4QC6A

Crystal structure of aminoglycoside 6'-acetyltransferase-ie
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
179
structure length
179
Chain Sequence
b'MNIVENEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDEVFRVIIEYNNVPIGYGQIYKMYDELYTDYHYPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLIFEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional AAC/APH
publication title Structure of the bifunctional aminoglycoside-resistance enzyme AAC(6')-Ie-APH(2'')-Ia revealed by crystallographic and small-angle X-ray scattering analysis.
pubmed doi rcsb
source organism Staphylococcus warneri
molecule tags Transferase/antibiotic
total genus 58
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.190: Aminoglycoside 2''-phosphotransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qc6A00
2O28A 5HH1A 2FS5A 1YK3A 1NSLA 3W6SA 5C82A 2GANA 4AG9A 2AJ6A 2FCKA 2RC4A 2D4PA 2ZW4A 1Z4EA 4KZTA 2VXKA 4R57A 3VWEA 4PK2A 3T9YA 1YLEA 1VHSA 3RYOA 2OZGA 2CNTA 4IUSA 5DWNA 2CY2A 5EBVA 2VBQA 3P2HA 2R1IA 1XF8A 3G8WA 2ZPAA 4F0YA 1RO5A 3S6HA 3JUWA 3W91A 4CS0B 4B5OA 4J3GA 5E96A 3EO4A 4R9MA 1M4DA 4KOXA 1XEBA 2P6EA 3EC4A 2PRBA 4CRZB 2C27A 2CNMA 3PP9A 1U6MA 2REEA 5H84A 2R8VA 3DNSA 1Y9KA 2I00A 4XNHC 1Z9UA 4KORA 2EVNA 1Q2YA 4KVME 1WWZA 2JLMA 5KTDA 3E0KA 1WK4A 1ON0A 1MJAA 2OZHA 1NMTA 2WPXA 3DDDA 3I3GA 2FT0A 4MY0A 4QB9A 3ZJ0A 4E0AA 4XNHB 1VKCA 4KUAA 4ORFA 4M3SA 1B6BA 2ATRA 3NE7A 3G3SA 5J8CA 1XMTA 3TTHA 1IIDA 4AB7A 5JQ4A 1MJBA 1YVOA 4AVBA 3B8GA 2OH1A 1KUXA 4JXQA 3R9GA 3TCVA 1QSMA 3F0AA 4LUAA 4U5YA 2FL4A 4QVTA 2BUEA 2REFA 2D4OA 5H86A 1SQHA 3R9EA 4MY3A 1NE9A 4UWJA 3QB8A 3I9SA 3FB3A 4H6UA 1KUVA 1Z4RA 1S3ZA 4XPLA 2ARHA 2ZXVA 4KOVA 4L8AA 4M85A 4R3KA 4U9ZA 3WR7A 3FYNA 3GYAA 4KOSA 1V0CA 2B5GB 1P4NA 4AVCA 4HNYB 3D8PA 2GIVA 4UA3A 1Y7RA 1I21A 1KZFA 3R1KA 4XPKA 1S7NA 2B3UA 3IWGA 2AE6A 2QIRA 2VEZA 1YREA 2HUZA 3PGPA 2BSWA 3LD2A 3FIXA 1S60A 2B5GA 3BLNA 4NEXA 5IX3A 3QAHA 1YX0A 2PR1A 4Y49C 3SXOA 4NSQA 1Q2CA 1YGHA 1M1DA 3D2PA 2JDCA 3FRMA 2FE7A 5CNPA 4NCZA 2G3TA 1CM0A 1P0HA 5I0CA 2EUIA 4FD4A 4KOTA 4Y49B 2BL1A 3S6FA 3GY9A 4E2AA 1QSNA 2PSWA 2GE3A 1S7FA 1I1DA 2K5TA 5DWMA 2HV2A 2HQYA 3LODA 4HKFA 5F46A 1Y9WA 3S6KA 1QSTA 4KOYA 2FIWA 1BO4A 4NXYA 4OADA 5F47A 4KOUA 2PQ8A 4CAVA 3CXQA 4XPDC 4RI1A 1FY7A 4X5KA 4NF1A 2FXFA 3CXSA 2DXQA 3DR6A 2G3AA 4PSWA 2Q7BA 5KTCA 3EY5A 4MI4A 1YR0A 2CNSA 3DSBA 2J8RA 5IB0A 5JPHA 2J8NA 4BMHA 3KKWA 3W6XA 4XPDB 4FD7A 2BEIA 2PC1A 1J4JA 3TO6A 2JDDA 4LX9A 1S5KA 3EXNA 5F49A 4GS4A 5F48A 3V8IA 2Q4YA 2B58A 5KTAA 2NMTA 2B4DB 4R87A 1IYKA 3GKRA 5HMNA 3TO9A 3TFYA 3CXPA 4UWIA 3TO7A 2PR8A 2P0WA 4ONUA 4IF5A 4FD6A 4MJ8A 3BJ7A 4CAWA 4EVYA 5EC4A 3BJ8A 2B4DA 4UBRA 4E8OA 2P6FA 3TOAA 3JVNA 4YGOA 1I12A 4H89A 4RS2A 2VZZA 2OU2A 4B5PB 1Q2DA 1CJWA 4YRHA 1QSOA 4KLVA 3UY5A 4PK3A 4F6AA 3FNCA 4ZBGA 1GHEA 5IV0A 3IGRA 4QUSA 3K9UA 4OAEA 2PDOA 1LRZA 2R98A 2H5MA 2Z10A 2QECA 4B5PA 1R57A 3F5BA 1KUYA 1IICA 1RXTA 2FSRA 2Z0ZA 4U9YA 5ISVA 3F8KA 2FIAA 2QMLA 1OZPA 3P2FA 3N7ZA 1B87A 4MBUA 1S7LA 2ZW7A 4KVXA 1M44A 4MHDA 4JXRA 2Z11A 1QSRA 4HNWB 3OWCA 2Q04A 1IYLA 1XE4A 3FBUA 3TOBA 4PSXA 2Q44A 1M4IA 5FVJA 4YFJA 4KOWA 4H6ZA 2ZW5A 4QC6A 4CAXA 3S6GA 3SHPA 4JJXA 2B3VA 1K4JA 1MJ9A 2IL4A 4L89A 3SXNA 4K30A 1MK4A 1UFHA 2Q4VA 1YVKA 1N71A 3D2MA 4QBJA 2WPWA 4R3LA 2KCWA 1PU9A 2Y0MA 2P6GA 3TT2A 2ZW6A 4OLLA 3MGDA 3H4QA 1TIQA 4PV6A 2G0BA 1XIXA 4KVOE 2VQYA 4HNXB 3FXTA 2OZUA 3VWDA 2R7HA 2J8MA 5GCNA 4JD6A 3R9FA 1BOBA 2F5IA 2VZYA 2JEVA 4JLYA 3ZZIA 2B4BA 2Q0YA 2I79A 2X7BA 4KLWA 4FD5A 4II9A 4DNCA 3T90A 3EFAA 1M4GA 4CRYB 2OB0A 3C26A 2A4NA 3R96A 1IB1E 4AVAA 4I49A 4AG7A 3DR8A 3D3SA 1L0CA 4KUBA 2VI7A 1S7KA 3TE4A 1PUAA 3PZJA 5C88A 4JWPA 5J8FA 3R95A
chains in the Genus database with same CATH superfamily
4A39A 2O28A 3BXMA 5HH1A 4C2YA 2FS5A 1AUGA 2GLFA 4CAFA 1YK3A 5J1QA 2JBJA 4NGTA 4KS9A 4AXVA 4KSAA 1NSLA 3W6SA 5C82A 2GANA 3D7GA 4P45A 4OIDA 4AG9A 4B13A 1Z5RA 2AJ6A 2FCKA 1CP7A 2RC4A 2D4PA 2ZW4A 3GIUA 1Z4EA 1LCPA 2PJ3A 2BO9A 2WZNA 2Z3KA 2VXKA 3HLPA 3PFOA 2PJAA 4KZTA 4PK2A 4R57A 1YLEA 3IIBA 3T9YA 5HXDA 5LYIA 1VHSA 3IFEA 3GLJA 4MFLA 3RYOA 2OZGA 1Y7EA 2CNTA 4IUSA 5DWNA 2CY2A 5EBVA 3D4UA 2VBQA 3P2HA 4P6YA 2R1IA 1XF8A 3G8WA 4PXEA 2ZPAA 1TKHA 4F0YA 5LYDA 3SJFA 1RO5A 3PFEA 3S6HA 3JUWA 3W91A 4CS0B 4B5OA 2YNCA 4J3GA 2NYQA 5E96A 1CPSA 4R76A 4UCPA 4K3NA 3EO4A 4R9MA 1TF8A 1YW6A 1M4DA 4KOXA 4C68A 1XEBA 2P6EA 2PE3A 2PIYA 2PRBA 3EC4A 2I3CA 4Q7AA 5AG7A 4CRZB 1ZG8A 2C27A 2CNMA 3FJUA 3PP9A 2PJCA 4FAIA 1U6MA 2REEA 2GLJA 2YNDA 2GREA 3GB0A 4FWUA 4LQ6A 4X2TA 3VARA 4CGMA 5I4MA 5H84A 4FUUA 2R8VA 3IJ3A 2ZEGA 3DNSA 2ZEEA 1Y9KA 2I00A 4A30A 1IGBA 4XNHC 1Z9UA 4RN7A 4KORA 2EVNA 1Q2YA 5A28A 4BINA 4KVME 1YQEA 4B10A 1WWZA 2JLMA 4Q38A 5KTDA 1Z2LA 4IAVA 4CYNA 4H2KA 5F09A 2ZOGA 3E0KA 2ZEHA 1WK4A 3D67A 1ON0A 2IMOA 1MJAA 2OZHA 3DGVA 1NMTA 2WPXA 3DDDA 3S9NA 5D29A 3I3GA 2FT0A 4WJBA 3IO1A 3KHXA 4IK2A 5K8MA 4MY0A 4QB9A 1ZG7A 4BBHA 2AFSA 3ZJ0A 4E0AA 3IEHA 4XNHB 4UEZA 1VKCA 2EK9A 1Z8TA 4KUAA 4MHZA 3PB4X 4ORFA 4M3SA 1QQ9A 4CGNA 4ZX9A 1F2OA 1B6BA 2ATRA 4UIAA 4UF4A 4B12A 3KASA 3NE7A 3G3SA 4MXUA 4NGQA 5J8CA 1CPXA 1XMTA 3TTHA 1IIDA 2ZELA 4AB7A 5JQ4A 1MJBA 4UFXA 1IOIA 4EMEA 1YVOA 2EO8A 2ZEFA 4AVBA 4R6TA 1X10A 1AMPA 3B8GA 2OH1A 1KUXA 3FF3A 3B3CA 4JXQA 5BWAB 1CP6A 3H8EA 3JRUA 4UFWA 3R9GA 3H5ZA 3TCVA 1QSMA 4DUKA 4NGRA 1XRYA 3F0AA 4LUAA 2XEFA 4U5YA 2FL4A 4QVTA 2BUEA 4R8FA 3D7FA 4A33A 2V8GA 5G22A 4ZI6A 2REFA 2D4OA 2HB6A 3CZXA 5H86A 1SQHA 3CT9A 3R9EA 4MY3A 5CBMA 1NE9A 4MMOA 1EE3P 1ELLP 1KWMA 2PJ6A 4UWJA 2EBJA 3QB8A 5K8PA 1ZLHA 3I9SA 3FB3A 4H6UA 1R43A 1KUVA 1LAPA 2QJ8A 3PB6X 4UCNA 2XEJA 3NH4A 1Z4RA 1S3ZA 4P44A 4XPLA 2ARHA 5G21A 3SI2A 4ZY1A 1CX8A 4EWTA 4OC4A 2DPSA 2ZXVA 4A2ZA 4KOVA 4L8AA 4UEFA 3RO0A 2QVPA 4M85A 4R3KA 4OKOA 4U9ZA 3WR7A 5J8FA 2RFHA 1VHEA 4MCPA 4C2ZA 3FYNA 3GYAA 4KOSA 2FVGA 4MCRA 1V0CA 4CYPA 2B5GB 4B14A 6CPAA 1P4NA 2Z3NA 3B3VA 3DLJA 4OP4A 2PJ4A 4AVCA 4HNYB 3D8PA 2GIVA 4UA3A 4PQAA 2C6GA 2PJ5A 3BHXA 3NH5A 4ONWA 4P10A 2PJ1A 1A2ZA 4W9YA 1Y7RA 5K8NA 1I21A 1KZFA 3R1KA 4XPKA 2AFWA 1S7NA 5AGEA 1JWQA 2B3UA 3RZAA 3GUXA 3IWGA 2AE6A 2QIRA 1YREA 2VEZA 2HUZA 3PGPA 4YWYA 2BSWA 1TF9A 3LD2A 3FIXA 2V8VA 4HPSA 1S60A 1Z8XA 4A94A 2B5GA 3BLNA 1Q7LA 4NEXA 5LRKA 4O23A 3S9LA 4UCMA 5IX3A 3QAHA 1YX0A 4GXHA 3NE8A 2PR1A 4Y49C 5JH9A 4MHYA 4NSQA 1Q2CA 3SXOA 1YGHA 2Z3LA 4CGLA 1M1DA 4Q36A 3D2PA 2JDCA 3FRMA 2FE7A 4KSIA 2BCOA 1DE4C 4P4EA 2Z3PA 2OOTA 2Q4ZA 1ARMA 4NCZA 5CNPA 2OR4A 3FH4A 1F57A 2GFQA 3MRUA 3V7ZA 2G3TA 1TXRA 2PJBA 1XJOA 3VH9A 4RUHA 3TX8A 1CM0A 1P0HA 5I0CA 2EUIA 2ODFA 4FD4A 4KOTA 4G1PA 4CAEA 1HDQA 2BL1A 4Y49B 4P4JA 3GY9A 2CTBA 3NFZA 3S6FA 3SJGA 4M6HA 4UIBA 3VWEA 2PCUA 3N5FA 4E2AA 2WSAA 1QSNA 2PSWA 2GE3A 3BI0A 5ELYA 2DEAA 2C1CA 4DJLA 1S7FA 4B6ZA 2C6CA 4CGPA 1I1DA 2K5TA 3IWEA 5DWMA 2HV2A 2HQYA 3LODA 4HKFA 4C7HA 4A37A 5CPAA 5THWA 4PXBA 5F46A 1Y9WA 3ISXA 3S6KA 1QSTA 2GU2A 4KOYA 2FIWA 2PJ7A 1BO4A 4CYQA 1Z8LA 2DPTA 3FEEA 3D7HA 4NXYA 4OADA 4YU9A 5F47A 4KOUA 4JYWA 2PQ8A 4PXDA 4R7MA 4CAVA 3CXQA 4XPDC 4RI1A 3LACA 1FY7A 4X5KA 4NF1A 2FXFA 1YSJA 1XBUA 2DXQA 3CXSA 2G3AA 2CIJA 3DR6A 4DYOA 8CPAA 4PSWA 4X3RA 2IQ6A 3B2YA 3PBBA 4P4DA 2Q7BA 3SI1A 2AFUA 2YGWA 3FMCA 5KTCA 3EY5A 3JTKA 3KQXA 1YR0A 1ELMP 2CNSA 4MI4A 4NJQA 1XOVA 5LRGA 3V38A 1ZG9A 3DSBA 2Q7SA 2J8RA 2PRQA 5IB0A 5JPHA 2J8NA 4BMHA 3KKWA 3W6XA 4B11A 3RNZA 4XPDB 4FD7A 4CYOA 2BEIA 2C6PA 2PC1A 1M4LA 4ZY0A 1LFWA 3LWUA 4JZ0A 1J4JA 1LANA 1UWYA 4F8ZA 3TO6A 2JDDA 2V8HA 3KGQA 2PJ8A 4LX9A 1S5KA 1BLLE 2AFMA 2VL1A 2G9DA 2YNEA 3EXNA 3PB7X 4GS4A 2F7VA 5F49A 5F48A 2Q4YA 2B58A 1ZLIA 3V8IA 5KTAA 2NMTA 2B4DB 4R87A 1XMBA 3PB8X 1IYKA 2V8DA 3GKRA 1YMEA 2ZEOA 4UEEA 5HMNA 2Q51A 3B35A 4MFJA 3TO9A 4A95A 3TFYA 3CXPA 2CF4A 2BOAA 4UWIA 2F8HA 3TO7A 4PPZA 1BAVA 3QNVA 2O4HA 3RBUA 3PB9X 4NJRA 5HVFA 2PR8A 2P0WA 3KR5A 1VGYA 1YLOA 4ONUA 4IF5A 2J9AA 1F2PA 4FD6A 4P4IA 4FBEA 4MJ8A 4NGNA 5HVGA 3BJ7A 5G20A 4CAWA 2ABZA 2AFXA 3WT4A 4EVYA 4F9UA 4ZYQA 2POKA 5EC4A 3BJ8A 3IU2A 1X12A 2B4DA 4UBRA 3H8GA 4X8IA 2P6FA 3TOAA 3CPXA 4E8OA 3JVNA 1DTDA 1IOFA 4YGOA 1I12A 4H89A 4OMEA 2EK8A 4RS2A 2VZZA 4Z65A 2OU2A 4B5PB 1Q2DA 1Y0YA 4P4FA 2ZEMA 1R3NA 3T8WA 1CJWA 2ZOFA 4YRHA 1LAMA 1JQGA 1QSOA 2PJ0A 3NA6A 4KLVA 3UY5A 1XFOA 4TNUA 4PK3A 2WYRA 4KSFA 4F6AA 1FT7A 2CXAA 3FNCA 1RTQA 4ZBGA 1GHEA 4F0XA 5IV0A 1NSAA 3IGRA 4QUSA 5D8NA 1VHOA 2PIZA 3K9UA 4OAEA 4A38A 4CGOA 2PDOA 1LRZA 1TKFA 2R98A 3D7DA 1BPNA 2V77A 2H5MA 3TC8A 2Z10A 5AG4A 2QECA 4B5PA 1R57A 3F5BA 3A9LA 1KUYA 1IICA 3MN8A 1RXTA 4OC2A 1QMUA 4MRIA 5AG5A 2FSRA 4P4BA 2Z0ZA 4U9YA 2DF5A 4ZGYB 2ANPA 3SI0A 5ISVA 3F8KA 2FIAA 4MHNA 4C7IA 2QMLA 1OZPA 2PJ2A 3N7ZA 3P2FA 4BD9A 1B87A 4MBUA 3H8FA 4MFZA 3KI9A 1BPMA 1S7LA 2ZEPA 2ZW7A 4KVXA 1M44A 4MHDA 4JXRA 2Z11A 5JGFA 1QSRA 3IC1A 4HNWB 4MFKA 3FX6A 1PYTB 4LQGA 3OWCA 2Q04A 5HVHA 1IYLA 1XE4A 2CTCA 3FBUA 1YW4A 3HUVA 4MFPA 4PSXA 3TOBA 1ZO0A 2Q44A 2PVVA 4A31A 1M4IA 5FVJA 5K8OA 4MCSA 2NSMA 4GM5A 4YFJA 5A27A 4KOWA 4H6ZA 2ZW5A 3WC7A 4QC6A 1CBXA 4CAXA 3S6GA 3FEDA 4NGMA 1OBRA 3SHPA 3B3SA 4TWEA 1LOKA 5LYLA 4JJXA 3VATA 3PEIA 4F9VA 2B3VA 3KR4A 3KHZA 3S9MA 1K4JA 1MJ9A 4OC5A 1CG2A 2IL4A 3QAYA 4IHMA 2AFOA 4L89A 3WABA 1HEEA 2RB7A 3CDXA 3K9TA 1PCAA 3SXNA 1AYEA 1IU8A 3L2NA 1IY7A 3KQZA 4OC0A 3FVLA 1MK4A 4K30A 4C2XA 1UFHA 3WC6A 4EFDA 2Z3OA 2PJ9A 4UFVA 2Q4VA 1YVKA 4MCQA 3D66A 1N71A 2WUUA 3D2MA 4NFRA 2XEGA 4QBJA 1GYTA 2WPWA 2IJZA 4R3LA 5G1ZA 4NGPA 2KCWA 1PU9A 2Y0MA 2P6GA 3TT2A 2JEWA 5LYFA 2ZW6A 4WWVA 2JBKA 3MGDA 4OLLA 4M6GA 3FECA 3H4QA 1TIQA 4PV6A 1H8LA 2G0BA 5AG6A 4ZX8A 1XIXA 3K2KA 4MFQA 2VQYA 3FXTA 2OZUA 1FNOA 3KL9A 4HNXB 2R7HA 4KVOE 3SJEA 3VWDA 2J8MA 1HDUA 5GCNA 4JD6A 2HC9A 3R9FA 2XEIA 4ZY2A 1BOBA 2F5IA 2VZYA 2AFZA 3IU1A 3IWWA 2JEVA 4JLYA 5DS0A 3ZZIA 2B4BA 2Q0YA 2ZENA 3BI1A 3CPAA 2I79A 3B7IA 5IB9A 4M6IA 2X7BA 3KZWA 2ZEDA 4FD5A 4KLWA 4DNCA 4II9A 3T90A 7CPAA 2O53A 3EFAA 5EMIA 5JM6A 1M4GA 4CRYB 1Z8WA 2OB0A 3D68A 3ISZA 3C26A 2A4NA 3R96A 1IB1E 3B3WA 3WC5A 4AVAA 3NH8A 4I49A 4A32A 4AG7A 2YNCC 3DR8A 4OC1A 3D3SA 1L0CA 4NGSA 4MHPA 3PRTA 4KUBA 2VI7A 3B3TA 3LMSA 4CPAA 1ARLA 2EWBA 3PBEA 3RAMA 3SJXA 1S7KA 2QYVA 5LRJA 3TE4A 1Y0RA 4PXCA 1PUAA 2PVWA 1TKJA 3PZJA 4JWPA 4OIWA 5C88A 4OC3A 2Z3MA 3I1UA 3R95A 1VIXA 2Q43A
chains in the Genus database with same CATH topology
2O28A 4C2YA 5HH1A 2FS5A 4CAFA 1YK3A 4KS9A 4KSAA 1NSLA 3W6SA 5C82A 2GANA 4AG9A 4B13A 2AJ6A 2FCKA 2RC4A 2D4PA 2ZW4A 1Z4EA 2Z3KA 4KZTA 2VXKA 4R57A 3VWEA 4PK2A 3T9YA 1YLEA 1VHSA 3RYOA 4MFLA 2OZGA 2CNTA 4IUSA 5DWNA 2CY2A 5EBVA 2VBQA 3P2HA 2R1IA 1XF8A 3G8WA 2ZPAA 4F0YA 1RO5A 3S6HA 3JUWA 3W91A 4CS0B 4B5OA 2YNCA 4J3GA 5E96A 4UCPA 3EO4A 4R9MA 4C68A 1M4DA 4KOXA 1XEBA 2P6EA 3EC4A 2PRBA 5AG7A 4CRZB 2C27A 2CNMA 3PP9A 1U6MA 2REEA 2YNDA 4CGMA 5H84A 2R8VA 3DNSA 1Y9KA 2I00A 4A30A 4XNHC 1Z9UA 4KORA 2EVNA 1Q2YA 5A28A 4KVME 4B10A 1WWZA 2JLMA 4Q38A 5KTDA 4CYNA 3E0KA 1WK4A 1ON0A 1MJAA 2OZHA 1NMTA 2WPXA 3DDDA 3I3GA 2FT0A 4MY0A 4QB9A 4BBHA 3ZJ0A 4E0AA 4XNHB 1VKCA 4KUAA 4ORFA 4M3SA 4CGNA 1B6BA 2ATRA 4B12A 3NE7A 3G3SA 5J8CA 1XMTA 3TTHA 1IIDA 4AB7A 5JQ4A 1MJBA 4UFXA 1YVOA 4AVBA 3B8GA 2OH1A 1KUXA 4JXQA 5BWAB 3R9GA 4UFWA 3TCVA 3H5ZA 1QSMA 3F0AA 4LUAA 4U5YA 2FL4A 4QVTA 2BUEA 4A33A 5G22A 2REFA 2D4OA 5H86A 1SQHA 3R9EA 4MY3A 1NE9A 4UWJA 3QB8A 3I9SA 3FB3A 4H6UA 1KUVA 4UCNA 1Z4RA 1S3ZA 4XPLA 2ARHA 5G21A 2DPSA 2ZXVA 4A2ZA 4KOVA 4L8AA 4M85A 4R3KA 4U9ZA 3WR7A 4C2ZA 3FYNA 3GYAA 4KOSA 1V0CA 4CYPA 2B5GB 4B14A 1P4NA 2Z3NA 4AVCA 4HNYB 3D8PA 2GIVA 4UA3A 1Y7RA 1I21A 1KZFA 3R1KA 4XPKA 1S7NA 5AGEA 2B3UA 3IWGA 2AE6A 2QIRA 2VEZA 1YREA 2HUZA 3PGPA 2BSWA 3LD2A 3FIXA 1S60A 2B5GA 3BLNA 4NEXA 4UCMA 5IX3A 3QAHA 1YX0A 2PR1A 4Y49C 3SXOA 4NSQA 1Q2CA 1YGHA 2Z3LA 4CGLA 1M1DA 4Q36A 3D2PA 2JDCA 3FRMA 2FE7A 2Z3PA 5CNPA 4NCZA 2G3TA 1CM0A 1P0HA 5I0CA 2EUIA 4FD4A 4KOTA 4CAEA 4Y49B 2BL1A 3S6FA 3GY9A 4E2AA 2WSAA 1QSNA 2PSWA 2GE3A 1S7FA 4CGPA 1I1DA 2K5TA 3IWEA 5DWMA 2HV2A 2HQYA 3LODA 4HKFA 4C7HA 5F46A 1Y9WA 3S6KA 1QSTA 4KOYA 2FIWA 1BO4A 4CYQA 2DPTA 4NXYA 4OADA 5F47A 4KOUA 2PQ8A 4CAVA 3CXQA 4XPDC 4RI1A 1FY7A 4X5KA 4NF1A 2FXFA 3CXSA 2DXQA 3DR6A 2G3AA 4PSWA 2Q7BA 5KTCA 2YGWA 3EY5A 3JTKA 4MI4A 1YR0A 2CNSA 3DSBA 2J8RA 5IB0A 5JPHA 2J8NA 4BMHA 3KKWA 3W6XA 4B11A 4XPDB 4FD7A 4CYOA 2BEIA 2PC1A 1J4JA 3TO6A 2JDDA 4LX9A 1S5KA 2YNEA 3EXNA 4GS4A 5F49A 5F48A 3V8IA 2Q4YA 2B58A 5KTAA 2NMTA 2B4DB 4R87A 1IYKA 3GKRA 5HMNA 4MFJA 3TO9A 4A95A 3TFYA 3CXPA 4UWIA 3TO7A 2PR8A 2P0WA 4ONUA 4IF5A 4FD6A 4MJ8A 3BJ7A 5G20A 4CAWA 4EVYA 5EC4A 3BJ8A 3IU2A 2B4DA 4UBRA 4E8OA 2P6FA 3TOAA 3JVNA 4YGOA 1I12A 4H89A 4RS2A 2VZZA 2OU2A 4B5PB 1Q2DA 1CJWA 4YRHA 1QSOA 4KLVA 3UY5A 4PK3A 4KSFA 4F6AA 3FNCA 2CXAA 4ZBGA 1GHEA 4F0XA 5IV0A 3IGRA 4QUSA 3K9UA 4OAEA 4CGOA 2PDOA 1LRZA 2R98A 2H5MA 5AG4A 2Z10A 2QECA 4B5PA 1R57A 3F5BA 3A9LA 1KUYA 1IICA 1RXTA 5AG5A 2FSRA 2Z0ZA 4U9YA 4ZGYB 5ISVA 3F8KA 2FIAA 4C7IA 2QMLA 1OZPA 3P2FA 3N7ZA 1B87A 4MBUA 4MFZA 1S7LA 2ZW7A 4KVXA 1M44A 4MHDA 4JXRA 2Z11A 1QSRA 4HNWB 4MFKA 3OWCA 2Q04A 1IYLA 1XE4A 3FBUA 4MFPA 3TOBA 4PSXA 1ZO0A 2Q44A 4A31A 1M4IA 5FVJA 4YFJA 5A27A 4KOWA 4H6ZA 2ZW5A 4QC6A 4CAXA 3S6GA 3SHPA 4JJXA 2B3VA 1K4JA 1MJ9A 2IL4A 4L89A 3SXNA 4K30A 1MK4A 4C2XA 1UFHA 2Z3OA 4UFVA 2Q4VA 1YVKA 1N71A 2WUUA 3D2MA 4QBJA 2WPWA 4R3LA 5G1ZA 2KCWA 1PU9A 2Y0MA 2P6GA 3TT2A 2ZW6A 4OLLA 3MGDA 3H4QA 1TIQA 4PV6A 2G0BA 5AG6A 1XIXA 4MFQA 2VQYA 3FXTA 4HNXB 2OZUA 4KVOE 3VWDA 2R7HA 2J8MA 5GCNA 4JD6A 3R9FA 1BOBA 2F5IA 2VZYA 3IU1A 2JEVA 4JLYA 3ZZIA 2B4BA 2Q0YA 2I79A 2X7BA 4KLWA 4FD5A 4II9A 4DNCA 3T90A 3EFAA 1M4GA 4CRYB 2OB0A 3C26A 2A4NA 3R96A 1IB1E 4AVAA 4I49A 4A32A 4AG7A 2YNCC 3DR8A 3D3SA 1L0CA 4KUBA 2VI7A 1S7KA 3TE4A 1PUAA 3PZJA 5C88A 4JWPA 2Z3MA 5J8FA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O28 A;  5HH1 A;  2FS5 A;  1YK3 A;  1NSL A;  3W6S A;  5C82 A;  2GAN A;  4AG9 A;  2AJ6 A;  2FCK A;  2RC4 A;  2D4P A;  2ZW4 A;  1Z4E A;  4KZT A;  2VXK A;  4R57 A;  3VWE A;  4PK2 A;  3T9Y A;  1YLE A;  1VHS A;  3RYO A;  2OZG A;  2CNT A;  4IUS A;  5DWN A;  2CY2 A;  5EBV A;  2VBQ A;  3P2H A;  2R1I A;  1XF8 A;  3G8W A;  2ZPA A;  4F0Y A;  1RO5 A;  3S6H A;  3JUW A;  3W91 A;  4CS0 B;  4B5O A;  4J3G A;  5E96 A;  3EO4 A;  4R9M A;  1M4D A;  4KOX A;  1XEB A;  2P6E A;  3EC4 A;  2PRB A;  4CRZ B;  2C27 A;  2CNM A;  3PP9 A;  1U6M A;  2REE A;  5H84 A;  2R8V A;  3DNS A;  1Y9K A;  2I00 A;  4XNH C;  1Z9U A;  4KOR A;  2EVN A;  1Q2Y A;  4KVM E;  1WWZ A;  2JLM A;  5KTD A;  3E0K A;  1WK4 A;  1ON0 A;  1MJA A;  2OZH A;  1NMT A;  2WPX A;  3DDD A;  3I3G A;  2FT0 A;  4MY0 A;  4QB9 A;  3ZJ0 A;  4E0A A;  4XNH B;  1VKC A;  4KUA A;  4ORF A;  4M3S A;  1B6B A;  2ATR A;  3NE7 A;  3G3S A;  5J8C A;  1XMT A;  3TTH A;  1IID A;  4AB7 A;  5JQ4 A;  1MJB A;  1YVO A;  4AVB A;  3B8G A;  2OH1 A;  1KUX A;  4JXQ A;  3R9G A;  3TCV A;  1QSM A;  3F0A A;  4LUA A;  4U5Y A;  2FL4 A;  4QVT A;  2BUE A;  2REF A;  2D4O A;  5H86 A;  1SQH A;  3R9E A;  4MY3 A;  1NE9 A;  4UWJ A;  3QB8 A;  3I9S A;  3FB3 A;  4H6U A;  1KUV A;  1Z4R A;  1S3Z A;  4XPL A;  2ARH A;  2ZXV A;  4KOV A;  4L8A A;  4M85 A;  4R3K A;  4U9Z A;  3WR7 A;  3FYN A;  3GYA A;  4KOS A;  1V0C A;  2B5G B;  1P4N A;  4AVC A;  4HNY B;  3D8P A;  2GIV A;  4UA3 A;  1Y7R A;  1I21 A;  1KZF A;  3R1K A;  4XPK A;  1S7N A;  2B3U A;  3IWG A;  2AE6 A;  2QIR A;  2VEZ A;  1YRE A;  2HUZ A;  3PGP A;  2BSW A;  3LD2 A;  3FIX A;  1S60 A;  2B5G A;  3BLN A;  4NEX A;  5IX3 A;  3QAH A;  1YX0 A;  2PR1 A;  4Y49 C;  3SXO A;  4NSQ A;  1Q2C A;  1YGH A;  1M1D A;  3D2P A;  2JDC A;  3FRM A;  2FE7 A;  5CNP A;  4NCZ A;  2G3T A;  1CM0 A;  1P0H A;  5I0C A;  2EUI A;  4FD4 A;  4KOT A;  4Y49 B;  2BL1 A;  3S6F A;  3GY9 A;  4E2A A;  1QSN A;  2PSW A;  2GE3 A;  1S7F A;  1I1D A;  2K5T A;  5DWM A;  2HV2 A;  2HQY A;  3LOD A;  4HKF A;  5F46 A;  1Y9W A;  3S6K A;  1QST A;  4KOY A;  2FIW A;  1BO4 A;  4NXY A;  4OAD A;  5F47 A;  4KOU A;  2PQ8 A;  4CAV A;  3CXQ A;  4XPD C;  4RI1 A;  1FY7 A;  4X5K A;  4NF1 A;  2FXF A;  3CXS A;  2DXQ A;  3DR6 A;  2G3A A;  4PSW A;  2Q7B A;  5KTC A;  3EY5 A;  4MI4 A;  1YR0 A;  2CNS A;  3DSB A;  2J8R A;  5IB0 A;  5JPH A;  2J8N A;  4BMH A;  3KKW A;  3W6X A;  4XPD B;  4FD7 A;  2BEI A;  2PC1 A;  1J4J A;  3TO6 A;  2JDD A;  4LX9 A;  1S5K A;  3EXN A;  5F49 A;  4GS4 A;  5F48 A;  3V8I A;  2Q4Y A;  2B58 A;  5KTA A;  2NMT A;  2B4D B;  4R87 A;  1IYK A;  3GKR A;  5HMN A;  3TO9 A;  3TFY A;  3CXP A;  4UWI A;  3TO7 A;  2PR8 A;  2P0W A;  4ONU A;  4IF5 A;  4FD6 A;  4MJ8 A;  3BJ7 A;  4CAW A;  4EVY A;  5EC4 A;  3BJ8 A;  2B4D A;  4UBR A;  4E8O A;  2P6F A;  3TOA A;  3JVN A;  4YGO A;  1I12 A;  4H89 A;  4RS2 A;  2VZZ A;  2OU2 A;  4B5P B;  1Q2D A;  1CJW A;  4YRH A;  1QSO A;  4KLV A;  3UY5 A;  4PK3 A;  4F6A A;  3FNC A;  4ZBG A;  1GHE A;  5IV0 A;  3IGR A;  4QUS A;  3K9U A;  4OAE A;  2PDO A;  1LRZ A;  2R98 A;  2H5M A;  2Z10 A;  2QEC A;  4B5P A;  1R57 A;  3F5B A;  1KUY A;  1IIC A;  1RXT A;  2FSR A;  2Z0Z A;  4U9Y A;  5ISV A;  3F8K A;  2FIA A;  2QML A;  1OZP A;  3P2F A;  3N7Z A;  1B87 A;  4MBU A;  1S7L A;  2ZW7 A;  4KVX A;  1M44 A;  4MHD A;  4JXR A;  2Z11 A;  1QSR A;  4HNW B;  3OWC A;  2Q04 A;  1IYL A;  1XE4 A;  3FBU A;  3TOB A;  4PSX A;  2Q44 A;  1M4I A;  5FVJ A;  4YFJ A;  4KOW A;  4H6Z A;  2ZW5 A;  4QC6 A;  4CAX A;  3S6G A;  3SHP A;  4JJX A;  2B3V A;  1K4J A;  1MJ9 A;  2IL4 A;  4L89 A;  3SXN A;  4K30 A;  1MK4 A;  1UFH A;  2Q4V A;  1YVK A;  1N71 A;  3D2M A;  4QBJ A;  2WPW A;  4R3L A;  2KCW A;  1PU9 A;  2Y0M A;  2P6G A;  3TT2 A;  2ZW6 A;  4OLL A;  3MGD A;  3H4Q A;  1TIQ A;  4PV6 A;  2G0B A;  1XIX A;  4KVO E;  2VQY A;  4HNX B;  3FXT A;  2OZU A;  3VWD A;  2R7H A;  2J8M A;  5GCN A;  4JD6 A;  3R9F A;  1BOB A;  2F5I A;  2VZY A;  2JEV A;  4JLY A;  3ZZI A;  2B4B A;  2Q0Y A;  2I79 A;  2X7B A;  4KLW A;  4FD5 A;  4II9 A;  4DNC A;  3T90 A;  3EFA A;  1M4G A;  4CRY B;  2OB0 A;  3C26 A;  2A4N A;  3R96 A;  1IB1 E;  4AVA A;  4I49 A;  4AG7 A;  3DR8 A;  3D3S A;  1L0C A;  4KUB A;  2VI7 A;  1S7K A;  3TE4 A;  1PUA A;  3PZJ A;  5C88 A;  4JWP A;  5J8F A;  3R95 A; 
#chains in the Genus database with same CATH topology
 4A39 A;  2O28 A;  3BXM A;  5HH1 A;  4C2Y A;  2FS5 A;  1AUG A;  2GLF A;  4CAF A;  1YK3 A;  5J1Q A;  2JBJ A;  4NGT A;  4KS9 A;  4AXV A;  4KSA A;  1NSL A;  3W6S A;  5C82 A;  2GAN A;  3D7G A;  4P45 A;  4OID A;  4AG9 A;  4B13 A;  1Z5R A;  2AJ6 A;  2FCK A;  1CP7 A;  2RC4 A;  2D4P A;  2ZW4 A;  3GIU A;  1Z4E A;  1LCP A;  2PJ3 A;  2BO9 A;  2WZN A;  2Z3K A;  2VXK A;  3HLP A;  3PFO A;  2PJA A;  4KZT A;  4PK2 A;  4R57 A;  1YLE A;  3IIB A;  3T9Y A;  5HXD A;  5LYI A;  1VHS A;  3IFE A;  3GLJ A;  4MFL A;  3RYO A;  2OZG A;  1Y7E A;  2CNT A;  4IUS A;  5DWN A;  2CY2 A;  5EBV A;  3D4U A;  2VBQ A;  3P2H A;  4P6Y A;  2R1I A;  1XF8 A;  3G8W A;  4PXE A;  2ZPA A;  1TKH A;  4F0Y A;  5LYD A;  3SJF A;  1RO5 A;  3PFE A;  3S6H A;  3JUW A;  3W91 A;  4CS0 B;  4B5O A;  2YNC A;  4J3G A;  2NYQ A;  5E96 A;  1CPS A;  4R76 A;  4UCP A;  4K3N A;  3EO4 A;  4R9M A;  1TF8 A;  1YW6 A;  1M4D A;  4KOX A;  4C68 A;  1XEB A;  2P6E A;  2PE3 A;  2PIY A;  2PRB A;  3EC4 A;  2I3C A;  4Q7A A;  5AG7 A;  4CRZ B;  1ZG8 A;  2C27 A;  2CNM A;  3FJU A;  3PP9 A;  2PJC A;  4FAI A;  1U6M A;  2REE A;  2GLJ A;  2YND A;  2GRE A;  3GB0 A;  4FWU A;  4LQ6 A;  4X2T A;  3VAR A;  4CGM A;  5I4M A;  5H84 A;  4FUU A;  2R8V A;  3IJ3 A;  2ZEG A;  3DNS A;  2ZEE A;  1Y9K A;  2I00 A;  4A30 A;  1IGB A;  4XNH C;  1Z9U A;  4RN7 A;  4KOR A;  2EVN A;  1Q2Y A;  5A28 A;  4BIN A;  4KVM E;  1YQE A;  4B10 A;  1WWZ A;  2JLM A;  4Q38 A;  5KTD A;  1Z2L A;  4IAV A;  4CYN A;  4H2K A;  5F09 A;  2ZOG A;  3E0K A;  2ZEH A;  1WK4 A;  3D67 A;  1ON0 A;  2IMO A;  1MJA A;  2OZH A;  3DGV A;  1NMT A;  2WPX A;  3DDD A;  3S9N A;  5D29 A;  3I3G A;  2FT0 A;  4WJB A;  3IO1 A;  3KHX A;  4IK2 A;  5K8M A;  4MY0 A;  4QB9 A;  1ZG7 A;  4BBH A;  2AFS A;  3ZJ0 A;  4E0A A;  3IEH A;  4XNH B;  4UEZ A;  1VKC A;  2EK9 A;  1Z8T A;  4KUA A;  4MHZ A;  3PB4 X;  4ORF A;  4M3S A;  1QQ9 A;  4CGN A;  4ZX9 A;  1F2O A;  1B6B A;  2ATR A;  4UIA A;  4UF4 A;  4B12 A;  3KAS A;  3NE7 A;  3G3S A;  4MXU A;  4NGQ A;  5J8C A;  1CPX A;  1XMT A;  3TTH A;  1IID A;  2ZEL A;  4AB7 A;  5JQ4 A;  1MJB A;  4UFX A;  1IOI A;  4EME A;  1YVO A;  2EO8 A;  2ZEF A;  4AVB A;  4R6T A;  1X10 A;  1AMP A;  3B8G A;  2OH1 A;  1KUX A;  3FF3 A;  3B3C A;  4JXQ A;  5BWA B;  1CP6 A;  3H8E A;  3JRU A;  4UFW A;  3R9G A;  3H5Z A;  3TCV A;  1QSM A;  4DUK A;  4NGR A;  1XRY A;  3F0A A;  4LUA A;  2XEF A;  4U5Y A;  2FL4 A;  4QVT A;  2BUE A;  4R8F A;  3D7F A;  4A33 A;  2V8G A;  5G22 A;  4ZI6 A;  2REF A;  2D4O A;  2HB6 A;  3CZX A;  5H86 A;  1SQH A;  3CT9 A;  3R9E A;  4MY3 A;  5CBM A;  1NE9 A;  4MMO A;  1EE3 P;  1ELL P;  1KWM A;  2PJ6 A;  4UWJ A;  2EBJ A;  3QB8 A;  5K8P A;  1ZLH A;  3I9S A;  3FB3 A;  4H6U A;  1R43 A;  1KUV A;  1LAP A;  2QJ8 A;  3PB6 X;  4UCN A;  2XEJ A;  3NH4 A;  1Z4R A;  1S3Z A;  4P44 A;  4XPL A;  2ARH A;  5G21 A;  3SI2 A;  4ZY1 A;  1CX8 A;  4EWT A;  4OC4 A;  2DPS A;  2ZXV A;  4A2Z A;  4KOV A;  4L8A A;  4UEF A;  3RO0 A;  2QVP A;  4M85 A;  4R3K A;  4OKO A;  4U9Z A;  3WR7 A;  5J8F A;  2RFH A;  1VHE A;  4MCP A;  4C2Z A;  3FYN A;  3GYA A;  4KOS A;  2FVG A;  4MCR A;  1V0C A;  4CYP A;  2B5G B;  4B14 A;  6CPA A;  1P4N A;  2Z3N A;  3B3V A;  3DLJ A;  4OP4 A;  2PJ4 A;  4AVC A;  4HNY B;  3D8P A;  2GIV A;  4UA3 A;  4PQA A;  2C6G A;  2PJ5 A;  3BHX A;  3NH5 A;  4ONW A;  4P10 A;  2PJ1 A;  1A2Z A;  4W9Y A;  1Y7R A;  5K8N A;  1I21 A;  1KZF A;  3R1K A;  4XPK A;  2AFW A;  1S7N A;  5AGE A;  1JWQ A;  2B3U A;  3RZA A;  3GUX A;  3IWG A;  2AE6 A;  2QIR A;  1YRE A;  2VEZ A;  2HUZ A;  3PGP A;  4YWY A;  2BSW A;  1TF9 A;  3LD2 A;  3FIX A;  2V8V A;  4HPS A;  1S60 A;  1Z8X A;  4A94 A;  2B5G A;  3BLN A;  1Q7L A;  4NEX A;  5LRK A;  4O23 A;  3S9L A;  4UCM A;  5IX3 A;  3QAH A;  1YX0 A;  4GXH A;  3NE8 A;  2PR1 A;  4Y49 C;  5JH9 A;  4MHY A;  4NSQ A;  1Q2C A;  3SXO A;  1YGH A;  2Z3L A;  4CGL A;  1M1D A;  4Q36 A;  3D2P A;  2JDC A;  3FRM A;  2FE7 A;  4KSI A;  2BCO A;  1DE4 C;  4P4E A;  2Z3P A;  2OOT A;  2Q4Z A;  1ARM A;  4NCZ A;  5CNP A;  2OR4 A;  3FH4 A;  1F57 A;  2GFQ A;  3MRU A;  3V7Z A;  2G3T A;  1TXR A;  2PJB A;  1XJO A;  3VH9 A;  4RUH A;  3TX8 A;  1CM0 A;  1P0H A;  5I0C A;  2EUI A;  2ODF A;  4FD4 A;  4KOT A;  4G1P A;  4CAE A;  1HDQ A;  2BL1 A;  4Y49 B;  4P4J A;  3GY9 A;  2CTB A;  3NFZ A;  3S6F A;  3SJG A;  4M6H A;  4UIB A;  3VWE A;  2PCU A;  3N5F A;  4E2A A;  2WSA A;  1QSN A;  2PSW A;  2GE3 A;  3BI0 A;  5ELY A;  2DEA A;  2C1C A;  4DJL A;  1S7F A;  4B6Z A;  2C6C A;  4CGP A;  1I1D A;  2K5T A;  3IWE A;  5DWM A;  2HV2 A;  2HQY A;  3LOD A;  4HKF A;  4C7H A;  4A37 A;  5CPA A;  5THW A;  4PXB A;  5F46 A;  1Y9W A;  3ISX A;  3S6K A;  1QST A;  2GU2 A;  4KOY A;  2FIW A;  2PJ7 A;  1BO4 A;  4CYQ A;  1Z8L A;  2DPT A;  3FEE A;  3D7H A;  4NXY A;  4OAD A;  4YU9 A;  5F47 A;  4KOU A;  4JYW A;  2PQ8 A;  4PXD A;  4R7M A;  4CAV A;  3CXQ A;  4XPD C;  4RI1 A;  3LAC A;  1FY7 A;  4X5K A;  4NF1 A;  2FXF A;  1YSJ A;  1XBU A;  2DXQ A;  3CXS A;  2G3A A;  2CIJ A;  3DR6 A;  4DYO A;  8CPA A;  4PSW A;  4X3R A;  2IQ6 A;  3B2Y A;  3PBB A;  4P4D A;  2Q7B A;  3SI1 A;  2AFU A;  2YGW A;  3FMC A;  5KTC A;  3EY5 A;  3JTK A;  3KQX A;  1YR0 A;  1ELM P;  2CNS A;  4MI4 A;  4NJQ A;  1XOV A;  5LRG A;  3V38 A;  1ZG9 A;  3DSB A;  2Q7S A;  2J8R A;  2PRQ A;  5IB0 A;  5JPH A;  2J8N A;  4BMH A;  3KKW A;  3W6X A;  4B11 A;  3RNZ A;  4XPD B;  4FD7 A;  4CYO A;  2BEI A;  2C6P A;  2PC1 A;  1M4L A;  4ZY0 A;  1LFW A;  3LWU A;  4JZ0 A;  1J4J A;  1LAN A;  1UWY A;  4F8Z A;  3TO6 A;  2JDD A;  2V8H A;  3KGQ A;  2PJ8 A;  4LX9 A;  1S5K A;  1BLL E;  2AFM A;  2VL1 A;  2G9D A;  2YNE A;  3EXN A;  3PB7 X;  4GS4 A;  2F7V A;  5F49 A;  5F48 A;  2Q4Y A;  2B58 A;  1ZLI A;  3V8I A;  5KTA A;  2NMT A;  2B4D B;  4R87 A;  1XMB A;  3PB8 X;  1IYK A;  2V8D A;  3GKR A;  1YME A;  2ZEO A;  4UEE A;  5HMN A;  2Q51 A;  3B35 A;  4MFJ A;  3TO9 A;  4A95 A;  3TFY A;  3CXP A;  2CF4 A;  2BOA A;  4UWI A;  2F8H A;  3TO7 A;  4PPZ A;  1BAV A;  3QNV A;  2O4H A;  3RBU A;  3PB9 X;  4NJR A;  5HVF A;  2PR8 A;  2P0W A;  3KR5 A;  1VGY A;  1YLO A;  4ONU A;  4IF5 A;  2J9A A;  1F2P A;  4FD6 A;  4P4I A;  4FBE A;  4MJ8 A;  4NGN A;  5HVG A;  3BJ7 A;  5G20 A;  4CAW A;  2ABZ A;  2AFX A;  3WT4 A;  4EVY A;  4F9U A;  4ZYQ A;  2POK A;  5EC4 A;  3BJ8 A;  3IU2 A;  1X12 A;  2B4D A;  4UBR A;  3H8G A;  4X8I A;  2P6F A;  3TOA A;  3CPX A;  4E8O A;  3JVN A;  1DTD A;  1IOF A;  4YGO A;  1I12 A;  4H89 A;  4OME A;  2EK8 A;  4RS2 A;  2VZZ A;  4Z65 A;  2OU2 A;  4B5P B;  1Q2D A;  1Y0Y A;  4P4F A;  2ZEM A;  1R3N A;  3T8W A;  1CJW A;  2ZOF A;  4YRH A;  1LAM A;  1JQG A;  1QSO A;  2PJ0 A;  3NA6 A;  4KLV A;  3UY5 A;  1XFO A;  4TNU A;  4PK3 A;  2WYR A;  4KSF A;  4F6A A;  1FT7 A;  2CXA A;  3FNC A;  1RTQ A;  4ZBG A;  1GHE A;  4F0X A;  5IV0 A;  1NSA A;  3IGR A;  4QUS A;  5D8N A;  1VHO A;  2PIZ A;  3K9U A;  4OAE A;  4A38 A;  4CGO A;  2PDO A;  1LRZ A;  1TKF A;  2R98 A;  3D7D A;  1BPN A;  2V77 A;  2H5M A;  3TC8 A;  2Z10 A;  5AG4 A;  2QEC A;  4B5P A;  1R57 A;  3F5B A;  3A9L A;  1KUY A;  1IIC A;  3MN8 A;  1RXT A;  4OC2 A;  1QMU A;  4MRI A;  5AG5 A;  2FSR A;  4P4B A;  2Z0Z A;  4U9Y A;  2DF5 A;  4ZGY B;  2ANP A;  3SI0 A;  5ISV A;  3F8K A;  2FIA A;  4MHN A;  4C7I A;  2QML A;  1OZP A;  2PJ2 A;  3N7Z A;  3P2F A;  4BD9 A;  1B87 A;  4MBU A;  3H8F A;  4MFZ A;  3KI9 A;  1BPM A;  1S7L A;  2ZEP A;  2ZW7 A;  4KVX A;  1M44 A;  4MHD A;  4JXR A;  2Z11 A;  5JGF A;  1QSR A;  3IC1 A;  4HNW B;  4MFK A;  3FX6 A;  1PYT B;  4LQG A;  3OWC A;  2Q04 A;  5HVH A;  1IYL A;  1XE4 A;  2CTC A;  3FBU A;  1YW4 A;  3HUV A;  4MFP A;  4PSX A;  3TOB A;  1ZO0 A;  2Q44 A;  2PVV A;  4A31 A;  1M4I A;  5FVJ A;  5K8O A;  4MCS A;  2NSM A;  4GM5 A;  4YFJ A;  5A27 A;  4KOW A;  4H6Z A;  2ZW5 A;  3WC7 A;  4QC6 A;  1CBX A;  4CAX A;  3S6G A;  3FED A;  4NGM A;  1OBR A;  3SHP A;  3B3S A;  4TWE A;  1LOK A;  5LYL A;  4JJX A;  3VAT A;  3PEI A;  4F9V A;  2B3V A;  3KR4 A;  3KHZ A;  3S9M A;  1K4J A;  1MJ9 A;  4OC5 A;  1CG2 A;  2IL4 A;  3QAY A;  4IHM A;  2AFO A;  4L89 A;  3WAB A;  1HEE A;  2RB7 A;  3CDX A;  3K9T A;  1PCA A;  3SXN A;  1AYE A;  1IU8 A;  3L2N A;  1IY7 A;  3KQZ A;  4OC0 A;  3FVL A;  1MK4 A;  4K30 A;  4C2X A;  1UFH A;  3WC6 A;  4EFD A;  2Z3O A;  2PJ9 A;  4UFV A;  2Q4V A;  1YVK A;  4MCQ A;  3D66 A;  1N71 A;  2WUU A;  3D2M A;  4NFR A;  2XEG A;  4QBJ A;  1GYT A;  2WPW A;  2IJZ A;  4R3L A;  5G1Z A;  4NGP A;  2KCW A;  1PU9 A;  2Y0M A;  2P6G A;  3TT2 A;  2JEW A;  5LYF A;  2ZW6 A;  4WWV A;  2JBK A;  3MGD A;  4OLL A;  4M6G A;  3FEC A;  3H4Q A;  1TIQ A;  4PV6 A;  1H8L A;  2G0B A;  5AG6 A;  4ZX8 A;  1XIX A;  3K2K A;  4MFQ A;  2VQY A;  3FXT A;  2OZU A;  1FNO A;  3KL9 A;  4HNX B;  2R7H A;  4KVO E;  3SJE A;  3VWD A;  2J8M A;  1HDU A;  5GCN A;  4JD6 A;  2HC9 A;  3R9F A;  2XEI A;  4ZY2 A;  1BOB A;  2F5I A;  2VZY A;  2AFZ A;  3IU1 A;  3IWW A;  2JEV A;  4JLY A;  5DS0 A;  3ZZI A;  2B4B A;  2Q0Y A;  2ZEN A;  3BI1 A;  3CPA A;  2I79 A;  3B7I A;  5IB9 A;  4M6I A;  2X7B A;  3KZW A;  2ZED A;  4FD5 A;  4KLW A;  4DNC A;  4II9 A;  3T90 A;  7CPA A;  2O53 A;  3EFA A;  5EMI A;  5JM6 A;  1M4G A;  4CRY B;  1Z8W A;  2OB0 A;  3D68 A;  3ISZ A;  3C26 A;  2A4N A;  3R96 A;  1IB1 E;  3B3W A;  3WC5 A;  4AVA A;  3NH8 A;  4I49 A;  4A32 A;  4AG7 A;  2YNC C;  3DR8 A;  4OC1 A;  3D3S A;  1L0C A;  4NGS A;  4MHP A;  3PRT A;  4KUB A;  2VI7 A;  3B3T A;  3LMS A;  4CPA A;  1ARL A;  2EWB A;  3PBE A;  3RAM A;  3SJX A;  1S7K A;  2QYV A;  5LRJ A;  3TE4 A;  1Y0R A;  4PXC A;  1PUA A;  2PVW A;  1TKJ A;  3PZJ A;  4JWP A;  4OIW A;  5C88 A;  4OC3 A;  2Z3M A;  3I1U A;  3R95 A;  1VIX A;  2Q43 A; 
#chains in the Genus database with same CATH homology
 2O28 A;  4C2Y A;  5HH1 A;  2FS5 A;  4CAF A;  1YK3 A;  4KS9 A;  4KSA A;  1NSL A;  3W6S A;  5C82 A;  2GAN A;  4AG9 A;  4B13 A;  2AJ6 A;  2FCK A;  2RC4 A;  2D4P A;  2ZW4 A;  1Z4E A;  2Z3K A;  4KZT A;  2VXK A;  4R57 A;  3VWE A;  4PK2 A;  3T9Y A;  1YLE A;  1VHS A;  3RYO A;  4MFL A;  2OZG A;  2CNT A;  4IUS A;  5DWN A;  2CY2 A;  5EBV A;  2VBQ A;  3P2H A;  2R1I A;  1XF8 A;  3G8W A;  2ZPA A;  4F0Y A;  1RO5 A;  3S6H A;  3JUW A;  3W91 A;  4CS0 B;  4B5O A;  2YNC A;  4J3G A;  5E96 A;  4UCP A;  3EO4 A;  4R9M A;  4C68 A;  1M4D A;  4KOX A;  1XEB A;  2P6E A;  3EC4 A;  2PRB A;  5AG7 A;  4CRZ B;  2C27 A;  2CNM A;  3PP9 A;  1U6M A;  2REE A;  2YND A;  4CGM A;  5H84 A;  2R8V A;  3DNS A;  1Y9K A;  2I00 A;  4A30 A;  4XNH C;  1Z9U A;  4KOR A;  2EVN A;  1Q2Y A;  5A28 A;  4KVM E;  4B10 A;  1WWZ A;  2JLM A;  4Q38 A;  5KTD A;  4CYN A;  3E0K A;  1WK4 A;  1ON0 A;  1MJA A;  2OZH A;  1NMT A;  2WPX A;  3DDD A;  3I3G A;  2FT0 A;  4MY0 A;  4QB9 A;  4BBH A;  3ZJ0 A;  4E0A A;  4XNH B;  1VKC A;  4KUA A;  4ORF A;  4M3S A;  4CGN A;  1B6B A;  2ATR A;  4B12 A;  3NE7 A;  3G3S A;  5J8C A;  1XMT A;  3TTH A;  1IID A;  4AB7 A;  5JQ4 A;  1MJB A;  4UFX A;  1YVO A;  4AVB A;  3B8G A;  2OH1 A;  1KUX A;  4JXQ A;  5BWA B;  3R9G A;  4UFW A;  3TCV A;  3H5Z A;  1QSM A;  3F0A A;  4LUA A;  4U5Y A;  2FL4 A;  4QVT A;  2BUE A;  4A33 A;  5G22 A;  2REF A;  2D4O A;  5H86 A;  1SQH A;  3R9E A;  4MY3 A;  1NE9 A;  4UWJ A;  3QB8 A;  3I9S A;  3FB3 A;  4H6U A;  1KUV A;  4UCN A;  1Z4R A;  1S3Z A;  4XPL A;  2ARH A;  5G21 A;  2DPS A;  2ZXV A;  4A2Z A;  4KOV A;  4L8A A;  4M85 A;  4R3K A;  4U9Z A;  3WR7 A;  4C2Z A;  3FYN A;  3GYA A;  4KOS A;  1V0C A;  4CYP A;  2B5G B;  4B14 A;  1P4N A;  2Z3N A;  4AVC A;  4HNY B;  3D8P A;  2GIV A;  4UA3 A;  1Y7R A;  1I21 A;  1KZF A;  3R1K A;  4XPK A;  1S7N A;  5AGE A;  2B3U A;  3IWG A;  2AE6 A;  2QIR A;  2VEZ A;  1YRE A;  2HUZ A;  3PGP A;  2BSW A;  3LD2 A;  3FIX A;  1S60 A;  2B5G A;  3BLN A;  4NEX A;  4UCM A;  5IX3 A;  3QAH A;  1YX0 A;  2PR1 A;  4Y49 C;  3SXO A;  4NSQ A;  1Q2C A;  1YGH A;  2Z3L A;  4CGL A;  1M1D A;  4Q36 A;  3D2P A;  2JDC A;  3FRM A;  2FE7 A;  2Z3P A;  5CNP A;  4NCZ A;  2G3T A;  1CM0 A;  1P0H A;  5I0C A;  2EUI A;  4FD4 A;  4KOT A;  4CAE A;  4Y49 B;  2BL1 A;  3S6F A;  3GY9 A;  4E2A A;  2WSA A;  1QSN A;  2PSW A;  2GE3 A;  1S7F A;  4CGP A;  1I1D A;  2K5T A;  3IWE A;  5DWM A;  2HV2 A;  2HQY A;  3LOD A;  4HKF A;  4C7H A;  5F46 A;  1Y9W A;  3S6K A;  1QST A;  4KOY A;  2FIW A;  1BO4 A;  4CYQ A;  2DPT A;  4NXY A;  4OAD A;  5F47 A;  4KOU A;  2PQ8 A;  4CAV A;  3CXQ A;  4XPD C;  4RI1 A;  1FY7 A;  4X5K A;  4NF1 A;  2FXF A;  3CXS A;  2DXQ A;  3DR6 A;  2G3A A;  4PSW A;  2Q7B A;  5KTC A;  2YGW A;  3EY5 A;  3JTK A;  4MI4 A;  1YR0 A;  2CNS A;  3DSB A;  2J8R A;  5IB0 A;  5JPH A;  2J8N A;  4BMH A;  3KKW A;  3W6X A;  4B11 A;  4XPD B;  4FD7 A;  4CYO A;  2BEI A;  2PC1 A;  1J4J A;  3TO6 A;  2JDD A;  4LX9 A;  1S5K A;  2YNE A;  3EXN A;  4GS4 A;  5F49 A;  5F48 A;  3V8I A;  2Q4Y A;  2B58 A;  5KTA A;  2NMT A;  2B4D B;  4R87 A;  1IYK A;  3GKR A;  5HMN A;  4MFJ A;  3TO9 A;  4A95 A;  3TFY A;  3CXP A;  4UWI A;  3TO7 A;  2PR8 A;  2P0W A;  4ONU A;  4IF5 A;  4FD6 A;  4MJ8 A;  3BJ7 A;  5G20 A;  4CAW A;  4EVY A;  5EC4 A;  3BJ8 A;  3IU2 A;  2B4D A;  4UBR A;  4E8O A;  2P6F A;  3TOA A;  3JVN A;  4YGO A;  1I12 A;  4H89 A;  4RS2 A;  2VZZ A;  2OU2 A;  4B5P B;  1Q2D A;  1CJW A;  4YRH A;  1QSO A;  4KLV A;  3UY5 A;  4PK3 A;  4KSF A;  4F6A A;  3FNC A;  2CXA A;  4ZBG A;  1GHE A;  4F0X A;  5IV0 A;  3IGR A;  4QUS A;  3K9U A;  4OAE A;  4CGO A;  2PDO A;  1LRZ A;  2R98 A;  2H5M A;  5AG4 A;  2Z10 A;  2QEC A;  4B5P A;  1R57 A;  3F5B A;  3A9L A;  1KUY A;  1IIC A;  1RXT A;  5AG5 A;  2FSR A;  2Z0Z A;  4U9Y A;  4ZGY B;  5ISV A;  3F8K A;  2FIA A;  4C7I A;  2QML A;  1OZP A;  3P2F A;  3N7Z A;  1B87 A;  4MBU A;  4MFZ A;  1S7L A;  2ZW7 A;  4KVX A;  1M44 A;  4MHD A;  4JXR A;  2Z11 A;  1QSR A;  4HNW B;  4MFK A;  3OWC A;  2Q04 A;  1IYL A;  1XE4 A;  3FBU A;  4MFP A;  3TOB A;  4PSX A;  1ZO0 A;  2Q44 A;  4A31 A;  1M4I A;  5FVJ A;  4YFJ A;  5A27 A;  4KOW A;  4H6Z A;  2ZW5 A;  4QC6 A;  4CAX A;  3S6G A;  3SHP A;  4JJX A;  2B3V A;  1K4J A;  1MJ9 A;  2IL4 A;  4L89 A;  3SXN A;  4K30 A;  1MK4 A;  4C2X A;  1UFH A;  2Z3O A;  4UFV A;  2Q4V A;  1YVK A;  1N71 A;  2WUU A;  3D2M A;  4QBJ A;  2WPW A;  4R3L A;  5G1Z A;  2KCW A;  1PU9 A;  2Y0M A;  2P6G A;  3TT2 A;  2ZW6 A;  4OLL A;  3MGD A;  3H4Q A;  1TIQ A;  4PV6 A;  2G0B A;  5AG6 A;  1XIX A;  4MFQ A;  2VQY A;  3FXT A;  4HNX B;  2OZU A;  4KVO E;  3VWD A;  2R7H A;  2J8M A;  5GCN A;  4JD6 A;  3R9F A;  1BOB A;  2F5I A;  2VZY A;  3IU1 A;  2JEV A;  4JLY A;  3ZZI A;  2B4B A;  2Q0Y A;  2I79 A;  2X7B A;  4KLW A;  4FD5 A;  4II9 A;  4DNC A;  3T90 A;  3EFA A;  1M4G A;  4CRY B;  2OB0 A;  3C26 A;  2A4N A;  3R96 A;  1IB1 E;  4AVA A;  4I49 A;  4A32 A;  4AG7 A;  2YNC C;  3DR8 A;  3D3S A;  1L0C A;  4KUB A;  2VI7 A;  1S7K A;  3TE4 A;  1PUA A;  3PZJ A;  5C88 A;  4JWP A;  2Z3M A;  5J8F A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...