4QC6A

Crystal structure of aminoglycoside 6'-acetyltransferase-ie
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
179
structure length
179
Chain Sequence
MNIVENEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDEVFRVIIEYNNVPIGYGQIYKMYDELYTDYHYPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLIFEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional AAC/APH
publication title Structure of the bifunctional aminoglycoside-resistance enzyme AAC(6')-Ie-APH(2'')-Ia revealed by crystallographic and small-angle X-ray scattering analysis.
pubmed doi rcsb
source organism Staphylococcus warneri
molecule tags Transferase/antibiotic
total genus 58
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.190: Aminoglycoside 2''-phosphotransferase.
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qc6A00
2P6GA 2B3UA 4YGOA 4FD7A 2QMLA 2AJ6A 1BOBA 2Z11A 4FD5A 1BO4A 3I9SA 4ONUA 5FVJA 3MGDA 1B87A 5IX3A 1XIXA 4KOXA 2VQYA 3EO4A 5IB0A 2FIAA 3VWDA 2B4DA 3SXNA 2B5GA 3OWCA 1M4GA 2CNSA 3BLNA 5H84A 4MJ8A 4UA3A 2HUZA 2VBQA 2Q0YA 2WPXA 5GCNA 5F49A 3W6XA 3D2PA 2B4DB 4H6UA 4DNCA 4PSXA 2D4PA 1J4JA 1Q2YA 4AG9A 4UBRA 3FIXA 4KVME 1MJBA 3EY5A 1KUYA 3PGPA 4L89A 4U9YA 4J3GA 2Q04A 3W91A 1S5KA 1QSTA 1YREA 3E0KA 4U9ZA 2PR1A 3EC4A 5JPHA 1R57A 2QECA 2PSWA 4MY0A 4NCZA 4FD6A 3ZZIA 4XPDB 1P4NA 2HV2A 3RYOA 1S60A 1S7NA 2CNMA 4YRHA 4RI1A 4II9A 4E0AA 2A4NA 4PK3A 4YFJA 4R9MA 2DXQA 5J8FA 1XEBA 1RO5A 1P0HA 2X7BA 1QSOA 4NF1A 5KTCA 3TTHA 2NMTA 2IL4A 5ISVA 2H5MA 1PU9A 1MK4A 5F48A 4CRYB 4XPDC 2J8NA 3KKWA 2ZXVA 3D2MA 1LRZA 4R3LA 4B5OA 5HMNA 1NE9A 2Q44A 1VKCA 1CM0A 1Z9UA 1M4DA 5KTDA 1YX0A 1YVKA 1Q2DA 3S6KA 4F6AA 2FCKA 1S7LA 5KTAA 3IGRA 3GY9A 4R3KA 2FIWA 4HKFA 2FXFA 3S6HA 2GIVA 3TOBA 4M85A 3LD2A 2JEVA 3C26A 2EVNA 2Q4VA 3DDDA 3R1KA 2ARHA 4IF5A 3BJ7A 1ON0A 4E2AA 4QB9A 5DWMA 4JLYA 4EVYA 2ZW4A 4AB7A 4KORA 2FT0A 3P2HA 1CJWA 1M1DA 5EBVA 2VEZA 3JVNA 1FY7A 4JXQA 4KUBA 2K5TA 3EFAA 3FB3A 2FL4A 2R1IA 3H4QA 4OADA 3QB8A 1S3ZA 4LUAA 4KZTA 3D3SA 2BSWA 3S6GA 1NMTA 3NE7A 3TO6A 4MHDA 1N71A 4KOWA 3V8IA 1WK4A 4KVOE 5CNPA 2EUIA 1QSMA 3TO9A 1Y9WA 2OZHA 2D4OA 2RC4A 4JD6A 1M44A 1VHSA 2OU2A 2P6EA 2R8VA 3W6SA 1KUVA 4H89A 1YGHA 4X5KA 3FXTA 2PC1A 2ZW6A 1V0CA 2ZW7A 4KOSA 2JDDA 4GS4A 3SXOA 4NSQA 3IWGA 5DWNA 2HQYA 4MBUA 3CXQA 3R9GA 4R57A 2J8RA 3GKRA 1L0CA 1TIQA 2P6FA 2G3TA 1MJAA 2GE3A 3EXNA 4OAEA 2ZPAA 1Q2CA 4F0YA 3R96A 2Q4YA 4ORFA 1M4IA 1IYKA 3DSBA 1XF8A 4NEXA 2R98A 2PRBA 2OZUA 1UFHA 2WPWA 3JUWA 3VWEA 1GHEA 2B3VA 1I21A 5H86A 4XNHB 1B6BA 3UY5A 5EC4A 1I12A 1Y9KA 2Y0MA 4CAXA 3R9EA 2PR8A 3CXPA 2J8MA 5HH1A 2Z0ZA 2OH1A 3TE4A 4L8AA 4E8OA 5IV0A 3PP9A 3TCVA 4JXRA 4AVBA 2F5IA 1XE4A 2C27A 2CY2A 3FYNA 2I00A 2CNTA 3F5BA 5E96A 4XPKA 4KVXA 4HNWB 2PDOA 5F47A 1NSLA 2B58A 3WR7A 4LX9A 4AG7A 3S6FA 1K4JA 3FBUA 3R9FA 4KLWA 2JDCA 3G3SA 3T90A 4PSWA 2BL1A 3TOAA 3I3GA 2AE6A 3D8PA 1YK3A 3LODA 4QC6A 3K9UA 4AVAA 4BMHA 3FNCA 1QSRA 4QVTA 4KLVA 3R95A 4B5PA 4K30A 4UWJA 2VXKA 1Z4RA 1YVOA 4JWPA 3ZJ0A 3CXSA 4B5PB 4PV6A 5C88A 2FSRA 4H6ZA 4HNXB 5F46A 4CRZB 2BEIA 1U6MA 3DR6A 1YLEA 3F8KA 4AVCA 2GANA 2B5GB 2ATRA 4KOTA 1KUXA 2REEA 2FE7A 5J8CA 1Z4EA 1IIDA 2Z10A 1RXTA 3P2FA 3F0AA 1WWZA 2I79A 1IB1E 3G8WA 4QUSA 1Y7RA 4OLLA 3B8GA 4R87A 3DR8A 2PQ8A 2G3AA 4KUAA 2KCWA 3T9YA 2O28A 4Y49B 3BJ8A 4U5YA 1I1DA 3PZJA 4MY3A 5I0CA 1IYLA 1SQHA 1YR0A 2VI7A 4XPLA 5C82A 3QAHA 4KOYA 2FS5A 4CS0B 1QSNA 4IUSA 2G0BA 2JLMA 1KZFA 3DNSA 4CAVA 4NXYA 4HNYB 4RS2A 2B4BA 2Q7BA 1XMTA 4ZBGA 1PUAA 2QIRA 4Y49C 4JJXA 4UWIA 4FD4A 4PK2A 2VZYA 4MI4A 2REFA 3TT2A 3FRMA 4XNHC 1MJ9A 4QBJA 2OB0A 2R7HA 4CAWA 3N7ZA 3TFYA 2OZGA 3TO7A 1S7KA 2P0WA 3SHPA 2BUEA 1IICA 4KOUA 5JQ4A 1S7FA 2VZZA 3GYAA 1OZPA 2ZW5A 4M3SA 4I49A 4KOVA
chains in the Genus database with same CATH superfamily
4PPZA 2P6GA 2B3UA 4YGOA 4FD7A 2QMLA 3D67A 4PXEA 2AJ6A 4OC2A 4BBHA 1BOBA 2Z11A 2Q7SA 4UF4A 4FD5A 1BO4A 3I9SA 3IFEA 2PRQA 2Q4ZA 1TF8A 2Z3PA 4NGQA 4ONUA 5IB9A 5FVJA 4C68A 3MGDA 2AFMA 1B87A 3KR4A 5IX3A 1XIXA 1EE3P 4EMEA 3PB6X 3GB0A 4KOXA 2VQYA 4CGOA 3EO4A 3GLJA 5IB0A 2FIAA 2Q51A 2PVVA 4A30A 3VWDA 2B4DA 3FEDA 4MFPA 3SXNA 2B5GA 3OWCA 4A39A 1M4GA 3IJ3A 2CNSA 2NYQA 3BLNA 5H84A 4MJ8A 3H8FA 4UA3A 1F2OA 2HUZA 4K3NA 2POKA 2Q0YA 2VBQA 4FUUA 2I3CA 2EO8A 5K8MA 4ZY0A 3SI2A 2WPXA 2XEJA 2Z3KA 4MCRA 1F2PA 1R43A 5JM6A 3D66A 5G21A 5GCNA 5F49A 3W6XA 4G1PA 1LOKA 2B4DB 3D2PA 1PCAA 4H6UA 4IAVA 2OOTA 4UIAA 4DNCA 5LYIA 2CF4A 3IU1A 4PSXA 2D4PA 4Z65A 3VATA 1KWMA 1J4JA 4P44A 5LYDA 4CGPA 3B3CA 1Q2YA 1VGYA 4AG9A 1ZG8A 4UBRA 4KSAA 3FIXA 1YLOA 4KVME 1MJBA 2V77A 3EY5A 2JEWA 1KUYA 3PGPA 4L89A 4U9YA 2ZEOA 4J3GA 2Q04A 3W91A 4MMOA 1S5KA 1QSTA 1YREA 3E0KA 4U9ZA 5K8NA 2DF5A 2Z3LA 2CIJA 2PR1A 4TWEA 3EC4A 3LACA 7CPAA 5JPHA 1R57A 2QECA 4B11A 3PBBA 2PSWA 4M6HA 2PJ4A 4MY0A 4NCZA 4FD6A 3ZZIA 3BI0A 4XPDB 1P4NA 1BLLE 2HV2A 1A2ZA 3RYOA 1S60A 1S7NA 2CNMA 3NFZA 4UCNA 4RI1A 4YRHA 5J1QA 5EMIA 4II9A 4E0AA 2A4NA 4PK3A 4YFJA 4R9MA 4A2ZA 2EWBA 2DXQA 2EK9A 4UFVA 5J8FA 4OIDA 1XEBA 1RO5A 1P0HA 3ISZA 2X7BA 2RFHA 3H8EA 1QSOA 3HUVA 4ZI6A 4X8IA 4NF1A 3S9MA 3D7HA 5KTCA 3TTHA 2QYVA 2NMTA 2IL4A 5ISVA 2PJ3A 3PFOA 2GLFA 2H5MA 2PJ0A 1PU9A 3LWUA 1MK4A 5F48A 2AFOA 3RAMA 4CRYB 1CPXA 2XEFA 3SI0A 3PEIA 3D7DA 4PXCA 4XPDC 4MHZA 2J8NA 3KKWA 3KL9A 4B6ZA 4MFZA 4PXBA 5LRKA 2ZXVA 3D2MA 5AG5A 1LRZA 4R3LA 1HDQA 2YGWA 4B5OA 3IEHA 4CYQA 1NE9A 2Q44A 2WUUA 1VKCA 2YNEA 5HMNA 4C2YA 1CM0A 1Z9UA 1X12A 1M4DA 2EK8A 3I1UA 5KTDA 2ANPA 2FVGA 2PJ6A 2O53A 2RB7A 1YX0A 1YVKA 1Q2DA 3S6KA 3WT4A 4F6AA 1TF9A 5HXDA 2FCKA 1S7LA 5KTAA 2PJ9A 3WC5A 3B2YA 3IGRA 3GY9A 3HLPA 4R3KA 2FIWA 3WC7A 4HKFA 2FXFA 3S6HA 2QJ8A 4MCQA 5BWAB 2GIVA 1BPMA 3CT9A 3TOBA 4UIBA 4F9VA 4M85A 3LD2A 2JEVA 3C26A 4CGLA 2EVNA 2Q4VA 1ZG7A 3DDDA 1H8LA 3R1KA 3LMSA 2ODFA 2ARHA 4IF5A 3BJ7A 2V8HA 1ON0A 4E2AA 2IQ6A 4QB9A 4JLYA 5DWMA 4EVYA 2ZW4A 4RN7A 4LQGA 4AB7A 4X2TA 2WSAA 2CXAA 4KORA 2FT0A 3P2HA 1CJWA 3L2NA 1M1DA 5EBVA 2VEZA 3KASA 3JVNA 1ARLA 1FY7A 5HVFA 4JXQA 2DPSA 4R7MA 4ZYQA 4KUBA 2K5TA 3EFAA 1XBUA 3FB3A 3NE8A 1XRYA 2FL4A 3SJGA 3NA6A 2PJ8A 2R1IA 3B3WA 3H4QA 4H2KA 4OADA 3QB8A 1Z8LA 4OIWA 3ISXA 1FT7A 1S3ZA 3KQZA 4LUAA 4KZTA 3D3SA 3RBUA 2BSWA 2IJZA 3FECA 3GUXA 4KSFA 3S6GA 4B13A 1NMTA 1PYTB 3SJXA 3NE7A 5K8OA 2PJ5A 3TO6A 4OC0A 2BOAA 4MHDA 1N71A 4KOWA 5AGEA 3V8IA 3CDXA 1UWYA 1WK4A 4KVOE 4P45A 2Z3OA 3GIUA 1VHEA 5ELYA 4WWVA 4GM5A 5CNPA 1TKHA 2HB6A 3H5ZA 2IMOA 4NGTA 5AG4A 4DYOA 8CPAA 1Q7LA 2EUIA 1QSMA 3TO9A 3RNZA 5THWA 1Y9WA 2OZHA 2D4OA 2RC4A 4P4BA 3T8WA 4JD6A 4A37A 1M44A 1VHSA 3PB7X 2PIYA 4OC5A 2OU2A 2P6EA 2R8VA 4TNUA 4B10A 3W6SA 1KUVA 2C6GA 4H89A 3D4UA 4MCPA 1YGHA 1JQGA 4NGRA 4X5KA 1M4LA 3FXTA 3PRTA 3NH8A 3D7FA 2GLJA 1LAMA 2PC1A 2ZEEA 2CTCA 1VHOA 2ZW6A 4A32A 1TKJA 1V0CA 2ZW7A 3RO0A 5AG7A 4KOSA 4X3RA 3PBEA 2V8VA 4GS4A 2OR4A 3SXOA 4NSQA 1YSJA 4F9UA 3IWGA 5DWNA 2HQYA 3PFEA 1LANA 3B3TA 2G9DA 4MBUA 3CXQA 2PE3A 2ZEHA 1IGBA 4RUHA 4FAIA 3R9GA 3PB4X 4R57A 3KHZA 4A95A 2AFWA 3KQXA 6CPAA 2J8RA 3PB9X 4P4FA 4NGNA 4F8ZA 1LAPA 1L0CA 2F7VA 1TIQA 1YW6A 2P6FA 3GKRA 5G1ZA 2G3TA 1MJAA 2ZEPA 2YNCA 2GE3A 3EXNA 4OAEA 1CP6A 2ZPAA 1Q2CA 3WC6A 4F0YA 1DTDA 3R96A 2ABZA 1XFOA 4OC3A 2Q4YA 4ORFA 2DEAA 1M4IA 2DPTA 1IYKA 3DSBA 1XF8A 2ZOFA 4NEXA 4Q38A 2JBJA 2R98A 4CAFA 2PRBA 1F57A 4UCPA 4DJLA 2OZUA 1UFHA 2WPWA 2XEIA 3JUWA 4NGPA 1JWQA 3KHXA 2BO9A 3VWEA 1GHEA 2B3VA 4EFDA 1I21A 4C2ZA 3DLJA 5H86A 4XNHB 4MFKA 1TKFA 1CX8A 3MRUA 1B6BA 5LRJA 3UY5A 4UEEA 1BPNA 5EC4A 3IWEA 1I12A 4UFXA 1VIXA 1Y9KA 2Y0MA 4W9YA 3RZAA 4CAXA 4F0XA 3NH4A 3R9EA 2PR8A 3CXPA 1YQEA 2PCUA 5DS0A 2J8MA 4R8FA 5HH1A 2Z0ZA 2OH1A 1XJOA 2O4HA 4L8AA 4BD9A 3TE4A 2GREA 3IU2A 4E8OA 5A27A 2YNCC 3PP9A 5IV0A 3TCVA 1CP7A 2C1CA 2ZEDA 4JXRA 4OP4A 5LRGA 4AVBA 2F5IA 2QVPA 1Z8XA 3B3SA 1XE4A 5JH9A 3IC1A 3IIBA 2C27A 2CY2A 3KGQA 2PJ7A 2GFQA 5HVGA 4CGNA 3FYNA 2J9AA 1X10A 2I00A 2CNTA 5CPAA 3F5BA 5E96A 1DE4C 4LQ6A 4XPKA 4KVXA 4HNWB 4CYPA 2PDOA 5F09A 5F47A 1NSLA 2B58A 4P10A 4LX9A 3CPXA 3WR7A 1CPSA 3S6FA 4AG7A 1FNOA 1K4JA 3B7IA 3K9TA 3FBUA 4MFQA 4KLWA 3R9FA 1RTQA 4ZGYB 2JDCA 1Y0RA 3FEEA 5LYLA 4UEFA 3G3SA 3T90A 3IWWA 4IHMA 4PSWA 1Z5RA 2BL1A 3TOAA 3TC8A 1ZLHA 2AE6A 3I3GA 3D8PA 2YNDA 4UFWA 1YK3A 3LODA 4QC6A 5AG6A 2AFXA 4MHPA 3DGVA 3K9UA 2VL1A 4AVAA 4BMHA 3FNCA 1QSRA 4QVTA 4KLVA 1IOFA 3WABA 2PJAA 3R95A 3H8GA 4K30A 4B5PA 4PQAA 4OC4A 4ONWA 3TX8A 4A38A 3KI9A 3QNVA 4OKOA 1GYTA 2Z3NA 4UWJA 3IO1A 2VXKA 3B35A 1YMEA 1QQ9A 1Z4RA 3FF3A 4B12A 4CAEA 3SJEA 1YVOA 4JWPA 3ZJ0A 4BINA 3CXSA 1YW4A 4A94A 4NGSA 4B5PB 5JGFA 2AFZA 4PV6A 5C88A 5D8NA 1Z8TA 3BI1A 5CBMA 4A33A 2PJBA 4CYNA 2FSRA 2JBKA 2V8DA 4H6ZA 4HNXB 5F46A 4CRZB 1ZLIA 2BEIA 4NGMA 1U6MA 3DR6A 4C7HA 1YLEA 4C7IA 4EWTA 1CBXA 1XMBA 3F8KA 2HC9A 2ZEMA 2XEGA 4AVCA 2GANA 1CG2A 3NH5A 4NFRA 4OC1A 3FX6A 2B5GB 2AFUA 2C6CA 2ATRA 4KOTA 1KUXA 4NJQA 3V7ZA 4HPSA 2REEA 3B3VA 2FE7A 3BXMA 5J8CA 3FMCA 2ZOGA 1AYEA 1Z4EA 1IIDA 3S9NA 2Z10A 1QMUA 3V38A 1RXTA 3P2FA 2PJCA 3KR5A 4PXDA 3VARA 1Y0YA 4UCMA 3FH4A 4MHNA 4OMEA 3CZXA 3CPAA 3F0AA 4MFJA 1WWZA 1ELLP 2I79A 2ZEGA 1IB1E 3G8WA 4Q36A 2BCOA 1Y7RA 2F8HA 4OLLA 4QUSA 2Q43A 4ZY1A 1BAVA 4NJRA 1Y7EA 4ZY2A 3B8GA 4R87A 3DR8A 2PQ8A 2G3AA 4CPAA 4KUAA 4UEZA 2KCWA 2WZNA 1HEEA 2PIZA 4IK2A 4O23A 3T9YA 3QAYA 2C6PA 4CGMA 2O28A 1Z2LA 4Y49B 2ZELA 3BJ8A 4P4IA 4U5YA 1I1DA 3SI1A 4ZX9A 4R6TA 3PZJA 4MY3A 5I0CA 3D68A 2ZENA 5HVHA 4AXVA 1IYLA 2PJ2A 5K8PA 1ARMA 3D7GA 1SQHA 3N5FA 1YR0A 1TXRA 2VI7A 4GXHA 4XPLA 5C82A 1IU8A 2PJ1A 4MFLA 3QAHA 3S9LA 3MN8A 2ZEFA 4KOYA 3FVLA 4KSIA 2FS5A 4M6GA 4MXUA 1QSNA 4IUSA 4P6YA 4CS0B 2G0BA 2JLMA 1KZFA 3DNSA 3KZWA 4CAVA 4NXYA 4P4DA 2AFSA 4Q7AA 4A31A 4M6IA 4HNYB 4RS2A 2PVWA 1IY7A 2B4BA 2Q7BA 1XMTA 4ZBGA 1PUAA 2CTBA 2QIRA 4Y49C 4JJXA 4MHYA 1R3NA 4FBEA 4KS9A 4UWIA 1IOIA 2WYRA 4FD4A 4YU9A 3JTKA 1AMPA 3PB8X 4PK2A 2VZYA 4MI4A 1ZG9A 2REFA 4P4JA 2V8GA 2Z3MA 4KOVA 4WJBA 3TT2A 3FRMA 2EBJA 4JYWA 4XNHC 1MJ9A 1OBRA 1Z8WA 3K2KA 2GU2A 4QBJA 5G22A 2OB0A 1ZO0A 1NSAA 2R7HA 4ZX8A 4CAWA 3N7ZA 5LYFA 3TFYA 2OZGA 4JZ0A 5D29A 3TO7A 1S7KA 4CYOA 2P0WA 1AUGA 3SHPA 2BUEA 4DUKA 1HDUA 1IICA 4C2XA 1ELMP 3SJFA 4KOUA 3VH9A 1XOVA 3FJUA 3A9LA 1S7FA 3BHXA 2VZZA 5JQ4A 4FWUA 4P4EA 4R76A 4MCSA 3JRUA 3GYAA 1OZPA 5A28A 5I4MA 2ZW5A 1LCPA 4YWYA 5G20A 4M3SA 4B14A 4I49A 2JDDA 2NSMA 1LFWA 4MRIA
chains in the Genus database with same CATH topology
2P6GA 2B3UA 4YGOA 4FD7A 2QMLA 2AJ6A 4BBHA 1BOBA 2Z11A 4FD5A 1BO4A 3I9SA 2Z3PA 4ONUA 5FVJA 4C68A 3MGDA 1B87A 5IX3A 1XIXA 4KOXA 2VQYA 4CGOA 3EO4A 5IB0A 2FIAA 4A30A 3VWDA 2B4DA 4MFPA 3SXNA 2B5GA 3OWCA 1M4GA 2CNSA 3BLNA 5H84A 4MJ8A 4UA3A 2HUZA 2VBQA 2Q0YA 2WPXA 2Z3KA 5G21A 5GCNA 5F49A 3W6XA 3D2PA 2B4DB 4H6UA 4DNCA 4PSXA 3IU1A 2D4PA 1J4JA 4CGPA 1Q2YA 4AG9A 4UBRA 4KSAA 3FIXA 4KVME 1MJBA 3EY5A 1KUYA 3PGPA 4L89A 4U9YA 4J3GA 2Q04A 3W91A 1S5KA 1QSTA 1YREA 3E0KA 4U9ZA 2Z3LA 2PR1A 3EC4A 5JPHA 1R57A 2QECA 4B11A 2PSWA 4MY0A 4NCZA 4FD6A 3ZZIA 4XPDB 1P4NA 2HV2A 3RYOA 1S60A 1S7NA 2CNMA 4UCNA 4RI1A 4YRHA 4II9A 4E0AA 2A4NA 4PK3A 4YFJA 4R9MA 4A2ZA 2DXQA 4UFVA 5J8FA 1XEBA 1RO5A 1P0HA 2X7BA 1QSOA 4NF1A 5KTCA 3TTHA 2NMTA 2IL4A 5ISVA 2H5MA 1PU9A 1MK4A 5F48A 4CRYB 4XPDC 2J8NA 3KKWA 4MFZA 2ZXVA 3D2MA 5AG5A 1LRZA 4R3LA 4B5OA 2YGWA 4CYQA 5HMNA 1NE9A 2Q44A 2WUUA 1VKCA 2YNEA 4C2YA 1CM0A 1Z9UA 1M4DA 5KTDA 1YX0A 1YVKA 1Q2DA 3S6KA 4F6AA 2FCKA 1S7LA 5KTAA 3IGRA 3GY9A 4R3KA 2FIWA 4HKFA 2FXFA 3S6HA 5BWAB 2GIVA 3TOBA 4M85A 3LD2A 2JEVA 3C26A 4CGLA 2EVNA 2Q4VA 3DDDA 3R1KA 2ARHA 4IF5A 3BJ7A 1ON0A 4E2AA 4QB9A 5DWMA 4JLYA 4EVYA 2ZW4A 4AB7A 2WSAA 2CXAA 4KORA 2FT0A 3P2HA 1CJWA 1M1DA 5EBVA 2VEZA 3JVNA 1FY7A 4JXQA 2DPSA 4KUBA 2K5TA 3EFAA 3FB3A 2FL4A 2R1IA 3H4QA 4OADA 3QB8A 1S3ZA 4LUAA 4KZTA 3D3SA 2BSWA 4KSFA 3S6GA 4B13A 1NMTA 3NE7A 3TO6A 4MHDA 1N71A 4KOWA 5AGEA 3V8IA 1WK4A 4KVOE 2Z3OA 5CNPA 3H5ZA 5AG4A 2EUIA 1QSMA 3TO9A 1Y9WA 2OZHA 2D4OA 2RC4A 4JD6A 1M44A 1VHSA 2OU2A 2P6EA 2R8VA 4B10A 3W6SA 1KUVA 4H89A 1YGHA 4X5KA 3FXTA 2PC1A 2ZW6A 4A32A 1V0CA 2ZW7A 5AG7A 4KOSA 4GS4A 3SXOA 4NSQA 3IWGA 5DWNA 2HQYA 4MBUA 3CXQA 3R9GA 4R57A 4A95A 2J8RA 3GKRA 1L0CA 1TIQA 2P6FA 5G1ZA 2G3TA 1MJAA 2YNCA 2GE3A 3EXNA 4OAEA 2ZPAA 1Q2CA 4F0YA 3R96A 2Q4YA 4ORFA 1M4IA 2DPTA 1IYKA 3DSBA 1XF8A 4NEXA 4Q38A 2R98A 4CAFA 2PRBA 4UCPA 2OZUA 1UFHA 2WPWA 3JUWA 3VWEA 1GHEA 2B3VA 1I21A 4C2ZA 5H86A 4XNHB 4MFKA 1B6BA 3UY5A 5EC4A 3IWEA 1I12A 4UFXA 1Y9KA 2Y0MA 4CAXA 4F0XA 3R9EA 2PR8A 3CXPA 2J8MA 5HH1A 2Z0ZA 2OH1A 3TE4A 4L8AA 3IU2A 4E8OA 5A27A 2YNCC 3PP9A 5IV0A 3TCVA 4JXRA 4AVBA 2F5IA 1XE4A 2C27A 2CY2A 4CGNA 3FYNA 2I00A 2CNTA 3F5BA 5E96A 4XPKA 4CYPA 4KVXA 4HNWB 2PDOA 5F47A 1NSLA 2B58A 3WR7A 4LX9A 4AG7A 3S6FA 1K4JA 3FBUA 4MFQA 4KLWA 3R9FA 4ZGYB 2JDCA 3G3SA 3T90A 4PSWA 2BL1A 3TOAA 3I3GA 2AE6A 3D8PA 2YNDA 4UFWA 1YK3A 3LODA 4QC6A 5AG6A 3K9UA 4AVAA 4BMHA 3FNCA 1QSRA 4QVTA 4KLVA 3R95A 4B5PA 4K30A 2Z3NA 4UWJA 2VXKA 1Z4RA 4CAEA 4B12A 1YVOA 4JWPA 3ZJ0A 3CXSA 4B5PB 4PV6A 5C88A 4A33A 4CYNA 2FSRA 4H6ZA 4HNXB 5F46A 4CRZB 2BEIA 1U6MA 3DR6A 4C7HA 1YLEA 4C7IA 3F8KA 4AVCA 2GANA 2B5GB 2ATRA 4KOTA 1KUXA 2REEA 2FE7A 5J8CA 1Z4EA 1IIDA 2Z10A 1RXTA 3P2FA 4UCMA 4MFJA 3F0AA 1WWZA 2I79A 1IB1E 3G8WA 4Q36A 4QUSA 1Y7RA 4OLLA 3B8GA 4R87A 3DR8A 2PQ8A 2G3AA 4KUAA 2KCWA 3T9YA 4CGMA 2O28A 4Y49B 3BJ8A 4U5YA 1I1DA 3PZJA 4MY3A 5I0CA 1IYLA 1SQHA 1YR0A 2VI7A 4XPLA 5C82A 4MFLA 3QAHA 4KOYA 2FS5A 4CS0B 1QSNA 4IUSA 2G0BA 2JLMA 1KZFA 3DNSA 4CAVA 4NXYA 4A31A 4HNYB 4RS2A 2B4BA 2Q7BA 1XMTA 4ZBGA 1PUAA 2QIRA 4Y49C 4JJXA 4KS9A 4UWIA 4FD4A 3JTKA 4PK2A 2VZYA 4MI4A 2REFA 2Z3MA 4KOVA 3TT2A 3FRMA 4XNHC 1MJ9A 4QBJA 5G22A 2OB0A 1ZO0A 2R7HA 4CAWA 3N7ZA 3TFYA 2OZGA 3TO7A 1S7KA 4CYOA 2P0WA 3SHPA 2BUEA 1IICA 4C2XA 4KOUA 3A9LA 1S7FA 5JQ4A 2VZZA 3GYAA 1OZPA 5A28A 2ZW5A 5G20A 4M3SA 4B14A 4I49A 2JDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6G A;  2B3U A;  4YGO A;  4FD7 A;  2QML A;  2AJ6 A;  1BOB A;  2Z11 A;  4FD5 A;  1BO4 A;  3I9S A;  4ONU A;  5FVJ A;  3MGD A;  1B87 A;  5IX3 A;  1XIX A;  4KOX A;  2VQY A;  3EO4 A;  5IB0 A;  2FIA A;  3VWD A;  2B4D A;  3SXN A;  2B5G A;  3OWC A;  1M4G A;  2CNS A;  3BLN A;  5H84 A;  4MJ8 A;  4UA3 A;  2HUZ A;  2VBQ A;  2Q0Y A;  2WPX A;  5GCN A;  5F49 A;  3W6X A;  3D2P A;  2B4D B;  4H6U A;  4DNC A;  4PSX A;  2D4P A;  1J4J A;  1Q2Y A;  4AG9 A;  4UBR A;  3FIX A;  4KVM E;  1MJB A;  3EY5 A;  1KUY A;  3PGP A;  4L89 A;  4U9Y A;  4J3G A;  2Q04 A;  3W91 A;  1S5K A;  1QST A;  1YRE A;  3E0K A;  4U9Z A;  2PR1 A;  3EC4 A;  5JPH A;  1R57 A;  2QEC A;  2PSW A;  4MY0 A;  4NCZ A;  4FD6 A;  3ZZI A;  4XPD B;  1P4N A;  2HV2 A;  3RYO A;  1S60 A;  1S7N A;  2CNM A;  4YRH A;  4RI1 A;  4II9 A;  4E0A A;  2A4N A;  4PK3 A;  4YFJ A;  4R9M A;  2DXQ A;  5J8F A;  1XEB A;  1RO5 A;  1P0H A;  2X7B A;  1QSO A;  4NF1 A;  5KTC A;  3TTH A;  2NMT A;  2IL4 A;  5ISV A;  2H5M A;  1PU9 A;  1MK4 A;  5F48 A;  4CRY B;  4XPD C;  2J8N A;  3KKW A;  2ZXV A;  3D2M A;  1LRZ A;  4R3L A;  4B5O A;  5HMN A;  1NE9 A;  2Q44 A;  1VKC A;  1CM0 A;  1Z9U A;  1M4D A;  5KTD A;  1YX0 A;  1YVK A;  1Q2D A;  3S6K A;  4F6A A;  2FCK A;  1S7L A;  5KTA A;  3IGR A;  3GY9 A;  4R3K A;  2FIW A;  4HKF A;  2FXF A;  3S6H A;  2GIV A;  3TOB A;  4M85 A;  3LD2 A;  2JEV A;  3C26 A;  2EVN A;  2Q4V A;  3DDD A;  3R1K A;  2ARH A;  4IF5 A;  3BJ7 A;  1ON0 A;  4E2A A;  4QB9 A;  5DWM A;  4JLY A;  4EVY A;  2ZW4 A;  4AB7 A;  4KOR A;  2FT0 A;  3P2H A;  1CJW A;  1M1D A;  5EBV A;  2VEZ A;  3JVN A;  1FY7 A;  4JXQ A;  4KUB A;  2K5T A;  3EFA A;  3FB3 A;  2FL4 A;  2R1I A;  3H4Q A;  4OAD A;  3QB8 A;  1S3Z A;  4LUA A;  4KZT A;  3D3S A;  2BSW A;  3S6G A;  1NMT A;  3NE7 A;  3TO6 A;  4MHD A;  1N71 A;  4KOW A;  3V8I A;  1WK4 A;  4KVO E;  5CNP A;  2EUI A;  1QSM A;  3TO9 A;  1Y9W A;  2OZH A;  2D4O A;  2RC4 A;  4JD6 A;  1M44 A;  1VHS A;  2OU2 A;  2P6E A;  2R8V A;  3W6S A;  1KUV A;  4H89 A;  1YGH A;  4X5K A;  3FXT A;  2PC1 A;  2ZW6 A;  1V0C A;  2ZW7 A;  4KOS A;  2JDD A;  4GS4 A;  3SXO A;  4NSQ A;  3IWG A;  5DWN A;  2HQY A;  4MBU A;  3CXQ A;  3R9G A;  4R57 A;  2J8R A;  3GKR A;  1L0C A;  1TIQ A;  2P6F A;  2G3T A;  1MJA A;  2GE3 A;  3EXN A;  4OAE A;  2ZPA A;  1Q2C A;  4F0Y A;  3R96 A;  2Q4Y A;  4ORF A;  1M4I A;  1IYK A;  3DSB A;  1XF8 A;  4NEX A;  2R98 A;  2PRB A;  2OZU A;  1UFH A;  2WPW A;  3JUW A;  3VWE A;  1GHE A;  2B3V A;  1I21 A;  5H86 A;  4XNH B;  1B6B A;  3UY5 A;  5EC4 A;  1I12 A;  1Y9K A;  2Y0M A;  4CAX A;  3R9E A;  2PR8 A;  3CXP A;  2J8M A;  5HH1 A;  2Z0Z A;  2OH1 A;  3TE4 A;  4L8A A;  4E8O A;  5IV0 A;  3PP9 A;  3TCV A;  4JXR A;  4AVB A;  2F5I A;  1XE4 A;  2C27 A;  2CY2 A;  3FYN A;  2I00 A;  2CNT A;  3F5B A;  5E96 A;  4XPK A;  4KVX A;  4HNW B;  2PDO A;  5F47 A;  1NSL A;  2B58 A;  3WR7 A;  4LX9 A;  4AG7 A;  3S6F A;  1K4J A;  3FBU A;  3R9F A;  4KLW A;  2JDC A;  3G3S A;  3T90 A;  4PSW A;  2BL1 A;  3TOA A;  3I3G A;  2AE6 A;  3D8P A;  1YK3 A;  3LOD A;  4QC6 A;  3K9U A;  4AVA A;  4BMH A;  3FNC A;  1QSR A;  4QVT A;  4KLV A;  3R95 A;  4B5P A;  4K30 A;  4UWJ A;  2VXK A;  1Z4R A;  1YVO A;  4JWP A;  3ZJ0 A;  3CXS A;  4B5P B;  4PV6 A;  5C88 A;  2FSR A;  4H6Z A;  4HNX B;  5F46 A;  4CRZ B;  2BEI A;  1U6M A;  3DR6 A;  1YLE A;  3F8K A;  4AVC A;  2GAN A;  2B5G B;  2ATR A;  4KOT A;  1KUX A;  2REE A;  2FE7 A;  5J8C A;  1Z4E A;  1IID A;  2Z10 A;  1RXT A;  3P2F A;  3F0A A;  1WWZ A;  2I79 A;  1IB1 E;  3G8W A;  4QUS A;  1Y7R A;  4OLL A;  3B8G A;  4R87 A;  3DR8 A;  2PQ8 A;  2G3A A;  4KUA A;  2KCW A;  3T9Y A;  2O28 A;  4Y49 B;  3BJ8 A;  4U5Y A;  1I1D A;  3PZJ A;  4MY3 A;  5I0C A;  1IYL A;  1SQH A;  1YR0 A;  2VI7 A;  4XPL A;  5C82 A;  3QAH A;  4KOY A;  2FS5 A;  4CS0 B;  1QSN A;  4IUS A;  2G0B A;  2JLM A;  1KZF A;  3DNS A;  4CAV A;  4NXY A;  4HNY B;  4RS2 A;  2B4B A;  2Q7B A;  1XMT A;  4ZBG A;  1PUA A;  2QIR A;  4Y49 C;  4JJX A;  4UWI A;  4FD4 A;  4PK2 A;  2VZY A;  4MI4 A;  2REF A;  3TT2 A;  3FRM A;  4XNH C;  1MJ9 A;  4QBJ A;  2OB0 A;  2R7H A;  4CAW A;  3N7Z A;  3TFY A;  2OZG A;  3TO7 A;  1S7K A;  2P0W A;  3SHP A;  2BUE A;  1IIC A;  4KOU A;  5JQ4 A;  1S7F A;  2VZZ A;  3GYA A;  1OZP A;  2ZW5 A;  4M3S A;  4I49 A;  4KOV A; 
#chains in the Genus database with same CATH topology
 4PPZ A;  2P6G A;  2B3U A;  4YGO A;  4FD7 A;  2QML A;  3D67 A;  4PXE A;  2AJ6 A;  4OC2 A;  4BBH A;  1BOB A;  2Z11 A;  2Q7S A;  4UF4 A;  4FD5 A;  1BO4 A;  3I9S A;  3IFE A;  2PRQ A;  2Q4Z A;  1TF8 A;  2Z3P A;  4NGQ A;  4ONU A;  5IB9 A;  5FVJ A;  4C68 A;  3MGD A;  2AFM A;  1B87 A;  3KR4 A;  5IX3 A;  1XIX A;  1EE3 P;  4EME A;  3PB6 X;  3GB0 A;  4KOX A;  2VQY A;  4CGO A;  3EO4 A;  3GLJ A;  5IB0 A;  2FIA A;  2Q51 A;  2PVV A;  4A30 A;  3VWD A;  2B4D A;  3FED A;  4MFP A;  3SXN A;  2B5G A;  3OWC A;  4A39 A;  1M4G A;  3IJ3 A;  2CNS A;  2NYQ A;  3BLN A;  5H84 A;  4MJ8 A;  3H8F A;  4UA3 A;  1F2O A;  2HUZ A;  4K3N A;  2POK A;  2Q0Y A;  2VBQ A;  4FUU A;  2I3C A;  2EO8 A;  5K8M A;  4ZY0 A;  3SI2 A;  2WPX A;  2XEJ A;  2Z3K A;  4MCR A;  1F2P A;  1R43 A;  5JM6 A;  3D66 A;  5G21 A;  5GCN A;  5F49 A;  3W6X A;  4G1P A;  1LOK A;  2B4D B;  3D2P A;  1PCA A;  4H6U A;  4IAV A;  2OOT A;  4UIA A;  4DNC A;  5LYI A;  2CF4 A;  3IU1 A;  4PSX A;  2D4P A;  4Z65 A;  3VAT A;  1KWM A;  1J4J A;  4P44 A;  5LYD A;  4CGP A;  3B3C A;  1Q2Y A;  1VGY A;  4AG9 A;  1ZG8 A;  4UBR A;  4KSA A;  3FIX A;  1YLO A;  4KVM E;  1MJB A;  2V77 A;  3EY5 A;  2JEW A;  1KUY A;  3PGP A;  4L89 A;  4U9Y A;  2ZEO A;  4J3G A;  2Q04 A;  3W91 A;  4MMO A;  1S5K A;  1QST A;  1YRE A;  3E0K A;  4U9Z A;  5K8N A;  2DF5 A;  2Z3L A;  2CIJ A;  2PR1 A;  4TWE A;  3EC4 A;  3LAC A;  7CPA A;  5JPH A;  1R57 A;  2QEC A;  4B11 A;  3PBB A;  2PSW A;  4M6H A;  2PJ4 A;  4MY0 A;  4NCZ A;  4FD6 A;  3ZZI A;  3BI0 A;  4XPD B;  1P4N A;  1BLL E;  2HV2 A;  1A2Z A;  3RYO A;  1S60 A;  1S7N A;  2CNM A;  3NFZ A;  4UCN A;  4RI1 A;  4YRH A;  5J1Q A;  5EMI A;  4II9 A;  4E0A A;  2A4N A;  4PK3 A;  4YFJ A;  4R9M A;  4A2Z A;  2EWB A;  2DXQ A;  2EK9 A;  4UFV A;  5J8F A;  4OID A;  1XEB A;  1RO5 A;  1P0H A;  3ISZ A;  2X7B A;  2RFH A;  3H8E A;  1QSO A;  3HUV A;  4ZI6 A;  4X8I A;  4NF1 A;  3S9M A;  3D7H A;  5KTC A;  3TTH A;  2QYV A;  2NMT A;  2IL4 A;  5ISV A;  2PJ3 A;  3PFO A;  2GLF A;  2H5M A;  2PJ0 A;  1PU9 A;  3LWU A;  1MK4 A;  5F48 A;  2AFO A;  3RAM A;  4CRY B;  1CPX A;  2XEF A;  3SI0 A;  3PEI A;  3D7D A;  4PXC A;  4XPD C;  4MHZ A;  2J8N A;  3KKW A;  3KL9 A;  4B6Z A;  4MFZ A;  4PXB A;  5LRK A;  2ZXV A;  3D2M A;  5AG5 A;  1LRZ A;  4R3L A;  1HDQ A;  2YGW A;  4B5O A;  3IEH A;  4CYQ A;  1NE9 A;  2Q44 A;  2WUU A;  1VKC A;  2YNE A;  5HMN A;  4C2Y A;  1CM0 A;  1Z9U A;  1X12 A;  1M4D A;  2EK8 A;  3I1U A;  5KTD A;  2ANP A;  2FVG A;  2PJ6 A;  2O53 A;  2RB7 A;  1YX0 A;  1YVK A;  1Q2D A;  3S6K A;  3WT4 A;  4F6A A;  1TF9 A;  5HXD A;  2FCK A;  1S7L A;  5KTA A;  2PJ9 A;  3WC5 A;  3B2Y A;  3IGR A;  3GY9 A;  3HLP A;  4R3K A;  2FIW A;  3WC7 A;  4HKF A;  2FXF A;  3S6H A;  2QJ8 A;  4MCQ A;  5BWA B;  2GIV A;  1BPM A;  3CT9 A;  3TOB A;  4UIB A;  4F9V A;  4M85 A;  3LD2 A;  2JEV A;  3C26 A;  4CGL A;  2EVN A;  2Q4V A;  1ZG7 A;  3DDD A;  1H8L A;  3R1K A;  3LMS A;  2ODF A;  2ARH A;  4IF5 A;  3BJ7 A;  2V8H A;  1ON0 A;  4E2A A;  2IQ6 A;  4QB9 A;  4JLY A;  5DWM A;  4EVY A;  2ZW4 A;  4RN7 A;  4LQG A;  4AB7 A;  4X2T A;  2WSA A;  2CXA A;  4KOR A;  2FT0 A;  3P2H A;  1CJW A;  3L2N A;  1M1D A;  5EBV A;  2VEZ A;  3KAS A;  3JVN A;  1ARL A;  1FY7 A;  5HVF A;  4JXQ A;  2DPS A;  4R7M A;  4ZYQ A;  4KUB A;  2K5T A;  3EFA A;  1XBU A;  3FB3 A;  3NE8 A;  1XRY A;  2FL4 A;  3SJG A;  3NA6 A;  2PJ8 A;  2R1I A;  3B3W A;  3H4Q A;  4H2K A;  4OAD A;  3QB8 A;  1Z8L A;  4OIW A;  3ISX A;  1FT7 A;  1S3Z A;  3KQZ A;  4LUA A;  4KZT A;  3D3S A;  3RBU A;  2BSW A;  2IJZ A;  3FEC A;  3GUX A;  4KSF A;  3S6G A;  4B13 A;  1NMT A;  1PYT B;  3SJX A;  3NE7 A;  5K8O A;  2PJ5 A;  3TO6 A;  4OC0 A;  2BOA A;  4MHD A;  1N71 A;  4KOW A;  5AGE A;  3V8I A;  3CDX A;  1UWY A;  1WK4 A;  4KVO E;  4P45 A;  2Z3O A;  3GIU A;  1VHE A;  5ELY A;  4WWV A;  4GM5 A;  5CNP A;  1TKH A;  2HB6 A;  3H5Z A;  2IMO A;  4NGT A;  5AG4 A;  4DYO A;  8CPA A;  1Q7L A;  2EUI A;  1QSM A;  3TO9 A;  3RNZ A;  5THW A;  1Y9W A;  2OZH A;  2D4O A;  2RC4 A;  4P4B A;  3T8W A;  4JD6 A;  4A37 A;  1M44 A;  1VHS A;  3PB7 X;  2PIY A;  4OC5 A;  2OU2 A;  2P6E A;  2R8V A;  4TNU A;  4B10 A;  3W6S A;  1KUV A;  2C6G A;  4H89 A;  3D4U A;  4MCP A;  1YGH A;  1JQG A;  4NGR A;  4X5K A;  1M4L A;  3FXT A;  3PRT A;  3NH8 A;  3D7F A;  2GLJ A;  1LAM A;  2PC1 A;  2ZEE A;  2CTC A;  1VHO A;  2ZW6 A;  4A32 A;  1TKJ A;  1V0C A;  2ZW7 A;  3RO0 A;  5AG7 A;  4KOS A;  4X3R A;  3PBE A;  2V8V A;  4GS4 A;  2OR4 A;  3SXO A;  4NSQ A;  1YSJ A;  4F9U A;  3IWG A;  5DWN A;  2HQY A;  3PFE A;  1LAN A;  3B3T A;  2G9D A;  4MBU A;  3CXQ A;  2PE3 A;  2ZEH A;  1IGB A;  4RUH A;  4FAI A;  3R9G A;  3PB4 X;  4R57 A;  3KHZ A;  4A95 A;  2AFW A;  3KQX A;  6CPA A;  2J8R A;  3PB9 X;  4P4F A;  4NGN A;  4F8Z A;  1LAP A;  1L0C A;  2F7V A;  1TIQ A;  1YW6 A;  2P6F A;  3GKR A;  5G1Z A;  2G3T A;  1MJA A;  2ZEP A;  2YNC A;  2GE3 A;  3EXN A;  4OAE A;  1CP6 A;  2ZPA A;  1Q2C A;  3WC6 A;  4F0Y A;  1DTD A;  3R96 A;  2ABZ A;  1XFO A;  4OC3 A;  2Q4Y A;  4ORF A;  2DEA A;  1M4I A;  2DPT A;  1IYK A;  3DSB A;  1XF8 A;  2ZOF A;  4NEX A;  4Q38 A;  2JBJ A;  2R98 A;  4CAF A;  2PRB A;  1F57 A;  4UCP A;  4DJL A;  2OZU A;  1UFH A;  2WPW A;  2XEI A;  3JUW A;  4NGP A;  1JWQ A;  3KHX A;  2BO9 A;  3VWE A;  1GHE A;  2B3V A;  4EFD A;  1I21 A;  4C2Z A;  3DLJ A;  5H86 A;  4XNH B;  4MFK A;  1TKF A;  1CX8 A;  3MRU A;  1B6B A;  5LRJ A;  3UY5 A;  4UEE A;  1BPN A;  5EC4 A;  3IWE A;  1I12 A;  4UFX A;  1VIX A;  1Y9K A;  2Y0M A;  4W9Y A;  3RZA A;  4CAX A;  4F0X A;  3NH4 A;  3R9E A;  2PR8 A;  3CXP A;  1YQE A;  2PCU A;  5DS0 A;  2J8M A;  4R8F A;  5HH1 A;  2Z0Z A;  2OH1 A;  1XJO A;  2O4H A;  4L8A A;  4BD9 A;  3TE4 A;  2GRE A;  3IU2 A;  4E8O A;  5A27 A;  2YNC C;  3PP9 A;  5IV0 A;  3TCV A;  1CP7 A;  2C1C A;  2ZED A;  4JXR A;  4OP4 A;  5LRG A;  4AVB A;  2F5I A;  2QVP A;  1Z8X A;  3B3S A;  1XE4 A;  5JH9 A;  3IC1 A;  3IIB A;  2C27 A;  2CY2 A;  3KGQ A;  2PJ7 A;  2GFQ A;  5HVG A;  4CGN A;  3FYN A;  2J9A A;  1X10 A;  2I00 A;  2CNT A;  5CPA A;  3F5B A;  5E96 A;  1DE4 C;  4LQ6 A;  4XPK A;  4KVX A;  4HNW B;  4CYP A;  2PDO A;  5F09 A;  5F47 A;  1NSL A;  2B58 A;  4P10 A;  4LX9 A;  3CPX A;  3WR7 A;  1CPS A;  3S6F A;  4AG7 A;  1FNO A;  1K4J A;  3B7I A;  3K9T A;  3FBU A;  4MFQ A;  4KLW A;  3R9F A;  1RTQ A;  4ZGY B;  2JDC A;  1Y0R A;  3FEE A;  5LYL A;  4UEF A;  3G3S A;  3T90 A;  3IWW A;  4IHM A;  4PSW A;  1Z5R A;  2BL1 A;  3TOA A;  3TC8 A;  1ZLH A;  2AE6 A;  3I3G A;  3D8P A;  2YND A;  4UFW A;  1YK3 A;  3LOD A;  4QC6 A;  5AG6 A;  2AFX A;  4MHP A;  3DGV A;  3K9U A;  2VL1 A;  4AVA A;  4BMH A;  3FNC A;  1QSR A;  4QVT A;  4KLV A;  1IOF A;  3WAB A;  2PJA A;  3R95 A;  3H8G A;  4K30 A;  4B5P A;  4PQA A;  4OC4 A;  4ONW A;  3TX8 A;  4A38 A;  3KI9 A;  3QNV A;  4OKO A;  1GYT A;  2Z3N A;  4UWJ A;  3IO1 A;  2VXK A;  3B35 A;  1YME A;  1QQ9 A;  1Z4R A;  3FF3 A;  4B12 A;  4CAE A;  3SJE A;  1YVO A;  4JWP A;  3ZJ0 A;  4BIN A;  3CXS A;  1YW4 A;  4A94 A;  4NGS A;  4B5P B;  5JGF A;  2AFZ A;  4PV6 A;  5C88 A;  5D8N A;  1Z8T A;  3BI1 A;  5CBM A;  4A33 A;  2PJB A;  4CYN A;  2FSR A;  2JBK A;  2V8D A;  4H6Z A;  4HNX B;  5F46 A;  4CRZ B;  1ZLI A;  2BEI A;  4NGM A;  1U6M A;  3DR6 A;  4C7H A;  1YLE A;  4C7I A;  4EWT A;  1CBX A;  1XMB A;  3F8K A;  2HC9 A;  2ZEM A;  2XEG A;  4AVC A;  2GAN A;  1CG2 A;  3NH5 A;  4NFR A;  4OC1 A;  3FX6 A;  2B5G B;  2AFU A;  2C6C A;  2ATR A;  4KOT A;  1KUX A;  4NJQ A;  3V7Z A;  4HPS A;  2REE A;  3B3V A;  2FE7 A;  3BXM A;  5J8C A;  3FMC A;  2ZOG A;  1AYE A;  1Z4E A;  1IID A;  3S9N A;  2Z10 A;  1QMU A;  3V38 A;  1RXT A;  3P2F A;  2PJC A;  3KR5 A;  4PXD A;  3VAR A;  1Y0Y A;  4UCM A;  3FH4 A;  4MHN A;  4OME A;  3CZX A;  3CPA A;  3F0A A;  4MFJ A;  1WWZ A;  1ELL P;  2I79 A;  2ZEG A;  1IB1 E;  3G8W A;  4Q36 A;  2BCO A;  1Y7R A;  2F8H A;  4OLL A;  4QUS A;  2Q43 A;  4ZY1 A;  1BAV A;  4NJR A;  1Y7E A;  4ZY2 A;  3B8G A;  4R87 A;  3DR8 A;  2PQ8 A;  2G3A A;  4CPA A;  4KUA A;  4UEZ A;  2KCW A;  2WZN A;  1HEE A;  2PIZ A;  4IK2 A;  4O23 A;  3T9Y A;  3QAY A;  2C6P A;  4CGM A;  2O28 A;  1Z2L A;  4Y49 B;  2ZEL A;  3BJ8 A;  4P4I A;  4U5Y A;  1I1D A;  3SI1 A;  4ZX9 A;  4R6T A;  3PZJ A;  4MY3 A;  5I0C A;  3D68 A;  2ZEN A;  5HVH A;  4AXV A;  1IYL A;  2PJ2 A;  5K8P A;  1ARM A;  3D7G A;  1SQH A;  3N5F A;  1YR0 A;  1TXR A;  2VI7 A;  4GXH A;  4XPL A;  5C82 A;  1IU8 A;  2PJ1 A;  4MFL A;  3QAH A;  3S9L A;  3MN8 A;  2ZEF A;  4KOY A;  3FVL A;  4KSI A;  2FS5 A;  4M6G A;  4MXU A;  1QSN A;  4IUS A;  4P6Y A;  4CS0 B;  2G0B A;  2JLM A;  1KZF A;  3DNS A;  3KZW A;  4CAV A;  4NXY A;  4P4D A;  2AFS A;  4Q7A A;  4A31 A;  4M6I A;  4HNY B;  4RS2 A;  2PVW A;  1IY7 A;  2B4B A;  2Q7B A;  1XMT A;  4ZBG A;  1PUA A;  2CTB A;  2QIR A;  4Y49 C;  4JJX A;  4MHY A;  1R3N A;  4FBE A;  4KS9 A;  4UWI A;  1IOI A;  2WYR A;  4FD4 A;  4YU9 A;  3JTK A;  1AMP A;  3PB8 X;  4PK2 A;  2VZY A;  4MI4 A;  1ZG9 A;  2REF A;  4P4J A;  2V8G A;  2Z3M A;  4KOV A;  4WJB A;  3TT2 A;  3FRM A;  2EBJ A;  4JYW A;  4XNH C;  1MJ9 A;  1OBR A;  1Z8W A;  3K2K A;  2GU2 A;  4QBJ A;  5G22 A;  2OB0 A;  1ZO0 A;  1NSA A;  2R7H A;  4ZX8 A;  4CAW A;  3N7Z A;  5LYF A;  3TFY A;  2OZG A;  4JZ0 A;  5D29 A;  3TO7 A;  1S7K A;  4CYO A;  2P0W A;  1AUG A;  3SHP A;  2BUE A;  4DUK A;  1HDU A;  1IIC A;  4C2X A;  1ELM P;  3SJF A;  4KOU A;  3VH9 A;  1XOV A;  3FJU A;  3A9L A;  1S7F A;  3BHX A;  2VZZ A;  5JQ4 A;  4FWU A;  4P4E A;  4R76 A;  4MCS A;  3JRU A;  3GYA A;  1OZP A;  5A28 A;  5I4M A;  2ZW5 A;  1LCP A;  4YWY A;  5G20 A;  4M3S A;  4B14 A;  4I49 A;  2JDD A;  2NSM A;  1LFW A;  4MRI A; 
#chains in the Genus database with same CATH homology
 2P6G A;  2B3U A;  4YGO A;  4FD7 A;  2QML A;  2AJ6 A;  4BBH A;  1BOB A;  2Z11 A;  4FD5 A;  1BO4 A;  3I9S A;  2Z3P A;  4ONU A;  5FVJ A;  4C68 A;  3MGD A;  1B87 A;  5IX3 A;  1XIX A;  4KOX A;  2VQY A;  4CGO A;  3EO4 A;  5IB0 A;  2FIA A;  4A30 A;  3VWD A;  2B4D A;  4MFP A;  3SXN A;  2B5G A;  3OWC A;  1M4G A;  2CNS A;  3BLN A;  5H84 A;  4MJ8 A;  4UA3 A;  2HUZ A;  2VBQ A;  2Q0Y A;  2WPX A;  2Z3K A;  5G21 A;  5GCN A;  5F49 A;  3W6X A;  3D2P A;  2B4D B;  4H6U A;  4DNC A;  4PSX A;  3IU1 A;  2D4P A;  1J4J A;  4CGP A;  1Q2Y A;  4AG9 A;  4UBR A;  4KSA A;  3FIX A;  4KVM E;  1MJB A;  3EY5 A;  1KUY A;  3PGP A;  4L89 A;  4U9Y A;  4J3G A;  2Q04 A;  3W91 A;  1S5K A;  1QST A;  1YRE A;  3E0K A;  4U9Z A;  2Z3L A;  2PR1 A;  3EC4 A;  5JPH A;  1R57 A;  2QEC A;  4B11 A;  2PSW A;  4MY0 A;  4NCZ A;  4FD6 A;  3ZZI A;  4XPD B;  1P4N A;  2HV2 A;  3RYO A;  1S60 A;  1S7N A;  2CNM A;  4UCN A;  4RI1 A;  4YRH A;  4II9 A;  4E0A A;  2A4N A;  4PK3 A;  4YFJ A;  4R9M A;  4A2Z A;  2DXQ A;  4UFV A;  5J8F A;  1XEB A;  1RO5 A;  1P0H A;  2X7B A;  1QSO A;  4NF1 A;  5KTC A;  3TTH A;  2NMT A;  2IL4 A;  5ISV A;  2H5M A;  1PU9 A;  1MK4 A;  5F48 A;  4CRY B;  4XPD C;  2J8N A;  3KKW A;  4MFZ A;  2ZXV A;  3D2M A;  5AG5 A;  1LRZ A;  4R3L A;  4B5O A;  2YGW A;  4CYQ A;  5HMN A;  1NE9 A;  2Q44 A;  2WUU A;  1VKC A;  2YNE A;  4C2Y A;  1CM0 A;  1Z9U A;  1M4D A;  5KTD A;  1YX0 A;  1YVK A;  1Q2D A;  3S6K A;  4F6A A;  2FCK A;  1S7L A;  5KTA A;  3IGR A;  3GY9 A;  4R3K A;  2FIW A;  4HKF A;  2FXF A;  3S6H A;  5BWA B;  2GIV A;  3TOB A;  4M85 A;  3LD2 A;  2JEV A;  3C26 A;  4CGL A;  2EVN A;  2Q4V A;  3DDD A;  3R1K A;  2ARH A;  4IF5 A;  3BJ7 A;  1ON0 A;  4E2A A;  4QB9 A;  5DWM A;  4JLY A;  4EVY A;  2ZW4 A;  4AB7 A;  2WSA A;  2CXA A;  4KOR A;  2FT0 A;  3P2H A;  1CJW A;  1M1D A;  5EBV A;  2VEZ A;  3JVN A;  1FY7 A;  4JXQ A;  2DPS A;  4KUB A;  2K5T A;  3EFA A;  3FB3 A;  2FL4 A;  2R1I A;  3H4Q A;  4OAD A;  3QB8 A;  1S3Z A;  4LUA A;  4KZT A;  3D3S A;  2BSW A;  4KSF A;  3S6G A;  4B13 A;  1NMT A;  3NE7 A;  3TO6 A;  4MHD A;  1N71 A;  4KOW A;  5AGE A;  3V8I A;  1WK4 A;  4KVO E;  2Z3O A;  5CNP A;  3H5Z A;  5AG4 A;  2EUI A;  1QSM A;  3TO9 A;  1Y9W A;  2OZH A;  2D4O A;  2RC4 A;  4JD6 A;  1M44 A;  1VHS A;  2OU2 A;  2P6E A;  2R8V A;  4B10 A;  3W6S A;  1KUV A;  4H89 A;  1YGH A;  4X5K A;  3FXT A;  2PC1 A;  2ZW6 A;  4A32 A;  1V0C A;  2ZW7 A;  5AG7 A;  4KOS A;  4GS4 A;  3SXO A;  4NSQ A;  3IWG A;  5DWN A;  2HQY A;  4MBU A;  3CXQ A;  3R9G A;  4R57 A;  4A95 A;  2J8R A;  3GKR A;  1L0C A;  1TIQ A;  2P6F A;  5G1Z A;  2G3T A;  1MJA A;  2YNC A;  2GE3 A;  3EXN A;  4OAE A;  2ZPA A;  1Q2C A;  4F0Y A;  3R96 A;  2Q4Y A;  4ORF A;  1M4I A;  2DPT A;  1IYK A;  3DSB A;  1XF8 A;  4NEX A;  4Q38 A;  2R98 A;  4CAF A;  2PRB A;  4UCP A;  2OZU A;  1UFH A;  2WPW A;  3JUW A;  3VWE A;  1GHE A;  2B3V A;  1I21 A;  4C2Z A;  5H86 A;  4XNH B;  4MFK A;  1B6B A;  3UY5 A;  5EC4 A;  3IWE A;  1I12 A;  4UFX A;  1Y9K A;  2Y0M A;  4CAX A;  4F0X A;  3R9E A;  2PR8 A;  3CXP A;  2J8M A;  5HH1 A;  2Z0Z A;  2OH1 A;  3TE4 A;  4L8A A;  3IU2 A;  4E8O A;  5A27 A;  2YNC C;  3PP9 A;  5IV0 A;  3TCV A;  4JXR A;  4AVB A;  2F5I A;  1XE4 A;  2C27 A;  2CY2 A;  4CGN A;  3FYN A;  2I00 A;  2CNT A;  3F5B A;  5E96 A;  4XPK A;  4CYP A;  4KVX A;  4HNW B;  2PDO A;  5F47 A;  1NSL A;  2B58 A;  3WR7 A;  4LX9 A;  4AG7 A;  3S6F A;  1K4J A;  3FBU A;  4MFQ A;  4KLW A;  3R9F A;  4ZGY B;  2JDC A;  3G3S A;  3T90 A;  4PSW A;  2BL1 A;  3TOA A;  3I3G A;  2AE6 A;  3D8P A;  2YND A;  4UFW A;  1YK3 A;  3LOD A;  4QC6 A;  5AG6 A;  3K9U A;  4AVA A;  4BMH A;  3FNC A;  1QSR A;  4QVT A;  4KLV A;  3R95 A;  4B5P A;  4K30 A;  2Z3N A;  4UWJ A;  2VXK A;  1Z4R A;  4CAE A;  4B12 A;  1YVO A;  4JWP A;  3ZJ0 A;  3CXS A;  4B5P B;  4PV6 A;  5C88 A;  4A33 A;  4CYN A;  2FSR A;  4H6Z A;  4HNX B;  5F46 A;  4CRZ B;  2BEI A;  1U6M A;  3DR6 A;  4C7H A;  1YLE A;  4C7I A;  3F8K A;  4AVC A;  2GAN A;  2B5G B;  2ATR A;  4KOT A;  1KUX A;  2REE A;  2FE7 A;  5J8C A;  1Z4E A;  1IID A;  2Z10 A;  1RXT A;  3P2F A;  4UCM A;  4MFJ A;  3F0A A;  1WWZ A;  2I79 A;  1IB1 E;  3G8W A;  4Q36 A;  4QUS A;  1Y7R A;  4OLL A;  3B8G A;  4R87 A;  3DR8 A;  2PQ8 A;  2G3A A;  4KUA A;  2KCW A;  3T9Y A;  4CGM A;  2O28 A;  4Y49 B;  3BJ8 A;  4U5Y A;  1I1D A;  3PZJ A;  4MY3 A;  5I0C A;  1IYL A;  1SQH A;  1YR0 A;  2VI7 A;  4XPL A;  5C82 A;  4MFL A;  3QAH A;  4KOY A;  2FS5 A;  4CS0 B;  1QSN A;  4IUS A;  2G0B A;  2JLM A;  1KZF A;  3DNS A;  4CAV A;  4NXY A;  4A31 A;  4HNY B;  4RS2 A;  2B4B A;  2Q7B A;  1XMT A;  4ZBG A;  1PUA A;  2QIR A;  4Y49 C;  4JJX A;  4KS9 A;  4UWI A;  4FD4 A;  3JTK A;  4PK2 A;  2VZY A;  4MI4 A;  2REF A;  2Z3M A;  4KOV A;  3TT2 A;  3FRM A;  4XNH C;  1MJ9 A;  4QBJ A;  5G22 A;  2OB0 A;  1ZO0 A;  2R7H A;  4CAW A;  3N7Z A;  3TFY A;  2OZG A;  3TO7 A;  1S7K A;  4CYO A;  2P0W A;  3SHP A;  2BUE A;  1IIC A;  4C2X A;  4KOU A;  3A9L A;  1S7F A;  5JQ4 A;  2VZZ A;  3GYA A;  1OZP A;  5A28 A;  2ZW5 A;  5G20 A;  4M3S A;  4B14 A;  4I49 A;  2JDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...