 4NZZA 2HA5A 2UVQA 3IPLA 1FVHA 3CH7A 2V0CA 2I7TA 3FUUA 1P19A 1CYDA 1WCIB 1YBHA 2K2QB 3HI6A 1WPGA 3CNQS 4MEAA 4R98A 3I01A 4DDHA 4YT8A 1IXKA 4EY7A 2ZZMA 4Q4JB 1JGTA 2XADA 5B58T 1W581 1PJBA 5A7HA 5KBYA 3CO0S 5LP6C 2KX7A 3TZKA 1W36D 4PYMA 4CKXA 4D02A 3R3JA 3A1SA 3IHTA 3AB8A 2BZ1A 1G17A 2C2YA 1PT9A 4IIDA 1W4AA 2D54A 2YUTA 2CV1A 2KWIA 2PAFA 4AJ9A 2WHPA 1SVMA 3FB4A 4DR6B 5J59A 4B71A 1P81A 5FPSA 1TTQB 2I2FA 3QP9A 4O2LA 5EZSA 3RJ5A 3VU8A 5CA1F 1W48A 5HFNA 1PAUA 2YXNA 5JMOA 1UCFA 3ZWWA 1RM5A 3U4HA 3K53A 5F1YA 1DMSA 1NQTA 4C88A 5ALIA 4EJSA 3IHWA 1NN3A 5TQ2A 3RTGA 4AKTA 2GHTA 3OLVA 4MW5A 2HHAA 2JAWA 2JHAA 3S27A 3L8ZA 4BRZA 4ZANA 1NOJA 2XYRA 1NY6A 1XZQA 3C7CB 2CF6A 3QPCA 4FKZA 4NYIQ 5EIHA 2VUTA 3ZS9A 2H65A 5C53B 1U5CA 3IIEA 4RVFA 1TAUA 4IYRA 1J00A 5DN6A 5LBUA 4A8JA 1Y6FA 1EVIA 4QARA 2JVKA 2ZYHA 4GPTA 3FD8A 5FYQA 4JVLA 3QVWA 3BWYA 2WT9A 1D9ZA 2VUUA 2XEDA 1GOTA 3ESRA 3P9YA 4QJBA 4AQDA 1PTJA 3VSBA 3VKWA 2VAXA 4RTQA 3FTPA 3T52A 3JCZA 5B3KA 4UPDA 2WWXA 2J5BA 1VC2A 3GJ0A 4G2NA 4RAOA 3TEMA 3TOCA 4CUKA 3NH9A 3GUHA 3UAOA 3W9UA 4LY3A 2Q6TA 3P0EA 2A4MA 5HS6A 3ZCXA 3HDYA 2WJHA 1RYMA 3TCNA 2DJIA 2ONCA 2QTFA 1MTZA 3AEKA 1XAJA 3GT4A 5M34A 1W4RA 3QPBA 1FSFA 3FCCA 3T0IA 2IPOA 2VP0A 3P2IA 4TV8F 1OBHA 3G2MA 3V97A 5LMNB 3WRXA 1KL7A 4QFBA 2J09A 2GXAA 3M1LA 5L3VA 1N1EA 2FMXA 1KI9A 3B6EA 4AZVA 5G53C 2AKAB 4U2DA 3RABA 1BMFD 1S8AA 4AMGA 3KYBA 1YS2X 2GFHA 1JKFA 1FYFA 4LN1A 4Z4HA 3EA4A 5EUBA 1JQEA 2XWJI 3KPJA 4QUIA 1F2DA 3UW3A 4KDCA 1L1RA 2ZSDA 4NEGA 3CA8A 3VFDA 1F9EA 3LIIA 2UVPB 3BF7A 3CR8A 4OOFA 3KO8A 3WLKX 4KSYA 1BH6A 2BISA 5E4JA 3SX4A 5LYJF 3KYCB 2A0FA 3D4OA 4BFSA 3VJMA 2PKYX 1EFVA 2PWPA 3HUUA 2ZR7A 2ZYAA 3NGMA 3L6DA 4TRJA 3B1VA 3GRKA 4GPEA 1AQ6A 4PYRA 2ZLBA 1DC6A 1AK9A 3PC7A 1YCDA 3BD6A 2ZWOA 4UXIA 5HE8A 4DQUA 1EHCA 2GK7A 3NV7A 1CW2B 2Q4BA 3L79A 1V1MB 1XMJA 4RULA 2X5KO 1WQ3A 2YHUA 3D1VA 2E4AA 2UYOA 4GEKA 4B3BA 4R3NA 3V4PB 5A02A 4JL6A 4CETA 4L5AA 1GZUA 1J07A 3HBFA 5C2JB 3QKIA 4YRKA 2PV0A 1FUKA 2G82A 4C20A 2AZDA 4R41A 1XL1A 1JVSA 4TWBA 3R1IA 4GMFA 3QOWA 4IGIA 2XIQA 1PL7A 4EMSA 2P5UA 1WS6A 4IMPA 4UVHA 3WYBA 1NC3A 3DEKA 3ZHBA 3DMTA 5AVSA 5IN4A 5CNJA 5KYWB 2BFPA 1BJTA 4HTAA 4BFCA 3HA2A 2FAXA 1DKOA 1FP4A 5TS2A 1P74A 1SKQA 5LDDC 1V3UA 5DLPA 3GRVA 4DM7A 1WO8A 1ZAKA 3JAWB 5EJAA 3MCUA 2J3KA 2B2XA 1ZNQO 3RIYA 1GTVA 4G67A 4U6NA 1OXSC 4G5HA 1C7IA 1E2EA 1G6KA 1XZIA 2PZJA 2MSWA 2BSXA 3CZQA 1HG0A 1Y9JA 3FPJA 3HJUA 2Q46A 4LMRA 4XWYA 3LHFA 1QIGA 1W0CA 2F67A 1YJ5A 1DT5A 1E2KA 3E22A 4LPSA 4M1ZA 3E3NA 2BDTA 3ROTA 1UPBA 2YXEA 3HU1A 3I12A 4KI0A 3RYFB 1SWVA 2ASVA 1AQJA 1ZRSA 1J0XO 3S2YA 4D9HA 4KAJA 5B1DA 2YQ5A 3ER8A 4MW9A 3CLSC 5KJFA 2FG5A 4WD3A 5HR5A 4LGMA 1BCRA 1NNUA 3SJAA 4GI7A 1U4OA 4PCVA 4JLBA 4MS1B 4F3TA 2HN9A 3Q7TA 1H69A 2QUIA 1EFAA 2D1SA 4JQZA 1ZEJA 2CBZA 3M6WA 3ZWPA 1E3JA 4BRUA 1ZIXA 2CLKB 4HK4A 1KORA 2C20A 4G5FA 1BKSB 3EA5A 1PFQA 5EXDA 3O2SB 2GFQA 1VE7A 2O2SA 1I3MA 2WUEA 3LFHA 5AM0A 3FPCA 3AEQA 2V4ZA 2CHGA 3B3AA 3HR8A 1GRNA 2D1TA 4TKVB 5EERA 3WADA 3C24A 3VC2A 1G2OA 4PVDA 4EPVA 3CLUC 3K4HA 5SICE 1W25A 2ZBUA 3KOWA 4Q7MB 1ISPA 1UPAA 1AB6A 5CJ2A 1UBMS 5IARA 2Q2QA 2PZEA 1GTZA 2WFMA 3SJUA 3DQQA 2CMKA 4IUDS 4JI6B 3C6YA 3IV9A 2LGJA 1RAIA 4IXMA 5BN1A 5IYZA 1C7RA 1P80A 2QG9A 3DBRA 2ZFUA 1CZOA 3KZVA 4KQ9A 1G6OA 2C8VA 3FZYA 3OQIB 5TQJA 3G85A 5FLEX 2CV2A 3BEOA 2BGUA 2B1QA 3F71A 4LBZA 1AUPA 5LCXA 4YYZA 3KQUA 1GNTA 1KZ1A 4PPFA 4CQJA 3RVMA 4E2YA 2QLBA 2ZBVA 2FEMA 4KV7A 4X91A 3H5VA 4REQB 4YCLA 5C37A 4YXWD 1F5SA 4AKEA 2GVNA 3GJSA 5B1EA 2Q7DA 5FTWA 5KNCH 3WOVA 4Y6LA 4P7GA 2OG1A 1T0UA 2COKA 5TJ9A 2V0NA 1WM1A 2DLDA 4PS0A 3OIFA 4Y2XA 5DCUA 4CL8A 1LBEA 4L07A 4MKHA 3ICVA 4F5EA 4TKUB 4YAGA 3C8ZA 4RMJA 4OHCA 3V5NA 1BRTA 4RPCA 2FRXA 4ZAGA 1OFUA 3G3EA 4O2AA 5DF1A 5E6UB 4A73A 1PUXA 2W6OA 4LOKA 3DLIA 3QENA 1JEYA 3M3HA 3BMNB 3CGWA 1WMDA 2PTGA 1S2GA 4TXLA 3B1FA 3D6FA 1L3BA 2AW5A 1LVHA 1T6ZA 1AKVA 1N3IA 4S1OA 5JAUA 1MV5A 1G5RA 1W35A 2IBTA 3MUFA 5DNUA 1J21A 2BI4A 2W48A 1UC8A 4CIDA 1R6TA 3GC6A 1TDJA 1X1CA 2G67A 4L3WA 3THWA 4NIMA 3ZCSA 2ZTLA 1KNQA 3LYLA 4ENSA 4NULA 2BFCB 2IYFA 2J3DA 3K1AA 3DBHA 1JFFB 3L7IA 4A6DA 4UTZA 3GLUA 4RZHA 2V55B 1NG1A 2RHRA 1J2RA 3NIFB 4OQEA 3IQEA 3LHSA 1VL2A 4HFNA 4OQNA 1UMCB 2CWDA 3I04M 1QORA 1CVRA 2JGDA 3DVQX 4I1VA 4F6LA 1L5VA 2PYDA 3EFOB 4HDSA 4MRVA 1YQXA 4WKBA 4BMZA 1FDSA 3E5RA 3HXKA 4GXQA 2PEZA 1TUBB 4QULA 4XCQA 3LDAA 3X2SA 3EZLA 1BXZA 4AWAA 5GIPE 4DJAA 2W8BB 1D2CA 3A6HA 4PR0A 4C7VA 3AUJB 3IP5A 4EUFA 5A4JA 1P2GA 4DB2A 4E5DA 1E2HA 2VJOA 1M7HA 3GP8A 4P98A 3H2KA 1CUJA 3KV3O 1F1JA 3Q7IA 2ZSKA 1U0TA 3R6GA 5GY7A 1WB6A 1RJ9A 1JZTA 5B2EA 3A4VA 2RGYA 3UAVA 1PQ4A 3E2PA 5SYAA 2IZ7A 5FFMA 1PT5A 2W6PA 2OD7A 3AEYA 1WB9A 1QLWA 4Q3AA 4A3SA 2PL5A 1Y1KE 1VBNA 3H1TA 4JVNA 3TW0A 5G41A 4ARAA 2WBLC 1E9BA 3DOCA 1R4ZA 2FSHA 1JR6A 2DHDA 1BDBA 2BGMA 4CZ2A 5E4FA 1Z6PA 5IYZF 1GPAA 4CNBA 1G7CA 5B57C 1N6KA 4LQ4A 3FNHA 4K9DA 4PCLA 1GUZA 4TTJA 2DPYA 3HJCA 3N0XA 2B4KA 3ORSA 5HJ2A 2F3UA 1MT0A 2HIGA 4CN9A 2TRSB 1RQLA 1LEHA 2ZETA 2XDQB 4F93B 4J90A 1GYQA 3QWBA 4OI2A 1STOA 1Q0LA 3RFCA 5BMOA 3OQPA 4PIMA 2UUAB 3UB3A 3KKLA 3MCAA 1LQ2A 1K5HA 5J2UB 3Q0TA 4CF3A 3P9IA 4OY3A 4JJ6A 3UUWA 2YFYA 3KYJB 3PEEA 1VJTA 4LE0A 2VJQA 2WWTA 2O20A 2QXYA 3RQSA 4M9UA 4TTRA 3URMA 2GNAA 3AUKA 5DK6A 4Z1OA 1QZTA 2I7CA 3HSYA 2QL7A 3ENVA 4PXSA 3VGPA 4K9QA 4DJFC 4EFKA 3FUVA 1UXJA 2BFAA 2D8MA 1UMDB 3LP8A 1N5DA 4H7PA 4JLNA 4N5LA 2F43B 4C4PA 1DP4A 1SUCA 1X0XA 2C58A 1U63A 3LBAA 2GHQA 3K1TA 1S2DA 1O4WA 1QPGA 4TKLA 2QSYA 1SHZA 3H2SA 1T9AA 4L9RA 4A26A 2QU8A 4G0OA 1YZKA 1A0OA 4DCMA 2W11A 3GMTA 4M1WA 5KNBD 5F12A 3RHZA 1EA5A 1YACA 3UT6A 1FY2A 1TIKA 4LXXA 5K09A 2IYAA 3MTDA 4ASUD 3EZYA 2OUKA 4AZTA 3ESYA 4R2KA 5JBNA 5LLSA 3MG9A 3GPCA 4DR2B 4PZYA 2HLDD 2UYGA 2YFKA 1HLPA 3C8UA 3RUDA 1HETA 4N1AA 4F12A 5EJ6A 3WYDA 1NVVQ 1S02A 1VRVA 5AJYA 2R6CA 4DNOA 4Y2PA 1KY5A 3QPWA 4PSVA 1TQ4A 4W5OA 3JAKA 2C7VA 4REOA 1N5IA 4Y2UA 3V3TA 1Y1QA 1E6MA 2H4YA 3PIIA 1I1NA 2PZAA 2R8EA 2LDBA 1Z83A 2W6NA 2ZUVA 1J09A 4BVLA 1F3LA 3H1PA 2C99A 2I3DA 4RSHA 1E0SA 2HK7A 3OKPA 5FNVA 3WR5A 4CCWA 4LC9A 1NVMB 4Y2VA 2D5BA 1J0AA 4FN5A 1U3UA 3EFOA 3PWKA 4XCVA 1SXJD 1EXWA 1Z4IA 3THYA 5EN4A 1M73E 1VJRA 4FYVA 1FUUA 2O8DA 3UFBA 2K7FA 1P7ZA 4A16A 1NQUA 4HGRA 2VTDA 4Q39A 1VLMA 2G04A 4HV4A 2V6MA 4MI1A 1P44A 5JMTA 1SD5A 3HM2A 1N2CB 1YNOA 2NZVG 4J3FA 1A2BA 2H1CA 2XGSA 2IXGA 1WXIA 4GXNA 4D3XA 3PJRA 1Z6TA 4BJ5A 4MS1A 3ZCPA 1FFWA 2ZBFA 3WLJA 3KOOA 2PA3A 1MW9X 4TOIA 3UMFA 1JR2A 1SBYA 2WHQA 1NUUA 1YJAA 1ZUIA 5DBHX 1OH5A 5IXYA 4GR5A 2G08A 2ABWA 4FXPA 3TLCA 2P4UA 1U0GA 3AR5A 4MKRA 3UKDA 4AZ0A 1L7EA 4MW0A 2Y71A 3F2IA 3EULA 4HTFB 4OIMA 4OQQA 4FT4A 5ENVA 4QM6A 1L7VC 5JCZA 1SKMA 3GLTA 1NLFA 3A7DA 4UNPA 1NKVA 1Z7GA 1SQGA 2JAOA 4HGZA 2Z2ZA 3L8YA 2R8PA 1VIYA 4GP6A 2L42A 3VTKA 4FK8A 5CFMA 1DEKA 3D02A 3R7WA 3NMUF 4ABTA 1QYWA 4I6EA 4C0XA 3K6KA 4QG3A 2Z5VA 2ZDGA 3Q9UA 2EZ9A 5ICSA 5IFKA 1OHHD 1E8MA 3TQOA 4PIPA 3HJGA 3JD0A 3WMEA 1KRHA 3ZGZA 1NRXA 1RE1A 1PWXA 2BCGY 1KXZA 4RD3A 4JC5A 2VTBA 2PZKA 2VPIA 4ND1A 1K08A 3ZE0B 2W42A 1I51A 2WNSA 3CE6A 4G5GA 4K9SA 4O4IF 4OU4A 3IA7A 3CWCA 1O54A 4HDAA 4NBNA 2CD7A 4WN3A 4UHCA 1CS4C 1KI4A 4RSMA 3S40A 4F4JA 2D1FA 1D2RA 1D7AA 5TQ0A 5MF6A 3SIRA 4D92A 3L82B 4M46A 1Z6YA 5BR4A 2XUPA 1ACMA 4U2BA 3ZU3A 2J9YB 1M10A 4L7QA 1E58A 3CRMA 3TQQA 3ZWNA 3UFXB 1IJFA 4ZJPA 3MWDA 4P0QB 1G4HA 1M6NA 1HNZB 3ZXYA 1T5HX 3ME5A 3U3XA 4EA7A 5PGMA 3JQ9A 1M2NA 4YP5A 2XUGA 4WXYB 4DLAA 3PC3A 3DLAA 1F8UA 3FPKA 2ZRHA 1YHNA 4OYRA 5EWLA 3OQJA 2FN7A 1U2GA 4BNKA 4GOXA 2H17A 1ZJZA 3D6MA 4G85A 4Z4IA 4Z8XA 4CIXA 4ZYLA 4B85A 1H4TA 3IAEA 4ZAYA 8OHMA 3U1BA 1T91A 3SMQA 4ZI2A 4ZVLA 4AD8A 3PD7A 1PJ4A 4BYGA 5I4CA 1Q0PA 1U0JA 3U44B 3U4QA 3GPDG 4R9VA 2JANA 3TR0A 4L73A 1UDCA 3RT1A 1MPXA 1N2SA 5KJCA 1FVOA 1D0SA 2EKDA 4LXHA 1CJSA 3IQWA 4F4CA 2CLDX 4RL6A 1H2RS 4RJJA 3H4IA 3SQMA 2PJRA 4JDPA 2BVNA 1QIKA 3GJYA 3DEIA 3K16A 5IT0A 5IM4A 4QLAA 5C31A 5AI9A 3U7QB 1Z5GA 3DKIA 1H0HA 3FGPA 4BIIA 4BQQA 3MGCA 1UP4A 4LSWA 3MMSA 4U2KA 2X9VA 3TQRA 1USKA 2PS3A 3QLTA 4KWIA 4PLCA 1GKYA 4KYTA 5CVTA 1OFHA 4R71A 3VU0A 3A9CA 3K96A 3WDSA 2CVHA 4N76A 1MVOA 5JQGF 1JEAA 1E2FA 1U81A 4G84A 3IT2A 1A8SA 4I7EA 4RZ3A 4TYQA 3PZRA 1L5HA 1DO0A 4ALMA 4BFXA 1H1LA 4W4TA 2UU9B 2ZBRA 2AQKA 5H9WA 1A9QA 2GZAA 2OCXA 2EIXA 3O84A 3ZDDA 2FE4A 5DN6D 2PJUA 1AUOA 3LLUA 4Q4HA 2VDQB 3DDOA 2PH7A 4P4UA 2QNIA 3ISTA 1DWPA 1BCSA 1SUAA 1C1XA 1XF9A 4YRGA 1MB4A 2XCTB 1WU7A 2CVFA 2Q1XA 5JY1A 3WL4A 2I66A 2CKMA 2H8KA 4BQSA 4A8PA 3R6DA 2Z2KA 3EG9B 3CB2A 1IUNA 121PA 3WQSB 3UENA 5CVDA 3V1KA 4BIMA 3DMTC 4HRXA 4KR9A 4INJA 1L8OA 3LC0A 4TX1A 4P0PB 2IEAA 4W5TA 2Y9PB 3JQEA 4FD3A 3OFND 3LYHA 4LC0A 4NLLA 4RVDA 3PJDA 5BT8A 5KX5A 2B5WA 2WTNA 3WHLA 2PVSA 4M21A 4PRKA 4FNGA 3EAFA 3TPZA 1R6UA 1IXSB 2HPZA 3RVBA 1FFBA 3DVRX 1X1TA 1FFYA 3P32A 1CT9A 5A2GA 4G0WA 3CF6R 1KARA 1HZZA 4QU9A 3ZI4A 4CV0A 5KU7A 2WOOA 1L4LA 3JWPA 5L40A 1BS1A 3DCYA 5MHTA 2XECA 4Q3NA 1R4AA 2ZIEA 2E55A 3ZH2A 5BQOA 4AWXA 5LDHA 1XBTA 2WAOA 3DOOA 4MZXA 4C03A 5D85A 1B41A 1PJCA 3PHIA 2ERCA 2FPRA 3L84A 4RKRA 3RRZA 5JANA 1QYCA 3IURA 4YIHA 3DMNA 4A0SA 3LZDA 2WWIA 4DLPA 2QM0A 3K92A 1Y3IA 2VWHA 3FZGA 4OBBA 1R18A 3CMCO 1J5PA 1TQ6A 1K98A 5DEIA 3HNPA 2EDAA 5AJXA 3QPVA 4KBFA 3F5MA 4AJNA 3W9YA 1US8A 1Z5PA 3NFRA 5ALRA 1KI1A 3O4IA 1R6VA 1OPXA 1TCUA 4TVSA 1TF7A 4J76A 3WSVA 3FHCB 2C97A 5DX1A 4GL4A 1WMEA 1M1YB 3HRHA 1QGAA 4N0MA 4BRSA 2OB2A 2XMQA 4NOLA 2C94A 1C3EA 2CL0X 4PEVA 4C08A 5K0FA 5K3EA 2VIIA 3A10A 4MQ5A 2GEBA 4X44A 2JEZA 3P71T 4B47A 1KU6A 4XUGB 4CR6A 3RD5A 4R7TA 1M2EA 4GSLA 4CU5A 3L6CA 4BYMA 4ZKDA 2Q9UA 1KWGA 1XKXA 4IDBA 3ICOA 3QV2A 4IIXA 3M4YA 4J6FA 1ISIA 2JCSA 3BRCA 1UP7A 3TAUA 4AY2A 1H1TA 2YWDA 3C5VA 1Z36A 2GJSA 1UXHA 3GG2A 2ORVA 3NTRA 3RREA 1JDVA 1UBFA 4KWHA 5KVCA 3BMNA 3D4NA 2XGJA 2VP6A 1YOVA 4UU7A 4EPTA 4PO3X 1YASA 4ZDKA 3H97A 1E18A 4DXAA 2IKSA 1F0PA 3DR5A 3MOIA 4EB6A 1XEWX 3RS8A 3U7EB 5HUHA 1KNXA 4E2ZA 1VP3A 1Y63A 2HU8A 2IIBA 3BDVA 3DVSX 1QKKA 3EY9A 3MBIA 4UUOA 5DVZA 5FKJA 1DEOA 2V7QA 2RGUA 1JF8A 4HAUA 2ZTMA 4MB0A 4Q4AA 3ACDA 3DMDA 5LZ9A 2VBFA 1AC5A 1QONA 2RONA 1ZZEA 1GJRA 2HRQA 4JMPA 4Z4FA 2PZLA 1FUYB 1JRLA 4M9ZA 1W5FA 1SHTX 4ZT7A 4LXGA 1PO7A 3WYGA 1TKCA 4RTRA 3GJXC 1V39A 1T9GR 2C84A 2B5OA 4BAGA 1N5LA 1IZ9A 4GLOA 3RRYA 4BO1A 1VE1A 4GSKA 3DQPA 1OYYA 4IQGA 1F17A 3ACCA 4FFBB 5E9JA 3RAJA 2P2ZA 1CUCA 3IALA 3T7SA 3ABQB 4OLAA 1P4SA 2VLBA 3OCJA 2QPLA 1K4MA 1Q1QA 4L2IB 1Y6ZA 1OW3B 3Q41A 3PT9A 2RHJA 3DFIA 4ZZ3A 1RMTA 4IVNA 4CLEA 3DHWC 4BVGA 2JIBA 4AO7A 4FYIA 5JDCA 1WSWA 1NV9A 1Y4ZA 1KMQA 4ITUA 4C5CA 3DDWA 4U3JA 3K70D 4WIAA 1DQZA 1V26A 4WNAB 3WIEA 5FWDA 4F4UA 1CF2O 1KK0A 3I3SR 4OJTA 2JLZA 1V11A 4MO9A 4A0FA 3AEQB 3M5WA 2GRJA 1SULA 3TG2A 2FPGB 3NOQA 1B8VA 5EG5A 3WSWA 1MX5A 2XE6A 3BCRA 2VBCA 3CU5A 3AUXA 2QQ5A 3OP4A 3Q4GA 4OQ4A 4QPDA 3I8XA 1OROA 4DIUA 1MQ9A 3SYTA 3GLIB 3OEHD 2YHIB 3E9ZA 4FM9A 1WW8A 2QUAA 4WTOA 3DHNA 4IG9A 1CUSA 5AICA 1BH2A 1U1CA 1W4BA 1Z6AA 1ULSA 4QHSA 1V2HE 2C04A 3O4GA 4FFLA 5E1MA 4F1WA 5IDXA 1KKUA 3KXKA 5CIQA 1ORRA 1SC6A 1HWYA 1PBTA 2ZATA 3KQQA 4KXXA 4DS3A 3WBKA 3AEZA 3CINA 1AO3A 4HVAA 2YIVX 1E0KA 1ZGJA 5EMHA 4H9GA 3GT0A 5HA5A 1NZDA 3PUKA 3V4FA 4HY3A 3EZNA 4F7WA 1BXRA 3ET4A 3ADBA 1SCNE 1VPLA 4NFLA 1GDTA 2H0RA 2EKZA 3WIDA 2BJHA 2JAHA 2VJLA 1JHAA 1ILEA 1JAZA 4B7AA 2G5GX 2ZPAA 5AUOB 3IV6A 4B34A 1F0NA 1I13A 4M87A 1N6LA 2CDCA 2OBXA 3C16C 4P3XA 6ABPA 1GGNA 1AQLA 3EOBI 3PFBA 2RE8A 2C4NA 1R88A 3M83A 3MTGA 1RAHA 1XCJA 4HEJA 4E1BA 5IZCC 3AHHA 1XZPA 4R5HA 3I01M 1N1MA 4GMXA 3L4EA 1HA3A 2QYOA 4I46A 4KB5A 3SZGA 4HLNA 3BSYA 4AP6A 5AKJA 3LUAA 4FFRA 3QEBZ 2EG9A 2HC9A 4CTKA 1X7ZB 1YZNA 1QP0A 3VAAA 2R1TB 3UHPA 3WLIA 2OSVA 1FRNA 4HNHA 4QJIA 2RD2A 4ARUA 1IJBA 2Q50A 3D3QA 1HO3A 3AO0B 3E6AA 4FYWA 4GZLA 4S0XA 3TIXB 3CFYA 4RVHA 2IX3A 4JXZA 4FZ3A 1ZD8A 3CLKA 5LB2A 4E15A 2Z4SA 2I2BA 4K6MA 1WUKS 3R3VA 2C5BA 6ADHA 3THOA 4B81A 5J23A 2X0RA 3LPNA 3RWOA 5JEDA 3THXB 3D4PA 3QY0A 4ITRC 3WIOA 3IQXA 2YYZA 3SEZA 2Y68A 3EXEB 4LGVA 2PSSA 3GB9A 4S2UA 4BJ3A 1USGA 3ES9A 3L6BA 5DPMA 4O4JA 2ZRKA 4RVNA 3TXXA 4GRIA 4J16A 2HTFA 4AQYB 3GMDA 2XE4A 5D1HA 1Y4SA 2RB4A 3HU5A 2M6LA 1UXIA 5B1YA 1PZMA 5LQDA 5AUPB 3U7JA 1IULA 4O4JF 421PA 2IEGA 4M8IA 4DNXA 2I6GA 1VBFA 3UH1A 3FM9A 2ISCA 4HB2A 1F51E 3ROPA 3TQFA 2WDZA 2X3UA 3QLUA 2VSYA 4DV1B 4RF3A 1FP7A 3Q3EA 2QS9A 1CE8A 2EGHA 5AVYA 3E05A 3KSRA 5LQSA 3TSWA 3TNDA 3KZ1E 1GTG1 2ZYGA 5JPDA 2RHDA 4L6AA 4WXHA 1MF7A 4BX3A 4WECA 1XWIA 3LZ6A 1HOXA 3RWMB 4A36A 3G1UA 1SCIA 2C2MA 4EI7A 2XUHA 1NR5A 3MTQA 3UTDA 3HL0A 1T2FA 2WE8A 4ED9A 1E79D 1JMKC 2F8TA 6YASA 2MJLA 4RS4A 3RF6A 3INGA 1PIWA 2PUGA 3ZHQA 1MQAA 4RPLA 3TW8B 4WZAE 4BKMA 3W5HA 1RXVA 1CUWA 1PWYE 5K3CA 4B1FA 1QIIA 5IHPA 3DOFA 1DVRA 3IHLA 3WDKA 1Y3HA 4C14A 5AESA 5HKOA 1P0IA 4PE5B 3JV7A 3Q7EA 2PIAA 2FFJA 1DKPA 4MMXB 4DPMA 1D9XA 1IL0A 1SXJE 1U5BB 2EF0A 1LLFA 4GNRA 1K2VN 4E14A 4EKNB 4ARSA 5FTJA 3VISA 5JC8A 3UQZA 4NE9A 2GPTA 5G3YA 2J3QA 3MRTA 4BBJA 1NU8A 3V3KA 4ODIA 4B6FA 1K6XA 1KETA 1RI5A 2ZIZA 5ERYA 1DOAA 3FBTA 1XNHA 1V7CA 5CCXA 4N3CA 2II6A 3AR2A 4DG5A 2ZBDA 1WB4A 4TUYF 2H06A 1ZXLA 3CUWA 4MGEA 4PSDA 5H8WA 2J33A 1RQXA 1V1MA 1Z68A 2X4GA 2WIJA 5B7GA 1YB1A 4GICA 4R1UA 5CHEA 5DRYA 2FW0A 2ZRIA 3AM4A 4UTPA 1E0DA 1EE1A 5AVTA 1GCIA 4CMBA 1T0HB 2DUNA 2ZZKA 3B53X 2NTNA 1TM2A 4RK0A 5THQA 4DA6A 1B8UA 2HYDA 4INZA 5AVXA 4P7BA 1Z7WA 2KMLA 1D3AA 3FPGA 4LTMA 1ZJWA 3DHEA 4JA0A 4W7IA 5JSZB 1KIAA 3PWTA 4NG4A 4ZOBA 5EEGA 2CHVA 1Q7TA 4QUHA 4YAWA 3GLGA 1D2GA 3HPQA 2IIVA 4JJAA 1JJFA 2HV8A 3KWJA 2XQFA 1VLJA 4FMDF 3EIOA 5JAIA 5FI1B 3QU7A 3N1UA 3TTVA 1KGDA 2AN1A 4HNTA 2GK6A 4V02A 2EV9A 1B0UA 2E4VA 3ZK7A 1PU2A 4MPJA 4X97A 3OOWA 1W44A 4K9MA 6AT1A 2Q28A 4Z7OB 2A30A 2C07A 3W1EA 5A4KA 2GSDA 2PSHA 2V98A 3DD5A 2ZEJA 1SMKA 1L9KA 2HM7A 3V8VA 3TI7A 2JK0A 2DFDA 2ZSAA 3NAZA 4MAMA 1V16B 2QTVA 1G6HA 2VLIA 3CEPB 2HD4A 4R1TA 1IRIA 1E89A 3N6XA 3HVKA 1XD2A 4F91B 2R3SA 1V5GA 2ZQZA 2ZYIA 4JI0B 3A26A 1GZVA 5L7TA 2CVZA 4A4DA 2X1VA 3I9V6 1OB5A 1BE1A 1DIRA 3NWBA 2O2HA 4LF8B 1FP1D 3CHYA 3TM4A 3W4JA 3HG7A 3BBLA 2C2WA 4YMIA 1JS1X 2P4EA 5HZMA 5FRDA 1T8TA 5JZVA 2H31A 4BX2A 1SM4A 1EA7A 4ALIA 1OI7A 5JSZA 2FZVA 3EGOA 1XZCA 4PFKA 1H05A 1JBEA 3MS4A 3LK6A 3PE3A 4HF7A 4C01A 1ZHOA 1BMQA 4K5QA 5CA0B 4NONA 1N2CA 2WHEA 3L6RA 3QUSA 4B6QA 2JFVA 2VATA 1ZRMA 3D6TB 6REQA 4IM7A 3NDJA 4L72A 3CNBA 2DFPA 2JLBA 2QVXX 3QWFA 1WULS 3I52A 1NVVR 3OBIA 3QFRA 4YJHB 1DV2A 1XCOA 2OBLA 4WSOA 1H22A 3S44A 3S99A 1K3FA 3B2EA 4ENRA 4QFMA 2HU5A 1SC9A 4AIIA 3E4DA 2JGNA 2NVUA 5EIFA 3VDXA 1X70A 3RLFA 1LPAB 1TYBE 1YUNA 2H7CA 4UBOA 1KE1A 5I48A 2H5JA 3N9IA 3KKPA 2QTCA 3DA8A 2WJAA 1LPSA 1C7FA 2WKRA 5DIZA 5KHLB 5KYUB 1RMQA 2VDWA 4OAPA 4X1KA 5CAEB 1T0JB 5LD2C 2W43A 2VEDA 3OLZA 5A5DA 1HE5A 2GK3A 1ENOA 1CQJB 1T0IA 1VYHA 2I2XB 3WL7A 1RW4A 3CKLA 4CTMA 5CA1B 1MKYA 4TWRA 2VZ0A 2YIJA 1QR2A 1PQYA 4ZT2A 5LU9A 2X4IA 3DG9A 2CHQA 2JBWA 4ARZA 4GYWA 4EUHA 2DC1A 2QXUA 4Y0AA 4EEZA 1QIDA 2MSKA 2OM2A 2W2LD 4HKTA 5T4HA 3FOEC 4DQKA 1ZD5A 1JIVA 1GL9B 2EBUA 4J0FA 4B75A 4PPQA 1T35A 5DWQA 4G5OA 4MUGA 5HYVA 5KAMA 3GY0A 3TRIA 1GTSA 3L4BC 1P9OA 4D9MA 1DRWA 4L3VA 2HIHA 3F8WA 4NEQA 4P5DA 3DEFA 2NACA 4WGFA 2RHOA 2XVZA 1M1YE 1RC0A 1XCGB 4NV3A 1NJ2A 2J6BA 2BFFA 2MHCA 3IPYA 4ONEA 5AW3A 3EIQA 1B00A 1XWWA 1ZGZA 3PCXA 3FSRA 4HH4A 4C6TA 1KA9H 1XPJA 2HCRA 2ACKA 4O25A 4P08A 1CR6A 1UBLS 4WKCA 5HIJA 2G25A 3O21A 1NY5A 2BIFA 1F8YA 2G06A 3PJEA 5KKAA 5CYGA 1RT9A 3TMYA 4B2IA 3RYIA 3OQMA 1EUDA 2QW1A 1HDIA 4HHEA 4TN5A 3RFTA 4P32A 3T3MB 3N2KB 3B20A 4Q7QA 3ZD8A 3V4ZA 3IKTA 3DSRA 3OESA 4KHZA 5HMLA 1F4VA 3EHEA 3L01A 1OAOC