4QC2A

Crystal structure of lipopolysaccharide transport protein lptb in complex with atp and magnesium ions
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
235
structure length
235
Chain Sequence
b'ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural and functional studies of conserved nucleotide-binding protein LptB in lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qc2A00
2ODNA 5C46F 1BYUA 2XSZA 3EWAA 3MRSA 3RRZA 1Z2CA 1VG0B 1OH5A 1XEWX 4A0FA 4C7OA 1ZC3A 4QL3A 2DYKA 4OI0A 1S3SA 1I4DD 3BGWA 3KJIA 4BASA 4IW3B 5G3ZA 2NOAA 1IN4A 1P61B 2FGKA 3DKPA 4MKFA 3T5DA 2V54A 3VR5A 1IONA 2AX4A 3RRMA 5HR5A 1F2UB 3U3OA 1G6HA 1II0A 1TF7A 1KI7A 4TYNA 3Q85A 1OKKD 2WJGA 3IPYA 4A6XA 2E9SA 1SHKA 2Z5FA 1S9DA 1IY1A 2ZPTX 1CJKC 5E95A 5CB6A 1RJ9B 2YC4C 1IBRA 3ADDA 2ZEJA 5GJBA 1RE0A 3AVQA 3HPRA 4OJKA 2IYYA 3N70A 2QQ0A 1IJFA 5BN4A 1QDEA 1U0LA 4ZO4A 4FMDF 1LW7A 3H4MA 1X8JA 3R7WB 2O8EB 4B74A 1MKYA 4YLGA 1DAHA 2AFIE 3K09A 1NN5A 2G1KA 4D4KA 2WTUA 2CE7A 5L3SA 1KI6A 2REXB 5LPNA 3MCAA 1VIAA 1ESMA 4EQ6B 4PXAA 2JJ8A 4ESHA 2AFHE 3I8SA 3QF4B 1IM2A 3WXMA 1ZNXA 3QSYA 4QJ4A 5M04A 2DWOA 2X77A 5SZKB 1SVSA 2CCKA 2O0HA 1T0HB 4JLMA 4P4TA 1VPLA 4RD2A 4LUCA 3WMGA 4ZCLA 5CYPA 1YRBA 1NNEA 3DO6A 3KJGA 2D4HA 2OM2A 1E4YA 4OHWA 5L3QA 3UKDA 1X3SA 3D7MA 2A30A 1W5TA 5IK2D 3RHFA 1JJ7A 4UNNA 5FL7D 4RD3A 2ATXA 2H5EA 4QNMA 1FUKA 4PAQA 4BFWA 2V8OA 4IHQA 3FYHA 3B1ZA 1VYVA 3U5ZB 2IF2A 4R7ZA 1FX0B 1X86B 5J5CA 4US1R 3KTAA 2R9VA 4NZYA 3SOPA 3ZQ6A 5JRZA 4Z1MA 4P4SB 3SQWA 1KKMA 1PJRA 2DFLA 3W8NA 3UG7A 3ZYCA 1XJQA 1M74A 3FFAA 1FW6A 4A1FA 2QSYA 2FSIA 1FFHA 5JWHA 1I4TD 4HB0A 3K9HA 1KI4A 3KFXA 2WPDA 2IS1A 1SVIA 3F3YA 2ZRBA 3SE0A 4QHSA 2FEMA 3WNBA 1DPFA 1W46A 4GZLA 1N6PA 3C16C 3AQ4A 5K8LA 1JQLB 3H2YA 4Q5IA 3UMFA 4EKDA 3EZ9A 3SS8A 4OHVA 2CDNA 3GFTA 1AA9A 1GDDA 1Y63A 2Q0HA 4JL5A 5TDHA 3KKQA 1E94E 4BLTA 2C78A 2RGBA 1U8AA 3TKLA 1DAFA 5HE9A 2QROA 1M6NA 1JR6A 1YZKA 3DMDA 1GITA 4LJ7A 5AWFC 3QKSB 2ERXA 2QMUA 4HAYA 1HA3A 4KBFA 1DS6A 1KK0A 2YWHA 3PV0A 1NVWQ 1G8PA 1AM4D 2Z4SA 1BIFA 4OL0A 4PSKA 1CP2A 3I72A 4XSGA 4W5JA 5KSYA 2ZS8A 3NKVA 2DB3A 3GJ6A 2VP5A 4NBSA 1FUUA 3I4LA 1X1SA 3CWQA 3AKEA 1AKEA 1EX6A 4JVNA 2CCGA 4XTCS 1YR9A 4C0SA 3EWSA 1XD2B 2HT1A 3UIEA 1YHNA 2A2ZA 1F2UA 5KHOC 2CVFA 3Q7QA 4IOMA 5HE8A 5HKKA 4MYCA 3CRMA 3W34A 2VO1A 1R8SA 2DWQA 621PA 1ZM9A 4M1TA 1OXTA 3CNNA 4CT5A 5CM9C 1N2CE 4HLUC 1ZM7A 4DRZA 3MAAC 1CXZA 4UNPA 1AS2A 4RCZA 5AK0A 4DSOA 3R7WA 1P6XA 2O8EA 3L82B 4BFSA 4M9ZA 4KFUA 1WQ1R 2FZ4A 1K5GA 1M2OB 3OE7D 4JLBA 1OHHA 3K8YA 3RAPR 4OQLA 1P2SA 4LK2A 2VHCA 5AJVB 3VKGA 1H8HD 2PX3A 3FKSA 2GEUA 2QM8A 1G8HA 4DVGA 5JJIA 3U4QB 5DLQC 5TARA 4XWOA 2JJ2D 1YKSA 4NYMR 2IS4A 3MJHA 2ZVPX 1EFRD 3VX3A 1ZUHA 4JLVA 1XFAA 3AH8A 1E1RA 1S2MA 4C30A 1ZAKA 4DLZA 2XZOA 4DB2A 5DISB 1LV7A 3OIYA 5DNYB 1HT1E 1Z29A 3MWKA 3IIJA 4TLBA 4DDTA 4RD6A 1G17A 2ZM5A 1S1MA 3BFXA 3X2SA 3A1SA 3VR2A 3T1QA 2ANBA 4UNQA 4BRUA 2XSZD 1KSGA 1E2PA 2WKQA 5FTJA 1TL7C 2WAYA 2IEYA 2VF8A 3GJ3A 5DI9A 1AQYA 1VG1A 4FCWA 4ASUA 1G41A 2QTVB 2GF0A 1KO5A 4HAXA 4RZUA 1II9A 1FX0A 4URYR 2BMDA 2BMEA 3RS5A 5GJVC 1N0WA 3NVAA 1KKLA 1XTKA 4R71A 4JJZA 5BWMA 1HYQA 1NG9A 2BM0A 1Z63A 1E2IA 5LDDC 2A5JA 2OXRA 4P4SA 1P75A 1KY2A 4I1VA 3SJBA 3CB4A 3J81k 4W5WA 4PO8A 4MH0R 2CHVA 4OI4A 1XMSA 4LC0A 3PUVA 4PO9A 3TGPA 3FB4A 4GRAA 2NO1A 4W5HA 2R8RA 4M0LA 2AR7A 2IT1A 4F91B 1CU1A 1A4RA 1EESA 4H9GA 4E03A 3KB2A 5H70A 2C9YA 2P6NA 1GAJA 1ESNA 5IHPA 2NZ8A 1G3IA 2AWNA 4LV6A 2QAGC 3DZDA 4HEJA 3EW9A 1RFLA 3D6TB 1OXVA 4OHZA 4LBZA 2QBYB 4N3NA 3H86A 2GXUA 2ZR9A 1CR2A 4GMDA 2ZUDA 3QKSA 1R0YA 4OJQA 3SHFA 4E09A 4GP6A 3GLHE 1WP9A 2D7CA 3C41J 3N5CA 1N3BA 1KDOA 3TAUA 2ZYTX 1U0HC 2B21A 1E96A 1YJ5A 4KHZA 1MRSA 4Z51A 1XTQA 4TTPA 1KDRA 4DT1B 3VR3A 3QEOA 3KXKA 1EG7A 1SKQA 2RGDA 1VCIA 4V0OA 4XVRA 4MRRA 1YR6A 3HDTA 3L8ZA 4Q7KA 2J7PA 1NJGA 3PUZA 1TMKA 1ZNWA 4EFMA 5DH9A 1ZU5A 2A5GA 1XDBA 3NC0C 4JS0A 4TYPA 2P5TB 3ICEA 2ZSEA 2HCJB 2ZE7A 1OXSC 2VIIA 4HLUA 1CR0A 1MT0A 4EFNA 5KSOA 1KO4A 3P32A 1SXJB 1AKYA 1MRNA 3FMPB 1FTNA 2EFCB 2E1RA 4NCIA 2J87A 4Z1MD 3R8FA 1LS6A 1KHTA 3ZS8A 2RMKA 3B9PA 4LV5B 5JRJA 4TZ0A 3TUJC 2WKRA 2RAPA 3ECCA 1DE0A 1MV5A 4YDHB 1ZU4A 4ACBA 2WICA 2ONJA 2O5VA 3P20A 1XRJA 3VU9B 1AS3A 1YZTA 2GJKA 2VP6A 1D2MA 3A58B 1YU9A 2QAJA 2VP9A 2NO9A 3HPQA 4DDWA 1RW4A 1S3GA 4HSEA 2V55B 3RC8A 3SU8A 3IKJA 3CX6A 2A7QA 3DM5A 4ZIRA 4D82A 4B3DA 3U4QA 4I81A 4BGDA 2GCOB 1CJTC 3SYLA 2QRNA 2HUPA 3GFOA 4EDHA 1MABB 5KPDA 4A2WA 1P9WA 1PZNA 2GHIA 5JSZB 1KJZA 1VG9B 4DSNA 1T3SA 2GXQA 1Q1EA 2WJJA 3GLHA 3WRXC 2BCJQ 4JVSB 2ZXUA 3ZQJA 4DLVA 4GBMA 2IA5A 4PFSA 4B2PA 2QI9C 3WYFA 1WRBA 4UXJA 2CL6X 1LNZA 3SYNA 1XF9A 1DAIA 2JLZA 3P4YA 4DSTA 3KX2A 1UKEA 3BH0A 4CEIA 3QENA 2D06A 3DZ8A 3LBHA 4Q1DA 4E07A 3M1IA 5F9FA 3I32A 3A1VA 1TPZA 3GQBA 421PA 3L43A 3NHAA 2PMDA 5D3QA 2NTYC 1M7HA 1EFUA 2EYUA 3IEUA 5HKKD 5TV2A 3B9QA 4MYTA 1YR7A 4Y0AA 4IDQA 1SKYE 3JVUA 3TR5A 2FPKA 5EP2A 1N5LA 1R5NA 2ZRCA 2OXCA 2BC9A 2FSHA 4RZ3A 3UWKA 3O8BA 5KNDA 2OFXA 1F60A 2GK6A 2R6FA 4GT1A 2KE5A 1XMVA 3P4XA 1KI9A 3RNLA 3CX8A 4A92A 4G5OA 4LV8B 2BEJA 2X2FA 2FFAA 3UATA 2Q9CA 1COWA 4HI0E 3SJZA 2MMGA 4URUR 1K5DA 1ZM3A 1OHHD 1YRAA 2D2EA 1UBCA 4O0MA 5EP3A 1J8MF 1HTWA 3FKSD 2DR3A 2VHQA 2QBYA 3THYB 3ZD7A 1OXUA 2XITA 4ESVA 4W9MC 4JYBA 1W47A 1NVVQ 1FQJA 1E1RD 4TSFA 3RLFA 3NG1A 1XCPA 2EFGA 4DCNA 4KU4A 2BHRA 2HJVA 2WIBA 4NYIR 4M1OA 3AVYA 2XB2A 3U2QA 4AYXA 1DG3A 3CRRA 3KJHA 5H1YA 1QHYA 4KODA 3I73A 1L8QA 4BPBA 4HDQB 1NY6A 2YNMA 4ASUD 2QU8A 1XTSA 3EZ7A 4IFEA 2GESA 1ZNYA 3CZPA 1H8EA 3TVTA 3GPLA 1OB2A 1PUJA 4MGKR 3H84A 4C3ZA 1LY1A 4EFLA 2J46A 4LJ6A 4MGIR 2FX3A 4AURA 4QKQA 4FINA 1VCMA 1ODFA 1G5TA 3FDIA 4RKFA 3G82C 3T5GA 1LF5A 1Q3HA 4R2IA 4PTLA 2D2FA 4A2QA 3AKDA 2GDJA 2RCNA 4JIMA 1R0ZA 3I1FA 4BWYA 2YWEA 1C4OA 2P6UA 3FTQA 1PLKA 4PPFA 4BFXA 3ADKA 1EX7A 3MD0A 2WSMA 1XX6A 1K6MA 4DCSA 1X8LA 1XMIA 3TIFA 2O8FB 4HB4A 3QKRB 4HLDA 4P0TA 1FL9A 3RS2A 2BBSA 1IXSB 2R62A 2TMKA 4JJKA 1OIXA 1KMHA 2N46A 3PXGA 2V6IA 4L4UA 5C18A 1XTRA 2GCOA 2AN9A 5AJZA 5EXPA 2UZIR 3CIOA 2DY1A 1MABA 2WOOA 2G1JA 1E2KA 2RGXA 2ZUCA 1P3JA 1KSFX 3CPEA 2CLDX 1QHHB 4HUQA 4A0HA 1CTQA 2AKAB 1HURA 1T6NA 2GEVA 2MSCB 1U9IC 3B7GA 3EIHA 1QG2A 1RVDA 2W6JA 3U6KA 2H57A 1E2QA 1KMQA 3TJZA 5H8WA 4YMUA 1W2HA 2VF7A 1L7VC 3LX8A 3RDPA 1NKTA 3EZFA 1JEEA 2PJRA 3QXJA 3QG5A 3RC3A 4DZZA 1N6RA 5EE0A 1TEVA 1IXZA 4RFVA 2J7PD 4PHHA 4A0RA 2A5YB 2RGCA 2FFBA 4S2EA 1Q0UA 5JJLA 1J90A 1MO4A 1OW3B 2ODEA 2DFKB 5LD2B 5KUTA 4ZKEA 2OSBA 3DOEA 1OV4A 4CGZA 2IYZA 2IYVA 1HUQA 3IIMA 4JLDA 1P4SA 1R10A 4O2LA 3VHXA 4F92B 1US8A 2ANCA 4B76A 3B85A 2XZLA 2CK3A 2WWWA 3X1YA 5GVSA 1OFUX 4CEHB 4QNRA 2AWOA 3TUIC 3NEJA 4A2PA 4URVR 3U7EB 5IRCD 4ZDKA 2O8BA 2XJ9A 5AJXA 2ZRJA 1JI0A 1JXMA 3T1TA 1MOZA 2FPMA 3Q3JB 3N2EA 2YJTD 3WYGA 1FOEB 1UBEA 1ZCAA 2CJWA 4J0QA 4AK9A 2ZS9A 3K09C 2WWGA 3LXRA 3G5UA 1TTTA 1KDPA 1T8TA 5EE3A 1N6KA 4DLXA 3GCGA 2R6GA 3KDSE 1WXQA 4R2HA 5EXTA 2GA8A 3ZVRA 1GL6A 2I1VB 4KAXA 3GLIB 2MSDB 5HCNA 1XWIA 3AKCA 1SVOA 3BB4A 3EZ6A 3O8RA 3U7GA 3CW2A 2BKEA 2F9LA 5FTNA 1DARA 3AF1A 4B2LA 4HAZA 5KO2A 3RSLA 2PX0A 4PC1A 4WZ6A 4B3XA 3L8YA 5ELXA 4B48A 1Z6XA 3CLVA 4FCVA 4KO8A 4KSBA 2AK2A 1QHSA 4L8GA 3ND8A 3BXZA 1N25A 2C99A 3WNCA 2ZU0C 3BIFA 2FFQA 3OFNA 1FQKA 1BOFA 2PZGA 2J41A 1N5IA 2XNDA 1IQPA 4DEYA 5UKDA 5KDDA 2HDNB 3V9PA 1A1VA 4POAA 3TUZC 1P2UA 2QUZA 2IBMA 5GJCA 4Q9LA 4F7WA 1EGAA 4XJXA 1GNRA 5EP1A 3T34A 4C9BA 1P62B 4AYTA 1W1WA 3L0IB 4QGHA 2YKGA 1IN6A 1Q57A 5FOXA 1Z6TA 1B0UA 1N6LA 1NN3A 1JJVA 2JLSA 2YOFA 5EUMA 4JVLA 5JCPA 2V4ZA 2GAOA 4DSUA 2I1QA 2W0SA 1A82A 3EXAA 2BVNA 4F4JA 3QKRA 4AKGA 5JHGB 2JAQA 2YVUA 4Q1AA 1L4UA 2BBOA 1COWD 4BEJA 1KO8A 2DBYA 2XX3A 2JASA 4Q21A 1KTVA 4Y0VA 5FTLA 1X1RA 2I3BA 3M6AA 1QVRA 1LTQA 3TNFA 4URXR 1QHHA 4NH0A 3SDZA 4MYUA 4PPNA 1D9ZA 1R8QA 4OQFA 4MRVA 3B8HA 4TSFD 2UVQA 4A6PA 4BFYA 1P9RA 4KCGA 1AZTA 2W00A 4Q9HA 2GVDC 3LVQE 1E9AA 4JVMA 4NCHA 2QNRA 2ZIAA 5FBWB 1Z0FA 3SBDA 5C4GB 2NO7A 2BMFA 2QPAA 1VYTA 2IC5A 1J8YF 1G9XA 1KDTA 2GVZC 4QM6A 1AS0A 4PR0A 2FV8A 4HDCA 1DTSA 5AJYA 4GOXA 2GWHA 2QMOA 2VP2A 4MQBA 4OQNA 1HE1C 5JBQA 1M1YE 1H8ED 4N0EA 4NCJA 3SZRA 1P2TA 1U94A 3TH5A 2OCPA 1Z3IX 1DAKA 2EU8A 3LRPA 4MKGA 2ZJBA 3SBEA 2X1VA 5KOYA 4TL6A 1D2EA 2CVHA 4RD1A 3TVDA 2YOGA 3AM1A 4Q4JB 2NGRA 1NJFA 3B1VA 4GMXA 1EFHA 1RC8A 2J0SA 4JKIA 1NN0A 3W3AA 4HZUB 2ZETA 4LCBA 1NI3A 2VSXA 3QQ5A 3QY0A 2VH5R 2WWYA 2O52A 2IYSA 1F5NA 4AWXA 3VX4A 2R44A 2O8CB 2DFTA 3KQHA 2JLUA 1LS1A 1BKDR 4H1UA 2O8DB 1IN8A 1RZ3A 4ZI2A 2FGJA 3DKVA 4QHTA 1KJWA 3I5YA 3EIEA 4KFRA 2WJVA 2HCBA 3PFIA 3U60B 5HZHA 3ZD6A 4G1UC 3RVBA 2ORWA 3AVOA 1G6OA 3B1YA 1W36B 1N0VC 3AF4A 3SN6A 1Z08A 4QRHA 2MSEB 2W6JD 4CZ2A 3EASA 3DHWC 1T91A 1RYFA 1ZBDA 4CRWB 1VIYA 1CF4A 4GP7A 5CJPA 1NIJA 2HF8A 2ZSAA 4QJ3A 1ETUA 1E0KA 2ECKA 4GDFA 4P31A 2QP3A 1KI8A 2FDCA 2OBLA 4D26A 5AR1A 2JEOA 1GWNA 2WWXA 1X6VA 3IHLA 2P2LA 1Q1QA 1II8B 1J70A 1QZXA 3LLMA 3TSOA 2BM1A 1G7CA 4JSYA 3FVQA 2ODBA 4BLSA 1HV8A 5AUQA 4Q1CA 3FPAA 1UKVY 2WKPA 3W6NA 4L9SA 2DPXA 1DBSA 2RGGA 1G291 2P67A 4HAVA 3W5JA 3MUFA 2CK3D 4Q4AB 3CRVA 1W44A 1WMSA 4URWR 1TEXA 3FOZA 3PG5A 1ZIPA 5FPTA 2P65A 1J7KA 2SHKA 4DLWA 1PVOA 1XPUA 1ANKA 2BCGY 4JLKA 5FTKA 4XVUA 2VBCA 4KYIB 4B32A 1JAHA 1OF1A 1VCNA 2C9CA 4MRNA 1XXHB 5DHAA 1T3HA 4Z54A 4D0LB 1KIMA 3TW8B 4DKXA 2ZJAA 1I4LD 1E3MA 3BH6A 2IEZA 3C7KA 1QRAA 3NC1C 2G0NA 2PZEA 2RGNC 3RS3A 3X1WA 3DVLA 4OHYA 2WIAA 2GZDA 2KWIA 1CLUA 5DN6A 1CJUC 2XTNA 4IXNA 2GXSA 5C2JB 3W9YA 2O0JA 1SVLA 3BS4A 3KQNA 2Q3MA 1KGDA 2AD1A 2BBWA 4LZZA 3RRNA 1CRPA 2HEIA 2IUSA 2XTZA 4LX0A 4CEJB 1O3YA 1QF9A 1OYWA 1Z6AA 4ACAA 5FOSA 1BYIA 1VCOA 2E87A 1FP7A 2H17A 3K9LA 4QBIA 4BLRA 1ZJ6A 1DO0A 3WMFA 4KXFB 2ZRKA 2C77A 1NSFA 4WBSA 4XTRA 5B58C 2RHMA 1ZD1A 1H65A 1NRJB 3OFND 5TVKA 3IHWA 4U5XA 1TNDA 2XNDD 2YWGA 1E69A 1RJ9A 3EPJA 4EIWA 1D6JA 2ZS7A 5AUOB 1SVWA 3BB3A 4O3MA 3OF5A 3GEEA 4JYCA 5TXGA 1GFIA 4FMBB 5SZIA 4UXHA 1CS4C 1Z8FA 3GLGB 4PQRA 1ZC4A 2QSZA 4N1AA 5A4JA 4Q9KA 2JJ1A 1YZNA 4OQXA 1G19A 3T1VA 4FCTA 3U44B 3D31A 2IHBA 4PHFA 4DXAA 2QMHA 4HZUA 1E2EA 4QBGB 5FBVB 1PV4A 5FOTA 1XCGB 4HLQB 1TADA 2ZRIA 3WBKA 4N0DA 4WVFA 3RRYA 4EQ6A 2NMVA 2RB4A 3OIWA 3QF4A 3CF0A 2PJZA 1XBTA 1G4UR 2V1XA 4NYJQ 4PC7A 5IDVA 3NBXX 3KKNA 4L15A 2EW1A 2GF9A 2NQ2C 2W0MA 3L0PA 2QP4A 1I2MA 1KOFA 3IPXA 4XIGS 2IS2A 2EFEB 2ZI3A 3CWZA 4PC3A 3WP1B 2ZRAA 3E2IA 3SC3A 2OT3B 3WYAA 4RZ2A 2W2TA 3K1JA 4EPYA 4IVPA 4Q4LA 2QTFA 3IQXA 1S0UA 2VP4A 2R6AA 4WXRA 4ARZB 3NH9A 3HYRA 2C2HA 2B8WA 4B34A 1GP2A 2C8VA 2P6RA 4US0R 2GETA 2B6HA 4LHYA 2ZVQX 3L2OB 4ZDIA 2PT5A 4IJMA 1JR3A 1DADA 4OI2A 4YXWA 1BMFA 2WOJA 1AQUA 4TL9A 5ANRB 4B35A 1NP6A 4QJ5A 2GZAA 3CKLA 1WBDA 1II8A 3A6PC 2Q6TA 1TX4B 1A2KC 1VDZA 5G41A 4KVAA 3K70B 2ASEA 4LSGA 3MGCA 1DG1G 2DWPA 1P9NA 1XJ0A 4PSVA 3LA6A 1YQTA 3LY5A 2XTMA 4Q4AA 1FNMA 4KFSA 2MMCA 2QG6A 4LPSA 3HYTA 1CULC 1E2GA 3JVVA 4H1VA 4V0MA 3FHOA 1E2LA 1JALA 2QT1A 4Q4HB 5JWOA 1NL3A 1XCMA 2JIZA 3A4NA 1M8PA 1ZM4A 5DYIA 3R9IA 1XXHA 1E0SA 3MG9A 3KFVA 1QBKC 1VG8A 3BD9A 2RGNA 2QP9X 2FEOA 4GL2A 4OK5A 4BFZA 2G9NA 4FMCB 1D8TA 2NZJA 3AGQA 2HYIC 4IOLA 4BE7B 2YV5A 1XD9A 3CH5A 1U2RA 3FMFA 1OYYA 1QVAA 2RKOA 3OEHA 2JLRA 2X2EA 4TMVA 3OIUA 4QBFA 2VRWA 3OAAA 5FPHA 5FUXA 2JCSA 4JLOA 2JLYA 1DAMA 4GSYA 2ZROA 4CEJA 2D3WA 1U8ZA 4JBYA 4BUJA 3EAQA 2BJVA 1SGWA 4YMSA 1F48A 1HE8B 3K9GA 4HZIA 4EPTA 3W8RA 2V1UA 3TSWA 1XD2A 2QEQA 2OV2A 3A4LA 4IKEA 4US2R 4TQUS 2QA5A 1NMYA 3EPKA 3AVWA 4ZV4A 1UDXA 2PBRA 3TAHA 4B3GA 4LHXA 2CL7X 3E1SA 4BRWA 4EAQA 1LFDB 2J9RA 1TAGA 4LBVA 1YZUA 3V4FA 3VTKA 1D9XA 2YOHA 5FUYA 3BRWD 2R2AA 3Q8XB 3CONA 4BLQA 1SXJC 5FPSA 5BQ5A 3GLGA 4QGAA 3CPJB 2ZRDA 2OBNA 5BW8A 1Q21A 3ZH9B 1KNXA 2WPDD 3B78A 5AJWA 3PENA 1NKSA 5E7MA 3MWLA 2IYWA 1G16A 1GRRA 1XJCA 5F3WB 1Q1BA 4JT4A 5DYGA 2PEZA 4PC6A 4Q7JB 3X1DA 2ZSBA 3VKWA 3U3RA 4ILEA 4M1KA 3GJ5A 2ZANA 3T12A 1OH6A 2IWHA 1GUAA 1OJLA 3I5XA 1JPNA 3U7HB 3CR7A 2WVJA 1FTSA 1BH2A 4LYFA 3TLXA 2J59A 2OILA 2Q3HA 4EPXA 5FPKA 2NPIA 4O2RA 4PPQA 4ZKDA 5L3RA 2CLCX 5DN6D 4A9AA 1XD8A 2OG2A 4ARZA 5G53C 4PAMA 1ZINA 4ZDJA 1P5ZB 2PLFA 3LVRE 3DPUA 2NPFA 2UKDA 3B6EA 3BJIC 3CZQA 4NONA 1GNPA 1ZVQA 1E9EA 2BJWA 2V9PA 3T1OA 2QRZA 1OFTA 1KI2A 1G3RA 1SXJE 3ZIAA 4DCTA 2FSFA 1RRCA 4YDSA 3TW4A 3QKTA 5KPJA 3NXSA 3ICQB 3LXXA 4DLUA 5F98A 4D0GA 4FWTA 2J0UB 3SHWA 4LHWA 3KB1A 4PO1A 1U0JA 5BN3A 1IHUA 1AGPA 3OIVA 5FBRB 3EC2A 5AUPB 1UADA 4TT3A 5FI0B 4CYMA 3THWB 2JJ1D 2F1JA 3AF0A 2ZJZA 3E5HA 4GZMA 4ZPXA 2ZREA 3ZS9A 3OESA 5JWRA 4QBHA 2AL7A 3FKQA 5L8VA 3BH7A 1Q1ZA 3DMNA 1OPXA 4C0BA 3V00A 4TLEA 2AXPA 3NBYC 2C95A 5D3MB 3A4MA 5K8UA 4WA7A 1DOAA 1KZ7B 4TTQA 5FR1A 1G3UA 2V7QA 2IYTA 2REBA 2JLQA 1E1QA 5JMTA 1XZPA 3ZLJA 1NBMA 4LRWA 1UFQA 1JEDA 2V6JA 3Q7PA 5LB2A 2CMKA 2EFDB 5J40A 4B33A 4D6PA 1Z47A 4G5RA 4LJ8A 4DT1A 5KNCA 4LYAA 5A5GA 1TU4A 3HJNA 5JEDA 3U3KA 2ZYWX 3ADBA 2ZJOA 2REOA 4EPRA 2Z83A 5B2ZA 1JB1A 2WHXA 2IW3A 3U3MA 3LH5A 4CW7A 2B92A 3AP1A 3PUWA 3WHKA 4B2IA 2IYXA 1NLZA 1R6BX 5EE5B 1HH4A 2PL3A 1MO6A 3HU1A 4W7SA 3FHCB 4V0LA 2HLDA 1SXJA 2A3RA 4Q9IA 3SQXA 1JR3D 4YXWD 4X8HA 3QVVA 1BMFD 1KK1A 3UMSA 1A7JA 3ZGXA 4TQAA 4RSGA 3GLFB 5FFMA 3KQUA 3R9XA 1SQ5A 3UMRA 2Q21A 2JGNA 4A0GA 2WAXA 3MSXA 2ZU6A 3VU9A 4TMTA 4HB3A 4EUNA 2IXGA 1HT2E 3F5FA 3KL4A 3P27A 3RWOA 4DC9A 3VNVA 2X8AA 3AEZA 3NBFA 3B2EA 2GJAA 4DLYA 4D4LA 1G7SA 4CF7A 2YINC 3BFKA 4AY2A 2EYQA 5CYOA 5KU1A 4TYYA 1CJMA 1YZLA 4HAWA 2HT6A 5CDFE 2IYQA 1M7GA 4P32A 2WSSA 4JLAA 5IF9A 4I1SA 1XEWY 1JXOA 4QC2A 4CDGA 2JIZD 4RFSB 3PJRA 3GFPA 1KI3A 3WBJA 3WP0A 5JSZA 2ZYVX 4TYWA 2PEYA 2CLSA 4IFBA 2FH5B 3WMEA 2RGEA 3F0TA 1KAOA 4TL7A 4OI1A 4B71A 1G3MA 1G7TA 1S96A 4KFTA 2QENA 4WXPA 2ZI4A 1NN1A 5JEEA 4PZLA 2JLXA 3OEHD 4YONB 1UM8A 2QT0A 4M4SA 3VR6A 4XSHA 1UDWA 1RRPA 1T3LA 4XD7A 3B13B 1GL9B 3UWOA 5G3YA 1RRGA 2R6CA 3OAAD 2VSOA 2OE2A 4XWKA 3W3ZB 4RZXA 3IGFA 2G6BA 4WIAA 4HYYA 4A8JB 3DOFA 3BBPA 2YZ2A 1ZUIA 4TMXA 4DIEA 4MGYR 1E2HA 3CNOA 1E9FA 4UJ5A 2OCBA 2G0TA 2QGNA 2WWFA 1W0KA 5JFGA 3ZVMA 2ATVA 2EWWA 5E7IA 2FF7A 4M9QA 1IXRC 3AVXA 3N2IA 4D0NA 3GD7A 3C14C 5LD2C 4M1SA 3GEIA 2J0UA 3AV0B 3BWDD 2WV9A 4LDJA 2XB4A 2F1HA 1HQYE 1SZPA 1P73A 2GJ9A 2Y8EA 3MJRA 4Q47A 2VHTA 4QHYA 3W90A 2ZSDA 4EJSB 3Q9LA 3C8UA 4B3BA 4PQYA 4TLAA 2CNWA 221PA 2NO6A 4G3XA 4BZXA 1ELOA 1U8YA 3NH6A 3G0HA 5DI3B 5J4LA 1ZRHA 5CDFA 4DDVA 5KTYA 3CH4B 1DAEA 3CRW1 4U7DA 4ON9A 4EPVA 2C9OA 2DCUA 2WJYA 4FI3C 3THYA 1NF3A 5D3MA 3TRFA 4UXIA 3QPUA 1EWRA 3EX7C 5F9HA 1MO5A 3Q72A 2GZHA 5DSZA 5FOVA 5KDLA 1Q20A 4NYMQ 2A5FA 3ONWA 3UK6A 3BE4A 5FR2A 3LFUA 5L3SB 1KI6B 5JI2E 1FNNA 3IILA 2B7CA 3A1TA 4LOAA 4PQFA 2F1RA 3K0CA 2F1IA 2OESA 2GEDA 3QXHA 1SULA 1TUEA 3UG6A 3AF3A 1W5SA 1OSNA 4WAUA 3SFVA 2ZI6A 5E3HA 2OHFA 4XH9B 1RRFA 1KSJA 2FZLA 3FMIA 3PUXA 5AUNB 1AK2A 4M22A 3BFVA 2HJGA 2C03A 5L3QB 2NIPA 4X8LA 3GLFA 2IYUA 3QNUA 1XTJA 1KK3A 1Z83A 4GNKA 4RJLA 5G40A 3ZIAD 3LW8A 2IWRA 3SEAA 1IAQA 3MWJA 4OKSA 1WBBA 3K70D 3LD9A 1G7RA 2PT7A 4NL4H 2O8FA 2BV3A 2ZUBA 2IXEA 3P26A 4FW9A 1HEIA 3B1WA 3R8CA 3AUXA 4TT3D 2ZI7A 2VPPA 3KUCA 3LQQA 4TMKA 5CLLA 4K81B 2QQEA 4LI0A 1T8UA 3SYKA 3ZZ0A 1TF2A 1ZD9A 1DO2A 4B3CA 2Q9BA 4TTRA 5DIFA 3TSZA 5L3VA 3KQLA 4RFSA 3CF6R 5JCZA 4BLPA 1D5CA 5CB8A 1HY3A 5FI1B 3A1UA 3LBNA 1KZGB 5SZJA 1P2VA 3GLIE 1Z06A 4JBWA 4C0QC 3KKMA 1FMLA 2FWRA 5EE9A 5DHFA 1N5KA 1E2JA 2V7QD 4MKIA 4PZYA 4PSAA 1L2TA 2GAAA 1E1QD 1G1MA 1NBMD 4IXMA 1EWQA 1ZM2A 4MUBA 2LKCA 4DLRA 2LCFA 5E4FA 3AP3A 3LWNA 5KSZA 1F3OA 3QBTA 2QGZA 4A8JA 2PCJA 1FP6A 1E9DA 3NBZC 3RS4A 2FE4A 1OB5A 4D2IA 2PZFA 4FMCF 4HDOB 4L9WA 4NU0A 4RY2A 4UKDA 2QM7A 721PA 5JI3E 1WE2A 2VHJA 2ONKA 2CE2X 2QE7A 1G5PA 2QTHA 2Q3FA 2J1LA 3AGPA 5FH9A 5CK5A 3SI7A 2QPOA 2HLDD 2WBLC 1SXJD 1IN7A 5EUQB 4D4JA 1JQJC 3QI2A 3X1ZA 5TY0A 4CEHA 4G5QA 4M1MA 2NO0A 4DCUA 2J3EA 4Q48A 4EJSA 2KJQA 1N5JA 2ODWA 1TQ2A 2QL6A 1R0WA 3EG5A 3QEJA 4BQSA 1Q44A 4YMTA 3LNCA 5DI3A 5GJWC 3IO5A 3UANA 1A5TA 1SVKA 2IUTA 1J2JA 1KJYA 1M7BA 2O0KA 2VQSA 2ZR0A 1PUIA 1ZIOA 2OAP1 2NG1A 2WSSD 5SZHB 4E22A 1P7CA 1OT3A 4P3YA 5CM8B 2OUKA 2ZE5A 3GLIA 2LWIA 2G88A 2OFOA 2GBLA 2H92A 2OAQ1 4ABYA 3O8CA 2OLKA 1GL7A 3VMFA 4LJ5A 1GKIA 3UPUA 1DVRA 1EFTA 1NVVR 2FNAA 3LO5A 4GOJA 4LJAA 4U00A 1W36C 1VKJA 5C4MA 3BK7A 2QMEA 4XD7D 1EXMA 1TQ6A 1UPTA 4OBEA 1DELA 3FMOB 1W4AA 3L0SA 5TMPA 4TZ6A 4CVNA 4PHGA 5FUWA 1NVXQ 2OBMA 4U02A 3IQWA 1G18A 1NIPA 1NY5A 3EA5A 3JZMA 2GCPA 3AF2A 2W83A 2AHOA 1UJ2A 2BMJA 3H1TA 3MLEA 1OLOA 4UNSA 4AKHA 1W0KD 1Z0JA 2A78A 4IDHA 4JL8A 4UJ3A 3KUDA 1W7AA 5B30A 1XEXB 1QHXA 4AIIA 3DM9B 4DCVA 1SVMA 2I4IA 2N42A 4AG6A 1OIWA 1N0UA 4BZPA 1E79A 4FXPA 4LJ4A 1UKZA 4KV9A 1Z28A 1VHTA 5CLQA 4BFUA 4KJZA 2KB0A 3L0OA 4FD2A 3CF2A 1G8FA 3AUYA 5TB5A 4B3FX 3ZZTA 3GJ8A 4AYWA 1TQDA 2F6RA 1TU3A 3TBKA 1V43A 3O8DA 3BORA 2CNWD 5JJKA 1WCV1 4G01B 2R65A 4P33A 2J45A 4Q03A 4S35A 1N6OA 3IBYA 1NMXA 4LHZA 3I62A 3KKPA 3REGA 1M34E 3K0AB 3LBIA 1OH7A 4LY6A 2RHDA 2FN4A 4TMWA 6Q21A 1W4CA 3SNHA 1W2GA 4F4CA 5KSPA 4NCKA 4HLCA 3ASYA 4XOIA 3ETLA 3B1XA 4OQMA 3THXB 4FWIB 1Z0AA 2PCLA 3BC1A 2VHUA 5JZVA 4B6FA 4C0JA 4HB2A 1XU4A 4NYIQ 1Q3TA 3EIQA 1Z07A 3FE2A 1NMZA 4L16A 2R6DA 4G5GA 1JR3E 3K9NA 1WF3A 2A5DA 2ZRPA 2EFHB 1W48A 1U99A 2L0XA 4D80A 4JMPA 2JATA 1AN0A 1JAIA 4IDNA 1DAGA 4HAUA 4C4PA 1CRQA 5DE3A 4RD4A 3ZVNA 4TMZA 2X19A 4CIDA 1Y3AA 1Z0IA 4A82A 5K8TA 1FZQA 1LVGA 4Q4JA 3K0EA 3QJYA 1CIPA 2BKUA 1T9HA 2H7VA 4IDOA 4V0ME 4O25A 2A9KA 5C1BA 8OHMA 2JDIA 4PHTA 3ZDQA 2FOLA 2KI5A 2ZRHA 1WDTA 1XXHE 4V0KA 4GOKA 3QBVA 1U98A 4WOPA 2XGJA 2O8CA 2J0VA 1GZSA 4I4LA 3QF7A 2O8DA 4CT4B 1XNJA 2H16A 4Q01A 4JSTA 4OHXA 4YMVA 1QHIA 1KYIA 4MYHA 1T0JB 1VHLA 4DBLC 2VYFA 4F93B 3EARA 3CNLA 4D25A 3PUYA 5FBQB 2WZQA 1G8YA 1NLYA 1G5RA 2XNSA 3RSOA 4JLJA 2AXNA 3M0EA 2CHQA 521PA 1OE0A 2KBFA 1FPMA 1A2BA 3LAWA 4ZIRB 4F38A 3MMPA 3BB1A 1E32A 1U90A 3R20A 2J0QA 2WJHA 4IVRA 1ZCBA 3ASZA 2F55A 1W0JA 4GI7A 1CR1A 2VLIA 3W6OA 1BS1A 3PIRA 1SHZA 4DIDA 2ORIA 3GLHB 2ZJ8A 4KITB 3I61A 5FBLB 3VR4A 1W4BA 2XJ4A 5HTKA 4DJTA 3U61B 1E9RA 2XXAB 2H18A 2VEDA 3HR7A 4C0KA 4A36A 3GJ0A 1B23P 5JHHB 1GRQA 4IDPA 1XEXA 1KK2A 4LPKA 2QE7D 2RGAA 4ZI3A 1E9BA 4JL6A 4CEIB 1IJEA 3GLGE 3MWYW 3GJXC 2CEAA 1E99A 3K70C 4NDZA 2GKSA 4Q1EA 4UQOA 2WJIA 2XOKA 2HYDA 3I92A 3CO5A 2DHRA 4KSCA 2HF9A 1QG4A 2D62A 4C0AC 4IRUB 1EK0A 1BO6A 3U7FB 2WWHA 4AD8A 3KJEA 1L4YA 2YHSA 2QN6A 1E6CA 2H8KA 4UNRA 3ZVLA 3PCRB 2VTKA 1CEEA 1YR8A 2C96A 3A1WA 1OFIA 3HP1A 3K0AA 4II7A 1LF0A 4Q1FA 1W4RA 1KI1A 1JNYA 3HWSA 4G0NA 2FPLA 4GPTA 2WM9B 3KKOA 5CIWA 3T61A 2C98A 4NP6A 5FOUA 3KQKA 2FA9A 1GKUB 2QAGB 3A8TA 3LV8A 4IEIA 1AZSC 2F43B 1NVUQ 3THXA 3THOA 4QG7A 5EE1A 4KI0A 1LB1B 1GRNA 4DUGA 2ZTSA 4IOJA 4PC2A 1P60A 2ZITA 1GOTA 3SJCA 5FOWA 3PEUA 1R2QA 4DLSA 4K46A 1JECA 3PITA 4QGGA 1F2TB 1IOZA 1UEJA 4JZKA 1T5IA 3MFYA 2HV8A 2N1BA 3WNDA 1GG2A 4PX9A 1ZUNB 5CJ2A 4NPHA 2W2VA 3AB3A 1T4GA 2QORA 4HATA 4C0HA 1QHNA 3BERA 3R9WA 1Z2AA 4MGZR 1GNQA 1CKEA 1E2FA 1V5WA 2P5SA 4FMDB 2IYLD 3A37A 5EP4A 3F8TA 2G3YA 1IN5A 2VP0A 4IOKA 2CL0X 1UAAA 4M8NE 3U44A 2W6IA 1E79D 2XAUA 2BDTA 5KNBA 4TN1A 2IXFA 4MKHA 3D8BA 1C9KA 2ZJYA 4KBGA 1T5LA 3T15A 5EZ6B 2GK7A 3OZXA 5CIQA 4C0LA 1GILA 1RIFA 1SKYB 2Q9AA 4M53A 4X8OA 2Z4RA 2HXYA 4GFDA 3W6PA 3RWMB 4KYUA 4F4IA 1GM5A 3OHMA 3I8XA 4B75A 1E2DA 4FIDA 2OZEA 2OEPA 1NBME 3K53A 5DGXA 4NCNA 2YYZA 5GVRA 5LB4A 5BN5A 4AI6A 1XMJA 4X8MA 3KZ1E 1D2NA 1CBUA 2IS6A 3NIBA 4BZQA 2VA8A 1KMHB 3C4JA 1GVNB 3EPHA 2C04A 1R4AA 3ZZUA 1S4QA 2Z0MA 5EXXA 2ZI9A 1R7RA 3TK1A 3DL0A 3CBQA 4RKEA 2D7DA 4OYHA 3DDCA 4IEEA 5J4YA 2XZPA 4HUQB 1X8KA 4IVQA 4YQFA 1HQCA 3C15C 2WWIA 4AC9A 1R5OA 1AGRA 4B44A 2XXAA 1NG1A 2H1LA 4NMMA 1ONBA 3CRQA 1TF5A 3B5JA 5JECA 2EVWX 3OEEA 1PLJA 2OLJA 4WZBE 1G20E 3AVVA 3TMKA 3B82A 2F3TA 3C5HA 4Q1BA 3VNUA 1G3QA 4B43A 5HCIA 4JT2A 5IT5A 2D74A 1KAGA 2KBEA 3FWYA 1VECA 2ZSFA 4Q4HA 5FPYA 1YZQA 3QPVA 3QXCA 3WY9A 5KYKA 2VL7A 3PEYA 2JLWA 2RH5A 4Q00A 5B57C 3QE0A 2JDID 2W58A 3WRYC 4QM7A 1N6HA 2P3SA 1Z6GA 1XEFA 4TYQA 4TL8A 1F6BA 1R0XA 1JBKA 1US8B 4I99A 3QXSA 4QOSA 3S1AB 2V3CC 2EQBA 3RABA 5F2EA 3QIAA 4DHEA 3B60A 4C2UA 2GJ8A 2FU5C 4AG5A 2GILA 2OFWA 2J5XA 3VAAA 2QAGA 1UEIA 2UZ3A 2O8BB 4LWZA 2F43A 4Q18A 2B7BA 4Q7MB 4A4DA 4MDFA 2ZRLA 1E0JA 1IY2A 2ZQ5A 3AVPA 3VHLB 4HUTA 1W36D 4JKYA 4ITRC 2CJWB 1N6NA 4BFTA 2CBZA 4ZCMA 1RPZA 4PAOA 2K5UA 2XEXA 1AJEA 4I1UA 3K0SA 2GCNA 2QY9A 3NDBB 3QXXA 2KSQA 1KO1A 3HR8A 1DEKA 1MR3F 5H68A 4L5BA 1F2TA 4QGFA 1W0JD 3RS0A 3FFBA 3K0CC 3KXLA 2BEKA 5E7JA 3Q5EA 2ZRNA 1E2NA 3AKYA 4M1WA 2ZAOA 3UXMA 1WB9A 1PLLA 4V0NA 2FMXA 5EXSA 1Z5ZA 3SJAA 3VKHA 3HU3A 3D3QA 1G21E 4R9UC 2ZR7A 4QXAA 4NHOA 4Z8YA 4DWJA 2CCJA 2IYRA 5HZKA 2BIFA 1TUIA 2IHYA 4Q19A 2VSFA 2YC2C 3IEVA 4B47A 1GKYA 1KSHA 1XPRA 1OKKA 5BYJA 2AKYA 3T06B 3IO3A 2CHGA 2GRJA 1O87A 5A0FA 4G5SA 1W49A 3RYTC 3REFA 2XOKD 3PQCA 5EZ5A 2ZRFA 4DB4A 3LX5A 1WA5A 4JBXA 3TQCA 2OCYC 1VYUA 1E4VA 1JPJA 3P1JA 2F7SA 2PMKA 1UBGA 2FG5A 4EPWA 4JLPA 1U81A 1QHGA 4QFMA 1FMJA 3CPHA 3IDQA 4M9SA 4MITA 5GADl 2ZJ5A 3CM0A 2LKDA 1I2DA 4LBYA 3GEHA 2BBTA 4M2LA 4R98A 4NYJR 3BAFA 4D4MA 1P72A 5J4VA 1S8FA 3LQRA 1CJVC 4C2TA 4PPGA 5CITA 1KNQA 1GTVA 3I3SR 4I1OA 2DFNA 3BOSA 3GJ7A 5LBIA 4YMWA 2GNOA 3CUEF 3JZAA 3TR0A 1E9SA 2OCAA 3C5CA 3HU2A 3QG1A 4V03A 5FUVA 4ERNA 4MRSA 2AD5A 2IX3A 5BXQC 1S1CA 4LYHA 2IL1A 3K0FB 3RANA 2GJSA 2YWFA 3CR8A 4DUGD 5JS7A 4D81A 2B8TA 1R5BA 1VMAA 2FFHA 1VTKA 3LDAA 1Z22A 5CK4A 4A8JC 1YVDA 3AVTA 1CR4A 3H0KA 5IK2A 2ORVA 4MA4A 4LJ9A 1Z6YA 121PA 5FL7A 5FTMA 2ZYUX 3GLFE 4PZZA 4C7OB 3X1XA 1E2MA 5FL3A 1K8RA 3GMTA 1YE8A 4NE2A 4BLOA 2IUUA 3IIKA 4LHVA 4MRPA 4Q66C 1NSTA 3IUYA 3Q5DA 4Z8XA 3TE6A 3LLUA 4OK6A 4AKEA 3NTUA 3THWA 3RS7A 821PA 3NWJA 1S9HA 2QPTA 2W6ID 1KY3A 1G4AE 3SR0A 2HXSA 4EJSC 1YZGA 2OO7A 1XZQA 4B6EA 2IF0A 1AIPA 4TQ9A 3KXIA 1RKBA 1XB2A 4M21A 3LW7A 3VR1A 4DLTA 1XTIA 3CX7A 2EWVA 2ZRGA 3VFDA 1KO7A 2F9MA 3AP2A 3S1AA 2PH1A 1OXXK 4WW0A 4TLDA 5P21A 5J47A 5EQTA 3EPLA 2G83A 3NHBA 3QPWA 5JLJA 3T35A 3TQFA 1ZW6A 1Q22A 1RYHA 3VQTA 3PR1A 2ZRMA 2GTPA 1MO3A 3NEYA 4FN5A 3E70C 4KVGA 3AVUA 3PVSA 4TLCA 1J99A 2GBLC 1GIAA 1XP8A 2CXXA 5B64A 2ZI5A 5EJEA 1E9CA 1ZYUA 4Q7LA 5HPYB 1Q12A 2JLVA 5DO9A 3ND9A 2Z43A 3U6BA 1UBFA 1UF9A 1OIVA 1IY0A 4JLNA 4BFVA 3V4RA 4BEBA 2FJUA 2WMOB 4RVCA 4M9XA 4NTZA 1Z0DA 3EC1A 1E0AA 4URZR 5K8IA 2ZE8A 3SFZA 4MDEA 2WMNB 4A15A 4BECA 1N6IA 4DEXA 5J4HA 2AK3A 4Q9JA 4AKIA 3QVUA 1OH8A 3M4YA 4XWAA 2ZJ2A 4M1YA 3QUSA 1MH1A 1G64A 1GSIA 4OK3A 1Z0KA 1UKYA 3PEVA 1E98A 1C1YA 5KDOA 3A36A 3DEFA 3OEED 3QKUA 4XVQA 2BWJA 4PANA 2J7KA 2GXAA 3NDPA 3KTAB 4ZCIA 2ZAMA 2BOVA 2ERYA 2F3RA 3FHTA 3EZ2A 1EFCA 2IK8A 4V02A 2FSGA 3O47A 1ZD8A 2G77B 2W2XA 1NLFA 4LYJA 2JA1A 4KLZA 4KLNA 4NKRA 1ZNZA 3U3JA 2PLRA 1ZMXA 3IBGA 2C5LA 3OE7A 4DDUA 4LC1A 4K8OA 1TQ4A 4RCYA 4YC7A 4TWZA 1H8HA 4B73A 3W5IA 4ZDWA 4LGMA 2P0EA 3ZJYA 3GP8A 2ZE6A 3QOFA 2JJ2A 4E5UA 3PEWA 1EFRA 4RD0A 5J4KA 4MUAA 4Q02A 1XPOA 1OFHA 2Z6VA 4LBWA 3EA0A 3K0FA 4P4UA 3WHLA 1G8GA 1ZP6A 4LJYA 5BYKA 5JS8A 3FGNA 1U9IA 3GJ4A 4WZAE 3ADCA 2QZ4A
chains in the Genus database with same CATH superfamily
4JBLA 4D9FA 2Y93A 1XR3A 2QRLA 3NPMA 2IXDA 4WGFA 4E6EA 5CNKA 2E5LB 2UVPB 1BYUA 1Y5NA 2HZ7A 4HGZA 1V16A 4L76A 4S0XA 3VDQA 4YV2A 2M1ZA 2W2KA 3DKKA 1IBCA 3HS3A 2VT7A 3DMPA 3A2KA 1WUIS 2DYKA 3JW8A 5IM5A 5CXUA 1S3SA 1NR7A 3TNLA 5AW5A 1I4DD 3BGWA 2BE7A 3KJIA 3KWFA 1JN0A 2V6BA 3C6YA 3DKPA 3AR8A 1ZH4A 2CXNA 1U2GA 5AXAA 5K4AA 3OQPA 3VZBA 4MTLA 3VR5A 2AX4A 3IIEA 4BQOA 2OOSA 1NAIA 1G6HA 3UJ7A 1TF7A 4TYNA 3A06A 1K4YA 4PLPA 5DEOA 4YN3A 4A6XA 1SHKA 2QTGA 3UKJA 4XRGA 5AJHA 4ZJUA 1R3DA 5EKXA 2IRWA 5LZ7A 4E46A 4DQXA 1CJKC 1DRWA 1WOMA 1H0KA 3ZOZA 4N9WA 5TS2A 2XMGA 2GHTA 5FEMA 2A9VA 3PQ6A 4Q37A 5FKJA 5COAA 5BSUA 2ZBRA 5CB6A 4ZK2A 3CXUA 2JHGA 2ZT8A 3RTCA 2K2QB 2IYYA 3N70A 4NE7A 3I64A 2QQ0A 3PXXA 3ROPA 1IJFA 1BS9A 4W99A 4BN5A 5EJ6A 4ZO4A 4FJ0A 3TWOA 4FMDF 1H9CA 1KZ4A 1LW7A 2Q1SA 4OLFA 5JYDA 2HA4A 3BHNA 3Q6NA 1JG7A 3N39C 2Z2KA 6REQA 1ZEMA 2O8EB 1QCYA 1W30A 3RRFA 3X2EA 2WHPB 5DBEX 3NCHA 4RTJA 1TUBB 1PQPA 2P9JA 2VHVA 2CJYA 2LXNA 3DTNA 3NONA 4DM4A 3D3KA 1H42A 1YB1A 2I3AA 1WCYA 4H6PA 2WTUA 3AFMA 3RIYA 2X9GA 1G4HA 3PDCA 4EG1A 3LUAA 4XB6B 5GZ6A 3FNEA 3I8SA 1UP4A 1EM8B 1RM4A 2X5OA 3AC0A 3NFRA 4PF1A 4QO8A 2VAXA 3CMCO 4NQRA 2X77A 3WWDA 5M04A 4BIMA 2O0HA 1FNDA 2UYHA 1NF8A 3KSAC 1JDJA 2O4CA 2CHEA 4V0SA 1PR9A 3UAXA 1ESEA 2UYGA 2XUJA 2IV7A 3AL2A 5CYPA 4KVZA 3RQIA 1G63A 1SCNE 2BF7A 3ESDA 4BKQA 5EKUA 3G0DA 3I9MA 2ODPA 3MRVA 3H65A 4E5VA 3L49A 5JTUA 4N41A 1JIXA 2Q2OA 2QTWB 3AHCA 4JUAA 3OE5A 2AYYA 4PR3A 2JKZA 1KRWA 3KSDO 2XYRA 3M3HA 5L51A 3M9XA 4YROA 5FL7D 1A4XA 4RD3A 3T6KA 1CQZA 1FFXA 1JNXX 4QNMA 1Q95A 4YIKA 3RYIA 3WGHA 4BFWA 1DOHA 2CVOA 5FADA 4UBOA 1MAUA 2FUEA 1J2TA 2GB4A 4BMZA 5DF1A 3AHJA 2IF2A 2Y1WA 2ZP1A 4DLNA 3L77A 2W6ZA 5C32A 4US1R 3LL4A 1FFDA 1C9JA 5E4JA 4NZYA 4BO7A 2WFLB 1AKVA 3ZQ6A 4G36A 2AUMA 2YQZA 2R7MA 2OB2A 3HCOA 2C0CA 2P7HA 4C7KA 1PJRA 5JFTA 2HO5A 1OCEA 1BTOA 1ZPDA 3VDNB 1FP2A 3MAGA 2O19A 1XJQA 1I4EB 3FFAA 3KT6A 5IM4A 1FW6A 4FX5A 2QSYA 2FSIA 2H31A 4KQCA 4BV8A 1B1CA 3EQZA 4CMAA 3KFXA 5GQSA 2AHRA 2WPDA 4QICA 1SVIA 2EFJA 3I45A 3F3YA 3SE0A 2AG1A 2WI8A 8LDHA 1ISIA 4OQ4A 2W6NA 5K8LA 4JYZA 2H54A 4Q5IA 3N1UA 1MB0A 3EZ9A 1TYBE 3I30X 4YGXB 3E81A 4OHVA 4H2DA 3GFTA 1I13A 1AA9A 1F9EA 2RKWA 4IGIA 3HDYA 2HQSA 1GDDA 1OR8A 2C7GA 4JL5A 4EUFA 4KACA 1E94E 3TGWA 2DPGA 1H6CA 3ZBUA 4C78A 2OPBA 2O59A 1U8AA 4JQZA 4RSRA 5HE9A 2VYNA 3R0VA 1QHEA 4M0KA 3NT2A 1JR6A 3F46A 3OIDA 4YQZA 2Q41A 2G06A 3MTBA 3QKSB 4LJ7A 3RYCA 4ZVTA 2EC5A 2QMUA 1JKXA 1XEAA 1HA3A 3ILSA 1F06A 1V39A 2OCLA 3PC4A 5HDBB 1DS6A 2YWHA 4XIJA 3WWCA 3STWA 2VNKA 4YCCA 4YUWA 1YIAA 3UFXA 2Z4SA 1Z6ZA 3BVPA 4JC4A 5E3IA 5REQA 4PSKA 1RLUA 5KSYA 1XZMA 4X71A 3GJ6A 5ECYA 2RI0A 3L79A 3WGJA 5LMNB 2H4JA 2YFKA 1J5PA 1REQB 3I4LA 3RT1A 4DRYA 4EKIA 4MQFB 2AB0A 4B83A 3OOHA 4XTCS 5CCBA 1EWVA 4WJKB 2HT1A 3UIEA 2A2ZA 4BMSA 2D8MA 3KD2A 4CV1A 1H2WA 3OX3A 2HQOA 4MYCA 3CRMA 3TL6A 4D5EA 2VO1A 2FJ0A 1R8SA 4RTPA 5H81A 3FOAA 4D8UA 2X8JB 3UVEA 5CM9C 1KVUA 2E2WA 2XCIA 3NW9A 5PNTA 5CB4A 1QO0D 4BCBA 5K01A 1ZM7A 1Z5GA 4DRZA 4UNPA 1X92A 2E48A 5FUMA 4A73A 1Z4MA 2O8EA 4BFSA 1K6IA 3BWXA 2ZGVA 3PKJA 3QFRA 1WQ1R 2WHPA 2YV2A 2B94A 1TUBA 1H2XA 2FX2A 1OHHA 4JLBA 4Y2PA 3WIOA 3OPMA 2MCFA 4AY3A 2GZ2A 4OQLA 4OJYA 2QLLA 2XADA 3HA7A 3VKGA 5C35A 3FKSA 1FW8A 2QM8A 4IGEA 1G8HA 3NIWA 4DVGA 1ONNA 1G66A 2P9BA 3U4QB 1CNMA 2I2CA 4MWSA 1FYWA 2C97A 1CT9A 1EM8A 4NAVA 1FFGA 2HF7A 2HSGA 1XFAA 1PR5A 4IJVA 1FFYA 1ENOA 3DC2A 4DB2A 1L0BA 5DISB 1BQ3A 3OIYA 4UPDA 1PJLA 1Q2XA 2EF1A 3JASB 3M8KA 3MCVA 3CX3A 1XVTA 5TX7A 5JAPA 3DLTA 4I50A 3WAKA 2ZUFA 1T4DA 2VDLB 4GO1A 4JC8A 4KLCA 2QR5A 3MOIA 1E3SA 2YXEA 3T1QA 3KNZA 3NX4A 3SYTA 1RC0A 4EG4A 5CA0F 1YVPA 3OZGA 2HNKA 3FOFC 2QTVB 3QBJA 1KO5A 4RZUA 3D5EA 5HQJA 3G7UA 1YOVA 5F1KA 3C8ZA 2JFZA 2WTBA 4URYR 5JZOA 2EIXA 1NYRA 4WBXC 1W29A 1ZS9A 4G9GA 4WACA 3EFOA 2D5CA 4MUIA 2A5JA 2J5BA 3SM9A 2C8KA 3N2ZB 3IPCA 4H7IA 1NYQA 1YJAA 1ISRA 4UTOA 4L0CA 4BQNA 5LP6A 1KFCB 4JI8B 3AW8A 2AW3A 4NARA 4HQLA 4DBLE 3IKMB 4LC0A 2GVNA 1AV6A 4CWAA 3AU8A 3PD0A 1EDOA 4LECA 1XJWA 2VT2A 3PNVA 4WKGA 5KI6A 3TPCA 4BN0A 4W5HA 2MYNA 1SQSA 2AR7A 2IT1A 4KNWA 4MPJA 3Q9SA 1YRHA 2WYOA 4PWZA 4B84A 4HWSA 4RS4A 3VTZA 2FZ5A 1BVYF 2Q5JA 3WE7A 5H70A 2HJ9A 1Z34A 1KVSA 3IP7A 1J23A 1ESNA 3OE1A 4PCVA 1KDYA 4LZPA 2JIRA 3WV4A 5IHPA 2AWNA 2QAGC 2PX2A 4HEJA 3DLPX 3RG8A 3ROXA 4F5DA 1ZIDA 3EW9A 2RBKA 1RFLA 1AKQA 4BO0A 3V4VB 1X7HA 5ICCA 4MKXA 4QUHA 4MVJF 2C4KA 4EUSA 5IASA 3R3JA 2QBYB 4M37A 4Z4QA 1VLMA 2ZR9A 1CR2A 1K0UA 2E18A 2GM9A 2QW0X 4JCCA 5EA2A 5FBZA 3QKSA 4AZTA 4RJJA 1R0YA 4NBWA 3QNMA 1N9KA 4OJQA 1L5NA 1P2DA 4BKRA 4E09A 2ZZNA 3PXEA 3N5CA 3Q6IA 2DERA 2X5NA 2ZPAA 1ZMOA 1N3BA 1WD7A 4OV6B 3SY8A 3TAUA 5KYWB 3GG2A 1INLA 4ZCPA 5C5DA 3E3MA 3JZIA 4LQ4A 2NACA 1MD9A 2G4LA 1XTQA 4Z51A 4B4KA 3SHVA 2VZEA 3IEXA 3L6RA 2DUNA 4OAQA 2JGJA 2Z1DA 3KXKA 3WLKX 4LNHA 5E8RA 1NUHA 1REQA 1WX1A 1PL8A 5CVTA 4V0OA 3KO8A 3L8ZA 2W93A 3KTDA 1RWWA 4YAEA 4YY3B 5LQMA 1B2RA 3SF0A 2F8MA 2X3UA 4OBXA 3DMYA 4YJ3F 3FBWA 2AEFA 1XDBA 3HCEA 3WYBA 4X20A 3MTIA 1DFHA 1XSEA 2Q4DA 2P5TB 3MELA 4JS0A 1KP9A 4LJSA 2HCJB 1NBWB 4OH7A 4C7XA 1OXSC 4HLUA 1C9DB 1CR0A 1XQVA 4EFNA 5KSOA 5L40A 3P32A 2SICE 3KJXA 1MRNA 5LQUA 4JJEA 4EUEA 4Z6KA 1FTNA 4LQLA 1MT3A 4NCIA 5KJCA 3R8FA 4F85A 3ZS8A 2RMKA 3WQQA 5MF6A 2IOYA 3TUJC 4OD0A 4TZ0A 1MB3A 2PL1A 5KC8A 2RAPA 3ZHVA 1MV5A 3NTVA 2WTEA 4L50A 5GM2A 2MWMA 1C30B 2ONJA 3NWBA 1WY7A 5JOQA 1TFUA 3A6ZA 1FDOA 4G25A 4I55B 2GJKA 5JVDB 3RTGA 4CXMA 1JDNA 2QAJA 3D9QX 4R41A 5CLHA 3HKCB 3HPQA 4HSEA 5D8DA 3P0HA 1PT5A 3IKJA 3U5TA 1E5TA 1TKRA 3DM5A 4ZIRA 1D07A 1LWNA 3C87A 3PSAA 3U4QA 3ZUPA 4BGDA 3LBAA 1L7DA 2GCOB 3SYLA 4MKRA 1NPTO 5K3OA 1VCHA 1ACMA 2GMWA 3GFOA 4CLOB 4DQDA 5KPDA 1P9WA 3C5VA 3ZTTA 1WPQA 4OHOA 4X94A 1T3SA 3BXFA 2V4UA 4OX9B 2BCJQ 2I33A 4H15A 3JASA 3DA8A 4NBTA 5U4QA 3ANTA 2JFQA 5F4ZA 4GBMA 5F52A 4UDOA 3MTAA 4UXJA 4OMDA 1QOQB 1Z9BA 4ZWNA 2PA3A 2EW2A 4DSTA 4ZVVA 3O1LA 3FNQA 3KX2A 4JU9A 3ZCPA 2QTVA 3QENA 2V45A 1TEZA 2HWWA 3Q8LA 3LBHA 4HNAA 4IDCA 4P93A 1VL5A 3GXOA 3M1IA 4E07A 3CV3A 2B69A 1N7HA 2VFAA 4L5IA 3TN7A 2W2OA 1GTL1 4ETIA 1LLUA 421PA 3L43A 3NHAA 3GRRA 4BAGA 1KY4A 1O0SA 5D3QA 2GPBA 3I9NA 3H05A 2FDRA 3BILA 2EYUA 4P3XA 4ZO9A 5D2CA 4PWYA 2GM3A 4Z0PA 4MYTA 3WK7A 1SOVA 2A9PA 4QZVA 1PWEA 1B93A 3JVUA 1RQPA 2FPKA 4UOEA 1Y5LA 4Z9BA 5LUAA 4E5KA 3F9RA 2BC9A 4RZ3A 4C7VA 5KX5A 2VDPB 5KNDA 3QJ5A 2J5QA 2GK6A 1B1AA 1OZGA 2IXBA 2QUHA 3CG0A 2J85A 4RVFA 5DPMA 4X64B 4YJFB 3HB0A 2JAPA 1ISGA 4FX2A 4G5OA 3HXLA 4H16A 4UHFA 1H2AS 1RWPA 4MEBA 2APJA 3WWOA 3AIIA 4U9HS 3U0BA 4URUR 4W7HA 1YA8A 4I46A 3WWZA 4HNUA 4RMIA 2BUCA 2H2GA 1H2BA 1SCIA 1SEVA 2NT4A 5EP3A 5DTJA 1HTWA 1SN7A 4V3BA 5FAKA 4BMOB 2VHQA 4HNGA 3UUFA 3T9DA 4DDKA 2QBYA 1YDFA 2XITA 2FRDC 2R00A 2ZAIA 3BGOS 3OOYA 1D0IA 2A1UA 1DEXA 4JYBA 4W9MC 1I9GA 5E2BA 1IJKA 1KVRA 2X7JA 1E1RD 4TSFA 3UYLA 5EIOA 4YV7A 2GARA 3DDWA 5I9NA 3C2QA 2PRYA 3ZGVA 5KYWA 1ZOIA 4LN1A 4C4YA 1XCPA 5SYNA 4DCNA 4GDMA 4NYIR 1B76A 2FETA 3PX7A 4E33A 4RJTA 3U2QA 1Y7HA 3CRRA 4FEEA 5H1YA 3CT6A 1PEKE 1YS2X 1AQJA 1L8QA 2Q5LA 4HDQB 4MR8A 4X91A 4F4FA 3ZJVA 2ST1A 3IH5A 2H63A 3A1NA 3Q98A 4JBGA 1QK4A 2G08A 5GY7A 4YVFA 5G1OA 1ZNYA 3CUVA 1H2YA 1H8EA 3EUWA 3MWGA 4MGKR 3H84A 4UAUA 5DYNA 3T41A 4C3ZA 2C3YA 2GN2A 1T9CA 3JAWB 2JFWA 3ANSA 3LWBA 4EFLA 2FX3A 3GFQA 4NVRA 2QIOA 1Z2PX 3FDIA 1T1RA 1JKJA 3AILA 3GRFA 4XJVA 4B40A 1OLUA 3T5GA 1LF5A 4X93A 1EJ6A 2ETXA 2D2FA 4MA5A 3AKDA 4R2IA 4A2QA 4UC0A 1L7QA 3NNNA 2GDJA 5HIAA 4I5EA 4JIMA 4G1CA 3I1FA 3E82A 2YWEA 3UT6A 2W2QA 3FTQA 1SC6A 1FJGB 1M83A 2O5RA 2B20A 3MMZA 1SQFA 2QVXX 4G4SO 4ZAGA 1K6MA 4DCSA 4DILA 4YWHA 2R7AA 5JVDA 2CBXA 2IEBA 3GZNB 3ESQA 1WPXA 1N7IA 1F8FA 4H4CA 4HNRA 4DMMA 3HKCA 4BJ6A 3TXYA 1QTQA 4P0TA 3DE5X 1T2UA 1AY0A 1MFZA 1XLWA 1EM6A 2FKAA 3NAZA 1YQGA 2TMKA 4QO7A 1FDVA 3CVOA 1I7LA 1AUVA 3JYQA 4MNTA 4F5EA 4GSKA 2MSLA 3KPUA 2GCOA 4EX6A 3CZCA 3PE4A 5AJZA 5EXPA 3TDMA 2VDNB 3WRXA 1LW6E 1Y3CE 5EWMA 1DC8A 2WOOA 3IR7A 2YCLA 4EYQA 4MWTA 4TMFA 3G2OA 3K9WA 2YY6A 3WIEA 2GAJA 4QQKA 1RJDA 2CLDX 3E8SA 3HCCA 3H97A 4HUQA 4A0HA 4F46A 2GEVA 3OJLA 4NZNA 5SICE 3B7GA 1WU7A 4IKPA 4TTIA 3PTZA 5CP8A 1V7ZA 3O31A 5CNIA 4WASA 3RIMA 1E2QA 4MUKA 4QD3A 1NW8A 2NVUA 4QUGA 3TTYA 4YMUA 1UKAA 4H17A 1HE3A 1L7VC 2JBAA 3O9ZA 3EZFA 5JNLA 1JEEA 5D6OA 3QXJA 4RF5A 4DBZA 1A2OA 4M99A 3VR3D 3OQHA 4OUKX 5JH7A 2P27A 5EE0A 1EZ1A 3CUWA 3B52X 3HABA 2X7XA 2CSUA 1Q16A 2I67A 4PHHA 1A88A 2A5YB 5J5VA 2MDTA 3SZOA 4A0RA 4DVJA 4O4HF 4PAGA 1TI7A 5JJLA 1GEEA 1U2GC 4MMZB 1UBSB 4CE6A 3T3NA 4INJA 4QARA 1Z35A 5CX1A 4HH3C 2GN0A 1GUFA 3MD9A 3OKFA 4B8YA 2SKDA 2XUOA 2DQ4A 2IYVA 3MTJA 1RPAA 2W2LA 3IIMA 4J90A 3LG2A 4O3FA 5FI5A 4ZD6A 5GONB 1DL5A 3HCDA 1A5AB 1P7WA 2ZDHA 4RIFA 1C1XB 2ZTVA 2ANCA 3QWIA 3RG2A 5C37A 3B85A 4J43A 3X1YA 4BNHA 1VZ2A 3PGKA 2NWQA 3D8NA 4JELA 5ITWA 1NW3A 2HLPA 3HDJA 4Z49A 3L7KA 1O96B 4IH1A 4NEGA 5AJXA 2ZRJA 1G2QA 1DQPA 2WD7A 3COJA 3ZK7A 3Q3JB 4K9PA 1ILEA 2YJTD 1FOEB 1UBEA 3ISJA 5U1PA 4J0QA 3UOAB 1KZHA 2Z57A 3ED1A 4O02B 4RPKA 4MB0A 5EE3A 4XZ3A 3DEKA 3HE3A 1EXDA 4PN7A 3EG9A 3P0FA 4RAQA 2R6GA 5EXTA 5JCXA 3KETA 3CVJA 3IMEA 2H08A 4ZQHA 1GL6A 1RWNA 3ZVRA 5ER6A 4CL0A 1UPUA 5CEJA 3G6KA 3GLIB 1DNPA 1UJ5A 2MSDB 5HCNA 3U4AA 4KAAA 2C2OA 4FYXA 1D1SA 2UDPA 3HBAA 2H29A 5FYDA 1SVOA 1VA4A 3EZ6A 1GN8A 2F9LA 2OMKA 3H1EA 3I9OA 4NV0A 5K8VA 4D4IA 1I7SB 2BYTA 3TZ6A 1JIJA 4PU0A 1I2ZA 1AQNA 1GTJ1 2EX4A 1KDZA 5KO2A 4PRKA 5JSUA 4FOOA 4PC1A 3VH4A 1TJNA 1QKKA 1JWBB 1PJ3A 3A6LA 3F5MA 3L8YA 2FHSA 4J0FA 4RIIA 1DSSG 5DK4A 1KQOA 1T6XA 2AK2A 4KSBA 3DQPA 4C07A 4J3JA 1L8XA 3ND8A 5DBFA 5TT0A 3WAGA 3TKAA 1JE1A 2C99A 3VOTA 2LNDA 4BNTA 4WOKA 4DV0B 5DMHA 1FQKA 1N1GA 1BOFA 2J41A 3H5RA 3OWXA 2FUG6 3IL2A 3JAWA 5C3UA 5KDDA 4X95A 1RBMA 2QUZA 2IBMA 3N8HA 3UV3A 1P1IA 1EGAA 4J03A 2JIOA 4Y6RA 4F7WA 1ABFA 4KHPB 1DHRA 1GGVA 1P62B 2A5LA 2ZBQA 5KTKA 1IN6A 1IZ7A 2EKQA 4L0MA 4QQNA 1TZBA 1G8SA 1B0UA 1YBFA 1HT0A 4YDQA 2AZTA 1UQRA 2X0IA 1XTPA 5JCPA 2VHYA 4O1IA 1C2YA 4LNUA 4OCZA 4RYLA 1KL7A 3DZJA 2Q5QA 4F4JA 3S2SA 4AKGA 5JHGB 3DCYA 4RHEA 4HDRB 1N4AA 4C03A 2FK8A 3OEWA 1L4UA 1W8DA 4GM1A 5ES3A 2DUUA 1TT7A 1COWD 3ZQKA 5A5FA 1EHCA 2D13A 5INTA 1MAHA 1CEYA 1KVQA 1U9JA 3GDHA 4Y0VA 5E1MA 1K9SA 2K7ZA 4OXNA 1E7QA 3KOUA 4A23A 3FWZA 5FP0A 3FOEC 3UMVA 2FG7C 4ZZ2A 3TNFA 4ANFA 4R1LA 3V97A 3E1KA 1I24A 2C4MA 3N86A 4BV9A 2YMPA 4JB0A 3SDZA 1D9ZA 1U7PA 2R25B 2TYSB 2UVQA 4ZRDA 2IP1A 4YRTA 4A6PA 3PDWA 5A9SA 5K45A 4Y9SA 4I8DA 2H11A 4KCGA 1R37A 1YA6A 1Q7CA 4Q9HA 5T3YA 1OAOA 2GVDC 1H4QA 4JVMA 4LSMA 3NM5A 5FBWB 4GWKA 3IR6A 3OETA 3ZU4A 5BVGB 2QPAA 1C3VA 4NCAA 1P0PA 2COKA 5LIPA 3WSTA 4D3ZA 1J8YF 3GIDA 1JU9A 3ZXSA 1WTCA 3BDAA 2AXQA 1EDDA 2ORYA 1B43A 2PNFA 3HVHA 4P8RA 3OTQA 1MNQA 5AJYA 5IJXA 1K66A 2GWHA 2VP2A 1JQDA 1GNSA 3OZTA 4HWOA 3I5MA 2Q2WA 5JBQA 3GXBA 5LSAA 1JHQA 1X1CA 1W73A 2BMVA 3KYCA 3L92A 4M7PA 3TH5A 1EVJA 3CLSC 4L28A 1QFSA 4EHNA 3T9FA 1K4MA 2LIVA 5AKEA 3AB7A 1C1XA 1GZVA 1MPTA 3LRPA 3OKCA 1MW9X 1CB0A 4IH9A 4TTVA 4PBTA 5KOYA 4EG8A 3L46A 2W6OA 4MA0A 4DR2B 2YOGA 2CDRA 3E9EA 2EHDA 2H9AA 3L4BC 3QPAA 2OYRA 3B1VA 4GMXA 1EFHA 2Y05A 1TIPA 5E0KB 3T95A 3KG2A 5DEIA 4NR0A 2UZ0A 3UK7A 5DVZA 2B34A 3WIDA 2CJXA 5AXBA 1NI3A 1MHPA 3GLKA 1TW2A 4QA9A 2PD6A 1DGQA 2LGJA 3ZX5A 1T4CB 4DG8A 2WWYA 2D1RA 2IYSA 3PC3A 3L02A 4N9QA 4ETWA 5KTSA 2QN9A 1V47A 1MGPA 2IUEA 5LZ5A 2O8DB 2RONA 3TB6A 1IN8A 3L6OO 1P1JA 1I3MA 2FGJA 2HQ1A 2KW5A 4ZI2A 5GTDA 1ZO8A 3E7FA 1VSVA 1RWOA 4AG3A 3JQGB 2BLNA 4BX2A 4EF4A 2K7FA 3U60B 1YB7A 1NC3A 1UINA 4I08A 2IVZA 1OVMA 3L8EA 1N0VC 1OFGA 3AESA 1TCCA 3D2BA 3IT3A 2HJSA 1XWWA 4ZYYA 4UCXA 4IJ6A 2OV6A 3G85A 1JT2A 4PHCA 3D8TA 2AMVA 3DHWC 3PA8A 1ZBDA 1VIYA 3C43A 3HLKA 3LP5A 5E2AA 3S6JA 1AHIA 1CHDA 1RPNA 2CD7A 2EWMA 3QUAA 4QTZA 5AW0A 5EEGA 4QJ3A 3GGGA 5FO0A 1YR3A 1KI8A 2QP3A 2FDCA 1FY2A 1YB2A 3P94A 5L7WA 1FYFA 1GWNA 1TK3A 2LD4A 1E4EB 1GU0A 1W36D 3GBVA 1Z4JA 2JF0A 4AO7A 1MJGA 3IHLA 1SIWA 1J7JA 2P2LA 4IYJA 1XK7A 4YRCA 4B3IA 2P69A 1BVHA 1D1PA 1G7CA 4P5EA 3RSCA 3IPRA 1BWRA 1DWPA 1BGWA 1ZIXA 1K3TA 4EJ6A 1TAHA 2WKPA 2FPPB 3GFVA 1NZFA 4BLUA 4JP5A 4ZQEA 1O5OA 4PLCA 2CK3D 3USCS 2C61A 3K9QO 1W44A 1YS6A 1TEXA 2IEAA 4DARA 1PVOA 4DLWA 4HDRA 3KZOA 1ANKA 5EY5B 3TJRA 5FTKA 2Q1TA 2VBCA 4P84A 1JAHA 2I9PA 3GDFA 3OKAA 2BEWB 5LXTF 4B32A 4MGHA 1O0CA 1XXHB 4J75A 2QVLA 4Z4HA 3L7DA 1KIMA 1Q92A 1ZCZA 2ZJAA 4N5HX 1YZYA 3RJZA 3U9TA 1ACJA 1PT6A 3BH6A 4INZA 4CI0B 2IEZA 3C7KA 2UXDB 1T35A 3NC1C 1P44A 2VDRB 2G0NA 2I6UA 2CT8A 2PZEA 3KT0A 2P40A 5JAUA 4U63A 4OHYA 1CS0A 3PFNA 4K3VA 4N5DA 3UPDA 3BCHA 4ZOQI 1E59A 3I01M 4P22A 3V8QA 4FXOA 5HZMA 3BS4A 3ENVA 1KGDA 2AD1A 1P39A 4PS1A 4H4DA 1I0LA 3TOCA 3BK1A 1O3YA 2OCXA 5CVJA 4AS2A 4W5OA 4DV1B 5FOSA 4JYAB 1SG9A 1EZ4A 3QE9Y 1VCOA 3M4ZA 5BVGA 3FNIA 1Z25A 3QH4A 1N2HA 4BLRA 3WMFA 1ZJYA 1C7RA 2Y92A 1HETA 3VR4H 2I5PO 4GP9A 3F7TA 4WBSA 1TVCA 1Y81A 4HC4A 5B58C 3GRKA 2RHMA 2NZUG 2NXWA 3IEMA 1BXKA 2RG1A 3EODA 5FF9A 5AXDA 1T9GS 4U5XA 1KQNA 1GPBA 1NJ2A 1TNDA 3JR7A 1RJ9A 4EW1A 4LYDA 5DT9A 1D6JA 2IUFA 4QODA 1UDRA 1RI1A 3GEEA 4JYCA 3ZCSA 1EBBA 1ZGAA 1Z8FA 3SXPA 5ERGB 5FEUA 2XB6A 4EHIA 1OI7A 1LNQA 2JJ1A 1YZNA 1G19A 5FUBA 3T1VA 1F0NA 3OT5A 4G4SP 4FBGA 4BBZA 3D31A 3PJRA 2XDQA 3OQ1A 4BB0A 5C1OA 1KOGA 1QX4A 5TQ0B 4PEVA 3BGIA 1E5VA 2AJCA 2QY6A 3TLJA 2QSUA 2MOKA 1A8IA 1PV4A 1FU7A 1FQOA 2WW8A 5FOTA 2H1IA 4HLQB 4QULA 2BGWA 4HX5A 2G9UA 2XUGA 5FPQA 1T4CA 3OIWA 1ZHFA 3QF4A 2PJZA 2ON6A 1SCBA 3F1KA 2J48A 2V1XA 3QITA 2GASA 4PSUA 4YRRA 2W5UA 3W5SA 5I9IA 4NYJQ 3NBXX 1NJSA 3F6SA 3KKNA 2NQ2C 3MAJA 5AICA 2W0MA 1HLDA 1YZVA 3L0PA 2QP4A 2R8ZA 1MBZA 2EW8A 2QW8A 1I2MA 3DMGA 1KOFA 2GFHA 4KAFA 4KXWA 4X9XA 3JQGA 4XIGS 4Y8VA 3K9CA 4RLQA 1OXMA 3P4UA 4BV3A 2JI7A 2ZI3A 3CWZA 4YCMA 3OLQA 1XA0A 1KFKB 1WUKS 3WP1B 5AW4A 5DGTA 1KEZA 2OV8A 3INNA 4Z9FA 5BN5B 3SC3A 3WYAA 1YS7A 1F7VA 5IAGA 4EPYA 2AOTB 4G09A 2JCGA 4IVPA 2MYTA 2P9TA 2CF5A 2C8LA 1O94C 2VP4A 4MUEA 4Q4LA 3D5TA 3HQ4O 4QPNA 3WJ2A 5IULC 3NH9A 3L0DA 2H0AA 1N8SA 2JAWA 1XTBA 1E6KA 2C2HA 5D1NA 1HORA 3HN7A 1KY5A 1SU8A 2GZMA 3DDUA 1GP2A 2C8VA 1V7QA 1K7XB 1MX1A 1T8WA 2PAAA 3A25A 5EJ9A 2RHGB 1A8PA 2B6HA 5TGZA 2ZVQX 3L2OB 1ZH8A 4H31A 3RUDA 3N7TA 5JMOA 1FA9A 2NLOA 1ARZA 3TQQA 5A1JA 5L45A 1BMFA 1E4EA 1TCBA 3Q7RA 4JR1A 4KPUB 4P38A 4TL9A 3R7BA 3RK0A 4AJEA 3T5AA 1NP6A 1YZ3A 4JR0A 1OILA 4BNDB 2GZAA 1J2RA 3V1TC 3FUUA 4Y2SA 1E4OA 4XPIB 4KR9A 1TX4B 4JZYA 1WHTB 3IA7A 5G41A 5ARBA 2W8ZA 1E3WB 4FN4A 1DG1G 4MVJD 1WXFA 1VPVA 4EEZA 3CO0S 3EVZA 4B2YA 4PSVA 3HGQA 3HY3A 5HIMA 2XTMA 4C3VA 2VHZA 5I48A 1E7SA 4JD5A 1TJPB 3GY0A 3GPIA 1T8RA 2B4AA 4UHKA 2Q45A 1E2LA 1KYYA 4D0RA 3D2LA 1SR8A 1CVRA 4HBZA 1Z33A 1NP7A 2EX1A 2IEIA 4GYYA 3JTMA 4AN0A 4L72A 4PRLA 3ZWDA 4L4ZA 1XXHA 3FZEA 3UEOA 1QBKC 1W96A 5FTWA 1NXWA 3N07A 4N39A 2NO5A 3S40A 3PPWA 3W77A 4GMFA 4KXNA 4HDNB 1QCZA 4BO9A 3O75A 2GCGA 1PJSA 3KEGA 3PS9A 2HJRA 5EPEA 2YRXA 2G9NA 1UK7A 1YOBA 1ZHHA 4IOLA 2UXCB 4K86A 1OYYA 1HG0A 1HG1A 4CKYA 4DY4A 4JASB 1X7YB 2X2EA 5IKOA 2R00C 2ISQA 1U4NA 1FSSA 3SQNA 7ABPA 2PY6A 2VSQA 4DQKA 3OAAA 3C6MA 4JLOA 1WB6A 4J1QA 2JLYA 1DAMA 1ODJA 1SG6A 5EWLA 4RMNA 1E1CB 3IAAA 4IICA 3RC7A 2D3WA 1NNLA 1RHKA 1JG6A 4C4ZA 1PTJC 4L3VA 1IWBB 3EAQA 3ONFA 4KLRA 1MC5A 3C97A 3UO8B 2I6FA 4JP2A 4NV3A 5G0VA 3W8RA 1DJPA 3UMYA 4TQUS 2QA5A 2GPTA 2LVBA 2K6GA 2XUDA 3EPKA 4ZV4A 1UDXA 1SQ6A 1FSGA 1SPXA 3TAHA 1JYSA 2CL7X 3H0CA 4FP9A 4WCDA 1D5WA 2YQ5A 3JQ7A 3TIXB 1LFDB 2FQQA 4GUAA 5L4SA 1TAGA 3SNKA 3ONVA 4WRRA 2VUHB 3KBBA 3VTKA 1Z4OA 3IE2A 1FDUA 1GQFA 3Q8XB 1TQHA 3CONA 2WU8A 3SZMA 1J1ZA 4BLQA 4EW6A 1CZNA 1PJ8A 5EWJB 1NXQA 2X5KO 5BNWA 5B6PA 1C0KA 2Z5GA 1XYGA 4WLOA 2HL6A 3ZH9B 5C8YB 1LPBB 4UEKA 1KNXA 1GCAA 1RHJA 1UZLA 2R66A 3MUNA 3WGYA 3DE7X 1UAGA 4LC9A 1BN6A 1LD3A 1P0CA 5E7MA 4QJIA 4OEHA 5TQ0A 4Z53A 1QK3A 3MGKA 1RXWA 2QTMA 1SXPA 1WIWA 1PJBA 3S27A 5EG5A 2C82A 2WFAA 3RE1A 2JFFA 1A9PA 2AC7A 4DJFC 1J22A 4GECA 3X1DA 1Z68A 3VKWA 5DTEA 5L53A 3U3RA 4ILEA 4M1KA 1IL0A 1T3TA 3GJ5A 4MP6A 4DIKA 5IJ0B 1U6IA 4F06A 2O7QA 3BSYA 4R2LA 4KPYA 4OUDB 1O6BA 2G4CA 5KOIA 3WLOA 5K3AA 1V5EA 3RM3A 4EPXA 1FTSA 1BH2A 2Q3HA 4B4VA 4D97A 1YDMA 1GZDA 4NECA 3LKBA 3OFJA 4O2RA 4Q1VA 5AKZA 3ZGNA 4BMPB 2CLCX 2C42A 3VU3A 1H2FA 5AQ1A 4HNHA 3ZE2B 5DN6D 3HJAA 1W35A 4GPZA 1WWKA 4AVYA 1ZINA 2X15A 1BDJA 2PMBA 2V0CA 4MPDA 2PLFA 3AR9A 4JBHA 4WCVA 3RSSA 1QU3A 1SXIA 2PZKA 3E9NA 3LVRE 4GICA 4GVLA 2R1VB 2QD3A 5CMLA 1G8AA 2Z3WA 1PTKA 2UKDA 1CRLA 2NZVG 3B6EA 4II2A 3ABZA 5E8JA 4NONA 3L05A 3UAOA 3D4PA 5HGJA 2EZ9A 1ZVQA 2BJWA 3UB4A 2XNJA 4IILA 1BROA 1CUUA 4KPUA 1FTQA 2FDXA 5C4IA 3GAZA 3FTDA 3ZIAA 1SC9A 1B0AA 1VPEA 4OU4A 4YDSA 2WNIA 2P9YA 2OZKA 3NXSA 3QKTA 3TW4A 4D9BA 3LXXA 4O2AA 5KTTA 4D0GA 5IWCA 2I4LA 3SHWA 1VE9A 1RXIA 1E3WA 1RM3A 1V8OA 4P2GA 4RZHA 1QWSA 2VOEA 1B8VA 3HEMA 5HIKA 4HYQA 1A71A 3EC2A 1J06A 3O4HA 1KYWA 1UADA 4ZU3A 2AZXA 2WA2A 3AF0A 3E5HA 1LSOA 1OZAA 1QTRA 2ZJZA 3DZCA 4GZMA 2V8BA 4OM7A 3VRHA 3SSOA 4C20A 4YUYA 3M6WA 2ZIUB 3BH7A 3IJEB 4EYEA 1Q1ZA 2GK4A 1GLGA 3D7LA 3N74A 3VR0A 3M3PA 3OQNA 3V00A 5K51A 1ENYA 5DLPA 4HDNA 1FRNA 1Y98A 3D3JA 5JE8A 1CY2A 5D3MB 2O4UX 3C1OA 4QBKA 5CTAA 1FB5A 1KZ7B 4HQFA 3QVKA 3ZIDA 1SHJA 2XE4A 4KK3A 5ERYA 5JMTA 3J80A 1NBMA 4RKRA 1V37A 3PRHA 4L8VA 1SVUA 1UWCA 2O2CA 2Z2ZA 2FSUA 3DJFA 3FF1A 3C3EA 4FD3A 4B33A 1ATIA 3THRA 4DT1A 5JR3A 3BK2A 1FMTA 1E1CA 1HDZA 1TU4A 1KVTA 2J5RA 4QGBA 3TKYA 3KPYA 2QRVB 1DX4A 3Q9NA 3KK0A 3BTUA 4WE3A 4NMHA 3U3KA 3UICA 4TKMA 4AZ0A 1WY5A 4CMCA 4EPRA 5CLFA 1JB1A 2WHXA 1PZEA 5A9TA 4FT2A 1KEEB 2XIQA 2ZIVB 1HBJA 1FU8A 2B92A 4UU8A 3CINA 3PNYA 3VSCA 3LIPA 4BBPA 2RAUA 1NLZA 3BIXA 1PR0A 2C29D 4YRZA 2V6MA 2Y77A 3HU1A 3DAGA 3F3MA 3M6LA 1SXJA 2A3RA 5AK6A 1JR3D 3CLUC 3UMSA 1TD1A 2K2WA 3GLFB 3F71A 3FNFA 2CMHA 3KWMA 4R68A 1SQ5A 3E8XA 2XEDA 4MW0A 2ZSIA 5EWJA 4KB5A 4CDMA 4JP8A 2O50A 1HNXB 3LUKA 3RD5A 3QX8A 1EB9A 1P2BA 1DBRA 2Q7DA 5AQEA 3FLBA 4MO9A 5ENZA 3EVTA 4HB3A 1HT2E 1M0SA 3P27A 3PD7A 3W7BA 5EHIA 2MR5A 5AKIA 4RWZA 2C88A 2XHEA 3IP9A 4DLYA 1LTKA 2YBEA 4D4LA 3GEGA