4QC2A

Crystal structure of lipopolysaccharide transport protein lptb in complex with atp and magnesium ions
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter related protein
publication title Structural and functional studies of conserved nucleotide-binding protein LptB in lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qc2A00
4Q9IA 3D31A 1CULC 2VL7A 1GNQA 2GJ8A 2V6JA 1EFCA 3CW2A 3BK7A 1IHUA 4CZ2A 4LJAA 4D0NA 2YWEA 5KDOA 2IS6A 3U4QA 3SJAA 3OIVA 4JT2A 4BLRA 221PA 4DEYA 1T5LA 1WXQA 1BYIA 2AWOA 2VP5A 4G5OA 4MQBA 1UKZA 4LSGA 3RWMB 1R4AA 2CJWA 1G19A 2VYFA 2GESA 1Q21A 1VIYA 1D8TA 1GRQA 4ASUA 4D81A 3VKGA 4RCZA 1XTRA 3P26A 2C77A 2PEZA 4CEIA 2X2EA 4LYHA 5F98A 1SQ5A 4JVSB 3RLFA 2ZUCA 3HDTA 1QBKC 2BCJQ 4OI1A 4C0JA 2QP4A 1ZIPA 1ZM9A 1WF3A 3GEHA 3KDSE 3RYTC 3MLEA 1JR6A 4PAQA 4LHVA 4I99A 1M8PA 5CJPA 4G1UC 2VHJA 3BFVA 2WICA 3OZXA 2LCFA 2C78A 3B78A 3FMOB 2VP4A 4JLNA 3W9YA 4BFTA 4BFUA 4KCGA 2B6HA 3FKSD 2GF0A 4V02A 4ARZB 4WA7A 4LK2A 5HCIA 2IXGA 1CTQA 1G18A 2ZE8A 5EUQB 4Q18A 1S8FA 3QUSA 3WYGA 3IPYA 4B2PA 2V7QD 2IK8A 3B82A 4NBSA 1OB5A 3SI7A 3AVYA 3LBHA 2CL6X 3AP1A 4IW3B 5AUPB 1OXXK 3GJ3A 3THYB 1T9HA 4PXAA 1K5DA 4D82A 2NZJA 3GLHB 3CRW1 1JI0A 2F55A 4PC6A 3FMIA 1HE1C 2VP9A 3IO5A 2Q3MA 3IO3A 1OXTA 2K5UA 1UBEA 4NP6A 4NH0A 1CJMA 2FNAA 2XB4A 4MITA 1W5TA 3F0TA 3T12A 4B6FA 4M1TA 4LC1A 1YZNA 3U61B 4LRWA 3IEUA 3TKLA 1E6CA 3AQ4A 4QHTA 4TL8A 4XSGA 4DCVA 3K70C 4B47A 3KFVA 3MJRA 4QJ5A 4QL3A 5KSYA 2C9OA 1SKYB 2GWHA 1TL7C 3AEZA 4MUBA 5E7MA 5DYGA 2ZSBA 1NY5A 1CR4A 2JIZA 4MDFA 2ZIAA 2I1VB 2V3CC 1S0UA 1Z6AA 2V4ZA 4OL0A 4DIEA 3PITA 5C4GB 1N0VC 2CK3D 2WBLC 2GJKA 3KJIA 1VKJA 4KFSA 3PJRA 2P6NA 4ILEA 1UEIA 3RS4A 3X1YA 1E2KA 2RMKA 3A4MA 3B9PA 4JZKA 4KSBA 2Q9BA 2WOJA 4M0LA 5JZVA 3CR7A 2H1LA 1XPOA 5DN6D 5IK2D 3E5HA 3MCAA 2BKEA 4QBGB 4YLGA 4Q4JA 3V00A 2GTPA 2ZVPX 4CT4B 4I81A 2BMJA 3H2YA 5FOUA 1P5ZB 1GIAA 2CNWD 2R6AA 1XF9A 4MRVA 1MO6A 4FMDF 4EKDA 2N1BA 1U99A 3NBYC 3N70A 4ZIRA 3ZVNA 1N6PA 2GZDA 4BLPA 3CWQA 1SGWA 2YWFA 3GJ4A 3TH5A 3ZZUA 3PQCA 4M9ZA 4PQFA 3O47A 5J4HA 1JEEA 1R5OA 3THWB 3MG9A 3RC3A 3MRSA 4IVQA 2H8KA 1FQKA 2PZFA 2TMKA 5HE8A 3VR3A 1U9IA 4GOJA 4Z51A 5KSZA 3AP2A 3WHKA 2D2EA 4NYMR 5FOVA 1J2JA 1G291 2FFAA 3L0IB 3EG5A 2REOA 3EIHA 2P5SA 1HEIA 1QVAA 1KI6B 2HYDA 2BMFA 5FPHA 5DISB 4Q02A 4B76A 2JLQA 4TLEA 5BN3A 4YDSA 3QBVA 4LJ8A 2ZI6A 4WIAA 5CK4A 4RZ2A 4KAXA 1G21E 2OFXA 3B1XA 4DUGD 1HYQA 2FPMA 2Z43A 5DE3A 4DZZA 4A6XA 3KKPA 4YDHB 4ZCMA 4Q66C 4DRZA 5JI2E 2QNRA 1SVIA 1X8LA 3B1WA 4NU0A 4U00A 1NMXA 3AVWA 2UVQA 1A4RA 3PR1A 2QBYB 1KK0A 1EWQA 5HKKA 1QHXA 1ZM4A 4DBLC 1VYTA 3K0CC 4XD7A 2IUSA 1KDTA 4DSTA 3U7FB 1A7JA 1M7BA 2C9CA 4F38A 5LD2B 4ZKDA 2HYIC 2X2FA 4CRWB 4KVGA 3U44B 1G6HA 1KJZA 3M6AA 1E9CA 1P73A 1KI1A 4HB3A 2ZRNA 2HT1A 1GITA 5JS7A 3EA0A 3K09A 4GL2A 2FFBA 1OSNA 4UXHA 3T1QA 1XMIA 1Z3IX 3LVQE 2CXXA 1FP7A 4DJTA 1N6OA 4TL9A 3QEOA 1D9XA 1Z6GA 1BO6A 3AUYA 2J46A 4MGIR 4CVNA 1XD8A 1ZD8A 1N25A 2FGKA 2A78A 2DY1A 1YR9A 1VCIA 1SKQA 2BBSA 2QEQA 1S9DA 5JLJA 1YVDA 1NLZA 2WAXA 5DYIA 4Z8YA 2J41A 1FX0B 4PQRA 4V0OA 5EQTA 3SYLA 4EAQA 1D6JA 2ZE6A 2X77A 1ANKA 3JZMA 4C7OA 2WV9A 4ZI2A 4HLQB 4QNMA 5B57C 2NO1A 2PX0A 1ZNXA 1EX7A 4PC2A 2ODNA 2J1LA 2GJ9A 4M1OA 4OHXA 3TNFA 2FGJA 1AM4D 4LV6A 5FOXA 4LHYA 3RS7A 2RHDA 2QRNA 2RGAA 3TE6A 5GJBA 2X1VA 2WPDA 3ASZA 1ZNWA 4US2R 5DNYB 1ZNYA 5EXXA 2XSZA 1GOTA 3TMKA 1OW3B 5EXTA 3MJHA 1ESMA 2A5DA 2H57A 2RGCA 3IDQA 4Z8XA 2R8RA 3SR0A 4PC7A 3TW8B 3PEYA 3EWSA 3GLGA 3VQTA 1LW7A 1G20E 2BEJA 3G82C 3CF2A 3SBDA 4FINA 3NBZC 2NOAA 3FYHA 4B2IA 3NC0C 3ZIAD 2QY9A 2WJVA 3AP3A 1TUEA 1CF4A 1DG3A 1AZSC 1W2HA 2C9YA 3DDCA 1P6XA 3QNUA 1OB2A 4PHGA 621PA 4L16A 4HUQB 4HAZA 1IONA 3WRYC 1KMHA 4XVUA 3NDBB 1L4YA 4L9SA 3W3AA 4PC1A 2GA8A 4C3ZA 1NBMA 2AFHE 3I8SA 2WJJA 4TTPA 3KUCA 2FA9A 4I1UA 1R5NA 4ITRC 4PZLA 3SJBA 4Z1MD 2P6RA 5DO9A 3ZQ6A 3B1ZA 2XEXA 3B85A 4MYUA 1P9WA 1G64A 1CS4C 1MO3A 2QE7A 2KB0A 4IEEA 3GCGA 1T0HB 3QKTA 4CIDA 1LS1A 4IOJA 4JVMA 3WBKA 5CLLA 4DLZA 4HZIA 4OYHA 2E1RA 4NHOA 4LCBA 1WCV1 2MSCB 1CEEA 1XCPA 3PIRA 2NQ2C 4C4PA 4M2LA 3RC8A 5FPTA 4LJ9A 3R7WA 2IX3A 4AY2A 4JSTA 3I72A 1BS1A 1X6VA 1MRSA 2ZRJA 4EPTA 1ZAKA 1ZM3A 2VTKA 2ZE7A 1G1MA 2ZITA 1LNZA 3CF6R 3GJXC 1NVUQ 2F1HA 2F3TA 4ZV4A 5KNCA 2ZAOA 1Q1EA 5FH9A 2ATVA 2FEOA 5TARA 1KOFA 2G83A 4XWKA 2J59A 1XEXB 2EQBA 3CPJB 1G16A 1ZINA 2JCSA 1U0JA 2YOHA 2VSOA 1NIJA 1P75A 4IVRA 1HQYE 3QEJA 1DAGA 1KI9A 2D7DA 1SXJD 1VMAA 2O8CA 4EUNA 1E2QA 1PJRA 1F48A 3OIWA 1AZTA 5GVSA 1CJKC 1TQDA 4FW9A 1W47A 2WJHA 3I1FA 4ESHA 4TLDA 2ORVA 2D74A 3SOPA 3VAAA 5JRJA 1GKUB 4KO8A 4LY6A 1NY6A 2WIBA 2ZTSA 3LFUA 4A82A 3D7MA 4J0QA 4TQUS 5EE9A 3U4QB 3HR8A 4PTLA 4QG7A 4V0NA 3CZPA 3GJ0A 2ZE5A 1W2GA 2GBLC 1MV5A 2C03A 3L43A 4BRUA 1T91A 2PX3A 2CJWB 2EYUA 1IAQA 1FZQA 4X8LA 2G9NA 3QKRB 1VCMA 1KSFX 5HTKA 1GL6A 4GOKA 2JLVA 4JLJA 2R2AA 5M04A 4X8MA 4F4JA 2OLKA 3FPAA 1KO8A 1YZTA 2NO7A 1JEDA 2CVHA 3BFKA 4B2LA 5GJWC 4N1AA 4Q7MB 1R5BA 1KK2A 3THYA 1R7RA 2E9SA 2ZJAA 1KDPA 1N6RA 4TMWA 1Z2CA 3DKPA 3GJ5A 4OJKA 1KK1A 4NYIR 3QI2A 4PPNA 3GLHA 3GLFE 3FMPB 2BM1A 1ZJ6A 4HAWA 1NVWQ 5P21A 1H8HA 1E96A 1PLLA 2RAPA 4NCHA 5CB6A 1ZUIA 5K8IA 2RH5A 4KU4A 3IIKA 2ZYUX 4NE2A 3H86A 1P72A 2ANCA 4WOPA 1GTVA 2W2VA 1YRAA 2IYXA 5FPYA 4BZXA 1HV8A 1OE0A 3ZDQA 2YOFA 1U2RA 4PC3A 5BN4A 2YV5A 2VO1A 1Z6YA 4BFVA 1Z6XA 2QMUA 2FV8A 1GUAA 4RZ3A 2CCJA 3SZRA 1Z06A 5G41A 1MT0A 1UDWA 2IYRA 2YNMA 1E79D 3KJHA 1XTQA 3KL4A 2NPFA 3BORA 1CR1A 3CNLA 3K0CA 2CE2X 3KKOA 1XCMA 4URZR 3OE7D 1E2IA 1XEFA 2JJ2A 1KKLA 2W58A 5JWOA 4IDQA 2WWXA 2FF7A 4TMZA 5EUMA 3C41J 3R8FA 2OCAA 1ZW6A 1CP2A 4WXRA 1P61B 1W0KA 5J40A 3K53A 1UDXA 3M0EA 4OQNA 4S35A 2ZRBA 3OESA 5SZIA 1QVRA 2ZAMA 3ZZTA 1B23P 1AKYA 1Z2AA 3ECCA 3D6TB 3C5CA 1X8JA 3WNDA 1T6NA 3MUFA 2VHUA 1SXJC 4K81B 1OIXA 4BFYA 2P65A 3PXGA 3AH8A 3IHWA 1D9ZA 3DZDA 1P9NA 1UM8A 4C0LA 5LB2A 3K9LA 5B2ZA 4V0MA 1J8YF 2ZRDA 4JL6A 1OT3A 3VFDA 4JMPA 4KVAA 4EPWA 5HZHA 5EJEA 1IN6A 4EFLA 2CNWA 1OH6A 1FTNA 1XCGB 1DAKA 4YMVA 4WXPA 3VR6A 4HATA 1YZQA 2HF9A 4JIMA 5FBLB 3UMFA 5EP2A 3VHXA 1KI6A 1H8ED 5CYOA 2JLWA 1RIFA 2H5EA 1VYUA 2VLIA 4BWYA 4JVNA 5FBQB 4BLSA 4A4DA 4ZIRB 5KTYA 4JBYA 1IXZA 2QTVB 3UMRA 5DI9A 4JBXA 2A5FA 1DBSA 2OFWA 1I4DD 3GP8A 4TLCA 1F2TA 4HLCA 4KLNA 4XWOA 3X1WA 3NEJA 2UKDA 3P1JA 2QT0A 3QVVA 4OQXA 3T61A 4CYMA 2QBYA 5CDFE 1IXRC 2DR3A 2DBYA 2O8DA 2OZEA 4IFEA 1XEWY 1LS6A 1G6OA 2Q0HA 3BRWD 3T5DA 4G0NA 1W36D 2KBEA 3NHAA 5J5CA 3DKVA 3BB4A 3FE2A 3AVPA 3KXLA 4Q1AA 4C9BA 2IYSA 1N5IA 2VRWA 4A15A 1M1YE 2ZYVX 1G7CA 1KI7A 1SULA 4AKHA 1TU4A 5BYKA 4Q4HB 5H70A 1LY1A 4MKFA 1P2TA 5FPSA 4BPBA 2N42A 4QBFA 3TQFA 2ONJA 2BHRA 4LC0A 4M8NE 3UMSA 4LBWA 4O3MA 2Q9CA 3ZD6A 3W8NA 3ADBA 1QHHA 2QQ0A 5C2JB 4DLUA 5J4VA 2A7QA 2YYZA 1KGDA 1TU3A 4ZCLA 2DPXA 2HLDA 4II7A 3Q5DA 3FVQA 3HJNA 4CEJA 1EFUA 1FX0A 1TUIA 3V9PA 1MABA 1E2NA 2J7PA 1E2DA 1CXZA 2F43B 4MRSA 3MMPA 2BC9A 3DZ8A 3GD7A 4D2IA 4QM6A 3QF4B 1G4UR 4V0KA 1NI3A 1YHNA 4EPYA 5KSOA 2FFHA 5EE0A 1E0KA 1U8YA 1IN8A 1KY2A 5FI1B 1MO4A 1KHTA 2GVDC 4M4SA 3R7WB 1Z29A 1SXJE 1NIPA 2QTFA 1M74A 2QORA 2IWHA 5AWFC 1W0JD 2EFCB 2GDJA 2QN6A 3AKCA 4BECA 4KITB 3U7GA 4DDWA 1VG0B 1G8YA 1GAJA 2B7CA 2JATA 4EJSC 1QHYA 2VH5R 2F9MA 3GLIE 3AUXA 1RFLA 3BB3A 2GK7A 3MFYA 5L8VA 5JFGA 5JJIA 2GXSA 1ZCBA 1XXHE 2ZS8A 4Q9JA 4DWJA 4QM7A 4B3DA 2G0TA 3LLUA 3W90A 5HPYB 1N6KA 4NZYA 1KSJA 1P7CA 3KQLA 4QC2A 2WSSA 4HUQA 2GBLA 4RFSB 4AYTA 4RJLA 1KSGA 5FUVA 3TSWA 4P0TA 3BAFA 4US0R 4URVR 3KXIA 1R0ZA 4DDUA 1CJTC 2JLSA 2PZGA 1VG8A 2Z0MA 2IXFA 5IHPA 4PPQA 2JEOA 2PT5A 3VR2A 1S1MA 4C2TA 2RHMA 2HV8A 3OEHD 3KQKA 3VR5A 4IFBA 4KXFB 2OAQ1 2VBCA 3GFTA 5D3QA 5AR1A 1UKVY 5TY0A 4DSUA 3KX2A 4XVQA 4QJ3A 2WKQA 3R9IA 2X8AA 1D5CA 2QZ4A 3D3QA 1J70A 1A1VA 2ZI3A 4WBSA 1E4VA 3FTQA 3DMNA 4QXAA 3I5XA 3DHWC 1OLOA 1Z0JA 121PA 4TT3A 3FMFA 2QTHA 2R6DA 5TV2A 2JGNA 4KYUA 3EPJA 4AKGA 1E69A 3WMGA 2DYKA 2XNDA 4P3YA 4C2UA 2N46A 2QU8A 4FI3C 3WNCA 3QF7A 2NPIA 4LDJA 2D4HA 5JWHA 1E1QD 3TR5A 2XNSA 3GEEA 1C4OA 2WJIA 4B33A 4F4IA 2YJTD 3I3SR 4JT4A 2GEDA 2BBWA 1UAAA 2CLSA 2VP2A 4LYAA 1LFDB 2QSZA 1XTJA 1AGRA 1A82A 1WE2A 1OFTA 2ZRCA 3TUZC 1FUUA 4HDOB 3CX6A 4WZAE 5JS8A 1XTSA 1CR0A 3BIFA 5BW8A 2A9KA 2KE5A 4DSOA 2GXUA 4BUJA 3RRNA 4PX9A 4C0AC 3Q8XB 4Q9HA 2B21A 2AK2A 5GVRA 1LB1B 2BV3A 4M1KA 1K6MA 4PHTA 3W6PA 3K70B 1Q12A 4TLAA 1S1CA 2NZ8A 2NTYC 2OT3B 4UQOA 3C16C 5H68A 1R0YA 1XD2B 1JJVA 1SXJA 3LNCA 3ND9A 3QKRA 5LBIA 2YZ2A 1P4SA 2QA5A 1P2SA 4Q21A 1PLJA 4LOAA 4LV5B 3HU2A 4HI0E 4Q7JB 3U6KA 2O8CB 1Q22A 1PLKA 1TQ4A 2CL7X 1P60A 4RZXA 3ZVRA 4NYJQ 1M7HA 3GJ6A 1FQJA 3ETLA 4G5RA 4RD1A 4HAUA 2F7SA 5FI0B 521PA 2GHIA 2WWGA 3LA6A 2GEVA 4ZCIA 1XFAA 5HCNA 4KI0A 4RD0A 5L3SA 1NN3A 4A9AA 4O2LA 1Z0KA 1B0UA 3UWKA 5JEEA 1Q1QA 3NXSA 4LJ7A 1R0WA 2UZ3A 2RCNA 1E0SA 3BGWA 1P9RA 1KZ7B 2GZAA 3QXSA 1Z8FA 2P6UA 4MGZR 1XJQA 4UNQA 2WWWA 5FPKA 1EGAA 1AS2A 4O2RA 5KU1A 1K8RA 4QHYA 2PBRA 3OF5A 2DFNA 4PAOA 1UBCA 5JRZA 3D8BA 2R9VA 3BOSA 2VP6A 3L0SA 1FFHA 1US8A 3K9GA 4BFXA 2DWOA 4JJKA 1E9DA 8OHMA 1NG9A 3QG5A 4M9XA 1JQJC 2BEKA 1IJEA 4DB4A 4TTQA 2ZXUA 3KJGA 4KYIB 2W6ID 1DARA 4BGDA 1X86B 1U81A 5B30A 3LDAA 1J8MF 3I92A 2WMNB 4B73A 2D62A 2HJVA 4QBHA 3BH7A 2KWIA 4JLDA 4WW0A 3RHFA 3KQNA 1E79A 4PZZA 4B44A 5FR1A 2OSBA 1L8QA 2RGNC 2J0UB 1NJGA 1KZGB 2YKGA 3UANA 3OEED 4A0GA 1G8PA 4FCTA 3P4XA 4TYWA 5K8LA 2HJGA 4FXPA 3K0FA 2O0JA 2JA1A 1GL9B 1NN0A 1RJ9A 4JL8A 4EPXA 3C14C 4YMUA 1OKKD 3SFVA 4DXAA 1BH2A 4DLXA 1OYYA 1JXMA 1GWNA 3TW4A 4M22A 1XP8A 4Q01A 1GSIA 3Q7PA 5DI3A 3DEFA 3KQUA 3G0HA 1U8AA 3MAAC 4N0EA 4LYFA 1P3JA 3SHWA 1HE8B 2FSGA 4ZDKA 2WSMA 2HEIA 3HYRA 3QXXA 2FH5B 4GSYA 3HPQA 4JS0A 1KO1A 2CEAA 4OI0A 2PCLA 5FBWB 1AS0A 2A5GA 5TVKA 4W5JA 1JBKA 1ZMXA 3DPUA 4Q1DA 4UJ5A 4L4UA 3QKUA 5K8TA 1W44A 2QAGC 1XEWX 2VPPA 2NIPA 4DLYA 4C0QC 3O8CA 1PVOA 4GZMA 3H4MA 2GK6A 4YMTA 5FTKA 3ZQJA 1KO7A 3AVXA 1GP2A 2IYYA 2ERXA 1E9SA 4I1VA 2FDCA 1H8EA 3CONA 1OIVA 3LAWA 1XNJA 4I1SA 1EFRA 2JLYA 1ONBA 1NN5A 4RD6A 4DCNA 4NCKA 3TUIC 2AXNA 3BD9A 4C0SA 2V1XA 5FTLA 2XB2A 4MYCA 3TLXA 3UXMA 1IOZA 1W4AA 3EZFA 1UKEA 4KLZA 1E2JA 4TSFD 3QSYA 3P20A 5FL7A 4H1VA 1W1WA 1XMJA 2JJ1A 2ZS9A 3RRMA 4URYR 3BWDD 1RYFA 1YKSA 5G40A 2IBMA 5E95A 2QM7A 1LTQA 4AURA 4DEXA 2EWWA 5KNDA 4Q4HA 4MDEA 1F2TB 2QPTA 1CJVC 2FWRA 3ZGXA 2G1KA 1E9BA 2AKYA 3TAUA 2GCPA 2ZVQX 2WOOA 3O8RA 3U7EB 4ERNA 2O8DB 4I4LA 1JAHA 1Z22A 3R8CA 3GLFB 3JVVA 3WP0A 2EFDB 3X2SA 2HCBA 2JJ8A 4BFWA 4G3XA 3LX8A 1HUQA 2RKOA 3OIYA 3RRYA 2IYWA 1TQ6A 2F43A 4R9UC 3G5UA 3GJ8A 4FWIB 1SHZA 1NL3A 4DKXA 1WRBA 3EASA 3RAPR 3VR4A 3QF4A 2W6JD 5F2EA 4Y0AA 2QL6A 1F6BA 5EXPA 2ZPTX 4BEJA 5EXSA 3SYNA 1T8UA 1MH1A 1UPTA 3LBIA 2WMOB 3CX7A 4A2WA 4M1MA 1LF5A 4AC9A 4HAXA 2AXPA 1QHHB 4R2HA 2O0HA 1IY1A 3A37A 1Q3TA 2EFGA 3U2QA 4HB4A 4N3NA 4XJXA 2VA8A 5TB5A 3P32A 1VCNA 1ZBDA 3TR0A 3UG7A 1XJ0A 1MABB 1EG7A 4I1OA 2QUZA 1XU4A 1ZUNB 1BIFA 4M1SA 1R0XA 3TVDA 2DB3A 3U7HB 6Q21A 5JJLA 2JASA 1PZNA 4YQFA 1W0JA 3WYAA 3LH5A 5KPJA 5BXQC 4RFSA 2Z5FA 1Z28A 3X1ZA 3LQQA 2PJRA 4A1FA 4A92A 2JLXA 5G3YA 2OE2A 2ZJBA 3OFNA 1N2CE 2GCNA 1AQUA 5BYJA 1DEKA 1G3QA 3Q5EA 3R20A 1QZXA 4E5UA 5IT5A 1EXMA 4MRNA 1KYIA 3KB2A 5CB8A 2OLJA 4PSAA 1E1RA 4DT1A 1VHTA 4XSHA 3SN6A 2AD5A 2ZJ8A 1L2TA 3TRFA 1SHKA 1AS3A 3CIOA 2ZRFA 2V55B 3ND8A 3AM1A 1XMVA 2D2FA 4MKIA 1QRAA 2XTZA 3U5ZB 4JBWA 4PZYA 4FWTA 1AA9A 5EE1A 3TGPA 4CF7A 1KAOA 1Q20A 2FX3A 3OEHA 2YWGA 4A2PA 2XZLA 1M2OB 3EC1A 2ODBA 3GFOA 3QPVA 2A2ZA 4NONA 2KSQA 4E09A 3B1YA 3K0SA 1TX4B 2ZJOA 4NMMA 4XWAA 5UKDA 3T06B 1KO4A 3IQXA 5B58C 1E2GA 4RD2A 1JPJA 4Q47A 4UXJA 3RDPA 5EP1A 3X1XA 2G1JA 4BLOA 1Z5ZA 2RGDA 3N2IA 4HEJA 4ZO4A 4YMWA 1DG1G 3W34A 4RKEA 2ONKA 1COWA 2NG1A 3TBKA 1RW4A 4ZDJA 1GRNA 5C18A 4LBVA 2OM2A 3OHMA 4Q1CA 3EXAA 2GJAA 1OIWA 4RY2A 2RGEA 4ON9A 4ZDIA 4IDNA 4GP6A 3RVBA 4FMBB 2RB4A 2EFEB 4FIDA 1U0LA 1ZUHA 2ZR0A 5AUNB 4PR0A 1II9A 4ZPXA 3J81k 1XD2A 1JQLB 2G3YA 3BS4A 4IVPA 4LHZA 4M9QA 1E2FA 2PL3A 3AGQA 4DDVA 2WM9B 1G8GA 2QENA 5KDDA 1CIPA 4OHWA 2ZSEA 1C9KA 2OFOA 1KI2A 3NIBA 2C99A 2PMKA 5A5GA 1Q3HA 2AL7A 2GZHA 1ZCAA 3EARA 3B60A 4A8JC 3CRVA 3T35A 1JPNA 2PZEA 1FMJA 4Q9KA 3W3ZB 3SS8A 4PPFA 2E87A 2Z4RA 3KKNA 4R98A 1E9FA 3RANA 1DE0A 1KJYA 2PT7A 5FUXA 3WXMA 5TDHA 4L5BA 4RFVA 5TXGA 2G77B 2QQEA 2EW1A 2H16A 4QGFA 2ZANA 2ZYWX 1G7SA 1SXJB 1IJFA 3BE4A 4UKDA 3W6NA 3SFZA 1F3OA 2CVFA 3CRRA 2Z83A 4HZUA 4JVLA 2MSDB 4Q4AA 4AI6A 4AG5A 2IYQA 3DL0A 4LYJA 2EU8A 1N3BA 1NKSA 4A0FA 4ASUD 5JCPA 5J4KA 1NLYA 2BDTA 3CPEA 1A2KC 4C30A 3A4NA 4D26A 2D3WA 1Z47A 2QAGA 2ZSAA 4M1YA 4A6PA 1AIPA 1ZC3A 1AK2A 1DO0A 1Z0FA 2GEUA 2REXB 3DOFA 4PO9A 3GLIB 4CEJB 2XJ4A 5G53C 4PAMA 3I73A 1E9RA 4HLDA 3L0PA 5HE9A 1XXHB 1E0JA 1N5KA 1FTSA 3FKSA 5L3SB 4AKIA 4HDQB 1NSTA 3DOEA 1SVKA 4TTRA 2JLUA 2GAAA 3HP1A 4MYTA 2BMEA 3VR1A 1DOAA 1S4QA 1UEJA 2V7QA 3SJCA 2OCPA 4YONB 3CX8A 2AN9A 1J99A 1CKEA 5J47A 2WJYA 4MGKR 3DM9B 2C8VA 2J0UA 3CZQA 5CM8B 3LD9A 1W4BA 3ICQB 1OF1A 3VMFA 1US8B 1S9HA 4AYWA 3FHTA 4HB0A 3ADDA 1D2EA 2ZRPA 1XTKA 2IT1A 4IEIA 3Q7QA 4US1R 1QHGA 1L4UA 4P33A 2IS4A 3WRXC 1WQ1R 1RRFA 1G4AE 1YZLA 3EW9A 3PUVA 1Z6TA 1T8TA 4BLTA 1MKYA 1O3YA 3IILA 3SQXA 2P5TB 1IY2A 2G6BA 1MO5A 2ZJYA 1G3IA 3HYTA 4A2QA 4LGMA 1U90A 3EPHA 2BBOA 3W6OA 1VPLA 2DHRA 4BASA 3LXXA 3AF4A 1ZM7A 3C15C 3K0AB 4ZI3A 1AQYA 1MRNA 2CK3A 3MD0A 3QJYA 1R8QA 4P4TA 1N5LA 2FFQA 2JIZD 4EFNA 3DO6A 1OKKA 4JLAA 2A5YB 3AVQA 3K0FB 5DN6A 3FHOA 1W48A 2QP9X 1RJ9B 1ZM2A 2OCYC 1YR6A 4GBMA 5IK2A 4Q19A 721PA 1GM5A 4NPHA 4BZQA 2J87A 1XRJA 4MKHA 4JJZA 2YHSA 1N6NA 2IF0A 3EPKA 3EA5A 5DI3B 1YQTA 1XZPA 1R2QA 4JKYA 5FOTA 3B1VA 4IHQA 4YC7A 1S2MA 5JI3E 2AR7A 5KUTA 2OEPA 1G8FA 3O8BA 1CJUC 3EIEA 2QP3A 1TTTA 3PCRB 3NHBA 3WY9A 2J9RA 4GZLA 5AK0A 1G17A 3I62A 1NVVQ 1FPMA 5F3WB 4EJSB 2Y8EA 1KK3A 1FMLA 3QIAA 4TQAA 1X1RA 2REBA 1WB9A 1HH4A 1OHHD 4XTRA 1ZC4A 4U02A 4TSFA 3F8TA 3GLFA 3REGA 3B13B 4RD3A 1VHLA 5ELXA 5L3QA 3NH9A 5HR5A 1W49A 2KJQA 3ZYCA 4ESVA 1JXOA 4Q7LA 3B5JA 3CNNA 3FDIA 3MWKA 2D06A 3CH5A 3QG1A 4IXNA 2VF7A 3UG6A 4DUGA 2CDNA 1IN4A 1RE0A 3KB1A 1IM2A 1OJLA 1UADA 4H9GA 1OV4A 3AVOA 1VYVA 2R44A 1TAGA 4R2IA 2EFHB 2H92A 2Q6TA 2R65A 4IKEA 2YOGA 4TMVA 1RRCA 4LUCA 1EFHA 1ZIOA 2R6CA 3H84A 1NNEA 1G41A 1BYUA 2QT1A 2ZRAA 2GXAA 4LJ4A 4D4LA 4GPTA 1T3LA 2FJUA 2F3RA 2OG2A 4WZ6A 4IXMA 3T15A 1MR3F 1SVMA 1WP9A 3VKWA 4ACBA 1TADA 4JLPA 2EYQA 4UNNA 1I2DA 2W6JA 3CBQA 1Z63A 2PCJA 3FGNA 1QHIA 1KKMA 1YZGA 2Q3FA 3LW8A 3NWJA 1E9EA 1H65A 4KBFA 3PFIA 1MOZA 3QENA 3CWZA 1JR3D 3AKEA 2GCOB 4OI4A 5AJXA 3L0OA 3U6BA 2ZM5A 2IXEA 3EC2A 1NLFA 3NTUA 4TZ6A 3LQRA 3A1SA 2AKAB 5D3MA 3NBFA 1NF3A 1M7GA 1GDDA 5KO2A 4EPRA 2IWRA 2P67A 4LHXA 3I61A 3TK1A 4P32A 1D2MA 4X8OA 2CL0X 1FNMA 2XITA 3CF0A 1FL9A 2ZI4A 1WBBA 1GFIA 5K8UA 2CMKA 4LI0A 2IYTA 4M1WA 2FOLA 4A8JA 1T0JB 3RABA 2IYLD 1I4TD 1NMYA 3W5IA 3BERA 4JLVA 2W0SA 2LKDA 3VX3A 2O8EA 4G5SA 4DLSA 3F3YA 2OESA 2GETA 3AF2A 3HU1A 1LV7A 3WP1B 2R62A 3REFA 4DSNA 5JHGB 3I4LA 4Q48A 4MA4A 5KYKA 1N0UA 3R9WA 3QOFA 3IQWA 3L2OB 1BMFD 1T3HA 1KTVA 2A3RA 3K0EA 1XZQA 2WPDD 2ZEJA 2I1QA 2IUTA 5CIQA 2VP0A 4QBIA 2ZUBA 2XGJA 2FU5C 2BKUA 3BFXA 3EAQA 2XSZD 3ZIAA 1XD9A 3LX5A 5CIWA 1W36C 1Q57A 2AFIE 2O8BB 4B3XA 1EWRA 5FL3A 5F9HA 4QJ4A 4DT1B 2XAUA 5CDFA 4A0HA 1XMSA 2ZYTX 4KHZA 5IRCD 2CE7A 3OAAD 4Z1MA 2FPKA 3NBXX 4WAUA 4PSKA 2X19A 2OXRA 4R71A 3PG5A 2BJWA 2NO9A 4GT1A 1NBMD 1E2PA 3BJIC 2V6IA 2CHQA 2WIAA 3P27A 5GADl 4O25A 3BXZA 3SQWA 1KI4A 4URWR 1UKYA 4JSYA 1W4CA 3CPHA 4GRAA 4UNSA 4TMXA 1E3MA 3QBTA 4K8OA 1W46A 3THXB 4QNRA 3QE0A 4C0BA 4HDCA 3U3RA 4DC9A 1RRGA 4QRHA 4TL7A 3K9HA 4ZKEA 4DCSA 3MSXA 3K09C 2O8FA 1I2MA 1OFIA 1II8B 2IC5A 2BCGY 1KNQA 2H17A 4HAYA 3VTKA 1TF2A 3SDZA 3FKQA 2Q9AA 3U60B 3UIEA 3FFBA 3DM5A 4DIDA 3ZLJA 1ZU4A 4UNRA 3AVTA 1SVLA 5CK5A 2ORIA 2O5VA 3W5JA 1JNYA 3AVVA 1E4YA 2FMXA 4EQ6B 1Q1BA 5EE3A 2PLFA 3MWJA 2CLDX 1HA3A 2GVZC 3T1OA 5JSZB 4AK9A 3N5CA 3A1VA 1DTSA 1GL7A 4ABYA 1G5RA 4OQFA 4OHZA 4OBEA 1OXUA 2J0QA 2YC4C 2ZROA 1Z07A 1E2HA 2EWVA 2ZSDA 3GLIA 5KHOC 4HB2A 2FE4A 1VTKA 2J3EA 2VHQA 821PA 1XXHA 3GMTA 2C98A 3E70C 4LWZA 3TJZA 2O0KA 2C96A 2Q3HA 1Z83A 4OKSA 2XZOA 1IY0A 2QPOA 3P4YA 2BIFA 3UKDA 3THOA 3H1TA 4HZUB 4Q4AB 1CLUA 4GNKA 3RS2A 2ZS7A 3IIMA 2BJVA 1KJWA 2XX3A 4UXIA 2QAGB 4LBZA 2CCGA 3GPLA 2FSHA 4F7WA 4YMSA 2VF8A 3IKJA 4DB2A 4OI2A 2QGZA 4BQSA 3Q85A 1JALA 3CRQA 4UNPA 3C5HA 2QGNA 5FR2A 1H8HD 4TMTA 3LO5A 1LF0A 4PSVA 3RS0A 4IOKA 4G5GA 1IN7A 1E2MA 4GP7A 4TL6A 4CEHA 1G3MA 4B48A 3NG1A 4N0DA 1J7KA 1IN5A 3KKMA 4NYMQ 3TSZA 2HXYA 4IRUB 5TMPA 1ZU5A 1ZP6A 3K0AA 2BMDA 2FPLA 4OK3A 2Q21A 3OE7A 3RRZA 1XBTA 4JLOA 5DHAA 4JKIA 1OH8A 1FNNA 4OHYA 3OIUA 4P31A 1T3SA 3PEVA 3ZVLA 3PEUA 1JR3E 1E9AA 2WVJA 3SEAA 1NVXQ 5LPNA 2VSFA 5BN5A 1XTIA 2JJ2D 3I8XA 3ZD7A 1F5NA 2DCUA 4K46A 4RCYA 5CM9C 4LV8B 4TYYA 1M34E 1G5PA 3ZS8A 4NYJR 2HDNB 2P2LA 5IF9A 3VHLB 1ETUA 2QRZA 1W0KD 4GOXA 4IOMA 4TZ0A 3ZZ0A 4IDPA 2B8TA 4F93B 3E2IA 2CCKA 1F2UA 2HXSA 2DWQA 4QFMA 3RS5A 1I4LD 1PUIA 4RKFA 2ERYA 3IPXA 1A5TA 2FZ4A 3QPWA 4O0MA 1UFQA 3SU8A 4W5HA 4Q1BA 3LBNA 1E32A 4W5WA 4AG6A 1HT2E 1LVGA 2A5JA 2KI5A 4D4KA 2WAYA 4BFZA 1NG1A 2J5XA 5JJKA 1YR8A 4GMDA 4BLQA 1NRJB 4EJSA 2B8WA 4U7DA 1VDZA 3PEWA 2AX4A 2W83A 2J7KA 1FUKA 4M21A 1TQ2A 4F91B 4L8GA 3AF0A 3R9XA 2ZRHA 4HUTA 2IEYA 1VCOA 2JDID 5KNBA 2GRJA 4RSGA 5EP3A 3TIFA 5GJVC 3RWOA 3F5FA 1G8HA 3QKSB 3T5GA 1OXSC 2MMGA 3C7KA 3GLGE 1R10A 1QHNA 4DVGA 3MWYW 3QVUA 1OHHA 2IHYA 2R6FA 1KMQA 2ZR9A 1RKBA 1U94A 4Z54A 5BWMA 2F1JA 1P62B 4DDTA 1CR2A 2HCJB 5E7IA 4X8HA 3A6PC 4Q9LA 4Q5IA 1SVSA 3K1JA 2VQSA 4DLVA 1DAMA 5L3QB 3IIJA 2FG5A 1NBME 2ZJ2A 2F1RA 4OJQA 5DH9A 4FMCB 3KJEA 1TMKA 3VU9A 2XOKD 1II0A 2ODWA 1M6NA 1KDOA 4CGZA 4TQ9A 3RSLA 2XXAB 3QXJA 2C04A 2GCOA 2WJGA 2CLCX 2GAOA 2XTNA 3NVAA 2YC2C 1XX6A 3CB4A 3VNVA 3B7GA 1K5GA 5JWRA 4FCWA 4H1UA 3A1TA 5C1BA 3UATA 2OILA 3PENA 1X3SA 2R6GA 1NJFA 1U98A 1ZRHA 4NL4H 4UJ3A 1FP6A 1F60A 3LY5A 2IS1A 2BM0A 2HLDD 1OXVA 1JR3A 2RGGA 2XZPA 2IF2A 2QMOA 3PV0A 4JL5A 4PO1A 3A36A 3E1SA 2J7PD 5KPDA 3IGFA 3B6EA 2ZRGA 3WMEA 4W9MC 1JB1A 2RGBA 3IHLA 1ELOA 1NMZA 4Q7KA 5D3MB 4QGAA 4HLUC 4M53A 1DO2A 1TEVA 1RRPA 1PV4A 2SHKA 1IQPA 3LVRE 2VHTA 3KTAA 4TN1A 3EX7C 4TLBA 3EZ7A 3Q72A 4CW7A 3GFPA 4A8JB 2CHGA 3QQ5A 1UBGA 2OBNA 2ZETA 2O8BA 5F9FA 2OV2A 4FCVA 4P4UA 5E4FA 5A0FA 3RSOA 1BOFA 2IYUA 2PH1A 2C95A 3A58B 3WYFA 1E0AA 2O8EB 4DCUA 1BMFA 2BVNA 1DAIA 4G5QA 1KY3A 5JCZA 1DPFA 4P4SB 2P3SA 5FTMA 2V8OA 1IXSB 3KXKA 2GKSA 2WSSD 1GVNB 4E22A 1EX6A 2IYVA 1DADA 4S2EA 2XTMA 2IHBA 3N2EA 3A1UA 4PFSA 3UWOA 1RC8A 2L0XA 2OXCA 3EZ9A 3NEYA 4F4CA 3V4RA 2HF8A 3GLHE 1XB2A 4QHSA 3CRMA 2W00A 4B35A 1N6IA 4IDOA 4URUR 5FUWA 1VG1A 4V0LA 1DAHA 5FBRB 3U3MA 4LPKA 1NN1A 4NDZA 1Q1ZA 3OAAA 1KO5A 2KBFA 3TVTA 2ANBA 4C0KA 3QY0A 1A2BA 3HWSA 3AF1A 4KV9A 5LD2C 3SNHA 5C4MA 3THXA 4LPSA 3VNUA 3TSOA 3KZ1E 1UF9A 2VSXA 3EPLA 5JEDA 1YZKA 2W2XA 3FHCB 2ECKA 3O8DA 1X8KA 2W2TA 3L82B 2PJZA 2IW3A 3CUEF 4QOSA 4BRWA 3EWAA 1CBUA 1II8A 1SKYE 2OUKA 2PMDA 4TT3D 2WKPA 1E1QA 1KI3A 2O52A 4MH0R 4NYIQ 3U3KA 5FTNA 4LHWA 3QXCA 3FOZA 3TUJC 2VIIA 3LV8A 4GMXA 1WBDA 2XNDD 3IUYA 1S3SA 4XTCS 1YZUA 2RGNA 2ZI7A 4IDHA 2QMEA 4OHVA 3S1AA 3SHFA 4PHFA 5DHFA 5B64A 4EQ6A 4B3FX 1KIMA 4RD4A 4B3GA 1OFUX 2B7BA 1GNRA 4GI7A 3WMFA 5JSZA 3QXHA 3L8YA 4NCJA 4YXWD 2C5LA 2JAQA 2WHXA 4B71A 1EFTA 2O8FB 2OBLA 5CLQA 3IBGA 2BBTA 5CJ2A 2GNOA 5DSZA 3WNBA 5JMTA 4G01B 1BKDR 4WVFA 2IA5A 1AKEA 1VECA 1HTWA 4FD2A 1W7AA 2GF9A 2WKRA 3BH6A 4KJZA 5AJYA 1UJ2A 4V0ME 1DAEA 5LDDC 3A4LA 4MKGA 3PUYA 2VEDA 4XVRA 1WA5A 2WWYA 1ZYUA 5DGXA 1YE8A 2ZU0C 3AKDA 3RS3A 3WBJA 5E7JA 2I4IA 2ZR7A 3KUDA 3K8YA 1FOEB 2W0MA 2OBMA 3ZH9B 1O87A 3WHLA 4PANA 2F6RA 2VHCA 4EPVA 3UPUA 2ZJ5A 1YU9A 2FZLA 1Y3AA 4BZPA 2IS2A 2DFKB 3JZAA 4KBGA 4F92B 3C8UA 5FOWA 5L3VA 4TWZA 1AN0A 1TF5A 2H18A 4AIIA 2ZSFA 4ARZA 2DWPA 2LKCA 2QSYA 1KDRA 4KFTA 2OO7A 2G88A 3MWLA 1PUJA 3M1IA 2NO6A 4CEIB 3ASYA 1XJCA 3ONWA 3NKVA 3Q9LA 1SVOA 2QM8A 2WWIA 1Z08A 3CM0A 3SYKA 4BEBA 4PPGA 2MMCA 3TQCA 1W4RA 2IUUA 3IBYA 3PUWA 5EE5B 3T34A 2V9PA 3AB3A 3VX4A 2W6IA 1W5SA 4DLRA 3FWYA 4XOIA 4EIWA 3IEVA 1YR7A 3CLVA 3QPUA 5LB4A 5FOSA 1RYHA 1J90A 4NKRA 4LZZA 2IEZA 3NH6A 2AK3A 2OHFA 3VKHA 5FTJA 4QGHA 4KFUA 4TMKA 5AJWA 4Q1EA 2P0EA 2ZI9A 1RPZA 4LJ5A 4CEHB 2BWJA 1ZVQA 1QG4A 2ATXA 1OYWA 3NC1C 5H8WA 1Q0UA 4FMDB 4TYPA 3K9NA 4HYYA 2OAP1 2G0NA 4BE7B 3OEEA 4EDHA 1ODFA 3GQBA 1GRRA 5H1YA 3PUXA 4QKQA 1V43A 4LJ6A 3PUZA 2QMHA 3T1VA 1KI8A 3UK6A 3DVLA 3HR7A 4DHEA 1RZ3A 1U0HC 1YRBA 3NDPA 4MYHA 5GJCA 2QAJA 3SBEA 2ZUDA 4C0HA 2WTUA 1T5IA 4B6EA 4JYBA 2H7VA 1EK0A 4B32A 5C46F 1E94E 5CITA 4L15A 3X1DA 4OQLA 1XPRA 1T4GA 4MRPA 2HT6A 1Z0DA 3CNOA 4LX0A 4RVCA 1FW6A 3SE0A 4PO8A 3KKQA 4NCNA 3AGPA 2QROA 2A30A 2Z6VA 4DLWA 1E2EA 4Y0VA 1F2UB 4L9WA 2AHOA 2CBZA 4HLUA 1KNXA 2NMVA 1YJ5A 4B74A 2QI9C 1JJ7A 5AJVB 5IDVA 4CDGA 3QKSA 3U3OA 3THWA 2ZRLA 1G5TA 2GXQA 1DS6A 3B8HA 4AWXA 3FB4A 5KSPA 4B34A 1VG9B 4MGYR 3B9QA 4PQYA 1QHSA 4Q1FA 3U3JA 2NGRA 3B2EA 4Q4JB 2JDIA 3CH4B 3AF3A 1Y63A 1U8ZA 2WWHA 5JBQA 1TPZA 4DLTA 1EFRD 4M9SA 2BOVA 1V5WA 4AD8A 1Q44A 1ZD1A 2MSEB 2XJ9A 3ZJYA 2GILA 5AJZA 2IYZA 4D4MA 4R7ZA 3V4FA 1ESNA 2FSIA 2ZRIA 4BFSA 2NO0A 1CU1A 1QDEA 2JJ1D 4KODA 5FL7D 2XXAA 5AUOB 3LXRA 4E07A 4E03A 4D4JA 1E98A 5J4YA 1JECA 3H0KA 4NCIA 5SZJA 4XH9B 4V03A 3M4YA 5ANRB 1R6BX 4URXR 1W36B 4WZBE 4OK5A 1XPUA 1AJEA 1AGPA 4HSEA 4JLMA 3KQHA 2J0VA 1R8SA 1WDTA 4MUAA 1QF9A 2XOKA 2DFTA 5HKKD 3U44A 2YWHA 3Q3JB 5EP4A 4XD7D 3RNLA 4GDFA 1HT1E 1DAFA 1IBRA 1P2UA 3BH0A 4HAVA 4NTZA 3HPRA 4JYCA 5FFMA 2F1IA 1TNDA 3VU9B 2ZU6A 4Q4LA 1JAIA 2JLZA 2LWIA 2ZI5A 3LLMA 3AVUA 5BQ5A 1DVRA 4LJYA 2PLRA 3ADKA 4KFRA 4KSCA 4U5XA 5AUQA 1TEXA 4POAA 2OCBA 4B43A 1N0WA 5DLQC 3CO5A 5EZ6B 1RVDA 2ZQ5A 421PA 1G3RA 1X1SA 5JECA 2C2HA 1G9XA 3DMDA 5E3HA 4Q00A 3LW7A 4B3BA 1SVWA 1P2VA 1GKIA 2GJSA 4FMCF 2I3BA 4Q03A 5G3ZA 3MGCA 5KDLA 2Z4SA 1NVVR 1GKYA 4XIGS 4W7SA 1Z0AA 1XWIA 2JLRA 4IOLA 1UBFA 2IL1A 5KOYA 1CRPA 2QG6A 2ASEA 1C1YA 4P4SA 3BC1A 1NSFA 1L7VC 4LBYA 1WMSA 2FN4A 4ACAA 1DELA 5CYPA 5SZHB 3GEIA 1G7RA 1GILA 2AD1A 1KSHA 3PVSA 1OPXA 3KTAB 5EZ5A 3OFND 3T1TA 4C7OB 1U9IC 1OH7A 3I5YA 5FBVB 1GNPA 1EESA 2J0SA 1G7TA 3JVUA 2HUPA 1OFHA 4DCTA 2UZIR 3CKLA 3EZ2A 4OQMA 4IJMA 2YVUA 4GFDA 2ZRMA 3BBPA 1S3GA 1TF7A 4A0RA 4FN5A 1E1RD 1N6LA 1G3UA 2ZJZA 2DFLA 3C4JA 5DIFA 4JLBA 1CRQA 3BB1A 2ORWA 3CR8A 3EIQA 3ZVMA 1Z0IA 4EFMA 1HQCA 3AV0B 4RZUA 4A36A 2AWNA 5J4LA 2D7CA 2PEYA 2J45A 4D80A 2FEMA 3GLGB 1ZNZA 3A1WA 2F9LA 4ZDWA 2WWFA 4QGGA 3TAHA 4D0GA 1GG2A 2RGXA 1VIAA 2WZQA 3A8TA 3ADCA 2EVWX 4B75A 1NKTA 4TYNA 1E2LA 2QE7D 2V54A 1NP6A 3HU3A 4MRRA 1S96A 2B92A 3LRPA 1XDBA 3EZ6A 2CHVA 3LWNA 3SC3A 3GJ7A 1ZD9A 2ZRKA 3ICEA 1KMHB 2FSFA 1N5JA 1HY3A 5HZKA 4D25A 1COWD 2ZREA 4JLKA 3SJZA 1OH5A 4TYQA 5JHHB 2YINC 3AKYA 5A4JA 1E99A 4D6PA 3KFXA 3FFAA 5FUYA 4PHHA 3L8ZA 4D0LB 3I32A 4AKEA 1GZSA 1N6HA 1XEXA 2V1UA 1QG2A 3K70D 4OK6A 1KAGA 5L3RA 3S1AB 3ZS9A 4AYXA 5SZKB 2QPAA 4YXWA 2ODEA 3W8RA 1SZPA 4B3CA 1D2NA 1HURA 4CT5A
chains in the Genus database with same CATH superfamily
4Q9IA 1CULC 3KUUA 1PR5A 3I34X 5CBPA 2V6JA 1NI4A 1NM5A 2ZT6A 4D0NA 2NT4A 3UH0A 3A6EA 3M9WA 2B69A 2EHDA 2YWEA 2HW8A 3U4QA 4JT2A 4WOKA 4YQYA 1PZEA 5KYWA 3FLBA 1ECPA 2AWOA 4LW8A 4LF5B 1UKZA 4INJA 3HL4A 4HSGA 2PZKA 2DECA 4RHTA 2H1WA 3E9ZA 5JPCA 4XI9A 1G19A 2CDCA 2VYFA 1VI5A 3DL2A 4ZI5A 5C1OA 1GXSB 1ATZA 1F0YA 3FRHA 5A9RA 4BWFB 4WNCA 4Z6KA 2BMAA 2C77A 2R4QA 3Q6NA 3QNMA 4YT4A 2BH9A 4KSYA 4NCBA 1DBRA 4OXKA 4KGVA 2VJBA 2HX1A 3RLFA 2IHNA 5F98A 5A2GA 1R8XA 1LQ2A 1QBKC 2JGLA 3S81A 4MW7A 2BCJQ 5EIEA 1C80A 2QG4A 5EEGA 2QP4A 1ZIPA 4H27A 4LSZA 2VH1A 4PU0A 4UREA 1F06A 3VU3A 4E13A 4PAQA 4R7TA 2XKAA 1G98A 2LP4Y 2FMHA 4G1UC 1ECGA 1JA9A 2VJAA 1F0PA 2E48A 5LN1A 2LCFA 4YEDA 3K1ZA 5IARA 4YPFA 2IBSA 2NVUA 4NECA 3WI7A 5KYUB 5ALDA 1XTUA 2VP4A 2WQZA 5ENZA 2ZB8A 3FKSD 4Z2AA 4V02A 2PK3A 1E9VA 1KVQA 3WLMA 4D3FA 3HXLA 3ZE0B 2G25A 3NPAA 3F3KA 4N7JA 2BGIA 4QWMA 4A8PA 1CJSA 4HFMA 4RSRA 1HRDA 4TVBA 3WYGA 4M88A 2G09A 4XPIA 3B82A 1OB5A 1AV7A 4PV7A 1WV1A 4BLWA 3AVYA 3KDAA 3AP1A 3LBHA 1Q14A 4G9EA 4L85A 4BQIA 3T3NA 2QRHA 1LBTA 1K5DA 3I01A 3PFFA 4D82A 1QYDA 3CRW1 2F55A 1PL6A 1ZOSA 4JJFA 4AWBA 4PC6A 3FMIA 2O2HA 4A5SA 5B2FA 3I58A 3BCRA 1WO8A 2WHEA 1PGOA 1TT7A 1UMDB 1IBLB 1CJMA 5F51A 4MITA 1G9TA 1OC2A 3IVAA 4RA6A 4B6FA 3DW1X 4K40A 2AJDA 4MJLA 1Q7TA 3FTPA 4P82A 3GVIA 2VWGA 3IEUA 1E6CA 3GGPA 3SDSA 2JH3A 3TKLA 3TKAA 3OQOA 4KGXA 1JDUA 2D54A 5BN4B 3W5AA 1Q7RA 4XSGA 3LK7A 1H3EA 3RSFA 3LQ4A 3EJ6A 4J90A 3I9V1 4MR7A 2JFXA 1TL7C 4Z7NB 1JP7A 5KSYA 2AMVA 3Q0TA 3PVZA 4H7IA 2G28A 5H0IA 1MAUA 1VMEA 2IYOA 3KSZO 5H83A 4F45A 5BVGB 4DCGA 5AVXA 2W37A 2PD3A 2V3CC 1QCYA 2AHRA 1R6VA 1Y3CE 3PC8A 5TS3A 3UHAA 5BR4A 2P2ZA 2P6OA 4OL0A 4Y6LA 3IAS6 4OKIA 3NKLA 4X1IA 3RJ9A 3UV6A 4AP6A 1PZGA 2CK3D 1C9NA 4KFSA 4MYDA 2J6CA 4YCSA 2YFQA 5ICSA 4ILEA 5LP6A 1UXOA 3BQMB 4JUBA 2PT9A 2RMKA 1Y37A 4YS6A 3ZWWA 2AB0A 1E18A 1F8UA 5JZVA 2H1LA 5IN5A 4YV1A 1EGHA 5CLIA 4ZJUA 4W5RA 2H85A 5ULLA 3IP1A 2OZLB 3R77A 1LSJA 1RZVA 2H1SA 3LQ2A 4CT4B 2FCAA 5EYPB 4R8KA 5C5DA 3FHJA 3RE1A 4H4DA 1QDLB 1UM9A 4FMDF 4NULA 4EKDA 4QO7A 2YUTA 4IHJB 1JQBA 3FHLA 3MD9A 2GZDA 4BLPA 2EDCA 3CWQA 2Z6QA 3GJ4A 3PC3A 3TH5A 3ZZUA 4BVEA 3DV9A 2Y1DA 1XZKA 3O47A 3HJFA 1EFPB 4DJAA 1JEEA 1R5OA 2EX4A 4I1YA 3EPRA 3ESCA 1CQIB 3MRSA 3AYZB 1FQKA 2PZMA 3VR3A 2VKQA 5I7UA 1T15A 4QXOA 4Z51A 3AP2A 4HTAA 3ZXIA 4ERXA 1V9LA 1XL0A 2UUCB 5C4IA 1D6MA 3M4XA 1E5TA 4EATA 1WY5A 2FFAA 3EIHA 1Z2PX 4HDMA 2P5SA 4EMBA 5LOVB 3D6AA 1QVAA 2OK8A 2HYDA 3BG5A 4G1EB 1DU4A 4YRCA 1QYIA 3U7JA 3I5AA 4PZDA 4AZ0A 3OWOA 1IWOA 4RKRA 2BMFA 1R4ZA 5FPHA 1JTVA 3AUSA 1O94C 2XDQA 3A6HA 3HEAA 1S7GA 3IKLA 1U1GA 4YNBA 1N5RA 1B0ZA 2AN1A 3ZZNA 4X62B 1RPNA 1CQJA 4RZ2A 5J9FA 1P81A 4DAEA 5KX5A 1Y8ZA 4WLNA 1ZVVA 2W8BB 4DA8A 2Z43A 2JFPA 2G8LA 2R79A 2AFRA 4Q66C 4UU8A 1SVIA 1UXKA 1N92A 3RU9A 1QIKA 3AVWA 1UK7A 5JQGB 3PR1A 2I22A 3JCZA 2O8NA 3NONA 4FDTA 3G6KA 4MS4A 4BV9A 5IEBA 4YAUA 4LZWA 1NNUA 1J4AA 1OLUB 3H2GA 3K0CC 2YMLA 4HN9A 3EMVA 5TQJA 1L5YA 1SBTA 1RKQA 1A7JA 1M7BA 1Z4JA 2FUKA 3C3EA 1L5OA 3TW6A 5JAMA 5L53A 3L1JA 1O0SA 2X2FA 3EEYA 3JPWA 2NV6A 1G6HA 3K4HA 2H1OA 2YHBA 3W2EA 3M6AA 2QN8A 5I9SA 3P9RA 3N8HA 3U80A 1P73A 3D7LA 1KI1A 1MAWA 4JYAB 4QDXA 2HT1A 1OZ0A 1OBVA 3K09A 4UD6A 4GL2A 4N0QA 3TQQA 2ZCVA 3LVQE 2OZPA 2CXXA 4Z3DA 5DM70 1QQ7A 2BFAA 4Q3AA 2FSSA 4TL9A 3OD5A 3GDGA 3QEOA 1Z2DA 2FPSA 2J46A 5HUQA 1YR9A 3ANNA 1VCIA 1FA9A 3D64A 3I6ZA 1EM8A 1SKQA 5C1DA 1EJ2A 4Q3BA 3J81A 2GD6A 1FLVA 1YVDA 3EY4A 1FX0B 4OAOA 3RSCA 3OX2A 4H3HB 1VBFA 3TXAA 4A7PA 2VPQA 4EW2A 2X77A 1H1TA 1ANKA 3A6ZA 3IAM6 4MUNA 3RAJA 2H1CA 4CJXA 2WV9A 2X7HA 4JITA 3WYEA 4EGAA 2DM6A 4C7OA 3LL4A 4QJIA 5B57C 3IBFA 1L8XA 3AERA 4H7HA 3K16A 3G8YA 5A02A 4OHXA 1CS0B 2FGJA 2GRAA 1EK2A 4OBXA 4M46A 5FOXA 5B4VA 1RI2A 3RS7A 3D2AA 2ZYHA 2RHDA 1ODTC 3F7TA 1F4PA 1Z82A 3QVTA 4FKBA 3QTBA 4KQXA 4DLLA 3MJ4A 8ABPA 1YCGA 1R66A 4LYEA 1K88A 1BXZA 1T8RA 1XIVA 1TW2A 4S1OA 3ZY3A 3RC2A 2B61A 3FR8A 4YA6A 5E4YA 4XX1A 4AZSA 1OW3B 4OA8A 5EXTA 3MJHA 2XQJA 3IDQA 1V6SA 1E7YA 3TW8B 3UGJA 2ZZMA 3PEYA 4PSDA 1U02A 3GLGA 1JQ3A 2PGDA 3VQTA 1G20E 3M1LA 3G82C 3IUNA 3JALB 2HSWA 3NEPX 3NBZC 3PC4A 1VP9A 1ZBQA 2GCIA 5I9LA 3OKFA 1OFGA 1CF4A 1DG3A 2YW2A 2QQ5A 1UZAA 3VR2D 1W2HA 3OU7A 1N7JA 2EDAA 4H6PA 3DZIA 5LQAA 5A3RA 3QUQA 5BR7A 3OUTA 2NXCA 4N3AA 3G5TA 1AUQA 5TPWA 3LC7O 2A1UB 5IAJA 1J5PA 1IONA 1FP4A 1NRWA 4U6NA 4UC0A 1MF7A 1L4YA 2GLXA 3DJYA 4CFSA 4PC1A 2GA8A 5CPFA 3SZGA 4C3ZA 2AFHE 2ZG6A 1JEYA 4BMOB 3KUCA 4ITRC 1R5NA 4NLLA 2P6RA 3COYA 3E3LA 3P9YA 3EVAA 2ISSD 3REOA 2OCXA 4ENRA 1NNI1 3KEOA 1GZUA 3QVJA 3SSAA 4MYUA 1G64A 1C50A 4IEEA 2C4KA 3ITNA 4HQOA 3GCGA 2YH2A 2RH9B 3UH1A 2BPOA 3WBKA 4DBLE 1Z18A 5CLLA 4CM1A 4UBMA 3PKZA 3WISA 3FNBA 3OECA 1Z7WA 3QLUC 5FWDA 4BVFA 1I6LA 3ZU3A 4KH1A 3E8XA 5JVDB 1YUNA 1W88B 1XCPA 3T52A 5ITZB 1DJLA 2NQ2C 2PUTA 4PGFA 3R7WA 3DFMA 3OQ6A 4JSTA 3QWHA 2ZRJA 2XMGA 1GG9A 3MWGA 3TOVA 3IUQA 1MHPA 3M6FA 4EPTA 5A6SA 5K8JB 2VWQA 3T3DA 2FN9A 4KQJA 2W4MA 4ZHQB 1NF8A 1P17A 3G17A 3U5TA 3BGIA 4ZV4A 4DBZA 5AVKA 2P68A 5CA1B 1LI7A 2OOSA 3CNEA 5JYEA 1Q1EA 5TARA 4DR2B 2R68A 4V2UA 1T9CA 3T8YA 2EQBA 3CPJB 5T4BA 3KSRA 1ONPA 3MINA 5K0LA 1MVNA 5CB0A 1PJTA 1ZJYA 2BT4A 4IVRA 1XZIA 1LFAA 3QEJA 4CF3A 2GYYA 5JS1A 2D7DA 4PG7A 3V32A 1J0EA 2X9QA 1GQYA 3IT1A 1TQDA 4MQLA 3LKBA 4YO7A 1AO0A 1GKUB 4KO8A 3CMMA 1NY6A 2WIBA 4LY6A 5MN5A 2D00A 3RRBA 4OHPA 4E5YA 4DJEC 5CYGA 4IRXA 4PTLA 1H3FA 3GJ0A 4R8SA 2ZE5A 4EKNB 2AMLA 5EPOA 4G5YA 2GBLC 2C03A 3ABOB 1N2BA 1N9ZA 4KQMA 1JDPA 3HI6A 1TM1E 4X8LA 1IAQA 1IB0A 3ELDA 1YS9A 2X9LA 5KYXB 2JLVA 2XPCA 4E2ZA 2Q5EA 2VZ8A 4OLFA 5F4ZA 1GGHA 2VXBA 2HFKA 3I0MA 3RC1A 3H99A 3SF8A 2Y68A 1WSDA 4MQEA 3O92A 2DPLA 4B2LA 1X94A 4DM7A 4Y2TA 4BQNA 1QFMA 3V3TA 1EUQA 4ROTA 2X23A 4X85A 2J6HA 3VBEA 1UFVA 1Z2CA 1KK1A 2AG8A 1AXEA 4NYIR 4AJ4A 1PJCA 4E1BA 4W5OA 3GLFE 3FMPB 1XO1A 1CQZA 3NBMA 3RASA 2J07A 4BV3A 5K20A 2RAPA 2ON6A 4DLNA 3NQ41 5KHLB 4FM9A 3KZCA 3JQPA 3EAFA 5K8IA 4QEKA 3MCUA 5B6JA 4EK9A 2P1RA 1K4KA 4F7DA 3BHIA 3G2PA 4NR0A 5DHUA 1O94A 5A05A 3N6VA 1V5IA 2WG0A 1GTVA 4B81A 3KVNA 4IH1A 3KBBA 4JQYA 4BMVA 4ZU3A 1WDMA 1OE0A 3ZDQA 3LUHA 4HV4A 2VJCA 1UBHS 5KJ6A 2VO1A 4C7BA 4GKAA 1KQNA 4WY2A 3D4BA 5J1SB 3GBPA 1Q1AA 2WV7A 4INPA 1WW2A 4JFRA 3K1YA 4CTMA 1FCJA 1HC7A 1Z6XA 3RFCA 2I2FA 2JCXA 2VXCA 1MT0A 1UDWA 3CLSD 2IYRA 1E79D 3KL4A 1XTQA 3BORA 3L7LA 1CR1A 5EESA 1Q83A 3K0CA 3D1LA 4MCIA 4YDQA 4Q37A 2XB6A 1AK9A 4YJFB 5AK6A 3LUDA 1D04A 4RVOA 3LDGA 3D7NA 5EUMA 4H7PA 2BUBA 3ZV6A 4X93A 5ECYA 4PX2A 1VYHA 1CFZA 1W0KA 1UDXA 4YCLA 3CF4G 1WEHA 1RAAA 4HMOA 1J22A 4IXTA 4MR9B 1Z2AA 5BRJA 4YRMA 5KBYA 1EUZA 3C5CA 3D6TB 3DBLA 1T6NA 1V95A 1NJSA 4HRVA 4NE7A 4D5EA 2XQVA 3OSUA 4S1WA 3F5QA 3OI7A 5AKEA 4I1RA 4BFYA 2DMRA 1WMDA 1ENZA 3HADA 3IVMA 3DEHA 4JR2A 1D9ZA 3T6KA 3MIIA 4JUDX 1P9NA 3K9LA 3DLAA 1J8YF 1BVYF 1Y9ZA 3AXTA 2ACVA 3OZ7A 3QZUA 3BUSA 4EPWA 1KBOA 1A5SB 1Z5OA 4EFLA 4EG8A 3DAPA 1XTBA 4ZVRA 1XCGB 2CB9A 4WXPA 3BD7A 1PWYE 3IJPA 4HATA 3PHLA 5DWVA 1YZQA 2BGLA 3DE4X 1B1CA 2HF9A 2ZTUA 3HXTA 4JIMA 3UMFA 4YRDA 1EZ4A 5EP2A 4FDLA 4XYGA 5ER9A 4R2MA 1RIFA 4S1PA 3SXUB 4ZT3A 1GDTA 4JVNA 1SKAA 4A4DA 5ICGA 1Z4LA 1IXZA 4JBYA 2ZDHA 1MGPA 1UT5A 4JBXA 4W99A 1T5SA 2A5FA 5EWLA 1S8NA 3WK9A 1BCRB 2ACWA 5F2NA 4GPEA 1CUGA 3WNQA 2OFWA 2WTAA 4AJNA 5KTRA 5EERA 3DVQX 1Y8QB 4MWDA 1LBEA 1JGTA 4D8WA 5JQWA 2JFZA 5J23A 4G84A 3NRBA 4LJLA 1ZR4A 3TOXA 3FNGA 1O57A 2PYIA 4XWOA 3GJQA 2QBYA 2YRXA 3Q1LA 4RELA 4OXQA 1VRVA 2DBYA 5BW5A 2BGJA 2OZEA 2PFSA 1YCHA 3BZUA 3DAOA 3OM8A 1B8UA 1LS6A 1QIJA 4GIBA 4IFEA 1U1IA 5FYDA 3T5DA 2Q0HA 2PKQO 1D1TA 4Y2YA 4UBOA 1VQ1A 5C3UA 4UHEA 4PX3A 4MWCA 1VL0A 1FU4A 2LUOA 3CXUA 3VZSA 4GZ5A 1N5IA 2YHAA 2G5CA 3LKVA 3HB5X 3ZI4A 2QR2A 3KR1A 4KV7A 2WK1A 4IHJF 4L76A 1XZMA 4OLBA 1SY7A 1K08A 1KI7A 1Y82A 2CY0A 1X7ZA 2C3YA 2ZFUA 1K6XA 1NQVA 3CLSC 3E9QA 4Q4HB 3MQ4A 4D9KA 5A4KA 4UNIA 2A33A 1X1QA 1CUSA 1H94A 1MVLA 4QBFA 4DQXA 1LU9A 3SR4A 1L0BA 3OCCA 2BHRA 3A2NA 1UBNA 4LC0A 2ONJA 2PUDA 3JQ7B 1D1PA 1RXCA 3ZD6A 2HNKA 3V4PB 3W8NA 1QHHA 4RGYA 2MINB 3GNTA 2QQ0A 3DB1A 1DV2A 4Z0NA 2MYTA 4GL4A 4ZCLA 2JZOA 4BGEA 2BSAA 2WJZB 4AF8A 4QDUA 1E4OA 3QLUA 4LS3A 3FVQA 3HJNA 2W2MA 5LOVF 3H9CA 1EFUA 2QVGA 2A35A 3AUJB 5EXEA 4QFDA 2VAWA 4FHGA 2Z08A 4A73A 1R1DA 2CUZA 2JGJA 3GZJA 3OFKA 5DGIA 2YV3A 3DZ8A 4D2IA 1N2IA 1TOAA 1SKMA 3VA7A 1MH9A 2AN5A 4KREA 2FWMX 1YHNA 3NV9A 4V0KA 4C89A 2FFHA 1Z6PA 4LYYA 1E0KA 4MARA 2WF8A 4JAVC 4E11A 1F9EA 3ONDA 3JWHA 3L1VA 2QX4A 4IKOA 1UANA 2AEMA 4F0JA 1NIPA 1DO8A 3ORSA 1M74A 4JBIA 4RGQA 3V4ZA 2IWHA 4B80A 3DNFA 5JQGF 5AWFC 2GDJA 3AKCA 2K7ZA 4REQB 4R1PA 3U7GA 3QOYA 4F56A 2PA0A 1E7WA 1G8YA 2Q8PA 3GGJA 2B7CA 3HB0A 3PK0A 4ZCPA 2AI2A 3HFSA 1QHYA 1EVYA 2VH5R 4YCMA 3AUXA 3BB3A 3GLIE 2GK7A 1F8XA 2GXSA 3O0TA 4F3RA 3LLSA 2QAIA 2EBWA 5FRDA 2E18A 1CX9B 4DWJA 4NF2A 4B3DA 4BQQA 2ZB4A 3P96A 3ZU2A 2P7IA 4FOTA 1KSJA 3L6BA 2HHJA 3I28A 2FP3A 2GBLA 3SK0A 1MDFA 2C5BA 4RJLA 1QQAA 2PO7A 3G7UA 4D92A 5JTUA 3ER9A 1AUVA 1P1IA 4LOJA 5GOZA 4REMA 4AO8A 4A6EA 4IINA 3BAFA 4UZEA 4US0R 4HVLA 1OTHA 1T8YA 1FE8A 5M29A 4H60A 2W70A 5IHPA 4PPQA 1W29A 2UUAB 1JKFA 3VR2A 1WHSB 1LPPA 3UQZA 5BWLA 2RHMA 2HV8A 4C2TA 2IU3A 2HJWA 3OEWA 3UUFA 2DFVA 2YS7A 1KZ1A 4IFBA 4RPLA 5AR1A 3WDSA 4BKMA 4DSUA 1YBAA 4XVQA 4C7JA 3R9IA 3RK1A 2J85A 1YZHA 2QZ4A 4G23A 1QZTA 2ZI3A 5I8WA 4CM6A 2C7BA 3FTQA 4BQOA 4LFAB 4BAZA 4ARIA 1L7MA 1Z0JA 4F97A 2R6ZA 2G9UA 2QTHA 2R6DA 3L4SO 5ITVA 2PT6A 3CLRD 4QSHA 1K98A 3BKXA 3T5CA 3U3DA 1E69A 1YNSA 3DOUA 5AM1A 4C2UA 1V6CA 3HR4A 2EW2A 3BJMA 3IPLA 4Q6WA 4XUGB 4DMGA 2VPYA 1G21B 1SR8A 3CY6A 3RIYA 4RJTA 3JAWA 5JWHA 4GAEA 3GEEA 4IWNA 4CGYA 4UTRA 5H9WA 4BY9E 3F6SA 3V6LA 1KHHA 5AVOA 4YRLA 4JC8A 4NBKA 2BBWA 3BF7A 3LY7A 2I66A 1CE8A 4YK7A 1Y9DA 4ZWNA 3IIEA 1A82A 1HFKA 2G67A 2VQ3A 2ZRCA 4G9GA 4ZQIA 1A88A 4EAAA 2VNIA 1DCKA 4FGZA 2UVDA 3JZIA 4HOYA 5E0KB 2A58A 5IDYA 4BB5A 1CR0A 2P27A 1GN9A 1WAMA 2A9KA 3LXUX 4BUJA 4EY3A 2WF5A 4Y1FA 4MAAA 2OXEA 4Q9HA 4LNUB 3ZKAA 3AEXA 5EHXA 4CKEB 1QTIA 4L5JA 1CUHA 1FP1D 1WLYA 2BV3A 1A9XB 1K6MA 2CFCA 3H16A 3N8DA 3J7TA 3IXLA 4PHTA 1E63A 4TLAA 5DXJA 4QGBA 4UQOA 3U4MA 1PV2A 1HTTA 3JQ6A 3HDJA 1JJVA 3ND9A 3DFUA 1DIRA 1UZMA 3QKRA 2YZ2A 4GOOD 1P4SA 5LBIA 2Z9BA 3UKOA 1H5QA 1PLJA 4CMBA 2R1VA 1DFGA 3I64A 1X74A 3EZYA 3JWIA 5HM8A 5TMDA 4FHZA 3VPDA 1TZBA 4ZTZB 3BT7A 1PU2A 5HDQA 3PRKE 3PXAA 5C8DA 5JALA 2JGDB 1XZCA 4BQRA 5JVDF 3U6KA 3ZVRA 4S1VA 2BKVA 4YT8A 5I4IA 2H5LA 1DL5A 3AIMA 4NYJQ 1PX2A 3ETLA 4G5RA 4TV9B 5FI0B 2F7SA 2GKOA 2YWDA 3ZUGA 4DL9A 1R00A 4GBGA 1VBKA 4ZHQF 5AVYA 1IK4A 1YS6A 4TTAA 2HQBA 5EJGA 1YSCA 3P2EA 3GCWA 3N2ZB 1NUQA 3AFIA 3PQDA 1B0UA 4XUDA 4TYMA 3PA6A 4LJ7A 1R0WA 5EIWA 4I5GA 1SHUX 4GYWA 5A7FA 3ASVA 3LFTA 1R88A 3DTVD 3Q2IA 2P6UA 3TM4A 2G1PA 3ODPA 1E58A 1T0IA 1XJQA 3O26A 4NJOA 1RHKA 4DNXA 3NRJA 1OA0A 1EGAA 1A69A 4L3OA 3ETCA 2OXIA 4QHYA 1DC4A 3EEOA 2OV6A 2ZUVA 1ODKA 4PAOA 3WR5A 1Z2NX 3CCCA 3L0SA 3VNSA 1Y89A 3RYFB 4AICA 4RF2A 1UQRA 3LG2A 2DQKA 5EMKA 5C3MA 1NG9A 3OTHA 1IJEA 3CLRC 2DPMA 3WRVA 1Y9JA 5HXAA 2ZXUA 2B8NA 4HCJA 3EIFA 2NAPA 5DK6A 1J97A 4AULA 1ZEJA 4D9CA 2O7VA 1F8GA 1DARA 4Y1GA 3IBSA 5EKUA 3TZ6A 1U81A 5AOVA 1C8VB 2QD3A 3I92A 3IAS1 2X6RA 3ZHXA 2UYCA 4KR7A 1JMVA 2WD7B 1IQUA 2AOWA 4L51A 1B8OA 1EGMB 2RAUA 1E79A 4OHUA 5LU8A 1ECCA 4B44A 4CXMA 5FR1A 5CXXA 4HH1A 1L8QA 4NBLA 4QQFA 2O3SA 1KZGB 1NMEA 2H4YA 5AI8A 1W1UA 3LI2A 2OGUA 2DHQA 4K6KA 1YUBA 5JADA 2O7NA 4HNGA 1UMKA 1XXLA 2B9EA 2HJGA 1VCHA 1R0KA 2EEPA 2JA1A 1GL9B 1NN0A 1RJ9A 1XNHA 3N2YA 3W2HA 5B1DA 3OT1B 2VZ0A 5DX8A 5HKLA 3VOSA 4YMUA 1EWKA 2RGUA 1OYYA 1VIDA 1GWNA 3L18A 4GEKA 3KE9A 4ETMA 2MSKA 1P31A 4Q01A 4F1JA 2BFBA 1FTQA 1HI9A 4ZO6A 5GZ6A 2PWAA 1SHLA 3VR0A 5JH7A 1L5HB 3R3UA 2X6QA 4DYVA 3NNSA 4W1RA 3SX4A 2NU6B 1P3JA 2R7KA 3EPPA 3I52A 4J43A 1HE8B 2HLPA 3SHWA 4HL6A 3PRJA 3VBCA 3QXXA 3HA2A 4L08A 1E3SA 5CPBA 2GEBA 4L50A 4ESOA 2VNHA 4JS0A 2CEAA 2BGKA 1AS0A 3ADPA 4YAKA 4J6EA 3WGYA 3CGWA 4EHBA 1N5OX 5HQ3A 3A3OA 2FB9A 5CH5A 4L4UA 4GZ3A 1O95A 2VZLA 3LFHA 4QDOA 2P30A 4C0QC 2FZKA 4ZQGA 4NU5A 5FTKA 2BAGA 3NIGB 1GP2A 2ERXA 3LAWA 4QEDA 1OIVA 1GPAA 1TAHA 1XNJA 1EFRA 1LZLA 3Q4GA 4PBRA 5AICA 5LLTA 3H9EO 2C4HA 3QLJA 4NCKA 2MT9A 3B6ZA 2EIXA 3IUEA 4OYYA 3I9OA 4G0UA 4OB8A 2R7MA 2FWBA 4MYCA 3TLXA 5L45A 3L7KA 1EAMA 4M7RA 1L5SA 5BUSA 3TIIA 3EZFA 5HGXA 2I2AA 3STHA 2P9CA 4L5YA 4TSFD 3S2GA 2W2OA 3P20A 1A0OA 1NQ5A 3HRIA 3IIIA 3PYXA 2AW5A 2H52A 2I4NA 3GPDG 4H1VA 1FNSA 1YKSA 1OWPA 2FY8A 1GHTA 1EBBA 1PJ3A 2IBMA 3PQ7A 5GAJA 3RC9A 3RVNA 5ILOA 2J30A 1EE1A 1WDKA 2VDWA 2ZBRA 3DOHA 1XKXA 2HRBA 1VHQA 3M82A 3FAKA 3L0YA 3HYSA 3IR6A 1JG2A 1HO3A 3S6JA 3W79A 3JQRA 3WWPA 2QUBA 1P45A 1E9BA 2AKYA 2FF5A 3CH6A 1Y98A 3GARA 1ZEMA 1X1CA 2IZOA 2VAMA 3PNVA 2IQIA 1K7XB 4GLJA 2ZWAA 4I4LA 1JG4A 3EXIB 1Z22A 3AEUB 3EGWA 4NK5A 3R8CA 5ER6A 1SNYA 3JVVA 2EFDB 2FXIA 4CCWA 2VOEA 3SPXA 3NHFA 3PNOA 4JBNA 3FTEA 2MR6A 3OIYA 1TQ6A 2BRUC 2DVMA 2F43A 4N4AA 1GQFA 3DWEX 1WCXA 2PMWB 4R69A 3EASA 2DJIA 1NQWA 4MINA 3W7BA 4QT4A 5K09A 2W6JD 2EZUA 3PUJA 5F2EA 1EMDA 2BGUA 3NNDA 4GPD1 1F6BA 1ZMBA 4D9EA 4BEJA 2ZPTX 1ZICA 3IAM1 1TJ3A 2P41A 1OGYA 1T8UA 1UFOA 3QYAA 1EX9A 4CL2A 3CX7A 3L6DA 5JR3A 3BCUA 2ZJ4A 4M1MA 1LF5A 4HAXA 2AXPA 4PYJA 4E70A 3WLSA 1RYYA 3DZGA 3AL3A 1HM5A 3F90A 2QN3A 1XA3A 5FNZA 3R7LA 1TECE 1SELA 2PWPA 3P32A 2ORYA 1VCNA 1YOVA 2WEKA 4G0MA 2FRVA 4KQIA 4JJEA 4X65B 3M5CA 4I1OA 1XU4A 4FFDA 4MVJA 2D3TA 4MP6A 4YHBA 3UUWA 1R0XA 3TVDA 2VJMA 4DA0A 3U7HB 1NYRA 3VPAA 5CTJA 5JJLA 1TKCA 1Q50A 2F62A 5BRNA 1WY7A 1QX3A 3LH5A 3A1DA 3SXPA 4WL0A 3FJ1A 3IOYA 4DREA 1SBNE 1Z28A 5TQ0A 3X1ZA 4DRYA 2GPWA 4A1FA 1AKWA 2R00A 5HJEA 2Z58A 2BUAA 4Q15A 3FCAA 4WEQA 4TXLA 3BREA 1BAPA 2COKA 3CGGA 4P4LA 5G3YA 3ISVA 4CM9A 3C45A 4EEZA 3MJTA 4KOAA 4C21A 3FPCA 1G2QA 4WJKB 1XLVA 1Z75A 1T35A 3EIUA 3CN7A 3Q5EA 1I51A 4NZ9A 5AI0A 3UWMA 3R20A 1CZUA 1XELA 1O7JA 3DCJA 4OAPA 1QQTA 1K7SN 1L4KA 2YICA 2M6SA 3DQQA 4M1QA 5AYVA 5KWIA 4BWGA 5IJ0A 5HBRA 3K7EA 5EJ9A 1N8SA 4NABA 6YASA 4DA6A 4RLSA 2AIRA 3OFVA 3ENWA 1F9AA 3WXBA 4XSHA 2AD5A 3PWKA 1KR5A 4UFOA 2DAPA 2E4XA 3IE2A 4LZJA 1SHKA 3TRFA 3JD0A 1AS3A 1XDSA 3A6FA 3C3BA 1VHDA 3FZYA 4M7WA 3RBZA 4C4YA 2V55B 3ND8A 5J1TB 5KOHA 4WK0B 5TJHA 1U1EA 3VM6A 5GIOE 5D6NA 1FYEA 1ZZEA 2XT9A 1QRAA 1TUGA 4U1RA 1I5OA 5EE1A 1X7YB 4C6TA 1KAOA 4YCNA 2G0AA 4Z9AA 4A2PA 1UZUA 3MUEA 3GFOA 3DTTA 3QPVA 4KDEA 3L7JA 4MA0A 4DYHA 4ZI7A 1BN6A 1DQYA 2AZDA 3B12A 3CQ9A 4M37A 3UT5B 2PPVA 3DWIA 1P2DA 2I65A 3HDHA 4G4IA 4NMMA 4F5EA 1SCAA 2BONA 1TD1A 3T06B 1HYGA 1MCZA 2VJDA 1KO4A 1DTWB 3E7XA 2AZ4A 1E2GA 2CKDA 3IQXA 4K3UA 4UXJA 4M8IA 1P1CA 3F6CA 2JLBA 1J1ZA 3RDPA 1LTHR 3MFQA 1L7BA 2CXNA 2RGDA 3AI2A 3CR3C 2H11A 4HEJA 3AEKA 5WRFA 3W34A 4FB5A 1J7JA 5SY6A 3QE9Y 1COWA 3BHNA 2ZYSA 1VL1A 1ZI9A 4EENA 3VO9A 4XR4A 1N2HA 1UOQA 3EXAA 1Z68A 2P4SA 2GJAA 2PUJA 1LK7A 2MWMA 2RGEA 3DOJA 3WFIA 2XMRA 4ZDIA 5LYJB 3OQVA 4D97A 4JP2A 2CXHA 2VA9A 2YJGA 1UQTA 4FMBB 4KUGA 3RVBA 4RM2A 1GQQA 1U0LA 3F47A 4H59A 5BNTA 4N76A 1J0XO 3C3KA 4FX2A 4XXHA 3S3TA 4ZPXA 1UK6A 3J81k 2VRCA 1JQLB 4LHZA 3ZW9A 1PGQA 1JVBA 2PL3A 2HJSA 2IYNA 4OREX 4LFBB 5I01A 1OPRA 2AX3A 4OHWA 1OWLA 5DNAA 4XSVA 3H1AA 4DYDA 1KI2A 3OJEA 4RVNA 2C99A 2IIQA 5HIJA 3VDMA 3ZY5A 1G5HA 1JIXA 4I6EA 2XUGA 2QG9A 3CRVA 3T35A 3PF8A 1JFSA 4UEQA 1U0GA 4PPFA 1H0SA 2Z4RA 1NR7A 4K9QA 2FZWA 3WWZA 2Q99A 4I5DA 1E9FA 4BMNA 5BWOA 1E64A 3WAJA 1JDNA 1EDOA 5U9CA 4Q9DA 2C9MA 1C3JA 3RQSA 3CMCO 5JMOA 3DAGA 1X80A 4GPZA 1SD5A 1DBQA 5TDHA 4L5BA 3E35A 1QQ6A 4ZXPA 5TXGA 2CNDA 1QIFA 2IQ5A 1M9NA 2RK4A 3N3AC 1VJ1A 3W4IA 5LZ2A 1LZKA 3K2QA 4UTVA 1TT5A 3UAOA 5IXJA 5KYYA 1QH1A 1IJFA 1EHIA 1EQ2A 4UHKA 1Z33A 2LCQA 3CRRA 3PFHA 1WCIA 4JVLA 2MSDB 3ED5A 4JP8A 2IYQA 1GPH1 4LYJA 2EU8A 2P9QA 4LY0A 5JROA 4Q1VA 1C7QA 3RPEA 3UK7A 3U9SA 1A7UA 3CPEA 3IC5A 4N5DA 3A4NA 2FFRA 1RM3A 1MXFA 2D3WA 3KLPX 4D8YA 5BSWA 2DUUA 1AKVA 1ZC3A 1Q6ZA 1AK2A 3Q8KA 3II6X 4CEJB 1GN8A 3C2QA 4UZSA 3LDFA 2GDZA 5FHQA 1AA6A 3QX8A 1JF8A 5HMMA 4I2VA 4K28A 1BZYA 4ASUD 3IDFA 3PIDA 1BFKA 2Q3LA 3DMTC 3P45A 1FTSA 4FYXA 2IXBA 1X1EA 3DOEA 4MW2A 1PJBA 4BMXA 4TTRA 5JS2A 2O2DA 4MYTA 5KCZA 4A27A 1DRUA 2BMEA 2EGUA 3VR1A 3W7AA 4A23A 4PG6A 2V7QA 2HRRA 2WTNA 4P7GA 3SJCA 2OCPA 4YONB 1L7QA 3KK0A 4KPFC 1BSVA 3W1WA 1ZL0A 4Y7DA 3VUFA 1J99A 4HDKA 4MGKR 4ZVPA 4XYEA 3UAZA 2PKRA 1ZSYA 3CZQA 1N3LA 5F33A 2D1FA 3LD9A 5CCEA 1YB7A 1OF1A 1NHGA 4TV9F 4AYWA 3FHTA 3WLTA 1VE9A 2DWCA 2C5HA 3A04A 4HB0A 1KKUA 3REQA 1M72A 3ZWBA 4CCSA 3ADDA 1SWWA 2HK6A 3Q7QA 1BX3A 3WICA 3F96A 4FGLA 3UHPA 3K6SB 2IS4A 1CNEA 4Q3CA 2C7VA 5ENDA 2HCRA 5B3JC 3PUVA 4HRYA 4OMFG 1SD1A 3FH0A 5T3UA 5B6IA 5DXAA 3QYFA 2PA3A 5FLEX 2C4WA 1T8TA 3GK3A 2I8AA 3LX6A 1L7RA 3M5DA 3U49A 5AW2A 2BRUA 4D56A 4B0PA 5FUQA 3SQXA 1RXVA 1C2TA 2RHJA 2G6BA 4EEXA 1E5LA 1G3IA 4LQCA 4LGMA 1NJ2A 3ST7A 2BBOA 1LCIA 1JLLA 3W6OA 1HEUA 2YWBA 3BIJA 2I4TA 3AF4A 3KV3O 4BQPA 3ANXA 3C15C 3K0AB 4L72A 4UUNA 4ZI3A 5JYCA 2ADOA 3LY9A 4EG4A 5K9ZA 2VH2A 4PAWA 3MD0A 3RF7A 1YS1X 2XZTA 4P4TA 5EWJB 2CXPA 3AJ9A 2YJNA 5LR6A 1N5LA 1I7NA 1AQ6A 2ZYAA 4L27A 4YJHA 3DO6A 5DNEA 4MI3A 3KAPA 4QOFA 3AVQA 2BFCB 5DN6A 2HIHA 2QP9X 1YR6A 2HWUA 2ECOA 1B2LA 3EF0A 2Q0QA 3WLNA 4Q19A 2R8OA 1XLTC 3INTA 2BR3A 4IYJA 3N0VA 2YL2A 5F7ZA 5DI3B 2R8ZA 3IP5A 1T9KA 3MCTA 4MCHA 4AU1A 3QYPA 3HV2A 1SUCA 4JFAA 1WQ4A 5I9IA 5KYYB 1V1MB 1EP9A 1B4DA 3DDNA 4O8ZA 4DG5A 4LY9A 1XK6A 5E9JA 3AHCA 3NS7A 1T2NA 3PZBA 4TXMA 4XQEA 1ODCA 2PN1A 2ZBQA 2F3QA 3EIEA 4DMCA 1TTTA 4HQRA 3NHBA 1HX7A 4WASA 2G9VA 2B2CA 3EWIA 5DZSA 4CR7A 1ZK3A 3QPCA 5IN4A 2I67A 2J3MA 5F3WB 4KXNA 3WRWA 4WLOA 1KK3A 2JHPA 4W1SA 4ZXFA 4YRBA 1H5NA 1IDOA 1SUFA 2PVSA 4Y9RA 2REBA 4LOKA 2H1HA 4DCCA 2C2WA 1JDVA 2XDWA 2Y2VA 1OHHD 3QIVA 1ZC4A 3P2KA 4TSFA 2Y0EA 3F8TA 2PUVA 2XCTB 2KPOA 3REGA 2H3EA 3JR7A 1DC7A 3CNHA 3O90A 1W49A 4ESVA 4JI2B 3B5JA 1G9SA 3MWKA 2WIKA 5H16A 5IKOA 5IASA 3D0RA 1YCFA 3I2GA 1RE0A 5ES3A 5HMLA 1SC3A 4JUIA 5JUWA 1UADA 1V9SA 4H9GA 3AVOA 5ALTA 2GD2A 2ZAYA 4P35A 4ITUA 2EFHB 2H92A 3NWOA 2Q6TA 2H1RA 3SVZA