4QC2A

Crystal structure of lipopolysaccharide transport protein lptb in complex with atp and magnesium ions
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural and functional studies of conserved nucleotide-binding protein LptB in lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qc2A00
4W5JA 4JLBA 4KAXA 3THWB 3LRPA 3U3RA 2CCKA 5C4GB 5JFGA 5JI3E 2GDJA 2IHYA 4C0BA 1G7CA 2GJSA 4Q1CA 2OBLA 2ZPTX 4KSBA 2AWNA 1ZUIA 1XMSA 2HDNB 1MO4A 2ZRNA 2O8FA 3FOZA 1IOZA 3THYA 4UKDA 1JXMA 4XWKA 4TMZA 1QHGA 1E98A 5FUXA 2VYFA 1I4LD 2F1IA 2R6AA 3K09C 4D6PA 3BH6A 3DMDA 2F7SA 3WNBA 1L7VC 1U9IC 1Q20A 4AWXA 4PHHA 4BQSA 4UXHA 3FHOA 4HZUB 3P27A 3FFAA 2YJTD 1P5ZB 4UJ3A 2XNSA 1ZU5A 1E2PA 1DVRA 1VG0B 4URUR 2Z6VA 4CVNA 3I73A 4KLZA 1KIMA 3LVQE 4JSTA 3T61A 2WJGA 1XDBA 4Q02A 1SHZA 2WPDA 3TLXA 5JHHB 3B1WA 5TY0A 1KSFX 4TMXA 4GOJA 1Q22A 3FTQA 1TX4B 4BFVA 2OAP1 2OM2A 3TR0A 3ZYCA 5KPDA 2IHBA 4Q4AA 4V0LA 4V0KA 1DARA 1LF5A 4ZCIA 3KXKA 2GCPA 1EFUA 1EX6A 1G7SA 1KNQA 3GQBA 2VSFA 4B48A 2ZETA 3X2SA 3EWAA 3DZ8A 1WBDA 1NVVQ 4XTRA 5CM9C 1NY5A 2QM7A 4G5GA 1NLYA 2ANBA 4BFWA 1XD9A 1FNMA 4PC1A 4AKEA 1R6BX 2DFLA 3WYGA 2X19A 2C9CA 1TUEA 4MITA 1ANKA 3NXSA 5AR1A 1NMXA 4F38A 4DLUA 5FBQB 1E6CA 1QZXA 3IO5A 4DBLC 4A0GA 2BBWA 3A1UA 5JECA 4IJMA 4XH9B 1XPUA 1E2JA 4B3BA 3EXAA 1G7RA 1W5TA 2W83A 1WB9A 2FGKA 4II7A 1G3MA 2CL7X 2ZRAA 4ON9A 1HV8A 2VEDA 1ZRHA 2WM9B 1VIYA 1KAOA 2GXQA 1E2KA 4L15A 5FUVA 1CJUC 2MMCA 3OIWA 2MSEB 4Z8YA 4UNSA 4WOPA 4QHYA 2UVQA 3HYTA 4PPQA 1KI4A 4GDFA 4L16A 3L82B 2PH1A 1TADA 2FN4A 4PAQA 1E9CA 4C0LA 5IF9A 1W36B 5JCZA 1N0WA 3AF1A 4JLAA 4R71A 1ONBA 1Q12A 1Y63A 5K8TA 3K70C 4NYMR 3AF2A 1Z29A 4QGHA 1VG8A 4MRSA 2JLWA 4JYBA 4BLTA 3GJ0A 3SI7A 4CEIA 1SKYE 2BCJQ 3E2IA 2ZREA 1CP2A 4NP6A 5FUYA 5A5GA 1G3UA 2AK3A 4DZZA 4I1UA 1HT1E 1KI8A 4EQ6A 2IW3A 2EFHB 4OHXA 2ZS8A 3KUDA 3I92A 4LV6A 2DFNA 4EPXA 1X86B 2ZYUX 3DEFA 2DR3A 1MO6A 3KFVA 3NIBA 3ZS9A 2FSGA 2ATVA 4TL8A 2WJIA 4ITRC 4US1R 1F48A 4OI2A 3RNLA 4DHEA 3QJYA 1OFUX 4YMUA 4GNKA 3AF4A 1II8B 3HU2A 4LHXA 1SKYB 4AIIA 1GUAA 5D3MA 4PPNA 3KZ1E 2JIZD 2YYZA 4U5XA 4I1SA 1QDEA 2Z5FA 4JL5A 4MRVA 3ZZUA 2B21A 3J81k 1M1YE 1RVDA 2QAGB 3LXRA 3NC1C 1FQJA 4OK3A 3MWLA 2A3RA 1T3SA 1COWA 1NF3A 1NSTA 5CK5A 2GJ8A 3QENA 3RRYA 2A78A 4MKHA 3QF4B 4RD3A 2HXYA 1KY2A 1EFRD 3WMFA 2Z4SA 2R6CA 1FP7A 2KJQA 2UZIR 4BLSA 3LBIA 2BEKA 4HDOB 2H8KA 2NQ2C 1AS0A 5G40A 5SZIA 2NOAA 1U0LA 3G82C 1P7CA 4CEHB 3LH5A 1JQJC 1P3JA 5EP3A 5H8WA 1BMFA 2CNWD 4DXAA 4D25A 4FMDF 2C99A 1CRQA 1LY1A 3MD0A 4OHVA 4TQAA 3DM5A 2ZROA 2AD1A 4NE2A 2YWFA 4ERNA 3Q5DA 2DY1A 1KDTA 3CNLA 1KMHA 1H8HD 4KCGA 4TLAA 3QQ5A 2NO0A 3PEVA 5B64A 5G41A 1XJ0A 3PFIA 1GM5A 1VMAA 4IDPA 1OE0A 4F7WA 3HWSA 1CU1A 1QG4A 1IM2A 1JR3E 2XSZA 2YWEA 3W90A 4KJZA 2J0SA 4PPGA 1DO2A 4XSHA 3C15C 1OKKD 1W0JD 3SE0A 5JEDA 4DUGA 5JEEA 1YU9A 2ZR0A 3GFOA 1KZGB 1N0VC 4MUBA 4DCTA 4UQOA 5EXTA 4YMVA 2ZSEA 4P32A 3PITA 1W36C 1CJMA 3C14C 3CRRA 2FEOA 4TLDA 4XTCS 1NBMA 4BFTA 1Z22A 1XBTA 2ZM5A 1W7AA 1PZNA 1S1MA 2RGNA 2YVUA 1S9DA 3K53A 2FFHA 1W0KA 3BXZA 3CO5A 4HLUC 2J3EA 3THXA 4RD4A 4B35A 1NJGA 4ZKDA 2XOKD 2BBSA 5CYOA 2SHKA 3K0EA 3HPQA 3ZIAA 4A0RA 1R0XA 4OJQA 3IBYA 1OHHA 3RS7A 2QPTA 4FCWA 4Q4JB 4KODA 1XTIA 2QZ4A 1XEWY 1QHHA 1E4YA 4IHQA 4Q9KA 3QXXA 2GTPA 2WMOB 1WXQA 2OO7A 3UWOA 1G5PA 3TH5A 3K0FB 2ZYTX 3LX5A 5IHPA 2WTUA 1AQUA 3JZMA 4US0R 4M2LA 2LCFA 3GCGA 4HUQB 2R62A 4LCBA 2C9YA 5IRCD 3KQHA 1GL9B 1KI7A 1SVWA 3OEEA 2CL0X 4TT3A 5AK0A 4POAA 3HU3A 1U0HC 3N2IA 2Z0MA 4IVQA 2VP5A 1ZBDA 3N2EA 1XCMA 3Q8XB 5C1BA 4CRWB 1NVWQ 4ILEA 2BM1A 1Z2CA 3NBYC 3VAAA 2FDCA 5AJZA 3Q3JB 4C0QC 5EP1A 1XXHA 2XZPA 1UPTA 2ZU6A 3Q5EA 3P32A 4M0LA 4TL9A 4MKFA 3VU9A 1GRQA 1NY6A 3EIQA 5FL7D 4RZ2A 1G4AE 1ZCBA 4OI0A 5EZ6B 1YZLA 1W48A 3K70D 3NBXX 4ARZB 3BB4A 1G9XA 4LZZA 1UKZA 1W4CA 2ERYA 4LJAA 3N5CA 1NRJB 3IGFA 2ERXA 2VL7A 4LBVA 4EPWA 1DOAA 2HF8A 1T8UA 3VNVA 1DAGA 3RSOA 2FFAA 4CF7A 1JJ7A 1T5IA 1E2HA 3ZQ6A 2JJ8A 1S0UA 3OZXA 2JJ2D 4FCTA 4BEBA 3GLFE 5FOUA 2BWJA 3ADKA 1KO8A 5HKKA 3QKRB 5H68A 1LB1B 1CEEA 2V1XA 5LBIA 4DDVA 1GL7A 1NMYA 4C0AC 1UKEA 2DWOA 4HYYA 2GILA 3FYHA 4RCZA 4MDFA 2IYQA 1S4QA 1X8KA 4HZIA 3BFKA 3RRNA 1E9SA 3E1SA 4MH0R 3SJZA 1KJZA 2QSZA 3EC2A 3AVUA 1RYHA 1T3HA 3W9YA 2HT6A 2WMNB 3TUIC 3I72A 3GP8A 2O52A 3BWDD 5B30A 4URZR 821PA 4NCKA 1EGAA 3U44A 3AEZA 4AG6A 2ZRBA 2WIAA 2A5DA 3VKWA 3GLFB 4G3XA 5BN4A 2V7QA 1E69A 1X8LA 2V54A 4IOJA 5LDDC 1LNZA 4TYWA 1UF9A 1NP6A 3Q7QA 5CJ2A 2QE7D 1EK0A 4ASUA 1M6NA 1YR8A 4MRPA 2VTKA 1QVAA 3EIEA 1H8ED 1M7HA 1UBGA 5GADl 4HAUA 2E1RA 4ZIRA 1P4SA 1KO5A 3RC8A 2F9MA 1UBCA 4YMSA 3X1XA 2OLJA 1A7JA 4Q48A 1W4BA 1ZNZA 4TL6A 4PSAA 2QRZA 2WHXA 2YOGA 4LJ7A 4TMTA 2G6BA 4KHZA 4ZV4A 2BC9A 2QQ0A 3BB1A 5TMPA 2OCBA 3KXLA 1E9AA 5DI3B 4UNNA 2QPOA 4FMBB 2CEAA 2RGAA 1GDDA 4F4IA 1KI2A 3U7HB 1W5SA 4LJ6A 4C0KA 3FKSD 4V03A 5J4KA 4ZDKA 1KTVA 1IXSB 5J4VA 2OUKA 1Z0FA 4NH0A 4B47A 2GBLC 3O8RA 4Q4HB 2QAJA 1E32A 1E1QA 4B44A 4YC7A 3CRMA 4D0GA 2EYUA 2ZS7A 5DN6D 1G64A 5BYJA 4QGGA 4A6XA 3AVVA 1G8FA 1E9EA 4JS0A 4ZI2A 2Q3MA 2DFKB 1DBSA 4NYJQ 4E09A 2J46A 2VP9A 3BK7A 2JLXA 1W36D 3NTUA 1XF9A 2ZI5A 3QKSB 1S3SA 4W7SA 3BAFA 1OH8A 3B60A 3VR5A 4G5SA 1JR6A 2FV8A 2X2FA 1U98A 2Z83A 3X1YA 1OIVA 2FZLA 2GETA 3IEUA 1U2RA 2BVNA 4OQXA 2WWWA 2GJAA 3U7GA 2J7KA 4KVAA 5TB5A 4BPBA 4XOIA 3B1ZA 2JA1A 1XFAA 1A4RA 4TYPA 2DYKA 4DSNA 2XZOA 3B2EA 4Z1MD 2J1LA 4HB2A 1D2MA 1XCPA 2ANCA 1OH7A 5L3QB 4HAZA 5AUOB 2VRWA 3MFYA 5LB4A 3A6PC 1ELOA 2WOOA 2WOJA 4K46A 2QMEA 3LO5A 1RFLA 1IXZA 3GJ4A 1MT0A 2QBYB 2IS1A 4M1OA 4LHZA 2J87A 4DLYA 1VYTA 3A37A 1XTKA 1VIAA 2MSDB 2GVZC 2WAYA 3THYB 2QP9X 4XVUA 1ZW6A 2J7PA 2Q0HA 5JS8A 4Q7MB 3SJCA 3RANA 2O8DB 1LV7A 4K81B 3TUZC 4DIEA 2XTMA 1HT2E 3SJAA 5KNCA 1G21E 4M53A 4BZPA 1CR2A 1J99A 2ZE5A 3EPHA 3KJEA 4NYIR 1PLKA 1P73A 3TBKA 2G1JA 2FMXA 5A0FA 4KFTA 3AKDA 2PMDA 4TTPA 3P26A 1F2TA 1CF4A 4H1VA 2W6IA 1PUIA 2QROA 3C16C 4IW3B 4GZLA 3L8ZA 4Q00A 3LY5A 1XX6A 1FMJA 1E9DA 2IC5A 2ZJ2A 3OEHA 4PAMA 5FBRB 1SXJC 1AGRA 2PT7A 2HEIA 3P4YA 2PJZA 3QXSA 1QF9A 2VH5R 3P1JA 4W5HA 4KFRA 1QHYA 2FG5A 2FGJA 4ZPXA 1IQPA 2B92A 1Z0JA 4C0JA 3GLHA 1G6OA 1WDTA 2CLDX 4JIMA 1SVKA 3A4MA 2JLRA 1N6LA 2Q6TA 1S1CA 2BV3A 3NG1A 3ZGXA 1US8A 4AKGA 4NBSA 1KSJA 2YKGA 3VKHA 3QXHA 1IY1A 2HYDA 2EWVA 3WMEA 2OSBA 3FKQA 2QU8A 3QPUA 4O2RA 1U8AA 4RFSA 5DHAA 2CDNA 2FOLA 2V9PA 1SVSA 1U94A 2O0KA 1J90A 4JVNA 4N3NA 3MG9A 4ZDWA 1LVGA 2R2AA 5F9HA 2H1LA 1YVDA 4I1VA 2QEQA 1NLZA 2K5UA 3EZFA 3KTAA 2F9LA 4ZCLA 1YRBA 2WWXA 4NCJA 2OT3B 4FI3C 3B9QA 5AUNB 4OHZA 4LBYA 3SU8A 2IYXA 3IEVA 4JT4A 3CLVA 4F4JA 1TEXA 2JLSA 4TLBA 4EUNA 1ODFA 3RSLA 1IN8A 1HYQA 4M9QA 2ZR7A 3PUVA 3WBJA 5KOYA 1G16A 4DKXA 4ZDIA 2ZE7A 1XEXA 3PXGA 5IK2D 4Y0AA 4Y0VA 2D7DA 4QJ4A 4LWZA 1FUUA 2WAXA 2GZHA 4PC7A 4TTQA 2GEDA 2IYUA 2ZE8A 2CMKA 3UG6A 1BYUA 2JLVA 5K8IA 2BDTA 1G291 5EE9A 2WJJA 2A5GA 2CVHA 1W2HA 4KXFB 4OHWA 4CEIB 2C77A 2NMVA 3SJBA 3BFVA 2ZXUA 1RIFA 2B6HA 2HLDD 3VR3A 4EPTA 4BLQA 1KO1A 2C5LA 2IX3A 5FL3A 3KUCA 1YHNA 3K0AA 3U4QA 5K8LA 3D31A 2P65A 1MO5A 5FTMA 1QRAA 3H86A 2JCSA 2KBEA 1PUJA 1MKYA 2FU5C 1Z28A 4Z51A 2PEYA 3AKYA 2OCPA 2IL1A 5H70A 1U81A 3U2QA 421PA 2PT5A 1MV5A 2ZJBA 3CF0A 2ZRDA 2ZSFA 4RJLA 2HJGA 2X1VA 4A2WA 2BJVA 3CF6R 1WF3A 1OT3A 1NVVR 4A6PA 3KFXA 3MWJA 1YZKA 4M22A 2IYYA 1G7TA 3QXCA 4LYAA 4EJSA 1SULA 4DB4A 1L8QA 1YE8A 2DPXA 3VKGA 3BRWD 3DL0A 3RWMB 2ZUBA 3FMOB 4HAWA 1NVUQ 5L3SA 4RD2A 3RYTC 5J4HA 3OFND 4HAYA 1N6RA 1OIXA 4LPKA 4OKSA 4KLNA 2IXEA 2YINC 2IS2A 3P4XA 1WCV1 5CDFA 2IA5A 3MLEA 2W00A 1OB5A 2ODEA 2OILA 3B8HA 3SBDA 5J40A 1CLUA 2WIBA 3AH8A 4ZKEA 2ONJA 2IF2A 4QJ5A 3SYLA 4GP7A 4D26A 4S2EA 1NL3A 4X8LA 4AI6A 1NBME 4NZYA 4B3XA 2VP0A 3NEJA 1TQ6A 1Z5ZA 2JASA 3RAPR 4B71A 4M1KA 4AD8A 4IEEA 1KK2A 1N2CE 2CL6X 2BMDA 4U02A 4IKEA 4P4SB 3B6EA 1FTSA 3NWJA 2EW1A 3QG5A 2UKDA 1NN3A 1NN5A 3D7MA 4HDQB 3X1WA 2ZRPA 3QKTA 2OESA 1SZPA 4A0HA 1KO7A 4LHWA 1OFHA 2KBFA 5FR1A 1U8YA 2AFHE 1FMLA 4JBYA 4TSFD 5G3ZA 5KSPA 4MGKR 2QRNA 3CH4B 4CDGA 1OXUA 5KNDA 2L0XA 3QNUA 1XNJA 4Q47A 4PSVA 3THXB 4B33A 2A7QA 1SXJD 3LBNA 1C9KA 2F1RA 2QN6A 3PR1A 3K9HA 2ZSBA 4LUCA 4DEXA 2AKYA 1YZUA 1KI3A 5L8VA 3AM1A 2E87A 3AQ4A 4V0NA 3CW2A 1KI9A 1M7BA 5A4JA 5KSYA 4BLPA 1A1VA 3VHLB 2G77B 1QHHB 4R2HA 1GTVA 3IHWA 3CONA 1BIFA 2BMFA 4LJ5A 4PTLA 1SVIA 2JIZA 2Q3HA 2WBLC 3QVUA 5JHGB 3DKVA 2VHUA 1M74A 1XXHE 4PZYA 1W47A 2FZ4A 2H5EA 2WKPA 1J2JA 2NPFA 3C41J 4QG7A 2ZAMA 1G3IA 4IFEA 2C9OA 2RMKA 3I3SR 1CRPA 1G8HA 1TPZA 3IO3A 3IDQA 1RRFA 1JI0A 2KB0A 1R0WA 1NI3A 1Z83A 1JB1A 1R5NA 1X1SA 2WKQA 3GJ5A 3NH6A 3WNCA 4LY6A 2CCJA 3V00A 1EFRA 1XPRA 3EWSA 1UBEA 2B7CA 4DIDA 2GA8A 5AWFC 2NTYC 3T1VA 3UXMA 3EASA 3TMKA 1Z08A 3OAAD 4JLOA 5J4LA 2PJRA 3A1TA 2C2HA 4MYTA 4NCHA 1T91A 1IXRC 1DS6A 2CNWA 3B82A 5EE0A 5SZJA 2ZJZA 2P5TB 2J45A 1BOFA 1XXHB 1KDOA 1ZM4A 1B0UA 3VU9B 3CB4A 2GJKA 1OV4A 3A1VA 3M0EA 1H8HA 1NLFA 1CKEA 4JBWA 2ZRCA 5EXSA 4TYQA 2BMEA 2RGBA 3LFUA 4LX0A 4QJ3A 2JDID 5FH9A 1FPMA 3R7WA 1XPOA 2ZIAA 3E5HA 4IDHA 1J7KA 5KTYA 4JKIA 1R0YA 3K09A 4E5UA 1E2GA 4Q01A 1Z6XA 1OKKA 1W0JA 1G18A 5KHOC 4R7ZA 1U9IA 3EZ6A 4B2IA 1ZAKA 2REOA 3W8NA 1HQYE 1W1WA 1G17A 4RFVA 2C04A 3IIMA 1DAMA 1YKSA 2OFOA 1VPLA 2QTVB 1RE0A 1YZQA 2W6JD 2O5VA 3GJ8A 3OIUA 4OQNA 3DO6A 3ZVMA 1JECA 1FX0A 3FHCB 2C78A 3W8RA 3GJ3A 4BFYA 4DLSA 3QY0A 1KI6A 2WV9A 1IHUA 2BKUA 2IF0A 2J0QA 3IILA 3QIAA 3RLFA 1E0AA 3GLGA 4WZAE 1QBKC 2ORWA 2XOKA 4A1FA 3SZRA 1LS6A 3R9WA 2RGNC 2ZYVX 1ZUHA 5EE1A 4LV5B 1EWRA 1VG9B 4LYHA 5BYKA 1KYIA 3CPJB 3CRVA 4YMWA 1N6PA 3LNCA 4RKEA 1E2QA 4G0NA 2V4ZA 3N70A 4RVCA 2NG1A 3W3AA 1KJWA 2GCOA 3B9PA 3IUYA 1RC8A 3LAWA 3W3ZB 1KK1A 1BH2A 1CR0A 5FOVA 3EA0A 4V0MA 4AK9A 4O0MA 4RZUA 3K0SA 5TARA 4ZIRB 3EC1A 4B34A 1KY3A 1Z6TA 2NO9A 1D2EA 1KSGA 3MSXA 3GPLA 2FPMA 4FMCF 1X8JA 3SHFA 3UATA 5CJPA 3EARA 5BWMA 1AJEA 4MYHA 4DJTA 4Q1DA 2VF7A 1RJ9A 3IKJA 4N1AA 4Q7KA 1E2FA 1II9A 2DBYA 2V3CC 1T9HA 4ESVA 3AB3A 3GEEA 4LJYA 3F5FA 5EXXA 1NJFA 4CW7A 5KNBA 4Q9HA 2Q9AA 5FL7A 3QSYA 2QP3A 2ZJAA 1CJTC 4JLKA 4YMTA 3O8CA 4PZZA 1ZP6A 2ASEA 4B3DA 3EPJA 5F3WB 4A8JB 4DDWA 4AYTA 3FHTA 1CR1A 1Q1BA 1JALA 3HDTA 2OXCA 2PCJA 4XJXA 3THWA 4DDTA 2ZI4A 3F8TA 3RS2A 3DVLA 3T5DA 2CXXA 3TSZA 1VCIA 1Q21A 4JLNA 1ZC4A 2D62A 2JJ2A 4NYMQ 4HB4A 2REXB 3NVAA 2F55A 1HUQA 3QI2A 4BUJA 3H0KA 1R10A 4JZKA 1R0ZA 2CBZA 3PCRB 1PJRA 2F6RA 1DE0A 2YZ2A 1WMSA 1QHIA 3FB4A 1GNRA 3L8YA 5FPSA 4PHGA 1UDXA 2JLZA 1CR4A 2QT1A 3B1XA 3D6TB 1NMZA 4A9AA 4EAQA 4PHTA 2OHFA 2HF9A 3FMPB 1GILA 4OQLA 1I2DA 4H9GA 4EFLA 4GOXA 4KYUA 4OI4A 2AR7A 2AN9A 1KDPA 4OYHA 3MJRA 3UK6A 721PA 1AGPA 4M1YA 5DIFA 2QL6A 3BORA 3QUSA 3ADDA 3T06B 2GWHA 2ZRJA 2FSHA 2CK3D 2V1UA 4F91B 4CT4B 3KX2A 3CF2A 2QE7A 1YJ5A 2QI9C 2V8OA 5DE3A 4B43A 4BWYA 1H8EA 4XD7D 2VPPA 4Q4LA 4C4PA 5ANRB 3MWKA 5AJVB 2QAGC 2CLSA 2LKCA 2AWOA 2GF0A 4PX9A 2FX3A 5FR2A 3GLHE 4NDZA 4LC0A 5KYKA 2HCJB 1VKJA 4LJ8A 1FZQA 3MUFA 3UIEA 4FINA 1M2OB 4NPHA 4FXPA 4B75A 4I4LA 4G5RA 2OCAA 3Q72A 3P20A 5CLLA 3C7KA 1RRPA 5E7JA 2WSSD 3SDZA 4FWTA 2XGJA 1Z3IX 3UANA 1F6BA 1J8YF 4A2QA 1Z0AA 1T4GA 5EP4A 1JAHA 1P60A 1XEFA 2BBTA 2GVDC 3FKSA 3QG1A 3GMTA 4UJ5A 1TU4A 2IK8A 4XIGS 2PLFA 3MWYW 3S1AA 2FSIA 4Q5IA 2BEJA 1R4AA 5GJCA 1T8TA 4QGFA 1XMJA 4IDNA 3GLHB 3ONWA 4NTZA 1MRNA 5DN6A 3RC3A 3B85A 3SEAA 5SZKB 5FOTA 2A5YB 2ZR9A 2GXUA 2EFCB 1XTQA 5EE3A 1D9ZA 1US8B 1V5WA 1WE2A 4B3FX 1GWNA 1Z8FA 3EIHA 5C18A 3QEOA 4ZI3A 3TAHA 4RKFA 2PX3A 1FNNA 2V55B 3SFZA 2ZJOA 4A8JC 1ZIPA 2ZVQX 4LSGA 4YQFA 1TF2A 121PA 1MOZA 1OLOA 4TWZA 5JZVA 3K0CC 5TDHA 2FWRA 2ZI9A 4M9XA 4DB2A 1I4DD 3KTAB 2J59A 1AA9A 3TVTA 4J0QA 4Z1MA 3ZH9B 1AIPA 3HR7A 1HQCA 4B32A 5JSZA 2B7BA 4MRRA 2X77A 4NL4H 4TLCA 4WZ6A 2EFDB 1LTQA 3SS8A 2CJWB 4L8GA 1E0SA 1Q1ZA 3U61B 3AGPA 1IJEA 4P4UA 1GOTA 1XEXB 2QSYA 2MMGA 3CKLA 4AYXA 3AVYA 5E95A 1II8A 1R8SA 2FPKA 2IYRA 2JLQA 5EZ5A 1V43A 3MMPA 1JNYA 1XEWX 2Z43A 1L4YA 4QBGB 4GT1A 1GZSA 2GEVA 2GEUA 3KQUA 3R8CA 2XJ9A 4DSTA 3R9XA 1NVXQ 3X1ZA 1IN5A 1DTSA 2D74A 2KSQA 2WJHA 1HE8B 5KPJA 1SKQA 1VCMA 1UM8A 2QMHA 1ZCAA 4W5WA 3KKQA 3K0AB 3T12A 3U4QB 4RD1A 4JVLA 1KI1A 2HUPA 1FW6A 1EG7A 3CWQA 1TNDA 1CIPA 3CZPA 5CLQA 3R20A 3L43A 4WXRA 2QENA 2AX4A 1FP6A 5AUPB 2VQSA 2D06A 3A4LA 1Z06A 4M1WA 5KSZA 5JJKA 1RYFA 1W4AA 3CIOA 4EFMA 5CDFE 3BIFA 3I1FA 2XXAA 4C7OA 2OLKA 2O0HA 4EJSB 2R44A 3KQLA 1JPNA 2AXPA 3OHMA 3MCAA 4JL8A 2VO1A 3ZD6A 1OF1A 2ZRLA 1WP9A 4IXNA 1OFTA 1IN7A 2C96A 3U3KA 5JLJA 3IBGA 1DADA 1TQDA 2ZRMA 4D4JA 5JWRA 2GRJA 4XVQA 2QTFA 3K9NA 5KDOA 1Q44A 1E2LA 1X3SA 1R7RA 2ZQ5A 4WVFA 1XJQA 621PA 2RGGA 1GKYA 4OK5A 4DRZA 2KWIA 4P4TA 2R6GA 1NG9A 1PV4A 1E9FA 3TJZA 2FA9A 1XCGB 3AF3A 4S35A 1XD2A 3H2YA 4D80A 4X8OA 2ORIA 3SYNA 3TQCA 3WYAA 3BH7A 1N6KA 1DO0A 1Q3TA 3HR8A 3A8TA 1X1RA 3O8DA 4GI7A 4LRWA 5E3HA 1AM4D 4W9MC 3DMNA 1MABA 1CJKC 1EWQA 2O8FB 5F2EA 1A2BA 1OJLA 3FFBA 1UJ2A 2IYZA 3GLIA 5IK2A 4BFXA 1XP8A 3U60B 3U7FB 1VG1A 4MRNA 4BEJA 4B2PA 5FOWA 4A15A 5FI1B 2HCBA 5DYIA 1LW7A 2WWGA 1G8YA 1AZTA 4URWR 5CB6A 3K0FA 1NKTA 2BBOA 1HURA 2GESA 4UNPA 4FWIB 2P2LA 1E3MA 1G5RA 5HCIA 1IBRA 1ZMXA 2CCGA 3FVQA 5B58C 3IPYA 1NSFA 2HLDA 4JLDA 1AKEA 3FWYA 1N5IA 3AKCA 4P0TA 2ZUCA 3BOSA 5JMTA 4KBGA 3WP1B 5BQ5A 2ZYWX 2QA5A 4Q1EA 3CRW1 1W46A 3A1WA 1UFQA 4P3YA 2XZLA 5EXPA 1ZM3A 4Q4AB 1E79D 1U90A 1RRCA 3I32A 2W2VA 1ZUNB 4IRUB 4M9SA 2GBLA 2CHGA 2NZ8A 1F2UA 3DHWC 4OQMA 5UKDA 1IN4A 1TAGA 2OFXA 1AN0A 4C2UA 1P75A 4D4MA 5M04A 1JEEA 2RHMA 2ZVPX 4HDCA 2P6RA 3LQQA 1XZQA 4AYWA 2IYTA 3B78A 3U3OA 2ZAOA 2YC4C 1UDWA 2NIPA 4XSGA 1OXSC 4ARZA 2EFGA 2FEMA 4JLJA 2VHQA 1E2IA 1U8ZA 3IQWA 2P0EA 4NKRA 4D4KA 4EDHA 8OHMA 4US2R 2VHJA 4DDUA 3TRFA 5FTNA 3KJHA 4DCSA 1HE1C 3RS4A 2ODWA 4F4CA 2BOVA 3OFNA 5GVSA 2N46A 4UNQA 4A92A 3VR6A 3CX6A 3RWOA 3ZD7A 4URYR 2Q9CA 1DAIA 2QQEA 1GITA 5EQTA 5CITA 5B2ZA 1R5BA 3QKRA 1JR3D 3C5CA 4BFSA 4P31A 3I5XA 2O8BA 1TQ4A 1Q1EA 1D6JA 1HTWA 1RKBA 4QM6A 4QHTA 1G8PA 3EPKA 3TE6A 3K9GA 1GRNA 2VP2A 1TMKA 2XNDD 3SFVA 2ORVA 1ZD9A 3GFTA 1NN1A 2G9NA 3TK1A 3QXJA 4QBHA 3OF5A 3DDCA 5P21A 4V02A 3QVVA 3G0HA 2JJ1D 1ZM2A 4QBFA 1Z0KA 1M7GA 3KXIA 3ZQJA 1E94E 2E9SA 4BFUA 2O8CA 4EKDA 4UXIA 4NHOA 3MRSA 4EQ6B 1ZVQA 2ZU0C 4DLXA 1VHTA 3ZDQA 4TSFA 2VLIA 1MO3A 5L3RA 2HV8A 3MGCA 2IYVA 1J70A 4PZLA 1FX0B 4OL0A 1DAEA 2YWHA 3ETLA 1CBUA 4V0ME 5AJYA 1YZNA 3AKEA 1KI6B 3WNDA 5JS7A 2WZQA 1T5LA 3QKUA 5EUMA 4FMDB 3TIFA 1SXJA 2QPAA 1G20E 1P6XA 1Q0UA 5FBVB 1LF0A 1II0A 2H92A 4FMCB 4EPYA 4H1UA 3ADCA 5LPNA 2GHIA 2ODNA 1VDZA 3JVVA 1SGWA 5D3MB 2FJUA 5DISB 1SHKA 4IXMA 2W2XA 4A2PA 3EAQA 5EP2A 4NCIA 4PC3A 2HJVA 2QMOA 3DOEA 3OESA 3WYFA 3EPLA 5JRJA 5L3VA 2GCOB 2IYWA 4DT1A 4TYYA 2EYQA 4DLZA 1XTSA 2YHSA 1UKYA 2D3WA 3AGQA 3CNNA 3DZDA 4O3MA 1T0JB 2VHCA 1A5TA 2XEXA 4NONA 3RRZA 3W5JA 5KO2A 2OCYC 5SZHB 1AQYA 2KI5A 2PCLA 1QHSA 4JMPA 2B8WA 5JJIA 3RVBA 1CS4C 3W6OA 1KNXA 3OAAA 2ZS9A 5HPYB 1J8MF 1GRRA 2PZFA 1KMHB 2GNOA 1RJ9B 1AS2A 1PLLA 3LD9A 3LQRA 4HLDA 5FBWB 3TR5A 1M34E 3BBPA 3I5YA 1YRAA 2OE2A 1G5TA 4QC2A 1WQ1R 1L4UA 2Q9BA 4LBZA 3H1TA 1AS3A 3LVRE 4TMWA 4PC2A 3BGWA 4LOAA 3K70B 2YWGA 4AY2A 1GNQA 1NIJA 1ZINA 5HCNA 2VBCA 1E2MA 3I61A 1N25A 3NKVA 3ASYA 2JDIA 4EIWA 1OXXK 4YXWD 1R2QA 2QBYA 4GRAA 3CPEA 5DGXA 3PUZA 3AVTA 1IONA 3UMFA 2EU8A 1VTKA 4Z54A 5BN5A 1OB2A 4EFNA 4JLVA 4B73A 2G0TA 3VR4A 4JJZA 3ZVNA 3TVDA 4M4SA 1JQLB 4R2IA 4Q9IA 2H7VA 5AJXA 3U3JA 1Z6YA 3ZVLA 4XWOA 2O8DA 4N0DA 1DAKA 2W6JA 3IQXA 3TW8B 1SVOA 5DH9A 2ZE6A 3OE7D 4PPFA 4C2TA 3UWKA 1JXOA 2OBNA 3WXMA 2NZJA 2A30A 1E1RD 4KU4A 1U99A 1I2MA 1ZNXA 1Z6GA 3VMFA 2AFIE 5B57C 3GEHA 4PO9A 4JT2A 4ABYA 3PEUA 4DCNA 2GXSA 2PMKA 5FPKA 2F3TA 3NC0C 3W6NA 2WVJA 3B13B 4CEJA 2ZRGA 4Q18A 2I1QA 4RZ3A 2I3BA 1F3OA 2FSFA 3CWZA 3CBQA 3BC1A 1OSNA 1QG2A 4Q21A 1Z0IA 2RCNA 2NO7A 3GJXC 4M1TA 1ZD8A 4MKGA 3W34A 5HR5A 2OBMA 1KMQA 5FPHA 2ZITA 4PR0A 4B76A 1KOFA 3CR8A 5G3YA 2A5FA 1ZNYA 1S96A 3C5HA 4D4LA 3ICEA 2J9RA 3ASZA 4I99A 2R6FA 4L9WA 4M1MA 5E4FA 3VTKA 2R9VA 3F3YA 2TMKA 3A58B 1GKIA 5HZKA 1G19A 5DHFA 2O8EA 4RD0A 1TEVA 3CX8A 2VA8A 4QRHA 2GK7A 3B5JA 4PO8A 2ZRHA 2AD5A 3AF0A 4M1SA 2RB4A 3DM9B 4KI0A 1E2DA 3T35A 4B6FA 5CIWA 3LDAA 3X1DA 1UKVY 4IEIA 1GG2A 4LHYA 2RGEA 4LJ4A 5E7MA 4DVGA 2BKEA 3TGPA 1RZ3A 5EJEA 2GCNA 4GMDA 5FOSA 3I8SA 3TSWA 2RGXA 3S1AB 521PA 2XITA 3FE2A 4WIAA 3TW4A 2F3RA 1S8FA 4QFMA 4Q03A 3R9IA 3AUYA 4Q9JA 1TUIA 2ECKA 3PIRA 1GIAA 1W2GA 4MDEA 4MA4A 2NGRA 1XMIA 5IT5A 2CE7A 1ZM7A 3RABA 2P6UA 4QBIA 3OIVA 2J41A 2FH5B 4NCNA 2LKDA 3WHKA 1YR7A 2C8VA 4RSGA 3RHFA 4HLCA 3EZ2A 3WP0A 5KU1A 2ZSAA 2RAPA 1W4RA 4HSEA 3KKMA 4DWJA 1NIPA 4LDJA 1D5CA 2BM0A 5JI2E 4BGDA 1OYYA 1VCOA 3QPWA 1N5JA 1FFHA 4V0OA 5DLQC 4IOLA 4QOSA 3PVSA 2WPDD 5JSZB 2GAAA 2BJWA 3PUXA 4TMKA 2JLYA 3U44B 3SNHA 4KO8A 3B1YA 2Y8EA 3M4YA 5FBLB 3BD9A 4B3CA 4I1OA 2FF7A 2P5SA 1A82A 1GAJA 3A36A 3NDPA 1GVNB 3MAAC 4PSKA 2WSMA 3NEYA 2G0NA 2YOFA 4GSYA 1N6NA 2OZEA 3VHXA 3LV8A 3T5GA 4CZ2A 2CK3A 1E96A 2QGNA 3AV0B 1N6IA 3ND8A 4A82A 4HLQB 3M6AA 4CGZA 1RRGA 1Z6AA 4EPRA 2J0UA 4F92B 5C2JB 5CB8A 1S2MA 2ONKA 4WA7A 4XD7A 2F43A 2WKRA 1F5NA 1QHNA 5DSZA 4Q1BA 3NH9A 1TU3A 1VCNA 1N0UA 3KKPA 5TVKA 1SVMA 5AUQA 3AVOA 3LW8A 1VYUA 2ZRIA 2GK6A 1ZNWA 4M9ZA 4B2LA 4AURA 3WRXC 4HI0E 3T15A 1K5GA 1U0JA 2PX0A 3H84A 1KZ7B 3W6PA 2D2EA 3LW7A 2WSSA 4MUAA 2QM8A 1QVRA 4GP6A 2OFWA 4RZXA 4DCUA 3ZS8A 4I81A 4BZXA 4UNRA 4QNMA 1FQKA 3L0IB 3FDIA 1XZPA 2G3YA 4C3ZA 1E9BA 1HEIA 1OXTA 2XXAB 4C7OB 5FUWA 4IDOA 4PANA 2BIFA 2Z4RA 4IOKA 1ZIOA 2ZJ5A 3PV0A 4DLWA 4R98A 3KJGA 2VSOA 2FE4A 3I4LA 4PO1A 4X8HA 4JVMA 4Q1AA 3CNOA 5LB2A 1BKDR 3GFPA 4P4SA 1TF5A 3QBTA 4A4DA 3ECCA 1M8PA 1GNPA 5DNYB 2WJYA 3REGA 2ZJ8A 4K8OA 1N5LA 1ETUA 3PEWA 4L5BA 5BXQC 2ODBA 5JJLA 3GLIE 4MGIR 3KB1A 5TXGA 5LD2B 1OPXA 3L0SA 1ZD1A 1Q1QA 2WWHA 2ZTSA 4HZUA 5CM8B 3PEYA 3VX4A 2XJ4A 4OHYA 1K8RA 2PL3A 3QE0A 4F93B 1VECA 2F1HA 1E4VA 2OAQ1 1JJVA 3IHLA 1XD2B 4QM7A 1EFCA 3RRMA 2GZAA 4DSOA 3C4JA 2W0SA 3CX7A 3ZVRA 3PUWA 4GZMA 3EW9A 1K6MA 3WMGA 5FOXA 5CYPA 4GOKA 2W2TA 3TAUA 1G4UR 2PBRA 5HE9A 1MABB 1E2EA 3LLMA 1CULC 2A5JA 2AXNA 2ZRKA 3KDSE 3Q85A 5J47A 5JWOA 4JLPA 3GLIB 1OYWA 4O25A 1T3LA 3M1IA 2XX3A 3PQCA 4MGYR 4FD2A 5C4MA 1RPZA 2G88A 2NPIA 1Z07A 3D3QA 2GKSA 2QY9A 2YOHA 1COWD 1OIWA 1TF7A 4KFSA 4LC1A 4DEYA 3NDBB 4A36A 4BLRA 4BZQA 2CE2X 4WZBE 1F2TB 2OXRA 4URXR 1FOEB 4D82A 4GL2A 4CIDA 2FFQA 1N6HA 5DI9A 2JAQA 1EFHA 1T6NA 3PG5A 4QHSA 2B8TA 2JATA 1EESA 4URVR 3GJ7A 1KJYA 1BMFD 4WBSA 4YDHB 3U6BA 1XTRA 2EFEB 3KQNA 2X2EA 2IXFA 3K9LA 3V4RA 1OH5A 2AK2A 3VR1A 1CTQA 2A9KA 3T1TA 4D0LB 3BB3A 1S3GA 2CVFA 3A1SA 4KBFA 2AHOA 1F2UB 5GJBA 4OI1A 3O47A 4MYUA 4NYJR 5AJWA 2JEOA 4FN5A 4MKIA 1IAQA 1EX7A 1IY0A 4KITB 3SHWA 2N42A 2GZDA 4RD6A 1G41A 4CT5A 2XSZD 4TL7A 1FL9A 5JWHA 2NO1A 2AL7A 3SC3A 3HJNA 4E03A 1DPFA 2GAOA 4TQ9A 1NN0A 1AKYA 3I8XA 5J5CA 2P6NA 1D9XA 5BW8A 4DUGD 4YLGA 3WRYC 4RFSB 4DLTA 5E7IA 3CRQA 1JBKA 2IUTA 3LA6A 4TN1A 4AC9A 2VP4A 4M21A 4MYCA 1YQTA 3OIYA 4HLUA 4R9UC 1A2KC 4MGZR 1T0HB 1P2VA 4ACBA 1NBMD 4LI0A 5HE8A 4D0NA 2C03A 3SYKA 1VYVA 1YR9A 1P2UA 1E0KA 2GF9A 4Q7JB 2RH5A 3QBVA 2DWPA 2A2ZA 2CLCX 1DEKA 4LK2A 2C98A 2ZJYA 1EXMA 4MQBA 1W0KD 2W58A 4GFDA 4JLMA 3GD7A 4XWAA 1N5KA 2GJ9A 2OEPA 3RS0A 1NKSA 2ATXA 2O8BB 2PLRA 1WRBA 2IYSA 2VP6A 3EZ7A 4Z8XA 3UG7A 5LD2C 4N0EA 3ZIAD 3NHBA 5FFMA 3PENA 1D8TA 3SBEA 3F0TA 1OHHD 3SR0A 1ZU4A 2IUSA 4Q19A 2VHTA 2PZGA 3D8BA 3THOA 1CJVC 1PLJA 4B3GA 2BMJA 1SXJE 3CZQA 3LLUA 5DO9A 2LWIA 2XTNA 2FPLA 4B74A 1YR6A 4PAOA 5FTJA 3WHLA 2QAGA 1ESMA 3GJ6A 2O8CB 1KSHA 4TZ0A 1SVLA 5TV2A 3OEED 4TT3D 4TYNA 1P61B 2QNRA 2H57A 1D2NA 3QF4A 3VFDA 4TTRA 5FPYA 4DLRA 4JVSB 1Q57A 1SQ5A 2CHQA 3DOFA 2CHVA 2HXSA 3L2OB 4Q7LA 4HB3A 4TQUS 1Y3AA 4LHVA 4CEHA 4QXAA 3NBZC 4Q9LA 4LBWA 2IS4A 4PQYA 1SXJB 1UEJA 2C95A 3TNFA 5H1YA 3B7GA 1E79A 4Q66C 4JSYA 4BRWA 2R6DA 1DG3A 3ND9A 3T1OA 1OFIA 5FTKA 3QF7A 1Z0DA 2JGNA 1GL6A 1Z2AA 4BRUA 2QUZA 3LBHA 2DHRA 2YNMA 1E9RA 2H18A 4U00A 4YDSA 4DT1B 2BHRA 3V4FA 3V9PA 4IVPA 3L0PA 5L3SB 2RHDA 3RS5A 2EWWA 4OJKA 1HA3A 4PQRA 1KAGA 3LXXA 2XB4A 3IIKA 4A8JA 3R8FA 2HYIC 2Q3FA 4ZCMA 5IDVA 1R5OA 1ESNA 3FPAA 3RS3A 3K0CA 5HZHA 1MR3F 5HKKD 4KYIB 2H17A 2ZI6A 2IUUA 4C30A 3SOPA 1Z63A 1TQ2A 1UADA 1G8GA 3LWNA 3ZZTA 2JLUA 2QGZA 3FGNA 1PVOA 4JL6A 4PFSA 4YONB 1IN6A 2R65A 5EE5B 4TLEA 5FI0B 1OH6A 2J0VA 4RCYA 1GKUB 1JR3A 2QTHA 3CM0A 1KKMA 3DPUA 4BECA 4LV8B 2X8AA 4BLOA 3W5IA 3IIJA 2IBMA 1BS1A 4IOMA 4XVRA 3REFA 221PA 4JBXA 2FNAA 3TQFA 3U3MA 2UZ3A 1B23P 3QEJA 1GSIA 2H16A 1R8QA 2IEZA 2HT1A 2J5XA 3U5ZB 5FPTA 4Q4JA 1S9HA 2DWQA 2XNDA 4HATA 5JCPA 2V7QD 1P9WA 3MJHA 4LJ9A 4UXJA 3UPUA 4AKHA 2AKAB 3H4MA 4QNRA 3UMRA 2N1BA 1W44A 4ASUD 4DC9A 3SQWA 2JJ1A 4BASA 4M8NE 4G5OA 4IDQA 4HB0A 4NMMA 4RY2A 3RDPA 4HUQA 1AZSC 1IJFA 2G83A 2Q21A 2EQBA 4QL3A 4GBMA 2IYLD 1XMVA 4DSUA 3VX3A 1Z47A 3EX7C 1O3YA 4G01B 4IVRA 3T1QA 3BFXA 4AG5A 1LS1A 1XB2A 4PHFA 3HYRA 4B6EA 5D3QA 2O0JA 4WW0A 3EZ9A 4C9BA 1DG1G 1E2NA 3TSOA 1XWIA 2OG2A 2W0MA 1KKLA 4QGAA 1P72A 5BN3A 4WAUA 2YV5A 3HP1A 4GPTA 1DELA 1GP2A 1KK0A 1RW4A 1MRSA 3UKDA 5F98A 1XU4A 2IWHA 4CEJB 1H65A 4DCVA 1K5DA 1O87A 1ZYUA 3K1JA 3AP3A 5KUTA 4HEJA 1YZGA 1E1QD 2QORA 3Q7PA 4DLVA 2ZEJA 4E07A 2PEZA 1ZJ6A 3IPXA 1DAFA 2WWFA 1EFTA 1N6OA 3WY9A 2REBA 1I4TD 1KO4A 4L4UA 4D2IA 3JZAA 5KDDA 4X8MA 1QHXA 2F1JA 4EJSC 3A4NA 2EVWX 1FUKA 3CH5A 5JRZA 1P2TA 2OV2A 3HPRA 4O2LA 3T34A 2P67A 1XRJA 1HY3A 1G6HA 1E0JA 2RGDA 1FTNA 3QOFA 2O8EB 1GFIA 1P9RA 1ZC3A 3BE4A 3CPHA 1G1MA 3KKOA 2IWRA 4P33A 1N3BA 2P3SA 2VF8A 2D7CA 2IXGA 4FW9A 2WICA 3UMSA 3EA5A 1XJCA 3FMIA 3WBKA 5J4YA 3G5UA 2G1KA 3SN6A 1KDRA 5K8UA 4PXAA 3QPVA 4KVGA 4HAVA 3AVXA 1OXVA 5CK4A 3R7WB 1NG1A 1JPJA 1XD8A 2ZSDA 4E22A 3GLGE 4D81A 2QMUA 1YZTA 1WA5A 1BYIA 1TL7C 1JEDA 3GLFA 2CJWA 4FCVA 4ZDJA 3KQKA 2XAUA 4GMXA 4OQFA 3VR2A 2VSXA 2ZANA 2V6IA 5FTLA 4C0HA 4YXWA 3ZJYA 1X6VA 5EUQB 3KL4A 4BE7B 2XTZA 4FIDA 2J7PD 4HUTA 3HU1A 4PC6A 2BCGY 5GVRA 5F9FA 5KSOA 2R8RA 3AVWA 5GJVC 5GJWC 4EPVA 1Q3HA 2DFTA 4CYMA 2ZUDA 4PQFA 4NU0A 3EG5A 1KHTA 3U6KA 4TZ6A 1NNEA 2I4IA 1DAHA 3KKNA 2KE5A 4ACAA 4AKIA 1MH1A 4L9SA 4NYIQ 3GLGB 1OW3B 3ZLJA 3DKPA 3OE7A 2IEYA 2W6ID 4BFZA 1UBFA 2XB2A 2RGCA 1HH4A 4ZO4A 5DI3A 1LFDB 2QT0A 2D2FA 1C1YA 2WWIA 1E99A 4A0FA 1E1RA 2YC2C 4TMVA 1F60A 1VHLA 2ZI7A 3BJIC 3JVUA 3C8UA 5CIQA 3OEHD 4OK6A 1P2SA 3B1VA 3AP1A 4OBEA 4KV9A 3BH0A 1XTJA 4JYCA 5ELXA 1P62B 1IY2A 2RKOA 4IFBA 2WJVA 1AK2A 2VIIA 3L0OA 3AUXA 1G3QA 3CUEF 4Q4HA 2IS6A 1UEIA 1W49A 3O8BA 1ZM9A 5DYGA 1C4OA 2PZEA 3GEIA 3AP2A 3KB2A 1TTTA 3AVQA 2IT1A 3QKSA 2J0UB 5HTKA 3K8YA 3U7EB 1KK3A 2I1VB 3BS4A 2GXAA 5C46F 2MSCB 2F43B 3ADBA 3NHAA 1WBBA 3TKLA 4Q1FA 2NO6A 2V6JA 3LX8A 3PUYA 5JBQA 4C0SA 2DB3A 1CXZA 3VNUA 3SQXA 4QKQA 4G1UC 1P9NA 3E70C 3NBFA 4JJKA 4LYJA 3PJRA 4KSCA 1G3RA 3TUJC 4LGMA 3ZZ0A 6Q21A 3FMFA 1KGDA 3AVPA 5KDLA 2FFBA 4JKYA 2QG6A 4LPSA 4ESHA 2D4HA 1BO6A 4KFUA 3VQTA 3I62A 5L3QA 2ZRFA 3KJIA 1JAIA 1UAAA 3BERA 4HAXA 4U7DA 4G5QA 4WXPA 5G53C 3Q9LA 4LYFA 3CR7A 2ZI3A 2DCUA 2WWYA 3ICQB 2QP4A 1L2TA
chains in the Genus database with same CATH superfamily
1VMKA 3THWB 3LRPA 3U3RA 2IHKA 4UTNA 5JI3E 1C5KA 1ZQ1A 2JKVA 3O8NA 4MROA 2OBLA 4YPVA 4B4DA 3L6DA 3WI7A 4AP6A 1MO4A 2FVYA 3DDSA 3HJBA 3HUDA 1E20A 4UKDA 2B78A 4ZVSA 2WFZA 1JXMA 5DMXA 2RHHA 5CA1F 1QHGA 2VDNB 4L22A 1E98A 1HLGA 2BHNA 2DFPA 2YXEA 2VYFA 4YRFA 4I1PA 3ZH2A 3NHJA 1N32B 1ZJYA 2IOFK 1Q84A 3GUHA 4F12A 4OAPA 1OWOA 2ZWOA 1DC8A 2DBQA 3O8OA 5ESXA 4LFAB 2R1TB 1P44A 1V5EA 1EWTA 1TZCA 2UVDA 1E3JA 1U3DA 3HMKA 1P5ZB 2E4XA 4GSLA 4UHEA 4Y2UA 4KLZA 1O7JA 3ANSA 1RTTA 4GH5A 3DL2A 3K92A 1L5NA 3TLXA 2HBYA 3B1WA 4GKAA 1KSFX 5TY0A 4UOEA 1RYYA 1DAOA 4TMXA 4GOJA 4TTIA 2OM2A 3IFSA 3ZYCA 1X1AA 2VYCA 2BCEA 4HVAA 4ZCIA 4B8WA 3KXKA 4MEJA 1EXNA 5CGQB 4X85A 5MGBA 1G21A 3FR8A 4YAUA 4G56A 3B12A 5F5NA 1NYQA 2I6GA 3EEYA 3EH1A 1WBDA 4PXSA 1NLYA 1CFJA 1VDMA 2ANBA 2O06A 1FNMA 3GUZA 3WYGA 4K6CA 2ZYIA 3GU3A 2C9CA 2PGIA 3KZVA 1AKTA 4MIOA 2F67A 2XIQA 1DBWA 3U62A 2GHTA 3NXSA 2BLNA 5LBIA 3RIHA 1KR5A 1ZI9A 1ZESA 5AR1A 5BW6B 5TNXA 4EGAA 1GGVA 2A9JA 1ZJ4A 5FBQB 4EKGA 3L41A 3IO5A 2WD8A 5TT0A 3DDNA 5JECA 1YACA 3MAGA 3EXIB 2ZSKA 2CSUA 3EXAA 5IH3A 1W5TA 3A9SA 5E6RB 4ON9A 2MT9A 2ZRAA 4M55A 4B7UA 4D9CA 3PEEA 3WLNA 3OQIA 3O2NA 2C4KA 2WM9B 3JD1A 1E2KA 4G0XA 1BRMA 2J85A 3WGLA 5IM4A 4HVLA 2YHBA 1YKGA 3BTOA 4M54A 2YXBA 2PH3A 3IP3A 4UNSA 3EEQA 2XEDA 3T7AA 4ZAXA 3QU7A 4GDFA 3P0IA 4REQB 1NKVA 5HRUA 1YRLA 4OU5A 2PH1A 2XDAA 4TM7A 3UMJA 3NRJA 4CBVA 3G9QA 1MG0A 3LCRA 4H1TA 3LF1A 5F5XA 3HDVA 1E9CA 1MENA 1QWOA 1HE5A 1WXEA 2PS0A 3KWFA 4WCFB 1X7ZB 3STVA 4CFZA 4D9GA 1DRVA 1TLFA 1ONBA 5K8TA 1D4OA 4JEUA 3KEQA 3T94A 1HRDA 3K70C 3AF2A 3HXPA 5FTWA 4V24A 4DCJA 2AG8A 2JFFA 4BQEA 1HZZC 3HUEA 3N6RA 5BV7A 2Q5FA 3GPDG 3W7AA 2JLWA 1W35A 4HX9A 4JYBA 1UPFA 4G25A 2HPZA 4IUBS 1SKYE 2H7CA 3ESCA 4R1TA 5MN4A 1CP2A 2QN7A 4NOLA 3R0ZA 2AK3A 4YJ2A 3KVVA 4I1UA 3ZEIA 2DWCA 2VJKA 2IW3A 5KNDD 3EGWA 4E51A 1PJ8A 4IIHA 4LV6A 1RD4A 2VNJA 2DHDA 1P0CA 4JA0A 1X86B 2QOEA 1WXWA 3DEFA 5DOVA 5AOBA 3TFWA 2DR3A 3NIBA 1VB3A 4AO6A 4DW8A 3ZS9A 2G36A 2FSGA 3OZFA 4I08A 3G2QA 1TKBA 3LUFA 4U0KA 1OAOC 2V7BA 4ITRC 2XADA 4M8SA 5FFFA 3NB0A 2HRRA 1P4JA 2IEDA 1Q0QA 1ZIYA 2A5LA 2QV7A 4GIBA 4OI2A 1DC6A 4YQZA 5CBPB 3UJBA 2DR2A 3RNLA 1I7LA 4M0KA 2OCKA 4DHEA 2IUYA 3S2EA 3W2TA 3U37A 4PNPA 3AF4A 1II8B 3UYLA 4LHXA 1SKYB 4PLFA 3GOHA 5T4FA 1E3LA 1TA4A 5D3MA 3KZ1E 4B4VA 4U5XA 2GNPA 2GYUA 5KC9A 1R5JA 2HLPA 1M1YE 3DR5A 1RVDA 1XQ9A 2GCEA 2QAGB 2XDWA 3AFGA 3HN2A 3JQ7B 1EVKA 3LXRA 2YDYA 3ZCQA 5F23A 1BTOA 1R50A 4YJHB 1D2CA 3L7IA 4Y1FA 3GPBA 1G2QA 1X74A 4PLCA 2ZB8A 9ABPA 1Y82A 2HXYA 4W5OA 3H2IA 1FP7A 1XQ1A 2EBWA 2OAGA 2UZIR 3TEJA 1F2VA 5MDHA 5IVHA 2CB0A 1VBNA 2Y0BA 3GGGA 3V2IA 3TLMA 4BMOB 2PQ0A 3RYHA 4MK4A 5DNEA 2FHPA 2C4HA 5DNWA 1JQJC 1P3JA 2ZJ3A 2SKEA 5EP3A 3LCVB 3BFPA 3IQIX 4IIGA 4K9QA 4X1IB 3QHQA 4FMDF 4HMPA 1LY1A 4QQNA 2CHEA 3OQVA 4TQAA 3DM5A 5LNK1 1PT9A 2XTJA 4N5IX 2X7XA 3H5TA 1M1YB 3CNLA 4GI2A 2WTMA 3NTRA 2NO0A 3B20A 2YN4A 3D8UA 5G41A 4ECAA 2ECOA 1X7WB 1GM5A 3TLCA 1OE0A 4F7WA 4EK9A 1SK8A 2VKQA 3EB9A 4RHCA 1QG4A 4LYEA 5G1NA 3F73A 2UYCA 3ILVA 2NU8B 2J31A 1KOGA 3UN1A 2FZWA 2C42A 3W90A 2OHXA 1FTQA 1NR7A 1XSEA 2F62A 2ZB4A 4OH1A 3HVHA 4NJMA 5AH0A 3OCCA 2VQEB 2BGWA 3P9NA 4JDPA 1NXQA 4IX1A 4FR0A 5AHWA 2ZR0A 4BV9A 4MUBA 5HKBA 2P4HX 3BRQA 4NE7A 4UQOA 2ZSEA 4P32A 2YXNA 4RTLA 4Q3LA 3PHHA 3PGXA 3C14C 3LC7O 3CRRA 4CU2A 2HQBA 4OXIA 3T41A 1FFDA 4DHWA 4RO0A 1FU4A 1TFRA 1THGA 2QTWB 3NUZA 4ODIA 4OXYA 1IB0A 5CRIA 3RK1A 3EQ9A 2ZM5A 2GZRA 3IA2A 1WCWA 1S9DA 4UZEA 3C39A 5EMKA 2FFHA 3TI9A 1ULSA 3BXZA 2J3EA 2PO7A 2JFVA 4XEHA 2FMUA 4E46A 2PKXA 3R3HA 5CFZA 3KR9A 1ZWKA 3KSMA 4PZEA 3G79A 4JC4A 3E82A 1JG3A 2AZ4A 3K0EA 4Y7CA 5AKKA 3S5JA 3VVMA 5LKAA 4HH1A 3K6KA 3S1SA 2PH7A 4QUDA 4A8TA 3IBYA 1OHHA 4Q37A 4FCWA 4MULA 5J2TA 1O0BA 4Q4JB 3ZBPA 1ADYA 2QZ4A 4EMBA 3I5AA 1GA1A 1R9NA 4N0MA 3PVCA 1E4YA 5AKLA 1LTHR 2HNAA 2IE0A 2FUCA 1WXQA 3FWPA 5HW0A 4KR6A 2NTEA 1SCAA 1YAHA 3AR7A 3PX2A 4IHKA 4MJ7A 3VPCA 1C7QA 2LIPA 4B40A 5IHPA 4ONEA 4HZGA 3G0DA 2C2OA 1Z38A 3B48A 3OQMA 3UMCA 1GKKA 3PD1A 1T6YA 1CE8B 2VUHB 4DQKA 3IBSA 3S5UA 2M2IA 3CE6A 4MVWA 1KI7A 1SVWA 4MVJH 1RC0A 3HU3A 6PFKA 2WD9A 2GTIA 4F8EA 1ECPA 1LSUA 2UUAB 1TO2E 1HLDA 2H85A 2NT4A 1GA4A 3KQQA 2QRJA 3QVTA 4BWVA 1KVRA 1Y48E 5FP0A 3V32A 5IXYA 4S0ZA 1RWNA 5ULLA 1X1TA 1DAPA 3VAAA 2FDCA 3VJRA 3N0VA 1B00A 1NQ5A 2FZCA 5EP1A 1XU9A 2VPQA 3FVWA 1FK8A 2Z6QA 1UPTA 2ZU6A 5BMVF 2QVGA 1OA1A 2PQ2A 1AQLA 1M1NA 3OMWA 5CVEA 1GRQA 1NY6A 5FL7D 3TOSA 3UMGA 3ZGNA 4C2BA 4F9FA 1ONOA 1U7TA 5LMZA 3KBBA 1UDCA 3HKDB 5EZ6B 1UKBA 2NX2A 5EJGA 4ARZB 1NVTA 2FK8A 5U4QA 2BP7B 1GR0A 3EVGA 2JCYA 1DG9A 2WE7A 4IO1A 1XZDA 3I12A 1Z7WA 2CEKA 5C1OA 5D01A 3IGFA 2VL7A 4JEHA 4V1CB 4ZT6A 2HF8A 5A9SA 1OLXB 4OB7A 3IIIA 3EXEA 1DAGA 4BVGA 1V9CA 1N3LA 3UMMA 1T5IA 3AR9A 2H2FA 2JJ8A 5D00A 3IIEA 3OZXA 5CURA 2BT4A 2JJ2D 1WCYA 1V2GA 1LRLA 4P9NA 4B8ZA 1FUIA 4CV1A 3ADKA 1QRUA 2QX9A 3U17A 4DQLA 3DLIA 3KPUA 4GLOA 4MB0A 3DP7A 4ZU1X 1U3UA 1Z5NA 3HFGA 3AT1A 1GL7A 1NMYA 1UKEA 2CBXA 2DWOA 1WHTA 4OQPA 3ZX4A 1T4DA 1AMNA 3EN0A 4MDFA 4QU0A 3P0FA 3QX7A 1S4QA 4HZIA 3RFCA 1TPYA 3HL0A 3E1SA 1N92A 4BN5A 3OY7A 3QWBA 4XEUA 3SJZA 3F9CA 2BRUC 3H9CA 4B46A 3N59A 5JNUA 4JKOA 1X2BA 1ZK4A 2BW0A 3AIMA 3PRKE 4XQ0A 3T0GA 5M2QA 3WB0A 2ADFA 4ZAYA 1DLIA 1YB1A 1NHWA 2VUUA 1E3DA 3BWDD 3RVRA 4YAIA 1N2JA 3FCOA 4M0CA 4NCKA 1EGAA 3V97A 4DGQA 2A57A 4KQMA 3AEZA 3WRWA 1RLTA 1SC6A 2J3HA 2ZRBA 2ZWIA 3B51X 3QVJA 1JJBA 4HRVA 4NULA 1L9KA 4L0MA 4UE6A 4WK0B 4YB8A 2CXSA 3VKWA 4K3UA 1KEEA 2GASA 3FWHA 3NW9A 3FOBA 3DYVA 4IOJA 4C5AA 4EO9A 3PFGA 2B4YA 5CMLA 5LDDC 3H19A 4TYWA 1C2TA 2VDKB 2BUCA 3S2UA 1BHSA 1ZD3A 4J0FA 4AULA 1EK0A 3GI1A 4KLAA 4BN0A 5MFPA 4IKOA 1CJBA 2VTKA 4MRPA 1ZL2A 4NFYA 4OATA 4U7FA 3NYRA 4WPGA 2O1EA 3SQDA 5IPFA 1ZDMA 4UTRA 5BRAA 5LWQA 3WLIA 5T6BA 2E1RA 5ALUA 2CWDA 2VOEA 4EHJA 4B85A 2OLJA 1A7JA 4Q48A 1W4BA 1ZNZA 1ABFA 3UW1A 1EIWA 2WHXA 2TMYA 3C3YA 4ZQFA 1X70A 4KR7A 4HX2A 2G6BA 2JBWA 2JFNA 2CMHA 5IUJC 1E5LA 3GRZA 1G0NA 3BB1A 3KXLA 5DI3B 3T7IA 3QEKA 4BBPA 2FDRA 1C81A 3UAWA 1IXKA 4FYMA 3VO8A 2PKWA 1KI2A 1LBEA 2I66A 3OJLA 4MPDA 1CQZA 2EP5A 3DW1X 1T1RA 1ACMA 4LJ6A 1XMQB 2WF6A 3NOOA 2JG3A 2YFYA 5C81A 5J4KA 4ZDKA 3NHPA 1ZICA 1IXSB 3WGKA 5J4VA 5JIBA 2OUKA 3DMHA 4B47A 1J56A 2XHEA 3I76A 4B3MB 4NCBA 4Q4HB 1S2NA 3RU9A 2AE2A 4C4XA 2PGLA 4B44A 4YC7A 3CRMA 1EQAA 1Q0ZA 4ECEA 2EYUA 3KHUA 3N1UA 4QYMA 5DN6D 2RI6A 3WRYA 4Q3CA 4MVJM 6REQB 4B3TB 3O38A 3UWPA 2DFKB 3I4CA 4E09A 2AKEA 4Q6BA 1WUIS 1DI0A 4EI7A 2I55A 2WM8A 1XF9A 3NTUA 1P2FA 1S3SA 4W7SA 1NNI1 1TM1E 4D97A 1JR6A 4G5SA 2QJFA 4TSKA 1QANA 3A2KA 3G8BA 3X1YA 1A9XB 3HC7A 4H7FA 4BMNA 4C4TA 1GTRA 1EH5A 1QAMA 1U9JA 1U2RA 4WKNA 3RB8A 4L02A 5H3LA 3L4KA 4INPA 4BMDA 3U7GA 2GJ4A 2UYYA 3IR6A 1YDWA 3IB6A 4MYRA 3CLSD 4IF4A 1WZNA 1CUZA 1V26A 3ZHRA 2BFDB 4DSNA 4E2WA 4Z1MD 2J1LA 1XCPA 1CUAA 4UDYX 4XQEA 3REOA 3LYLA 2ZRQA 3ZEAA 4MCAA 5LB4A 4RNCA 4UVHA 4XVHA 3FD8A 2WOOA 4U4AA 4KE6A 2GPWA 5TQJA 5JR3A 5I9BA 3OURA 1IB6A 1QIJA 3V3TA 3G2MA 3V4PB 2JHAA 2QBYB 3VOBA 1Q6YA 2JCBA 4FKBA 2X13A 4M1OA 5IH7A 4LHZA 5GAJA 3W5SA 4NZOA 2ADOA 3DBHA 3JQ8A 5SYMA 2PKQP 2Q6VA 3ZTYA 1YBMA 3OBIA 4G8CA 2P2CA 1AO3A 1IWOA 2B98A 3Q3GE 1XZCA 3GBPA 1W5BA 3VO9A 4P38A 2LP4Y 2OO5A 2Y0DA 4MCJA 5KVCA 2ID8A 3AX6A 1YI8A 2J7PA 2Q1YA 2VBGA 3IJ5A 2VDRB 5ITZA 1UMBB 3SJCA 3RANA 2O8DB 2PSEA 1N8NA 4DIEA 4E32A 4M53A 4BZPA 3LO8A 4EGJA 4NYIR 2AZXA 1XVVA 3TBKA 1P73A 4XR9A 4UCQA 4WQMA 5A0FA 4KFTA 1QH1A 2ZIVB 3LZ6A 4KAAA 3ER6A 4QOEA 4TTPA 3LRTA 2J9XB 4ITVA 5B3JA 4S05A 4TMFA 2Z5VA 2W6IA 3L8ZA 2FE1A 3UHJA 3LY5A 1XX6A 1DQNA 1FMJA 2Q8NA 3H9UA 1D0VA 3O83A 2JVKA 1B0PA 3OEHA 2PMWB 1GU0A 1W19A 2PT7A 3M7IA 4EHNA 2HEIA 3GK3A 1JFSA 2PUTA 1KVUA 5H3CA 5FUQA 1QF9A 3R3SA 1CUIA 1JLRA 2BFFB 3OWHA 5AI5A 2I67A 4O6VA 1RVV1 4ZPXA 1C0IA 1D3AA 1VBKA 4FIZA 3UV3A 2B92A 1FNDA 1NJ5A 3RSSA 4X66B 2JI8A 2WQZA 2FWJA 2XB6A 1XLUA 4D9FA 1D2GA 3PCXA 3ZWDA 4EHKA 5I6DA 1BE8A 3T9FA 1A7AA 4B2YA 3VV3A 1MZVA 1S1CA 2H2DA 3ZGXA 4G1MB 1I5EA 3HCEA 4EO7A 1DC4A 4F3NA 1Y1PA 3H04A 5JBNA 2JBAB 2PZAA 2KW5A 3L7DA 4CCSA 4WNAA 2HYDA 1JT2A 3FUWA 1VOTA 4PG5A 3FKQA 2J33A 4WLUA 5CLGA 5D1NA 2Q8QA 5DHAA 1VLJA 4MINA 4P36A 2V9PA 3FDFA 3RTAA 3V6MA 5IDXA 2JRCA 2OM6A 4KQFA 5F9HA 2R2AA 3JYPA 4RLFA 2Q99A 1QR6A 3EZFA 1IIRA 3KTAA 2QJTA 3L84A 1QC5A 2WWXA 3L46A 4EF5A 5K01A 1BW9A 4BNZA 4YO8A 3R0QA 1NW3A 1NBAA 3GH1A 1T8RA 3B9QA 5FI3A 5HWSA 4F97A 3HV0A 4ROTA 5SY4A 3IEVA 3GF4A 5B53A 3ZWMA 4UPEA 3CLVA 3N3BC 2JLSA 4RE6A 2VWPA 4EUNA 1ODFA 3JRXA 3C5WP 3RSLA 2QV0A 4GXTA 1ZN7A 2F8SA 5ALPA 1J5XA 3C3MA 3VDXA 5F52A 5JD5A 4MQMA 1VE3A 1ST3A 2Z1NA 3IEXA 4J03A 5FRDA 4DJDC 5KOYA 5J1TB 3ETGA 3I2FA 5HF5A 1O95C 4DKXA 5IK2D 1IBKB 4DXHA 4Y0VA 2Z2XA 1BDBA 1FUUA 4J90A 4XOUA 3D9QX 2OOKA 4PC7A 4XPIA 1WVMA 1FQOA 2VT3A 1KEZA 1POWA 2ZE8A 6CHYA 3OQPA 4RIGA 5REQA 4ALKA 1NNSA 3UG6A 5CNKA 4HQKA 2JLVA 2BDTA 3M1LA 4BKPA 3M5WA 4CNBA 2P9CA 1CQIA 1W2HA 1EAYA 4CEIB 2WM2A 4HQ0A 1YR1A 4KO4S 3TOZA 2Y71A 3DZJA 5DULA 1OTXA 2HMWA 5FNVA 1XN4A 3VR3A 1MX5A 4EPTA 1GQYA 1NW6A 1AZWA 1P77A 2C5LA 1L4MA 2PSHA 3C43A 5DWDA 5J59A 3VR5H 4DMKA 3L6RA 3O74A 5J23A 2OGZA 2CLHB 2YH2A 3MWGA 3A6LA 1CUSA 1M67A 2OORA 3U4QA 3HHPA 4XB1A 5K8LA 5JZ9A 1BGWA 2P65A 4RSRA 4OLJA 4RVSA 5U1PA 3ZE2B 5JANA 1VFPA 2GLTA 1QRAA 2O3SA 2PWZA 2X41A 1D7AA 1NOJA 2PSSA 4AFNA 4DCOA 5AJTA 4OTZA 3CUKA 1XE3A 3D7LA 4UVIA 3WTCA 3AKYA 2IL1A 1SIOA 2PT5A 4RJLA 3CF0A 3DFFA 2ZSFA 3ZCXA 2HJGA 4G1FA 5THQA 5LJIA 3G13A 1WF3A 1OT3A 4MS3A 3CT4A 4PRLA 3W05A 3A2NA 4A6PA 4WJZA 4M22A 4PS1A 3QXCA 2OFPA 4LYAA 1PSWA 1LGYA 3DMYA 2GUWA 3EFOA 5AVTA 1NC3A 2HZBA 1GUDA 1YE8A 2Q4OA 4UZSA 2F1KA 3BRWD 5B1SA 3EK2A 4HNTA 3NHKA 1T24A 1A69A 2DUUA 3O4JA 4V0RA 4D9HA 2ZUBA 5CX1B 2Y66A 3BXOA 1NVUQ 3K96A 4E4RA 4HXGA 4RD2A 2R5WA 3DOHA 2EDCA 3VR6D 1N6RA 1AUXA 3IE2A 2WINI 2PUWA 3SHWA 5IS2A 5IFKA 1DIBA 1X1CA 2IXEA 2UVPB 3LPCA 3QBEA 4CM8B 1WCV1 3HFSA 4HWKA 4IDBA 4H3HB 3IXLA 5DYWA 4E13A 1K8YB 3M1AA 1OB5A 3BMNA 2OILA 4OCZA 2JGMA 3B8HA 3E6AA 1Q0PA 4YP7A 3SG0A 2YWRA 3F47A 1KGSA 3AH8A 5HIJA 1Y9DA 4D26A 1NUSA 1YUMA 3MM4A 1E6EA 1NL3A 2PT6A 1NBME 3WQBA 4POOA 4NZYA 1T8PA 3HA5A 3NEJA 4ZTUB 2JNWA 3FYUA 3RAPR 4N82A 1YJBA 4IEEA 5E2AA 3ET4A 2CL6X 3D7SA 1JLHA 1R9GA 5BUSA 3ITKA 5FQOA 1TAHA 4DV7B 2KHZA 3GLUA 1ZSYA 2Q41A 3FDZA 4UHHA 3L06A 3OCVA 3NWJA 4QPJC 1ES9A 2YQZA 3HWX1 3JWEA 4GPZA 4KSYA 2YXPX 5C1DA 4LXUA 4UTZA 3RC7A 1BVRA 4UREA 3C3DA 3B70A 2OAEA 2BI8A 4HDQB 1I9GA 4HQFA 3X1WA 4CGYA 1Z4KA 2VATA 2AFHE 4QAQA 3F2VA 1KMCA 3C24A 1FMLA 1T25A 3IP6A 4AKIA 3DVAA 1I6KA 1A97A 2ICAA 1FDWA 4HDMA 4I9GA 4YK7A 1A50B 3CH4B 4NEHB 4CDGA 4EG0A 2C9MA 1QIKA 5DXAA 3HV2A 1DNPA 2GAIA 4FHEA 4MV7A 2QYTA 4Q47A 4QNNA 5HQJA 1TRKA 4ZD6A 2J67A 2H31A 3VZBA 4FM9A 5T3UA 3THXB 4KKVA 3A14A 3LBNA 2X9GA 3K4PA 1PRYA 2QN6A 4OM8A 1WHSB 3NAMA 2R8BA 3OLZA 3PR1A 5ESWA 1EE2A 3L1HA 4XLTA 2IFTA 5G1PA 1YZUA 5AW4A 3OUTA 2E87A 2JAXA 4E21A 3ESZA 1KF0A 1KI9A 5A4JA 4MQEA 3Q98A 2VPYA 1U31A 2QUIA 5IN5A 3VHLB 3FXAA 5K0FA 1QCDA 3BHMA 2AFHB 3TEFA 4I55B 1GNSA 4QDUA 2R86A 4LJ5A 1NDHA 1SVIA 5BWCA 1U28C 1G8KA 3AV3A 4BATA 4KH0A 5K0SA 2FLWA 1SXGA 1WMDA 2VHUA 3A3OA 3DF7A 3MK31 3BQ9A 1ST2A 3MOIA 4YAFA 2NPFA 3T5TA 3UM9A 5JTTA 2ZAMA 3H8WA 2ET6A 3I3SR 2RMKA 3S2ZA 3IO3A 4RPLA 1XQYA 2KB0A 4KQEA 2WKQA 3U3XA 2GN1A 2O7NA 2XCLA 5KOHA 3BXGA 7AT1A 3HNPA 1FFXB 4FXOA 3V4LA 1XPRA 2FR1A 2P8SA 2WT9A 2YIMA 2B7CA 2FHSA 1GQSA 3MUNA 4D46A 1U1IA 4IZIA 4DIDA 1QKKA 3EWNA 2NTYC 3E4CA 3HWRA 3TMKA 3ITEA 2PJRA 2XMBA 4HF7A 4L7QA 3NIDB 2JHFA 3CUUA 4CMKA 4F6RA 1Y81A 2FPRA 4MYTA 5AK3A 2Q27A 1M2VB 3F9RA 3ONVA 3B82A 5PGMA 3ZU4A 3A1DA 4I4IA 4F4HA 4G5YA 5FT9A 2GM4A 1CUVA 2J45A 2WY2D 4DCGA 1ULZA 2XUKA 5LNK6 2PWPA 2VCYA 3WNQA 3OTQA 5GV8A 2ZVJA 3OOSA 3M0EA 1H8HA 2DTEA 1NLFA 1NJ2A 4RF2A 5DKFA 2R87A 4HQRA 3DMPA 1DWQA 3D8SA 1QGED 3DAGA 1HDGO 4CLDA 4KXLA 2BMEA 2RGBA 3JVIA 3K94A 4S0XA 3Q6MA 1T35A 1EA7A 4YT2A 3O3MB 1RLMA 2O48X 5LXTB 2J07A 3PHLA 1W25A 3X1KA 5DGTA 3E5HA 3WLQA 1J7KA 4WCVA 1R0YA 4LJRA 1XMXA 1Z6XA 1OKKA 4YGXB 5BVHA 4DV1B 1EK1A 1KWGA 3WLPA 1NR5A 1YH3A 4ZALA 2OHHA 3VR4D 1SOWA 3IMEA 3TFQA 4TWAA 4B31A 1W1WA 1C3XA 4MCHA 4IZOA 3IIMA 3IP8A 4BV8A 1YQEA 3SQNA 1RE0A 2EGUA 5I7VA 3BIWA 5AVOA 2Y0PA 3A1EA 5DEIA 5BNTA 1LPOA 3FAZA 5EHGA 2RARA 1HGXA 1S5PA 2XD4A 3DOIA 3ICOA 4DLSA 4AMVA 5F5LA 2WV9A 4JJ6A 3TI7A 4D8XA 3HJFA 2BKUA 1CZUA 3UWMA 8GPBA 3G89A 1FXWF 2GK4A 2CBGA 2PY6A 2Z1MA 3N75A 4MVYA 4KUGA 1KRWA 1LS6A 3ASVA 4MS4A 4RZQA 1NPYA 1ZUHA 1IYZA 2BGJA 1EUCA 3OHSX 5JE8A 1DMSA 3NETA 7ABPA 5CT9A 1DJQA 3B7WA 1EP2B 2NTNA 4KN9S 1TCCA 4PICA 1RJGA 1N6PA 1U7PA 3LNCA 4RKEA 1M1UA 1L7QA 2JH9A 4G0NA 4GKBA 3K7EA 2ZUEA 2EV9A 4RVCA 1I1QB 1KJWA 2GCOA 3B9PA 5JV5A 1GARA 2VN8A 1U2DC 4MZXA 1KK1A 2AVDA 1BH2A 1I10A 4FKMA 4HY3A 4YIHA 4AK9A 3HY4A 7REQA 2PUCA 2FKNA 1BOOA 4O0MA 3W6UA 3DUFB 2FLVA 3OSZA 5LBUA 2Z4TA 2WTBA 5I9IA 1G20A 2BH9A 3EGXA 4HNAB 5G4LA 1B0AA 1PFWA 3N7UA 2YR0A 2NO9A 1Z8NA 3M9XA 1B3BA 1D2EA 1RE1A 4FQ8A 4MWZA 3UMBA 4CG1A 4DTCA 1ZBQA 4WFJA 3V8EA 4BIMA 1GGNA 3FCAA 3MF4A 3KB6A 4QGBA 1A71A 5CFQA 1K63A 1JS1X 1T26A 3HBJA 1KYQA 1N2XA 4Z9AA 5JD3A 3EZLA 3FZGA 2UUOA 4MYHA 2ZYDA 4RTSA 3K2QA 5LBTA 2Z1DA 3CN9A 3IKJA 3ZK7A 4N1AA 2EJCA 3OQJA 4YJFB 6ABPA 1E2FA 2DBYA 3EVFA 5LOVB 3AB3A 2FEXA 2H8GA 2P2NA 4LJYA 3RVPA 3SR4A 1Y5IA 1N0IA 3OC6A 2XMZA 4FFSA 3SGLA 1NJFA 4ZZIA 3PE6A 5EVCA 5KNBA 2DMRA 2RGWA 4PLHA 5K0CA 1EHIA 4JLKA 4BGVA 5EHIA 4DM4A 3PLRA 3KL2A 1E5QA 4KAJA 5IMBA 4YMTA 2VTBA 4NR0A 1K06A 4PLWA 5JY1A 3MRVA 4PZZA 4BVAA 2I62A 2J5RA 2I4NA 5HUJA 5L53A 3NTXA 3RT1A 1JVNA 3JPYA 4NFLA 1XAIA 3S3TA 4Z9YA 1VLQA 3HABA 3K0KA 1XELA 1GCGA 2AW3A 3FNRA 4XJXA 5EAIA 1BHJA 4IIJF 4AWBA 2ZI4A 3F8TA 3VYTB 2WUWE 3T5DA 1J8FA 2D5LA 2WSIA 1NOKA 3NYQA 4G5XA 2ZK7A 1Q21A 5JSHA 1LPPA 4F84A 5EMLA 4E2XA 2GEFA 2REXB 3BSSA 4PFJA 4R54A 2QUHA 1IY9A 2BDUA 2J9FB 1LLDA 5MFZA 3UFBA 4N03A 4C08A 3ZJ5A 1R10A 4JZKA 4OYLA 1R0ZA 1L3BA 5FPSA 1JSCA 2YMPA 1Y98A 4PHGA 4KVZA 4L3WA 5FXMA 3WHPA 3QLUA 2ZCUA 2ZBDA 2ZB2A 4YH1A 1V8DA 1PNRA 3J81A 2HF9A 2R7LA 3VPDA 4CMEA 2JGAA 2NPOA 3EEIA 4OQLA 1P1IA 2GZ3A 3C87A 4H9GA 3ZY2A 4DTIA 2A84A 4GOXA 1HEYA 4OI4A 4FEAA 3X2FA 3MJRA 4GM1A 2FSVC 2HC9A 4M1YA 4YRQA 5DIFA 5IP5A 1I0IA 1Q6ZA 1SOUA 2OQ2A 1Y3BE 3ML1A 5A7HA 5KHAA 1ZGZA 1UOQA 2EZTA 3BORA 5CDUA 2RSLA 3I6YA 2JF0A 4IDAA 4FEGA 2C5FA 2CK3D 3H6KA 4LW8A 4MGHA 3S4YA 3FYCA 4GKJB 2GRAA 2BLLA 1FDUA 4CMIA 4F5DA 2H63A 1XCJA 1RS0A 2VPPA 4EW6A 5ANRB 2D1SA 3MWKA 1LZLA 1RKXA 1F14A 1U8UA 2AWOA 1AKWA 2DH5A 2Y1LA 3PWSA 3TB6A 4C07A 1BD3A 5CDSA 5FR2A 4JOQA 5LUAA 3PDHA 5AIBA 1H4VB 1MX1A 2P91A 1AMOA 1CUHA 1OI3A 1M2OB 1KZHA 2PG3A 3N8HA 2DUWA 3GV0A 3PPWA 4G5RA 4A3SA 3NX4A 1LVHA 3N7AA 4CT0A 4R05A 1RRPA 5E7JA 3EDYA 3WS7A 4XIYA 2IYOA 2WSSD 4IMRA 4NENA 3SDZA 3FSEA 4KQJA 1A5ZA 1F6BA 1J8YF 1O8BA 1Z0SA 3OVMA 1WPXA 1A96A 2R8ZA 3PLNA 4GGMX 4M98A 5LP6A 1T4GA 4A5SA 1JAHA 1XEFA 2ZSHA 4AQDA 2BBTA 1A77A 1FVHA 4MYDA 3I9JA 2IK8A 3QE9Y 5K6AA 3DCYA 3R6GA 3Q3IA 1VZ3A 2HHAA 2I99A 3NM4A 2VT2A 4WXYB 2WF8A 4EMSA 2BEJA 3AHGA 5CB4A 5AW7A 1T8TA 4DE5A 2P9FA 3KEOA 4HBGA 1T34A 4IDNA 5E8RA 1MRNA 2L2QA 1YAJA 4JJGA 2FPIB 5SZKB 4Y6LA 2ZR9A 3BFJA 3SZLA 5EE3A 4P3KA 4Y9SA 3TTVA 4AZ0B 1PAUA 2H5IA 2X3YA 4E11A 2IH2A 4DWWA 5C8YB 4TTAA 4QQKA 3V33A 1ZK1A 1WQ3A 1LSJA 3EA4A 1H4QA 3HZRA 2PUEA 1Q17A 2FW6A 4F46A 5AVVA 1Y42X 5JAIA 1L5SA 1XHFA 1MOZA 3ORFA 4M38A 3LYAA 5LZ9A 2DOKA 5TDHA 2FWRA 2ZI9A 1DFGA 1X39A 1Z9BA 3RBVA 3OFKA 1EP3B 4Y3UA 1QQBA 3HR7A 4B32A 2YFKA 4B17A 4M8IA 5JDIA 5BRNA 3H7AA 3BEOA 3N6VA 4TLCA 4DMLA 4N49A 1LC0A 2YJZA 4L8GA 1PJ3A 1QH8A 3GRAA 2GPBA 3KEFA 4PE5B 3OT4A 3QWFA 1WR8A 1J00A 3DE5X 3TYXA 1W93A 5IC4A 1PZMA 4HOYA 3AGPA 3U19A 3LP5A 1IOWA 4BLWA 4OJTA 1SU8A 1DV1A 1HSZA 3AY7A 2QSYA 4KRXA 3ZD9A 2ENUA 4X1KB 1Z2PX 3H2KA 4JBGA 4C4RA 4Q4DA 5CIYA 3LGXA 3WOHA 1INLA 2D13A 4EKEA 1O9BA 4EYGA 5FPQA 2IYRA 1T15A 2E5LB 1RU3A 2OHVA 5ALEA 4QBGB 4YMGA 1KOLA 1ICIA 1PO7A 2E2WA 5JOQA 5JXHA 1GZSA 1ILEA 4ABTA 1G63A 3GA7A 1XF1A 3GN1A 3CEAA 2VNSA 1KQFA 1FBTA 3BD6A 3DTVD 5EY5B 1IDOA 2QLLA 4B87A 5EJFA 3IDAA 2VDOB 1KQPA 1P3Y1 3NKLA 3T5AA 2B20A 2CNDA 2CD7A 4YIKA 2IEAA 1HDZA 4OXRA 3G2OA 1RWWA 3F4KA 2ZT7A 3DS8A 3T95A 4RTRA 2HUPA 4L5YA 1EK5A 4LOLA 1Z4IA 3H1AA 1DKUA 1EG7A 1SAYA 3RVOA 2XQGA 4TXNA 3D6VA 3CZPA 5A9TA 3WYEA 1L8XA 2B4RO 2I6QA 4W6QA 2NUAB 5E6SA 1FP6A 1W5AA 3GT0A 2O9JA 3G2LA 4KQWA 2O54A 2E4AA 5CDFE 1HPLA 2GNAA 3BDIA 3BIFA 4NOKA 1VHQA 2FMFA 3TOVA 3K4QA 1I33A 4C7OA 4BQFA 1T6BY 1UBOS 2RI1A 1AV6A 1BU8A 1UOOA 2X1MA 1ONPA 3F5QA 3OEWA 4CLOB 4J2OA 4JJ4A 4JL8A 2H4ZA 4A8HA 2V7XA 3A6HA 5CXXA 5CA1B 3MS4A 1ID8A 4WY8A 2VQ6A 1IN7A 3U3KA 1AKUA 1MEJA 4O4IA 1Y5RA 3ZLBA 5JLJA 1IZ7A 1TQDA 3D0KA 1OU4A 4HAOA 5JWRA 2O19A 4YAOA 1OTYA 3T6KA 2G8LA 2C0CA 3TF5A 5KDOA 2QTFA 4MAFA 4HEHA 2ZQ5A 1X3SA 1HMPA 4TS3A 4WVFA 3HTXA 3UAZA 4IXDA 621PA 2XMDA 4ZODA 1GKYA 2NVUB 2QN2A 3N2LA 4DRZA 1RZRD 4P4TA 5L95A 4KC0A 1QFZA 3WSWA 1D0SA 1UANA 4HNSA 1E9FA 3IOBA 3TJZA 2FA9A 1YRQA 2UYQA 2HTEA 2H4XA 4L75A 1XCGB 1M5TA 3BDAA 4JLUA 1RJEA 2BFOA 3PPYA 4IH1A 4DSAA 5BRJA 3PDWA 3TQCA 5DGDA 3WYAA 2PO5A 3TNLA 3RS8A 4LZAA 3EAGA 1FDRA 3PQEA 2ZIGA 3AJ9A 3A8TA 1SUSA 1X1RA 3P9SA 4YREA 3IEPA 3RASA 4BRZA 3DMNA 4MR8A 1EWQA 2OBBA 3BMOA 2FAXA 2O8FB 5DMHA 5BWLA 3SIXA 1JHUA 1OVMA 4N5DA 3SVZA 4NDNE 3EYAA 4DBZA 5I3CA 2WB2A 1XP8A 4ZT5A 4R41A 3H16A 1QGAA 1U9YA 1VG1A 2GGSA 1QONA 3OT1B 4B2PA 3L8FA 1E7SA 5FOWA 3RAFC 4J1QA 2HCBA 4G07A 4HN4B 4A15A 1LBIA 2WWGA 4AF7A 2IE8A 5I4CA 1AZTA 2NV2B 4CL8A 1G8JA 5CB6A 3MWEA 3HB0A 1HURA 5I45A 4UNPA 1E3MA 5HCIA 1ZSNA 4WBXC 4XR4A 1A5BB 3FVQA 2XT9A 4DILA 2HLDA 4LIPD 4JLDA 2QL9A 3AMVA 3FWYA 4WERA 3AKCA 5G1OA 4Y6SA 3KSAC 1QWSA 4BB9A 1JF8A 2FUG6 4I5FA 5JMTA 1ILWA 4KBGA 4KQ9A 2G06A 2O3TA 1ZD4A 2ZYWX 2HHHB 2QA5A 3HYSA 4EB3A 4GI3A 2LRHA 1XN1A 3PPXA 5LQDA 1UFQA 2AIRA 5EXPA 1ZRMA 4Q4AB 1U90A 2HDHA 2WTAA 3WLSA 2XOXA 2VPZA 1OWNA 3LC2O 2GBLA 3L9XA 2CHGA 1T3TA 3KLBA 5UKDA 4I1YA 1TAGA 4OKIA 1JAXA 3RVLA 1XROA 3AL0C 1P75A 1UH5A 1L3IA 4J7XA 3OPVA 5T8KC 2X8BA