4QCIA

Pdgf-b blocking antibody bound to pdgf-bb
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
YELTQPPSVSVAPGQTARISCSGDSLGSYFVHWYQQKPGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSAFTHNSDVFGGGTKLTVLPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-PDGF-BB antibody - Light Chain
publication title Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 39
structure length 206
sequence length 206
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciA01
1JGUH 1JFQL 3ZDYF 1UM6H 2H2PD 4GW5B 5F1OB 2A77L 5FKPB 1LK3L 1TDQA 1OPGH 3CXHJ 4FQ1L 1MVUA 2QLVB 4ERSL 4AM0B 3K2MC 2BNRA 1G6RB 1T0MB 3VG0L 5DI8A 1P69B 1PX3A 5KSUB 1L6XA 5F6HI 4P5KB 4PJFA 3TM6A 3C5ZD 1JMZA 2HVJB 3BAEL 2P8PB 4KAQH 1DQJA 2W07A 5D70L 2J6EH 4OLUH 2FSEA 4Y16C 3ALXA 4Y4FB 1VGEL 2KBGA 3I6KA 5D7JD 5J06A 1VADA 4K8RH 5T3ZL 4DKDC 1RZJH 4XZUB 2WIIB 4OFVA 4YNYB 4HKZA 5KSBF 2ARJQ 3HLAB 3WIIL 3L3HA 4HHAA 4OZFB 4WI3A 5JLZB 4X4ZA 2V7NA 5F6IC 5EA0H 4HS6B 3DVGA 4R2GD 4BH8B 4RA3A 4LARL 4P2OC 1RURH 1T6WA 3MRPB 5F7EL 2MQ0A 2ITDA 3VRJA 3H42L 1WTGT 1IT9L 4ODXB 4XVTL 5DZNA 5IGXL 5LVEA 1P2CA 3V4PL 1P4IH 4J3XA 4ZS6D 5EUOA 4QNPF 1QSVA 2EE9A 2DI9A 4NO2B 3MV8B 4JDTH 4OM0L 5MHSD 5D6CB 3O3EB 1OAUL 4H5SB 1R5IB 3C6SB 4ZPVA 3FO2A 2DWDB 4NQXA 1M6OB 1YYMH 3OKMA 4R0LC 3G5XA 1XF3A 1N64L 2P7TB 5I18H 4RZCA 3CIQA 5CD5C 3KHQA 3O8XA 4HZLA 2V5TA 1CDYA 3ARGA 1CICC 1QSZA 5FO8B 3ZDZE 4XP6H 3WFHB 4OT1L 5JHLH 1RZGA 4WFHE 3GMOB 4HIJB 2NY6D 1S7WB 3QPQC 2XWJB 2XQYG 1S9WB 1NCAH 4P3CL 1IL1A 2IQ9H 5ID0B 1JGDA 2R0ZH 1MFBL 4O9HH 2WQ8A 1IZKA 1BQHA 4XP1L 4DZ8A 1DN0A 1I8KB 2OSLB 2VDQL 5GSVB 3AAZB 1Y18B 1CXIA 4R96B 1QA9B 3GNML 5I16A 5JQ6H 3BE1L 3VXRB 1B0RB 2AEWA 5BOPA 5HVGB 3ABZA 1UKQA 1P5UA 4JN2B 4JN1H 4D9RE 2Q76A 5J1TC 4JHWL 2DLIA 4X7DC 1Z5LA 4I48A 1UACH 3DJ9A 3NCEB 1YEKL 4U31A 2PO6B 3BPNC 5FUOH 2B4CC 2HVKA 2DQCH 2X4NA 3HG1D 4Y16D 3E2HB 4F7EB 5KG9A 3LN4A 2A6IA 1YEHH 4WWKB 3MV8E 3QJFA 1FZMA 3SDAD 4FTVA 3ISWA 5KVEL 3SKJH 3IS0X 2E7HA 3M45A 3GUTA 1G9ML 1QFHA 4X7TA 4ONFH 4TNWK 4QXUH 4NHUB 1NBVL 3TIDB 5EBGA 3UTSD 1KN4L 3PIQB 1QPXA 4PPTA 5IQ7H 2W38A 4XWGH 1N7MH 1XF2B 4XC3H 4NRZA 4KI5E 1JZ7A 4NZUL 1SY6H 3SKOB 3ILPB 1FFNB 4MAYC 3ILQC 3QQ3B 5HBBA 5DSCA 1EO7A 1RSFA 2PTTA 1WBXB 3MLSL 1TVHB 1I7TB 1MI5B 3BUTA 3PWNA 1KTDB 5ITBL 1CBVL 1S8DB 5GGVH 4JM2C 2BVYA 5DUBA 2G5RA 3CPLA 1QLFA 5J9PB 2HRPL 1EH9A 4ZDHA 3VXRE 1IKNC 1X5ZA 3U4AA 3WD5L 1T3FB 3EDEA 2Y07L 2P44B 4E41E 3FOLA 2JJTA 2XWBB 1F3JA 4Z0XA 3REWA 2MHAB 1A7PL 2RBLA 1HYRC 2ADJB 4UT9L 1YUHA 3H3BC 3IB4A 2VIRB 5LGJB 4ISVB 2VQTA 4LLAA 4Z5RB 2RQ8A 4XXCA 2PNDA 3T3PF 4OGYH 2AV7B 2E6JA 3QPQD 3VD7A 1BIIA 4HKXA 4YHKH 1OOAA 3C60C 2R69H 1QUNA 2AK1H 2DL9A 5E4EC 1A7BA 4BFIB 5HHQB 5JMOC 4UINH 3UDWA 3C5ZB 3FO1B 4P2RD 5HPMA 3FN9A 1A7RL 1R24A 4L4VE 1IAKA 2I9TA 4X8JA 1R0AL 5ENWA 3OKKB 1FPTL 4YO0B 4LLDB 1QSFD 2PYED 5D7JB 3DHJA 1MCHA 3MJGX 3VU2A 3IKCA 3MQIA 5IHBA 4OV5B 1IEAA 2AEQL 4S1SL 4GKNA 3HRPA 1JYWA 3MLZH 2MCG1 1EEYA 4F2MB 3OWEA 3QIWC 3UBXI 3D2UB 3O9WA 1KULA 1QFOA 1VGKA 3S37X 3B5TA 1MUJA 1UB6A 5I8CA 4UILH 4WIQA 3WN5B 4K9EL 4YXHL 4ELME 5L2JB 2QJDA 3QXDA 1CFTA 2OQJA 4ACPA 4JKWA 3TBVB 2LE9A 3TO4D 1HYSC 2OXHA 1DBML 4LVHC 5JA9A 3ROLA 4LSPH 1JHLL 2GTZB 1Q38A 2VAAA 1VACB 2CRMA 3QUXA 4PGEB 3T65B 2CGRL 3S37L 4P46D 2ENYA 4C56D 4F8TA 4MQ7B 1IQDA 4Y8AA 1H8NA 4QT5B 2QQKH 1ZEAL 4R9HA 1J0YA 4XB7A 2IAMA 1PVHA 3DX8B 2XI9A 3LD8C 3IU3A 1CI5A 4UV7L 4KVCH 1VKXA 2PW2A 1XH3B 3PWJB 5ESVB 5C0IB 3EFDH 3JWDL 4JPWH 2A73A 3EO1A 2NY6B 1TJIH 2HP4A 4P4KA 1Z3GH 5K9JH 4JM2D 1FCCA 1G7IB 1S7TA 1CXKA 8FABA 5E00A 4U4BA 3LS4H 4QHMB 4WTZG 1U8PB 3O2DH 3SKNA 3QDGD 4IMKC 1EAPB 3QNXA 1X6NA 5KANI 3C9NA 1MRCL 4W6YB 3MV11 3T04D 1RFDH 1KG0B 2AJZA 2E9WA 1OWWA 4FN0A 4LNVA 1Y0LA 2ITCB 4GQ9L 3LRGA 3BDXA 1FDLL 4YX2L 5GGQL 1JMXA 2H32B 3OXSB 4QRPA 3RU8L 4N0YL 5HYJB 2GJZB 2BVTA 4R90H 1L4IA 1Z2KA 1J8KA 1H5BC 5E2VL 4WCYL 1LILA 3MRBB 3HI5H 2P8LA 2CLRA 2Q7NA 3OXRB 1D6VH 4QXWA 2VSCA 2WV3A 1E4XL 1KCRL 3MJ7B 4WNQA 1JWMA 2XXCB 4J12A 1V7ML 4N5EC 4NDMA 5IW6A 5MEOB 5AZEL 3B8SA 5MHSE 4DCQB 3SDAB 1SM3H 4WEBH 2H8PB 4ZSOA 4WI6A 3OPZH 4GAFB 1KLFA 4L3CB 4Z7WE 3MRKA 4YHIA 3GO1H 5E8OA 3PNWA 2DD8H 4GOSA 4NO0D 4ZFOL 4I0KA 3RY4A 2OJZH 3HUJB 1VENA 3OG4B 4BA8A 4K7FA 3T0XA 2AJVH 3ZYZA 3IJHB 2DBLL 3WE6A 1FP5A 2FIKA 5H94A 4X6FA 4AIOA 2EDWA 5AAWA 2BSTB 4J1UB 5GRJH 2AGJL 4P2YA 4PJ8A 1RAMA 5BRZD 5C9JB 2WLYA 4NP4L 4WO4C 1YN6B 3VFMB 3MRRA 4M7JL 4IJ3B 1C12B 3WFBL 2ZCHL 1HYSD 1IZJA 1W72H 3B8YA 5E7FA 1CIDA 2X4QB 2FX9H 1MCIA 1NLDL 3E8UH 4OCWH 1KJ2L 3I85A 5E9DE 4UU9A 5GS0L 5JIPA 2K3TA 3HTLX 1N0XH 4NQSB 4YDJA 5HI3C 1TMCB 5DRXB 3NBNA 1T1YB 2VUOA 1JWUA 2V9TA 4NKDB 5TDNA 2DKMA 4XCFL 3GJFK 4W4NA 5SWSB 4MA1B 3TV3H 3WIFB 3L1OL 1JGVL 2EIZB 1A3QA 2BC4A 2AEPL 5ELIA 1FL3B 4N1HB 1AXIB 1FL5A 4OD2B 2MQ3A 5GRUH 4U1LB 4PJXE 1L0XA 2VLJB 1A7OL 3CFCL 3STZB 4PJHF 3MODH 3HG1E 3I50L 3ZKXC 5I1DB 4HZAA 5JUEH 3BRGC 4OTXL 4TYUA 3OKLA 1PQZB 5E94B 2P42B 3HFML 1A5FL 4GRMA 5T3ZD 2X4SB 3V0VB 3QP3A 5GXBB 2JELL 3H8NA 2GITA 3PWPD 4NIKB 3AM8A 3RWJA 5C07B 3KYNA 1QSFB 2PYEB 4AY0A 4XBEH 3SPVA 3UTSE 1G6RH 1KTLB 5DJ8A 3V5DA 5EWIL 2E7LC 5E2WL 3MLWH 3U0TB 3CVIL 2OJEA 4HKJA 4M1DL 2HKHL 4U1JA 3IVKA 4V1DA 5JIKA 4JJHA 3AU1A 7CGTA 1X5YA 1BJMA 1BWMA 4OCXL 3INUL 2GSIA 4N5ED 1HH9B 5DUMH 4LU5H 5KS9F 5EZOL 1OAXL 3MZTA 2R4RH 1ZLUK 3NIFE 4OZFH 4QRSA 1RMFH 3SJVE 4L8SA 1TZIA 1FH5H 5DT1L 4C83A 2IFGA 4N5UA 5BZWB 1VFBB 2ESVD 5DWUH 3TO4B 3BQUD 1H15B 2Z91A 1DQLL 1CLOH 3DGGB 3MV9A 3CSYB 3G6DH 3CLEL 4J23A 3MA9H 3V79C 3HMWH 4OBRA 3QRGH 2AI0H 3ARYA 4P46B 2Q3AA 3RPIA 4C56B 5KTEH 5F97E 3ULSB 4XP5H 3VFVA 3OKOA 1PLGL 3DUSB 4L3AA 4JO3H 4JKPL 3P3YA 4ZUVA 4XTRC 1MIEL 1TJGH 4QTIL 1ZHKB 2OL3H 3QULB 4WO4D 1IGYB 2WWMD 5I1GH 5CSBA 4OFYA 3P2TA 5GS1B 3FOMB 4U1HB 1KUMA 4ZFFB 2X4UA 3S96A 1AHWA 4Z7OF 1I8MA 2PTUA 4P2RE 4U49A 5D1QD 2R1XB 2A38A 1F4YL 2E3VA 1FE8L 3AMLA 3L3OA 5K9KB 3QDGB 4L3EB 3OAYH 1QSFE 2PYEE 3O45A 1RUKL 3QI9A 1EGJA 3H2WA 3LEVH 2R1YA 4FFVC 3MNWA 4CJ1A 5BS0D 3L3IB 3QHFH 4X6CE 4M6OH 3IFOA 1EFQA 5J56B 3G6JA 2BDNH 2DI7A 1NCDH 1Q9WA 1KPVB 4IRJA 1MWAB 4ODSH 2UZIL 1BX2B 1NFDB 2NY5H 1VEMA 2N7AA 5IVXE 1SJEA 15C8H 2EH7L 3SGEH 3FB8B 1I8LC 4KZEL 1EFXD 3NFNA 1LHZA 3Q5YA 2YK1H 5DMGD 3AFLA 4G7VL 3SCMA 5EO9B 3GSOA 1E4KA 1RIHH 1OM3L 2AJXH 5D5MF 4TUKL 4WDIB 3SQBA 1KPRA 3TA3C 2PETA 4HIIB 3RTQA 3FO0L 4IRZL 4KWUA 3D85D 3RQ3A 4C56E 2RJMA 2VLKD 1GZQA 5ANME 2MQCA 1QO3A 1MCFA 1HHIB 4NO0B 1XCTB 2P5WD 1T2JA 3AC0A 4NBZB 4YE4H 4RIRB 3VRLE 4PY7B 3SKMB 4OLYH 5EU6D 1CL7L 3QIBB 3MGTB 3WO4C 4G80B 2X10A 1AO7D 1WTLA 4MDIA 1JF5A 5J6HA 1LE9B 3VW3H 2EXWD 3ZDZF 3VGEA 3WSQL 4AT6A 1HXMB 1TENA 3QDGE 4K71B 4LF3A 1BFVH 2EEAA 3E6FB 3WL9A 3DROA 3NABH 1XGRA 1FVCB 3PABB 1MVFA 1X9QA 4FQXC 5DLMH 2CIIB 3IDMB 4DQOH 4GW4A 4YHYC 2EO1A 2EICA 2E6PA 4XTRD 1I3RB 3RA7L 3VXQB 2OR9H 4K7PY 1G7JA 1F6AB 3IFLH 3MOBL 4PRHA 5ERWB 4FFYH 5EC2A 3TZVD 3C2AH 5C0BA 2CXKA 1G7QA 3U0PB 5IKCA 4YDIL 2GFBB 4M5YH 3V0AC 3MJ8A 3LMJL 1MREL 4IDJH 4P23C 5FK9B 4R4NC 4OF8A 1NBQA 4WHCA 1WFUA 3G08A 1U8OA 4WHTB 5FA4B 5GGTL 4D8PB 1AXSA 1EO5A 1WVZA 4FXGB 2PR4L 1GC1H 4QXGL 4JRYA 4DOHB 1NDGB 5TFSL 2YC1A 1G9NH 4XCEA 4EI5D 4H25B 1UB5A 1YPZB 3QWOA 4RSVA 4RISL 4S1QL 3ZKSD 5HVHC 1BJ1H 1FRGH 1UJTA 1AGDB 2WMPA 5DK0B 1HIMH 4TSAL 4QHLA 1NCWL 1OF2A 4YQXH 1K3ZA 4JFQB 4EXPX 5C0JB 1HEZB 4QOKD 5FIEA 5BRZE 5F7YC 4B5EA 4E5XB 3ARPA 1NAML 1EUUA 5JW4Q 5ICXA 4HKBA 3GKWL 1ZHBB 2FD6L 2XZAH 3W5NA 1GGUA 4HIHA 1TZGH 1QBMH 1QFWL 5JOPD 1D5XB 3HZMA 4NWTH 3NCBB 2FJGA 3BH8A 3GMMB 3L9RA 3X3GH 2F53A 3HKFA 4GXVH 5A3IC 3BQUB 1JHKH 3RNKB 1MIML 5DEGB 5EH1A 1JTOA 2WBJD 4BQ8A 1T21B 4Q7DA 4I0PC 3BPLC 1FGVL 5GZND 3ARBC 5BOZG 1IAII 1XR9B 3L3GA 4LEXL 5I8EB 5J3HC 3VXMA 5TF0A 3T3ME 3VI4E 1T20B 4YGVA 3FRPG 5I66B 3DYOA 3QQ4A 1ZTXH 4U6YB 2Q1EA 4UAOC 1L7IL 2AXFB 2R15A 1K6QH 1RVFH 4QRQA 5AD0B 1M7XA 1QOKA 3BZ4B 2VOTA 3BYYA 3R06B 3IKKA 5D1QB 4Q74A 5DHYA 4P9MH 3S4SG 3PWPE 5D7LA 5FXCH 4FQXD 3LPWA 1MFAH 3D5OF 2IH3A 5KVFH 3CSBA 3RVTC 5C09D 1NJ9B 1FNEA 4RGND 4UIKH 1ZWIA 4OLVH 2FBOJ 1F6LL 2ICEA 3MPCA 1JN6B 3DMMC 3KDMB 2E9IA 1UCTA 1LP9E 4LCIH 3O6KH 5L0QB 1JNNL 1NCBH 3BHBA 3ZE1E 4GSDH 2UUDH 1GVIA 1U8KB 5D8JL 4JY5L 3T8XA 1MCPH 2LAAA 2O5ZH 4IM8A 4EQ3A 5IIEB 5D7IA 3VG9B 4KDWA 4WUKL 4MNGB 4HC1L 1EFXB 1B4JH 3VFSA 2HFFA 3U36A 4LCCC 5SWQB 4D9LL 4AEFA 3N9GH 4KTEH 3TCXA 2ZPKL 3P9MA 1I9JH 3N85H 3ES6A 2ESVE 4KHTL 3X12A 4PJCA 3ZTNH 4ELMF 1HHJB 2IFFH 2VLRA 2C3VB 3QXAA 3BDYL 5T5NG 2C1PB 3BPOB 3OKDB 3UMTA 3VWKC 3QFJA 1U8MB 1T03L 4GJTB 2VZ3A 3MV01 2VLKB 4YPGA 4ZUUA 4OLXH 3ZHDA 2P5WB 4FQLH 5ETUB 1IC5H 1MQ8A 2R23B 5FYJH 1ADQA 1RJZB 2EC8A 3NFSL 1DQQB 3AREA 5EU3B 1OGAE 4GUPA 4JFHD 3S5LA 4PRDB 5EU6B 5CJ5A 4QGTA 3EIFA 4JFPA 3DWTA 5FEBA 3KXFA 4KV5E 4OLZH 2IG2L 5EU4B 2AJSH 5AG9A 3FKUS 2D31B 4LLUA 5GS0D 1I9IL 4X5WB 5K93A 1E6JH 2QADC 4NUJB 2P5EA 4ONHB 1UM4L 3K4ZA 2Z92A 4TTGA 1N3NA 3B3IA 3NIDF 4JFZL 3CFJB 2HT4D 2Q6WA 5IMMB 3RIAK 4KKBC 5BS0E 4DVBB 3F12B 4YXKL 5T5NF 1U36A 2V7HB 4LLMA 4I3SH 5IHUL 1U2HA 3ZZ1A 4EEEA 4LSSH 3CCHA 4PJGA 2A6DB 5J3HD 3BMVA 1H0DB 1OAQL 1S78D 3O0RL 3F6IA 3TBWA 4BJLA 4OD1L 2KH2B 5GQBA 4I3RH 3CDGB 4HUVA 3BZFB 3TZVB 3QCTL 1PBYA 3MCG1 5F1NA 4KPHL 4U1GC 1HNFA 2IC2A 2GAZB 5DD3H 5CSZB 3U1SL 3E1F1 4FQJH 3RVTD 3TWCL 3QUML 5A2LH 5EORH 1I3GL 3RWIA 2VLKE 4Q2ZA 4EI5B 3DMMD 4G8IA 4CU8A 2VTFA 1UZ6E 4Z77B 2P5WE 1BZ7B 1MHHB 3GSQB 4MNHA 4P48A 1HILA 4KU1A 4Z7WF 3PL6B 4I77L 1ZV5A 3GSRB 4LQFL 3RL2B 4F58L 3T4YB 4ODVL 1MLCB 4FZ8L 4LNRA 3LQZB 2DTSA 4QOKB 1AO7E 3N0PB 3JTTB 5DK2B 4X83A 5I0DA 1UG9A 1KT2A 1RUAL 1F8TL 3RGVA 4QXTB 2F8OA 4ETYA 2BHYA 2UYLB 5CP7B 5HTSA 1FN4A 3OR7A 5I8KL 2W60A 3QDJA 1H8SA 3GBMH 4JLRB 4LBEB 1WBZA 5I1JH 1Q72H 4JY4A 3QPXL 3U30B 1NC4A 2GK0B 5M7QA 2G60L 1NCUA 4MJ6B 1O0VA 3VWKD 4Z95H 3O41A 4OQTL 1CXHA 2VDRL 5D7SL 3K1KC 3IDNA 3ESVF 3H7LA 5M94B 3KPRD 1U93B 2R0WL 4ZTPL 1MCOH 2WBJB 3DI2B 2CLZB 4N8CH 1AGEA 1A3RH 1QACA 4HS8L 1MQKL 2IBZX 3WNNA 4JREB 3WJLA 4JFED 4Z7VE 3T1WA 3FHAA 1M05B 25C8H 1JPFB 3MGOA 3MLUH 1D5IH 1B4RA 1KELL 2NLJA 4YK4C 4LIQL 4XPHH 3D69B 4PJXF 3QFDA 3DECA 1KCUH 3QBTB 1AXTL 1MAKA 1TIUA 2D0GA 4H26B 3MA7A 1FV1B 2YPLD 4JB9H 3CVHA 4JJ5B 4UDTA 5C09B 4GRWB 3V4UH 4RGNB 2CJUL 3V52H 5D72L 2P46B 4PREA 2X4RB 2ZUYA 4DAGH 1I7UB 2JB5H 4GXUM 4FS0A 4JKLA 4PJIF 1A2YA 5EBMA 1S7SA 4GAJL 1F4HA 3NN8A 5B38A 1B2WL 4QOKE 5HDLA 3RKDC 4LCWD 2A0LD 2YN3A 1A9BB 4APQC 1VEOA 3QG6A 1RJYA 4YIQA 1HSBB 3C6LB 4RGOH 5E99H 1UGNA 1SYSA 5EZIL 1F11B 1MRDH 3SY0A 5CJ8A 3DUHA 4JANA 2UVFA 3MACH 5JOPE 2LQRA 4RFOH 1JNHB 2CK0L 3QWQB 1MWAH 2PKDA 3HR5B 4ZPTA 4YXLH 3GSNB 3TBTA 4O2FA 5IMOA 1U58A 1DCLA 4ZFOB 4URTB 3NIFF 3HI6H 1NGZB 2YXMA 2VDLL 1A22B 4FMFA 3EO0B 5DQ9B 4UOJA 3P73B 3UTTA 5C6TL 4H0GA 2VH5L 1S7VB 1PKOA 3AROA 4R7NA 4K55A 2EXYD 4TUJA 2ZCLH 3PDOA 5F1IA 1T66C 2VITB 3GZKA 5F9WC 4M6ML 4W70A 3EYOA 3H0TA 2BNQA 4DGIH 5DJZA 1KJ2B 3QEUA 3BIKA 1PG7X 3P40A 4ZOBA 2VL5B 2Y7QB 3GJFB 1C16A 2DJ4A 4HX1A 1OAYH 4TNVF 4Y89A 3OKNA 2X4PA 5TQ0L 5INDB 2DMBA 3WJJA 1YC8A 4JQXA 2AXGA 5JHDD 2FGZA 1UQSA 4QHNB 1H3GA 1CTNA 1M7IA 4U0RB 1CFNA 5ACLA 2DIBA 4HPOL 3SHSA 4F57H 4X6CF 3SBWA 3UTQA 4C4KO 5BZDB 1LDSA 4GG6F 1P9MA 4PJ5A 1MJUH 5IOPB 2ILLA 1I1CA 3SGKA 1PG7L 2C3XA 3WEXA 2OTUA 2CKBA 3V6OA 1P7KB 3WFEL 3IDUA 2NY1C 1P4BL 3O81A 1VFOA 4ORGA 5IVXF 1BQLL 4OZIB 1C7SA 3EOBB 1LK3H 4CN6A 2D2OA 1JRHH 4FQ1H 4ERSH 2XZQL 3RUGA 2EH8L 1FNGA 3CFIC 3HZYB 5EBLA 4BH7A 1PY9A 1T1XB 1T0NA 3O8XC 1LO2H 5C6WH 2J8UF 2XTJD 3X17A 3ARGC 3BKMH 2IPKB 4TSBH 4H1LA 5D70H 3S7GA 3RKDD 3BKJH 4APQD 1QVOB 4HJ0C 4FQPA 1LEIB 4JFHE 4OUUB 5JW5A 2LAGB 1PY4A 2R8SL 3FQNB 4ESKA 5KS9A 1N26A 2FYYB 4G6KL 1EO8L 4FQ2H 2YEZA 3WXWL 3GSXB 2R9HD 3PV6A 3WIIH 5ACZA 1S7UA 4S1DD 3WDHA 1QKZL 4OB5L 4E0RB 4JM4L 3JTSA 4MQXC 4HCRA 4I18B 3I75B 3V6FB 5JPMB 1E4WL 1ZK9A 4JM2F 5F7EH 3RL1A 1R3HB 4ZTOH 4P5MA 3O2WL 5AZ2L 1QFUH 3H42H 5CZVL 3TBYB 1IT9H 5JIHA 1FGNL 1TVDA 1G6VK 5EU5B 3GRWA 4M8VA 3K8MA 3MXVL 3WNPA 3MRLB 1NBZA 2DTML 5I6XC 4U6XB 4CMMB 1Z0NA 3O6FC 2DF3A 5KN5A 5KJRL 2APBA 4P3DA 1DFBH 2B5IB 5KAQF 1T4KB 3O3BB 1KB5L 4JFEB 4Z0BH 1TCMA 3MROA 4J6RL 4HXAH 1S3KH 4M6NH 2KZ1B 3ZKMD 1ZHNA 4JDVB 2OX5A 4DZBB 5INCB 2IF7A 3ROOB 5HHOA 3LZFL 2H26B 4OJFL 3FT2B 2PCPA 4Y2DD 4JAMA 4U3XA 2Q86A 3P77B 5D6DA 2A9NL 3QUZC 1HXYA 4MQTB 5D2LE 1DVFD 3KAAA 4ZOAA 1I9EA 1Q1JL 4OT1H 1KBGH 3CXDL 5DFVC 1A6TA 1QNZL 1SVCP 4XRCB 3VFUB 4YHOL 4X4YA 5JOFB 4E9LA 2ORBL 5GRWA 5DJXB 5FM5O 3KNBB 1ES0A 2YPLB 5FB8B 1N5AB 4HF5L 5DMKB 3HE6C 2WW8A 2ZJSL 2D7OA 3B2VH 2O5XL 2H3NB 3GHEL 2VXQL 3DIFB 4XHQA 2IH1B 5JDSB 3GNMH 2IJ0C 2CPCA 4LSVL 2Y72A 2NY1D 1U3HA 2APWA 5DJ6B 3TPKA 1J86A 5KSVB 1WAAF 1CF8H 1ZT7A 3S4SB 5IFJA 4ZUTB 1IC7L 1I1AD 2PYFB 4G3YL 4MB5A 3VRIA 3MRDB 1MHCA 3MO1A 3QIUB 3TJEH 1OTSD 2NY7L 1OWRM 4KKLD 3QJHB 8CGTA 3ZYOA 2JJTC 4AQOA 1EMTL 2MKLC 1YEKH 5C92A 4RQQA 4Y4HD 1R3KA 2YXFA 3QXWA 2KQNA 3RJQB 5E8EA 2D7PA 4JR9H 5E8DL 3KPRE 4HFWA 5IHZB 3EOAB 3JVGC 4DEPC 4M61B 5CEXB 1TCRB 2WM0A 5MEPB 2VDPH 5AWNL 3G04A 4M3JA 3SDXF 5FKPA 2CLVB 4JFDD 4JFEE 3VXUB 3LH2H 5IFHL 1FAIL 1G9MH 1HINH 1RIUL 4AM0A 3T2PA 5IESH 3D9AL 4H8WL 2VN4A 3BD5A 4LL9A 3UDWC 5KSUA 1HZHH 3QUYB 4P5KA 4MQXD 3KYOB 4ZFGH 3E3QC 3VI4F 5I75B 2P8PA 5MP6L 5F44A 4MLSA 2Z8VC 4RRPG 4Y4FA 2GJ6D 5FF6B 4MWFB 4U3HA 5IV2B 5B3JE 5BW7A 4NZUH 2YPVL 2D7NA 1AR1C 1B6DA 4XZUA 2YPLE 4XX1E 2WIIA 1S5IL 4JFXA 3HC3H 4KQ3H 1VFMA 4Y5VB 1IILE 3HLAA 4DKEL 3O6FD 3O9WC 1OAZH 5JHDB 1TETL 4HS6A 5IBTH 1U92A 4BH8A 35C8L 5IR1B 5HGBA 1I4FB 4LCWE 3V6ZB 3WD5H 3QXUA 3V9FA 4XVUC 1DE4B 1MFDL 4HD9A 1LEKB 2HWZH 1KB9J 4PJAE 5EZLB 4KRPD 4JO1L 4UIMA 1RZ8B 3QUZD 4ODXA 3LEXB 3ZE1F 4UT9H 1GGYA 3O6ML 4MSWB 5JR1L 5DFVD 4PJ9D 3CFEB 1A9EA 3WUWB 3MV8A 2XQBH 4XXDB 5J89A 1FZKB 2N4IA 3O3EA 3QUXC 3HRZB 4H5SA 2QHRH 1R5IA 2X70B 3C6SA 1AD0B 1UWGL 4ZUWB 3WMSA 3HE6D 1WFNA 4HG4J 3PGCB 3FFCD 4ZO9A 1FVDB 2IAMC 2P7TA 2XTJB 5DS8B 1SMOA 5I15H 2R56L 4E42A 2SEBA 4Q9QL 1BOYA 3Q6FB 4R26H 1A7RH 4JFOA 2VDMH 1R0AH 5FO8A 1ZGLB 3WFHA 1R5VB 1NAMB 1EHXA 2BY3A 3GMOA 5CJOH 3TF7C 3M07A 2CDEA 3H7BB 4OZHE 1YNTA 1S9WA 3BYTA 3WFDL 2HJFB 2AEQH 3HS0B 4S1SH 1QLRB 1NMCB 2OSLA 4IRSA 5GSVA 4X0KB 1OP3K 5J8OA 1Z9MA 3AAZA 1Y18A 1EEZB 4OV6F 4LK4A 4R96A 1QA9A 5IP4A 3VXRA 1B0RA 2DBJA 1N4XH 4UI2A 4E41A 5JHDE 1DBKL 2W0FB 5E2JA 4JN2A 1SJVA 2J2ZA 3BW9B 4TN9A 4XP4H 1EBAA 1V8HA 1JNLL 3GI9H 3F7VB 2GEEA 1JHLH 3MLYL 2JIXD 3MCLL 2PO6A 3WDIA 2GYSA 1GH7A 2CGRH 3C08H 4F7EA 4WWKA 4Y2DB 1IGFL 4NJ9L 1KYOK 3SDDA 4AIXA 2YWZA 5DFTA 5T1LB 2V2WB 5HHNB 2QSTA 3VFRB 1AR1D 4PTUB 4XWOC 1DVFB 2GJJA 4M43L 5EC1A 1EJOL 3BP7B 2HRLA 2DS4A 1Q0YH 4NHUA 1OD7A 2XTJE 3TIDA 3PIQA 3V0WL 43CAA 3RWGB 1XF2A 3CX2A 4M1GL 3SKOA 1JV5B 3ILPA 4FXKB 3QQ3A 2DIAA 4PBXA 1YC7A 1N6VA 1WBXA 4GQ9H 2UWEE 5CJQH 1TVHA 1I7TA 5FV1L 1FDLH 5GGQH 5T1DL 3G5ZB 2DN7A 1KTDA 3QUXD 1S8DA 3RU8H 4L8CB 4QRRB 4N0YH 2IPUK 3KHOA 4WI5A 1I1AB 3EYUL 2ARJB 5J9PA 4M8QB 3OZ9L 4JZJB 5HYIA 1IVLA 4PV8B 4BKLB 4Y5YA 1T3FA 4WCYH 5DGQA 4KGLA 5HGGS 4Y4HB 3L7FA 5JO5B 2XWBA 3NAAH 4PUBL 3BO8A 2Q7YA 1GAFL 2AK4D 4NM4L 1E4XH 1KCRH 2B0SH 2VIRA 3JWNC 5F3BB 1V7MH 4KQ4H 4Z5RA 3FQRB 5AZEH 3MLXH 3LRSB 4LSDA 5JOEA 4JFDB 2WBKA 4N0RA 4O51B 3UYOD 5FOBB 3SE9L 2BNUA 2NY3C 2OZ4L 2YD5A 1IJ9A 2UVEA 3LQAL 2G2RB 4LFHG 1CD9B 3C5ZA 1RUQH 3FO1A 3WS3B 1T83A 3KPOB 4NZRH 5J1AB 4XCCL 2YR3A 2X44D 5ECJE 4JQVC 4NM8H 3OL2A 4LPVA 4YO0A 5D7JA 2VLMD 4NC1C 4UT6L 5I1KH 1U42A 4MCYB 4PBVC 2CDGB 2DM2A 4CNIA 5HHXH 1BLNB 3IFPA 4M7JH 5GRZA 4OV5A 1AGCB 3WFBH 4OZGB 4G8FB 3W0WD 3D1MC 3NCYP 5T1KD 5TQ2L 2JB6B 4O02H 5TDPB 5EOCL 1KJ2H 1WSST 1JGUL 3BWAB 3RIFK 1UM6L 4HUWB 5ESAA 3RX8A 3CSPA 2AQ1A 5HYSG 4NFCA 1BMGA 1OPGL 3IXAB 4L8SC 2VDKH 5JDJA 4XPBH 4BYHA 4I2XE 2VWEC 3L1OH 4QHUB 5C7XL 4Y4KC 1JGVH 2AEPH 3TBVA 3T0BA 4GH7B 2J8UB 3QUMB 5CIPA 4PJ9B 1ONQB 4U33A 5F3HB 2BVOA 2F19H 2C1OB 4KAQL 2GTZA 3BMWA 2J6EL 4OLUL 3ESUF 4IOSD 1VACA 4PGEA 3T65A 2ZOLB 1UH2A 4Z7WA 2X42A 3ZE2E 1A1OB 3FFCB 3B4NA 5SX5H 4MQ7A 3DX7A 3HFMH 4K8RL 2E8YA 4QT5A 1CLYH 1A6VH 4WV1B 4CVXA 3JBG7 3DX8A 1S7XA 4MDJA 3KJ4B 3BGFC 1XH3A 1YMMB 5C0IA 2X7LA 1AHWC 4ZNEE 4A6YA 4RFEA 3WLBB 5F9DC 1G7IA 1P7QD 2NXYC 3P0YL 5I74C 3DLQR 3RI5F 4HK0B 5JNYB 3QI9C 4LSQL 4RFNB 2GJ6E 1CT8B 4M1DH 2HKHH 2DWEB 4LSRH 1FFPB 3DX9B 1I9RH 1FLRH 1A64A 3EYVB 1P4IL 5C0RL 1KG0A 2P48B 4IRJC 4NC2B 4XMKH 2FEDC 3INUH 4Q6YA 5B39G 4JDTL 3V8CA 1Q9LB 4WW1B 3WIHA 1B0GB 3G6AB 2APVA 1K8IB 3I2CH 2H32A 3F62A 5J13C 2PN5A 2VKXA 2E6QA 1YYML 2GJZA 2YMXL 5DT1H 1KCVH 4EI6A 2NY3D 3WHE1 5I18L 2BHUA 2H1PL 2FNBA 2DQUL 3HPJB 3OXRA 3GMRB 3CLEH 2JIXB 5FDWB 3RDTC 3SCMC 2QR0A 5F1KC 3OAUL 5DJ0A 1JK8B 3RVUD 5JHLL 3TN0D 4HDIB 1AI1L 1E4KC 1U8IB 3TNNB 5JW3H 5D96C 1YDPB 3OV6A 5MEOA 2VO5A 2DQIH 3NTCL 5DD6B 4DCQA 3SDAA 2H8PA 1MIEH 2R0ZL 1XGTA 4O9HL 2YUZA 4L3CA 4TSCH 5ESQA 3FFCE 4V1DD 1MJJA 3PP3H 1IQWH 3NGBB 5LBSL 2B1HL 5CMAB 3UTSA 2HKFL 3HUJA 1E6OH 3O3AA 1F4YH 3IJHA 1WF5A 2EDBA 1DBBH 2BSTA 5CUSH 4J1UA 1XGQB 3CFKB 4O2CB 3WCYA 3JXAA 5C9JA 4XNQB 4EDXB 5E5RB 1YN6A 4Y4KD 3V4VH 3VFMA 1A47A 2IBZY 1ZANH 1UACL 1K4CA 2X4QA 1LGVA 3MR9A 3HMXA 5FUOL 4K3GA 1BFOB 3UTPD 2DQCL 3ULUC 1I1RA 2ICWB 4ONGL 4NQSA 1YEHL 2EH7H 3I6GB 1OP9A 3JV5A 2JCCB 4KZEH 4R0LA 4J3SA 5I73C 1T04B 5DRXA 2A2QT 3SKJL 2Y9RT 3MNZB 3MFFB 2AK4B 4PTTA 5D2NB 4ONFL 5JMRA 5FKAB 2EIZA 3LV3B 4OFKA 5GRYA 3U82B 1FL3A 4N8VB 5GS2H 4OD2A 5FFLA 3LSOB 4U1LA 4F7CB 5IQ7L 3E3QE 4Z18A 5T3XD 2PXYD 2HN7B 5I1DA 4XC3L 3QI9D 4JQIH 1K4DB 1SY6L 1PQZA 5E94A 3D0LA 1X4YA 4FFZH 3BGMB 1D5BA 1MHPH 1T7WA 3V0VA 3QB7C 2R0KH 1CL7H 1JVKA 3GK8H 4HGWA 1I8IB 5LXGL 5SV3A 4UV4L 3GSUB 5C07A 3P4OA 1QSFA 2PYEA 5DA4A 3B9KC 1II4E 3VDAA 1JYVA 5D2LF 3HNTH 1NUDA 4RCAA 4N1EA 1KTLA 4O5LL 4PJBB 3K8KA 4RGMB 3U0TA 2OM5A 2VXTH 2OR7A 2RB8A 1NPUA 1OSZB 3RDTD 3RVWC 3SCMD 2X9XA 2NTFA 1NQBA 5DJDA 2ZCKL 5IVXA 2Z35B 2BCKB 1HH9A 3IU4H 1F00I 3ULVL 3WV0A 3DXAD 4WW2B 5F6HJ 1T1WB 5EOTB 3FJTA 4LCYB 1PX4A 4QCIB 4YHKL 3PWLB 5HHMB 3RA7H 3MOAH 1FC2D 2R69L 3MOBH 5FGSA 5BZWA 1VFBA 2JCCE 4NYLB 3TO4A 2DQTL 1H15A 4U1SB 3RY6C 4R97B 2BFVL 4LPCA 3CSYA 1J5OL 3DETC 3G5VA 1MREH 4UBDC 5D1ZB 3PP4L 2APTA 5GGTH 3DVIA 2FJFB 4P46A 4C56A 4KUZH 5ANMA 5E1HB 3ULSA 5E08L 5JZ7C 3GIZH 3VFTA 3FRUB 5HJ3B 3DUSA 4N8PA 5DD0L 5FYLE 2PR4H 5CIPH 1ZHKA 5IQ9B 3QULA 4K07A 5AUMB 1IGYA 3PQYD 4U6VH 2NX5D 5CJXC 3V8OA 1WZ1L 4RISH 4MVBC 3MNVA 4U1HA 3EKCA 1BD2D 4ZFFA 2GSGA 4JM2A 4TSAH 3ULUD 4ZD3L 4LEOB 1P7QB 5E5MB 1I7ZA 4UILL 2R1XA 1U3JA 3QDGA 4QRPE 3UO1H 1S9YB 2VLME 2FGWH 1ORSA 4PJBE 5CINL 3GM8A 5C0BD 2FD6H 3VGAC 3VI3E 5B3JF 1KPVA 3W0WE 4L4TB 5F93C 3Q3GB 4OGAC 1CU4L 1KB5B 1UWEL 4P5TB 2A83B 2GTWB 4XGZB 4WJ5A 2YD6A 3DTXA 3HE7D 4P99A 4LKXB 3FB8A 2VMFA 1PEWA 5SX4H 1MIMH 3OJDB 4KVCL 3OGCB 4S2SB 5A16A 4HK3J 5DC0A 1ZLWK 1FGVH 3EFDL 5J11B 4PJAF 4JPWL 3UX9B 4AEHH 1TJIL 3MJ9A 2DM4A 4GKZB 3H9HA 1Z3GL 5K9JL 1VPOH 3B9KD 4WDIA 3ZYIA 4HIIA 5FYKD 1TLKA 5GISH 2NTSP 3HI1B 1L7IH 1FVEB 2J7LA 3GSWB 4TOYL 4DKFL 3WKNA 2AABH 1HHIA 1LWRA 4DUXA 1CDJA 4NO0A 2IALB 1RZJC 4POYA 1XCTA 1KLUB 4H20H 5F9JB 1RFDL 4U0QB 1F13A 3PHOB 5GGSY 4PY7A 3C8HA 4NO5A 3SKMA 1ERNA 3MGTA 2V5RA 4GLRH 5I76B 4G80A 1JF1B 1UFUA 3CK0L 3RZCB 5CS7A 3VXSB 3ZKNC 1BM3L 1RY7B 4R90L 1LE9A 4IDLA 2NY4C 1I1FB 1FBIL 3TBSA 1ZT1B 1V3KA 4WFEE 2F54D 3IDYB 3MLVL 4XBGB 1IMHC 4OZHF 1DL7H 1D6VL 3B6SB 1JP5A 4PLNC 4ODWB 4CADB 3TVMD 4RAUB 4UBDD 5D8JH 3UPRA 3E6FA 3RY5A 1U8QB 4JCLA 4KVNH 1FVCA 3PABA 1QRND 4WUKH 4WEBL 3SE4A 2CIIA 1AGFB 3IDMA 4Q0XH 4XAKE 5HGAB 1RK1B 3OPZL 2XACC 1CFQA 1GL4B 4LLVB 3TPUB 2ERJC 1I3RA 2ZPKH 5CILH 3VXQA 3GO1L 2QBWA 4KJQC 2EKSA 4BUHA 5KBNC 2ZUXA 4MVBD 1NCCH 3U0PA 1P84K 4X6DF 2GFBA 2FEEL 2AJVL 1J0KA 1L0YA 3VE0A 1T03H 3EDKA 5FHBH 1FG2B 5L8LB 4WHTA 5FA4A 4D8PA 2XN9D 5GRJL 3ARZA 4LHUG 4IMKA 4FXGA 1CDGA 3MRMB 4M03A 4NC1E 2FCBA 4KRLB 3GKZA 1NDGA 3PWPA 4FOMA 4V1DE 2FX9L 2IG2H 2X1WL 3ZT6A 1Z0MA 1AGDA 5IMLB 3ARXA 5DQJB 1I9IH 1NMAH 1K8DB 5ISZB 5D93B 5ALBH 3MRCB 4QTHA 5BV7C 1RZIB 5TPWL 5C0JA 4YC2B 1HEZA 4Z76A 1LP9A 4MA3B 4EUPH 1GOGA 3RGVC 1ZA3B 2XNAB 4E5XA 4DUWA 2NCMA 5CFHA 3TCLB 3HNSH 2R1WB 3MUZ1 5HI5D 1LNUB 5TE7L 5A2IH 2VLRD 1ZHBA 5GRUL 2H41A 4L5FH 2R2CA 3DXAB 3BJ91 3H9ZA 4Y19B 5LAXB 4BSWB 3UTPE 1ZSDB 1EZVX 3MODL 4UTBL 1D5XA 5GGUB 2UWEF 2ESVA 2N1KA 2QQNH 3BQUA 2VE6B 3EO9H 5MI0C 2B4CH 4K8RD 4OF6A 4KDVA 1OY3B 3C8KB 2E8ZA 1G1CA 3TC9A 1X5LA 5IJVB 1RK0A 1KC5L 5E4IA 3FQUB 3ALPA 1NUGA 4XBEL 4CKVX 4X4ME 1XR9A 5HYSB 2APXA 3QUMH 5T3XE 1V05A 2WWKO 1I3GH 4U6YA 3PQYB 5CGTA 2NX5B 4PJFF 5I1CH 1NC2D 2AXFA 1YMHB 1BD2B 1CGUA 1R3LB 3B9VA 3BZ4A 1A7QL 3BP5B 1SJXA 5KZCD 1LK2B 5D1QA 2QSQA 2BK8A 4I77H 4F58H 1SEQH 4TVSa 5DUML 2E27L 1H8OA 1VFAB 3L3KB 5H37G 1S7RA 1G7HB 3MBXH 2R4RL 2XV6B 3U9UB 3L6FB 1RMFL 1NJ9A 2VZ1A 5BS0A 5TGBB 1RUAH 3IFNH 4KJQD 5D4QA 5C0CD 2CIKB 3KDMA 4XI5D 1D7FA 3G6DL 3DHMA 3MA9L 4X6BB 3QRGL 2AI0L 1NANH 4NO3B 2G60H 5HVWA 5CP3A 3CAFA 4OQTH 2EZ0C 3BZEB 4P23B 5KTEL 2VDRH 3QAZB 5I30H 3HE7B 5IIEA 1MPAL 1YNLH 1BQHG 4JO3L 4MNGA 4QWWD 4WTZA 1EFXA 3DXAE 4GKSB 1TJGL 5EUOF 2JJUA 2OL3L 3ARFC 3DO7A 2KQMA 5I1GL 1KJMB 2VL4A 2EDFA 4HS8H 1A6PA 2DDQH 1V3MA 3AY4C 3IGAB 3BXNB 4O4YH 4UZGA 3IYLW 4LASH 2X09A 1MFCH 3S35H 1HSAB 1A6ZA 2IANB 3QEHA 2GUOB 4WEUD 1KELH 3D85A 3IDGB 1UH4A 2VLKA 1YJDL 2IPTL 2FRGP 2V9QA 3CFDB 4WI7A 3LEVL 2NXZC 2VXUL 1SJHA 2P5WA 5ETUA 3C5SA 2R23A 1RJZA 4BQ6A 3OAYK 1DQQA 1T5XA 4OGZA 1JPST 1KXTB 4PLOB 4UB0L 4FMKA 1NCDL 5JXEC 1AXTH 2NX5E 2OI9B 4PRDA 5EU6A 1P7HL 4F37F 4ODSL 3X13B 5EU4A 4U7SA 1AO7A 2NY5L 3ULUE 5D72H 3FB7B 1MJ7L 5I1AB 4NUJA 4NRXB 4RNRB 2F54B 4KK5C 4K3DH 3RIAF 5A2FA 5CHNA 3IJYA 1B2WH 4JHZA 4M02A 3WJJC 5IMMA 3TVMB 4JQXC 4DVBA 3SGEI 4PB0H 3F12A 4K7PH 5C0BE 2V7HA 2WZPD 2CUHA 1QRNB 2AJXL 1I3UA 3SBWC 2X9WA 3BT2H 5I71B 2A6DA 3IDXH 4KROB 1P9MC 3ZLQC 1Z9LA 5DHVB 3VXPB 3SGKC 3OBAA 5IB5B 4HLZG 2NY2C 4UAOB 2ZOKA 3V6OC 3BZFA 2YPKA 4YE4L 2XWTB 3TZVA 4Z7VA 4X6EB 4CU7A 3RWCB 2CR3A 2YSSB 1XGYH 5C6TH 3F7RA 4XPAH 1BZ9B 4Y1AB 2BY2A 2BSSB 3MSPA 3U7AA 2XFXB 5CSZA 4AIZA 3VW3L 4ZAKC 4ZO6A 5IM7B 4WRLA 5FYKE 3RP1A 3FQWB 3F5WB 2HTKC 1NBYA 4EI5A 4F3FA 3RWHB 3O2VL 4KZDL 4M6MH 1OP5H 1BFVL 5J12B 1BZ7A 3GSQA 4NQEB 4X5XB 4HUNB 2E9JA 2J1KA 3PL6A 1QQDB 2ATPB 3EJZC 3RL2A 2X6MA 3T4YA 4X9BA 1WWBX 3IRPX 3DSFH 3CX5K 4QOKA 4LHUD 3UTZB 5LG1A 2OR9L 4G6MH 5DK2A 3ARFD 4G9FB 3QNYB 2FX7H 3QUKB 4QXTA 5D9SB 3LKNB 2UYLA 4J4PC 4JLRA 4JPIB 4LBEA 4IDJL 1TNNA 2GK0A 1SEBB 4LVNC 4BQCA 5IB2A 3NVQA 3DGCR 5H35B 1X4ZA 3ELAT 1RIVL 2NXZD 5KW9H 2WBJA 3S36L 5FYJU 1BQLH 3SOBH 1G9NL 5F7UA 4PP1D 3U6RB 5JXED 2Y25A 3HZVB 2NZIA 1FRGL 4LPTA 1HCFX 5FGCB 2EE6A 2P49B 3EJYC 1M05A 1UZ8B 1G7LB 3OHXA 2VDNL 5F7WC 4YQXL 3IAGC 5D6DC 2QADB 5CLTA 1IM9D 1HHKA 2XN9E 3W81A 1WFTA 3B9EA 3D69A 3IDJA 5KZCB 3P4LA 4LHQB 2XZAL 3BEVB 4QRTB 4FQXA 1TZGL 2NW3B 3OKYA 4JJ5A 4PRPD 3EBAA 4NWTL 5C09A 3X3GL 5D7IE 2LTQC 2X4RA 2NY2D 4M1CC 4OB5H 4JM4H 1JHKL 3BX7C 5C0CB 1U3HC 5ID1A 1E4WH 2ADFH 1BF8A 4OZ4B 4PLJD 5DC4B 3D0VB 3QNZB 1A9BA 2F74A 5HGHB 3VD9A 3OQ3B 2VLRE 4F15C 1NL0H 1TNMA 3O4OB 4PJDB 3MXVH 4NN6B 1F11A 5CEZH 4HUKB 1EVTC 2W65B 4ZAKD 3NPZB 1ZTXL 4KJYB 1ETZA 4L8DB 1JNHA 3GMLB 5IK3B 1MCJA 1B9ZA 3HR5A 1RVFL 3GSNA 5CJBA 4UNVA 1WCBB 3VCLB 1HHGB 2LU7A 1FZJB 1NGZA 5L2KD 4P9ML 4OJFH 5DQ9A 3P73A 1D5ZA 3G5YA 2L0DA 2ZG1A 1KTKE 5KVFL 4DGYL 2DKUA 5HHPB 1UT9A 4UIKL 1PW3A 4QF1B 4OLVL 2YBRB 5MEQB 1F42A 4LLWA 2ORBH 4YBLC 4LCIL 4NUGH 3S97C 3QDAA 1YEDB 3ZO0A 4J4PD 3KLHD 2VITA 4Y4FC 4HF5H 2Q8BH 3T0ED 2ZJSH 1MCPL 2O5ZL 1EGJL 5MERA 1FSKB 2O5XH 3GHEH 4RAHA 4CDGC 2Y7QA 3GJFA 3KPNB 3MUGA 4PJGE 1CWVA 2MTPA 5ITFA 5INDA 3N85L 3VMNA 4YHZH 3ZTNL 3PDGA 1T2QH 4XCNB 2X9YA 1ZLSH 1LQSR 4KUCD 5BZDA 2AKRB 1PZ5B 3QG7H 1FL6B 5IOPA 2ZWLT 2KUTA 4FQLL 4XNXL 3VGHA 5FYJL 1KN2H 1P7KA 2I5YH 1A21A 3LHPH 4JPKH 1T89A 5AWNH 3V7AE 5BJTB 4HGMA 2BVQB 3UPCA 5DDHB 1MCNA 4ZXBD 4KJPD 3HZYA 4H8WH 1VSCA 1E6JL 3KPQA 1T2XA 2YS4A 5HDBE 1ZE3C 3JV4A 4M5ZL 1E27A 4PJEB 2XA3A 3T77B 3VWJD 4Z7UB 2QSCL 5DQDH 3GSVB 4M9OA 2LU3A 3ECBB 2D03H 1HQ4A 1QVOA 4KI5C 4OFIA 4I3SL 3ZDXF 1BFTA 4GW1B 5DEFB 2YPVH 4LSSL 4OUUA 5C3TA 1PKQB 1UXSB 3PV7A 3FQNA 1U3ZA 4HUUB 5KSAD 5FECA 4LHUB 4L1HA 3TNMA 1FC1A 4LCCA 3GSXA 1NCNA 4TRPH 5GGVY 3IETB 3OTTA 3JWOC 2YRPA 1EEUA 2Y5TA 3DYPA 4YDLB 4E0RA 1IM3B 35C8H 4I18A 3I75A 5JPMA 1MFNA 1R3HA 2FZ3A 4ZOEA 4O58H 4JZNB 3TBYA 1K5NB 4PY8I 4X4XA 2BNRB 4DVRL 2Z93B 3KPRA 4FQJL 3QR2A 5DI8B 2Y4SA 5JR1H 4HWBA 1XR8B 2PO6C 4R4FH 3EOYG 4PJFB 3ZE0E 3BPCB 1T4KA 4JFEA 3E2HC 1UWGH 4Y4FD 2Y6SD 1L9MA 5EPMB 1H3VA 4BFBD 4WWKC 3I6KB 4JDVA 3QCUL 3SDDC 4AZ8A 5INCA 3ROOA 1VADB 2QKIB 4X8XA 3FT2A 1AY1H 3BWUC 1I7RB 3DYMA 1IM9B 3P77A 5DEZA 4OCRL 4F7PA 4WHYG 4Q9QH 7FABL 3BD4A 1ACYL 3ZSTA 4POUB 1TITA 4KK9C 4MAUH 3KS0J 4XRCA 3VFUA 3RWEB 3GBML 3EGSA 1N6UA 5DJXA 5L6YH 5JTWA 3KNBA 1Q72L 2ITDB 2YPLA 3VRJB 1N5AA 5SV4A 4MGXA 4PRPB 5DMKA 3ZSSA 4Z95L 3FN0H 4LOUC 2NR6C 4PB9H 3C09B 1P2CB 3NCMA 1H3UA 3DIFA 5JDSA 5EUOB 3IXTB 1JF6A 2FECI 5C9KA 4LCWA 1CD8A 3TO2B 1A3RL 4POZC 3GGWB 4PJAA 2FDBP 1CE1H 2IGFL 5KSVA 3WNMA 3ARDD 4ZUTA 25C8L 5DMIH 3P0VL 3MRDA 1XF3B 3UTTE 5EBWB 4RZCB 4V2CB 1IAIM 3O8XB 1B6UA 4OCSL 3MLYH 4HZLB 4XPHL 3MCLH 2I25N 2CMRL 4HWNA 1NGYA 5IHZA 1CGXA 3EOAA 1KCUL 5EO1B 3NH7H 1C7TA 1TCRA 5HGDA 1DLFH 4NJ9H 4J3OC 2H6PA 1JGDB 2FJHB 3WNOA 4JB9L 3VXUA 1BQHB 3T0VA 4DZ8B 2GY5A 3ARTA 1GGCL 4DAGL 4OF5A 2JB5L 3C5ZC 3IDIB 1BIHA 1T83C 4XPTH 2R29L 3KYOA 1F3DJ 1KV3A 4HAGA 3T0EB 1GHFL 1J8HD 3V0WH 4N0CD 4EQ2A 5D7JC 3LKOA 3MTRA 5FF6A 4LVOB 4MWFA 5E99L 1QEWA 1ED3A 5IW3A 2D4DA 2Q76B 4YUEL 1IEHA 5GJSH 3MACL 4H88L 4PRPE 4RFOL 3G6JF 4Y5VA 4JHAL 1KIQB 1OT1A 4G8EB 5BMFL 2PO6D 2WSKA 4Q97A 3JV6A 4HW6A 5T1DH 1NAKL 4LRIC 3LOWA 5JHDA 2X4NB 3MUJA 2D7QA 5EFIB 3HI6L 1JCKA 1I4FA 4MS8C 3WN5C 2XTLA 3GFUA 4KDTC 3QJFB 3M17A 3V6ZA 3DRQA 2XQYK 1JWSB 5E6IB 1LEKA 4MA8H 1UADC 5EZLA 3H3PH 2JKXA 3GUTB 1GAFH 3LEXA 1MFEH 4ZS6C 2FR4A 2ZCLL 4MSWA 1QSED 3HAEA 4KK9D 3CFEA 4MJ2A 3WUWA 3WNKA 3PWUB 2NY0D 2ICES 4XXDA 1FZKA 1G0DA 3FB5A 4ZXBB 5L9DH 4GAYA 4Q9RL 2X70A 1AD0A 2D4FA 4DGIL 4KH2A 2OZ4H 5L2KE 1QYGL 1XIWD 1FNAA 3AS0A 1ADQL 2X4TB 2K1MA 1GIGL 4D3CH 1ZVSB 1OAYL 5DS8A 1BECA 3VWJB 2XKNB 2XZCL 1MCDA 1MY7A 2PTTB 5C71A 5DZOA 2ADGB 1C08B 1ZGLA 1MI5D 4APQA 2NY6C 2VJXA 1R5VA 1NAMA 5DMJB 5ICYB 1ZS8B 1ORQB 3H7BA 4UT6H 4ZDHB 5KSAB 4KY1H 3T0EE 1XGUB 4I4WB 3FAWA 3NCYS 3HS0A 4FP8H 4MXVE 3WHXB 1F3JB 3REWB 4NNPL 5TQ2H 1IKFL 4X0KA 5EOCH 2Y5EA 5FCSH 5L7XH 2F5AL 2HTLD 4G6FD 2JJVA 2YUXA 4CMHB 3NCFB 4J8RB 3F7YB 2XG5A 3V6BR 3DURB 4QRUA 4K3EL 1DBAH 2CKNA 1JRHL 2AJUL 4HKXB 2W0FA 1UXWB 5HHOE 5C7XH 4PRNA 5F88B 1LO2L 1Q8MA 3EYFB 4JG1H 5A40E 3BKML 3F7VA 5HPMB 4TSBL 1R24B 3KPPA 5DVLA 2I9TB 2HYMA 1G84A 3BKJL 1T5WB 5DVMA 1VERA 2C4XA 2MCPH 3F65A 3SDAC 2X89D 1OTUC 4Y2DA 3U79A 4DJMA 3OKEB 3VFRA 4FQ2L 1GSMA 4G42A 4HUXA 4PTUA 1DVFA 4GKNB 1RPQA 2AJYL 3BP7A 5DC9B 2G75A 3D2UD 1WGOA 3SO3B 1GJIA 4U1IB 5I8CB 3P0YH 4ZTOL 2ZSWB 5DJAB 1W0YT 4MS8D 2PTVA 4LSQH 1FFQA 1QFUL 3RWGA 5BV7L 5DJCB 5TF1H 2JF1A 1JZ5A 5FGRA 4HC1A 4IJ3C 4NNYB 3DOSA 5C0RH 5GIRB 1PJ9A 2OL3B 3LKQA 1DFBL 4BK4A 1X5GA 4Z0BL 3QCVL 2X1QA 5IVZB 4CVWA 3G5ZA 2DLHA 3ARDB 1S3KL 4HXAL 5I0ZA 4M6NL 4L8CA 3EHBC 2YMXH 1I1AA 4KHXH 2ARJA 3LKRB 4I2XA 2K7PA 4M8QA 4JZJA 3W11C 1MHEB 4R4BB 4PV8A 4BKLA 2H1PH 2WBWB 2DQUH 2I07B 3IU3B 3C5JB 4OSUH 4Y4HA 5IMKB 4MA1C 5JO5A 2YD8A 1VKXB 5E8PB 2BY1A 3OAUH 3DVFA 2AERT 1KBGL 4JEGB 1AI1H 3MBED 5GGRB 4PJ7B 5CGMA 3FQRA 2ZNWA 4MD5B 4P4KB 5DUPL 5IBLC 3NTCH 4HSQA 4LLYB 3LRSA 1S7TB 5C0EB 3U9PH 4TVPE 8FABB 5E00B 4JFDA 4MHHG 2O5YH 4O51A 3O6LL 5FOBA 3SKNB 4AMKH 3N1QC 3B2VL 3QXTA 2C7UB 2FATH 3C9NB 2G2RA 4ZNEA 1I85A 5GRVL 5LBSH 2B1HH 2HKFH 2EEBA 4NCC2 4X5LA 3NZ8A 3MCKB 1J8HB 4PS4H 4ZMAT 3I3BA 3BESR 3KPOA 5GRVK 4L9DA 2X1OA 3RVXD 4DKAA 1E28B 5ICZB 3D3VB 3CVHL 2GJ6A 1CF8L 4BELD 5HYJD 2ZUQC 1DLHB 1V3LA 2XY2A 2VAJA 3TJEL 2UZXB 4MCYA 1FYTD 1BLNA 1AGCA 5GJTH 2CLRB 3BVNB 3O6FA 1CE6A 4OZGA 4G8FA 4JVPA 2BVEA 2JB6A 4JR9L 1IEBB 1YEJH 3S5LG 5TDPA 2BOCB 2NYYD 4AEIL 1M4KA 4ONGH 5FYJD 1Y6MR 3BWAA 5D7IF 4HUWA 2VDPL 4LDLB 1OTUD 3IXAA 1VDGA 3LH2L 1HINL 1IGIH 3MRKB 3QUZA 4YHIB 2O26U 5IESL 3HC0A 3TO4C 3P9WB 1F58H 3BSZH 4QHUA 4PJCF 3M1BB 1QSEB 4PJ9A 1ONQA 2R4SH 1HZHL 1U95B 2NY0B 2LFGA 4XPGH 1TZHB 4ZFGL 2C1OA 4TUOB 1BOGB 4J3TA 4P46C 4X6FB 4PJ7E 1CZ8H 1JL8A 2ZOLA 3HE6A 1XIWB 1A1OA 3FFCA 2EC9U 4PJ8B 3WFCH 1T7YA 1CD1B 5AAMA 1JPTH 2DQJL 4WV1A 5C0ND 3HC3L 4KQ3L 3IJSA 4DGVH 3GMQB 2N56A 3FHQA 4Y7MA 2QV2A 3RAJL 3KJ6L 1UEMA 5LXGH 1OAZL 2EECA 4UV4H 2EIEA 1GXEA 5IBTL 4UU9B 3GDBA 2X05A 1RZKC 4O5LH 4LPWA 4PIRF 3EHBD 3MRIA 3P4NB 1J8HE 5IF0B 2J8OA 5DRZA 3W11D 4HK0A 5JNYA 1HOCA 2HWZL 3W2DH 1JWUB 5TDNB 3GBNL 1CD0A 1YA5A 2DWEA 1FFPA 4Q58C 5SWSD 2R2HB 3EYVA 4G6FB 3KS0H 3M8OH 2BC4B 3MJ6A 3JVGA 4ODTL 4RX4D 2ZCKH 4P49A 1KEGH 2QQLL 2XQBL 4WW1A 5IBLD 4PJGF 4I3GA 3ULVH 2VLJD 5I2IB 1NMBL 2QHRL 3QA3A 1B0GA 3G6AA 2R0LH 1K8IA 4GT7A 1U8HB 1N8ZB 2DQTH 1IAIH 4GRMB 3S6CA 5I15L 2BFVH 1J5OH 1INEL 2HFEB 3GMRA 4R26L 2JIXA 5FDWA 2VDML 2GITB 3PP4H 1J1PL 3MXWH 1DUYB 1JK8A 1I75A 3K2UL 4HDIA 1IGMH 2WP3T 1U8IA 3KYNB 5C07D 1QSEE 1CDHA 5CJOL 1MF2H 3SPVB 5E08H 4G6JH 4IMLA 5DD6A 4IOIA 5DD0H 4XT1C 3BN9D 4MZ3A 4ODUB 1QBBA 1QFPA 2OJEB 2DB8A 4HKJB 4D0CA 1WZ1H 4U1JB 4G6AD 4XPFL 5T5FH 4U2ZA 2BERA 5CMAA 2OXGA 4ZD3H 5CWSA 5B22A 2YZ8A 3QIBC 5B4MD 1LMKA 4AL8H 1OAKH 1A4KB 5I19L 4M00A 1AGBA 1MI5E 1N4XL 1XGQA 2W59A 3CFKA 4O2CA 5DD5H 1JIBA 3LY6A 4L8SB 4HWZA 4XP4L 4C83B 5CINH 4XNQA 4EDXA 2EYTB 4HCRL 4K2UH 3GI9L 4OQ1A 4AJ0A 3MV9B 3SDCD 4K71C 3VFWB 1IGJB 3U4BL 1CU4H 3V2AR 3S9DB 1UWEH 1A4JA 4U1MB 1BFOA 3S98A 3C08L 3F58H 1V5JA 1NKOA 2CR6A 3GRWL 3SE4C 4OLWL 2JCCA 1T04A 4MZ2A 5E0QA 4EN3D 3NCJH 4UMGA 3MNZA 3MFFA 3F7QA 2AK4A 5D2NA 5B38G 3MBEB 1UVQA 5IWLA 2AJ3A 1Q0YL 5HDOA 3LV3A 5H37H 3HCVA 1I8MB 5F7NC 4N8VA 1WEJL 3LSOA 2MPAH 4WU7B 1O5DT 1A6UL 1RHHB 4L3ED 3O45B 5DD1L 4TOYH 4DKFH 1Q9KB 2R1YB 1K4DA 3MNWB 2XPGB 1DSFL 4EVNB 3MZGB 1R3IH 3IFOB 3A0OA 3BGMA 4P0DA 3LS5L 3G6JB 5IW1A 1Q9WB 1CXEA 1P6AB 2AEIT 3RVVC 3FMGH 4DW2H 5CJQL 1X5AA 9CGTA 1SYVB 3CK0H 3GSUA 1BM3H 5EOQH 2I24N 2E7BA 1FBIH 1FYTB 4PJBA 3MLVH 3VXTB 3NFNB 3QZWB 3W0WA 5T1KA 2YWYA 3NAAL 4EKXA 2B0SL 4KQ4L 2VKWA 1C1EL 1INQB 3MLXL 5E2TH 2Z35A 2BCKA 2B39A 5C0AD 3RTQB 2C3HA 1WC7B 4WW2A 4GG8A 3RPKA 1T1WA 2YD7A 4LLQA 1E4XI 5EOTA 3HZKB 4LCYA 1QR1B 3X11A 4F80A 3BQUC 5LQBH 3TIEA 2RCSH 1MCQA 3VXNA 4N9OB 4K3JL 4PRBB 3SDYL 3MYJA 4U1SA 4XNMA 5C1MB 1D9KD 1RUQL 4TPRH 4OBSA 5D1ZA 4NZRL 3QIBD 2FJFA 2YD1A 4LAQH 4NM8L 2FIRT 2JK5A 4MDIB 3FRUA 5HJ3A 5I1KL 1CFVL 1SVZA 1TQCB 2WWMC 2WINB 5HHXL 2VN7A 5IQ9A 4MCZA 1PD6A 1VESA 5AUMA 3UROR 1TQBB 4NN5B 4O02L 2YD9A 2OP4H 5D1QC 4JZOA 1XGRB 4LSUH 4LEOA 1P7QA 5E5MA 4Z7NE 1D3CA 4FQCH 4HLZH 3N50A 4WTXA 4HJJH 4IIQB 5TPWH 2X40A 1S9YA 2VDKL 5HYJE 4QKXB 4XPBL 5FA3B 3UZEA 3MRQB 1G7JB 2KDGA 1LO0H 4AG4H 2HLAA 3F7PC 1FYTE 3WDJA 4H1LG 2B20A 4NQDD 1A0QH 5TE7H 1G7QB 3CU7A 4XCYA 1KPUB 5L0QC 1WZLA 5M95B 2RGSA 2F19L 4WY7L 1XEDA 5CKGA 1T7XA 4Z8FL 1LE5B 4UTBH 1KB5A 5FYJE 2A83A 2GTWA 4DN4L 5A2JH 4XNZB 4XGZA 3VG9C 1PSKH 2EIDA 4LKXA 3G9VA 2XKUA 3CLFL 1CLYL 4JPVH 1A6VL 2L7UA 3LPFA 5DMGC 5GGSA 4XH2A 4RMQA 4JRYB 5KSBB 3OJDA 1U2CA 5SX5K 3B5HA 3OGCA 4S2SA 4XCEB 3PGFH 1KC5H 3TN0A 3IF1A 1NH6A 3RVVD 4GBXD 4MXQD 5C0DB 1CXFA 4EJ1C 3HUJE 2IBBA 4JQVA 3RUGF 3SE8H 1BBJB 3BPOC 1BEYH 4GKZA 4QHLB 1FVEA 1IGTB 3GSWA 4LSRL 1UJ3B 1BAFH 1I9RL 1FLRL 5T33L 2IALA 1CS6A 1A7QH 3VXOB 1KLUA 2KPNA 3NFPB 5F9JA 3HNVH 3NPSC 3PHOA 4XMKL 1PAMA 2E27H 4MNQD 5CCKH 4F9LA 5I76A 4CW1B 3I2CL 1JF1A 3HZMB 3RZCA 2EXWC 2VABB 3ZDYE 3L9RB 3FCTA 2F53B 1KCVL 1I1FA 1ZT1A 4Y4KA 1ODAA 4XBGA 4HH9B 4WI2A 3SDCB 2EDHA 4NNXB 1GZPB 2J12B 5SWSE 3B6SA 2IBGA 2VXSH 4G7YL 1KYOJ 5JW3L 2ENSA 2QTEA 3OAZH 3FT3B 1L9NA 1MPAH 1U8QA 2DQIL 3AB0B 2VLJE 1X6LA 3DX6B 3RBSA 2A6KA 4EZMA 1AGFA 1RK1A 4G43B 4EN3B 3QQ4B 5B8CB 4LLVA 2D0FA 2M26A 1HHHA 4TSCL 3TZVC 4ETQB 1CXLA 1MLBA 4QRQB 3T2NH 1IQWL 43C9B 4X4MA 1QPPA 1E6OL 3MMEA 4XC1H 2AW2A 5KSBE 2V17L 5D7LB 3PP3K 2PXYA 3O4LD 1FG2A 5C08D 5C07E 1DBBL 3SGJA 1YJDH 2APFA 2IH3B 2IPTH 5CUSL 2VXUH 3MRMA 3TLRA 1EK3A 2W91A 5EZJB 3K1DA 5IG7B 3V4VL 4EI5C 1FO0A 1ZANL 4UB0H 5FYLH 1EVUA 5IUSA 1PYWA 4JE4B 1W0VB 4RMWA 2HJLB 1AE6L 3PL6C 5IMLA 5DQJA 1K8DA 1MJ7H 4X80H 4K9EC 5CEYB 3MRCA 2XOTA 4WVRA 1KIPB 1WWCA 1YEIH 2HFFB 3F6LA 4YHPB 4YR6B 3MGAA 4BQBA 3L5JA 4MA3A 1RUPH 3RDTA 2KL6A 1U8NB 2GY7B 4UQ3B 1ZA3A 2XNAA 2ZSVA 3ES6B 1NEZA 3WKML 4TQEH 2R1WA 3SKUD 2FBJL 3Q1SH 4HIXH 1F90L 3JUYA 4D0BB 5C0AB 3U30C 1JYXA 3BUYB 5E95B 1MELA 3DXAA 4ZYKB 3BP4A 4C57C 2CSPA 5LAXA 2CXGA 5F9AC 1EDQA 1PGRB 1ZSDA 3ARUA 4CUCA 1C5BH 3W39A 3PHQB 5GGUA 4G5ZL 4ZUUB 4JQIL 2WBJC 4FFZL 2VE6A 2DM7A 1F4WL 1D9KB 3AREB 1CGWA 1MHPL 3KLAB 4L29B 4LCUB 3C8KA 4GUPB 3CUPB 32C2B 3S5LB 2R0KL 3H9SD 5GZNC 3BZDA 5IJVA 1L7TH 3EFFA 3GK8L 4JREC 3WS6A 2HT2D 1YY8B 2IMNA 3JWDC 3FQUA 2MJWA 4YAQA 4CRPA 4LLUB 4YHLH 3HNTL 5HYSA 4HMCA 5IFAH 2J4WH 4K94C 3VFNB 2NY4B 1CL7I 5SWZD 1N3NB 2VXTL 3B3IB 4L3EE 3PQYA 2NX5A 2OCFD 4KZDH 3O2VH 1BVLA 12E8H 4NOBA 1MAML 1I1YA 3TGXA 1BD2A 1R3LA 1X3DA 3BP5A 5DTFB 1LK2A 3QSKB 3UYPA 3IU4L 3A67L 3L3KA 5ILTH 1LVEA 1G7HA 3OB0H 3TBWB 4RGNC 1NFDE 3LIZH 3U9UA 4M62H 3L6FA 3AVEA 3MOAL 4PGJA 5J1SC 4IS6B 3BEWA 3MRGB 3VJ6B 4NQDB 4M7ZB 2CIKA 1URLA 4X6BA 5IB4B 1T22B 5HD8D 5L8KB 4HV8A 5DURB 1KENL 5F1NB 4NO3A 4JRXD 3P4MA 1Y6NR 2D7TL 4KUZL 3HE7A 3GIZL 5C2BH 5C0AE 4A2LA 1RIVH 1R3JB 2HFGH 3S36H 3RWIB 5IEHB 4U6VL 5DFWH 1KJMA 1MCRA 1CGVA 4GBXB 4D2NA 3OJMB 4MNHB 3IGAA 3BXNA 5JORA 4JDZA 2M1KA 4NWUH 3B9KA 4PRAA 4NGHL 3PL6D 2VDNH 2P47B 3I3DA 5EN2B 2GUOA 4LNRB 3IDGA 4PR5B 3UO1L 1LO4H 3CFDA 2FGWL 3HC4H 2V2TA 1C8PA 4A6YL 1T1ZA 3EAKA 5TE4H 1FN4B 3N1MC 3QDJB 4KI5F 5EU7C 2XY1A 3KPSD 4MNQB 1WBZB 3QEQD 1WK0A 1NC4B 3UPAA 5GS0C 5BVPH 1S9VA 3X13A 3L3DB 3LVEA 3CH1A 3NA9H 2J5LB 3FB7A 3IDNB 1JGEA 3OX8B 4AQ1B 3RFZC 3LDBB 4NRXA 4RNRA 2F54A 4KI1A 2HT4C 4KFZC 5FO7B 3RY6A 1A6AB 4HS3B 1QFWI 4F33B 4QYOB 4JHBA 1TPXB 4I9WD 3TVMA 2VC2H 4UTAH 4X7FC 2UV3A 4NQDE 4AEHL 1F45A 4U0RC 1QRNA 4WHYH 4MX7B 1VPOL 1S78C 1NLBL 1Q94B 4KJWD 5GISL 5DHVA 3VXPA 4Q9BA 5H2BA 5IB5A 4U1KA 2AABL 5CJXA 3QFDB 2XWTA 5T3ZE 1ITBB 2DLGA 4H20L 1T89C 4S10A 4DOHE 1YPZE 2ARWA 2YSSA 3O4LB 3MA7B 5C08B 3N1PC 1BZ9A 4XNYH 2YZ1A 3CVHB 2XN9A 4DGYH 3MLRL 2XFXA 4HFUL 3OJVC 5IM7A 3FQWA 4EOWH 4M93B 3TYFB 4M4PA 4HWEH 5HY9A 5B38B 4GLRI 4L9LB 5D1XD 1DL7L 1JZ4A 3RWHA 4FRWA 3W5MA 1Q0XL 2ED7A 3QG6B 5I9QC 1RJYB 2I9LB 4B7IA 4YIQB 1EGJH 4X5XA 3C6LD 4KVNL 2HMIC 1QQDA 1SYSB 2ATPA 3CMOL 2WUBL 4MNQE 3SY0B 5IB3A 4Q0XL 5BO1H 4JANB 4U7KA 1RULH 3UTZA 2V9RA 5CILL 3HMXL 3TBTB 4O2FB 3QNYA 1NCCL 4I18C 4L8BA 4CN4A 3LKNA 1X5FA 3THMH 4ZFZB 1X44A 5IEKB 3PGDA 5JW4R 5FHBL 2J6EA 4NQCD 1SEBA 4OKVB 4PG2A 3T4AB 3NIGE 4X9IA 5H35A 4NSKB 4XNXH 3NOIA 1SBBA 5DGRA 4QHKJ 2R2EB 1LEGA 1U91B 2YA1A 3R0MA 1YECH 2B5IC 3H9SB 1NGQH 5F1IB 5I1HL 4RAVB 4HQQL 5JPNB 3HZVA 3TH3T 3EYOB 2BNQB 1MEXH 3ZT5A 2EYSB 4R7DA 1NMAL 1G7LA 3UJJH 5ALBL 4M5ZH 4OI8A 1C16B 3O4LE 5SWZB 4JY6B 1NC2A 2QSCH 3OKNB 2X4PB 3E6HB 4TNVK 3CDYA 3HNSL 1D5MA 2AXGB 2YD3A 5DVNA 5DJYB 1M7IB 4HAFA 1C5CL 3BEVA 5CSGA 4L5FL 4PJHB 5LWYL 5AYQA 1OP3H 5AYUL 2H9GA 4PJ5B 4PFEA 4NZJA 2XYCA 1G7PB 4MNGE 2QQNL 1DZBA 6FABL 4UDUA 2CO7B 3VFPB 3EO9L 2B4CL 5C0CA 4NT6B 3KYKH 2A0LC 4XAWH 6CGTA 1IE5A 1M7DB 3GMNB 5K9QI 4JRXB 3D0VA 5HGHA 1HWHB 1OLLA 4DVRH 4PJDA 4Z78A 2IEPA 4YLQT 3BN3B 4J2XA 2W65A 2XIDA 4KJYA 3Q5TA 3GMLA 5IK3A 3TH2T 5I1CL 3EYSH 5F72S 4N0FA 1GCFA 4FQQB 3VCLA 1HHGA 2V5SA 3QCUH 1FZJA 3H9SE 5EU6E 2XXMB 5J6GA 1D6EB 5LGKA 1SEQL 4C59B 2HMID 5KS9B 2ADIA 4OCRH 3MBXL 7FABH 2EXYC 5HHPA 1ACYH 3AXLB 4QF1A 3IFNL 2YBRA 5SWZE 4JRWA 3JTSB 1YQVL 2H2SD 3KPSB 5I75C 3VA6A 4NKOB 4JFYB 1YN7B 5JW4N 5FOJA 3S35X 1LDPH 1IARB 1YEDA 3QEQB 1NDMB 5I30L 2AQ3A 1YNLL 3FT4B 1NEUA 1X7QB 2VZSA 1UEYA 3OF6D 4BZ1L 4PJHE 4Y5VC 4CVZA 1NANI 4PGZA 3FN3A 4P3DB 2F5BH 4Z7NF 1BVKA 3VGFA 2DDQL 2IGFH 3MROB 1CVSC 5MEND 4O4YL 1A3LH 1YNKH 4LASL 1MFCL 4Q6IB 3P0VH 3S35L 3VGGA 4XCNA 5EO0B 1AD9B 4JAMB 4JRXE 4M3KB 4OIIH 3OSKA 1U8JB 4OCSH 2AKRA 1PZ5A 5DR5H 5I17A 1HXYB 4I5BA 1FL6A 2CMRH 4L4VD 4Y88A 4DTGH 2W9EL 3FONA 1J7VR 1SY6A 1KJ3L 3D25B 4K7PX 4X4YB 5E5UB 3R0NA 1QG3A 2BVQA 5DDHA 1GGCH 3C87A 2XTJC 5ACMA 2LTQB 1DQTA 4U1NB 4K3DL 3GJEB 3B83A 3FFDB 5ADOH 4PJEA 5D1XB 3HUJF 1MSPA 4FZEH 2R29H 4Z7UA 3VDBA 3GSVA 1GHFH 1WITA 3V5HB 3ECBA 1S7QA 2BVPB 3DVNB 4PB0L 4K7PL 5D5MB 4MJ4A 3KPSE 4FQHB 5DEFA 5E6ZA 3V7MA 1MHCB 4ENEC 1PKQA 1UXSA 1U8LB 3FQXA 3BT2L 3QIUD 4YUEH 3QEQE 5FCUH 3IDXL 4Z6AT 2R9HC 4HUUA 4H88H 4S1DC 1NMCC 4LHUA 4JHAH 1DBJH 4C55A 3ARFA 5BMFH 3IETA 1P84J 1NAKH 4HFWB 3T1FB 4EUPG 3AY4A 1N0LA 1XF5B 5IJKA 4I9WE 2FX8H 5F1SA 3BP6B 3G04B 1XGYL 4XPAL 3LKPA 4NQCB 3D87B 5D71H 3VXUD 4H0IA 4Z7OE 1OGTB 4JZNA 4MXWH 1K5NA 4YPJA 2ICWI 1YEGL 2Z93A 3VFOB 4LDEB 3UXFA 2FH8A 5E1AA 1XR8A 3QUYD 2X1PA 3IS1X 3BPCA 3TJHD 5JXEA 3OR6B 4YBLB 1JPGA 3WFZA 4IEFB 3ZKMC 4Q9RH 2GCYB 4CVUA 5EPMA 2A9ML 1QYGH 3MFGB 4Y2DC 5FM5M 2QKIA 1OP5K 1ADQH 3I84A 1GIGH 1EPFA 4NKQB 4GMSL 4JFXB 1I7RA 4HBCH 1IM9A 2XZCH 3DSFL 1DVFC 1NCTA 3T0AA 5C09E 4GRWE 2XRAH 3MRNA 4RGNE 4G6ML 1UH3A 4D94A 2W0LA 2FX7L 3HA0A 5KVDH 3BKYL 1MCCA 3HPLA 1U92B 2VQUA 3RWEA 5HGBB 2JJSA 4WWID 3IAPA 2J8HA 3JSSA 4KRNA 3B2UD 4PRPA 2EIBA 2AV1B 2BVUA 3NZHH 4LMQE 4UIMB 1YYLH 4NNPH 5D5ME 1IKFH 4BK5A 4N90D 2F5AH 2OK0H 2XT1B 1F5WA 5KW9L 3IXTA 1DQDH 1A9EB 1UKSA 2HAZA 3SOBL 4O2EA 3TO2A 4O00A 4GS7B 4K3EH 3GGWA 3GBLA 2L7JA 3QH3B 3HB3D 1I1AC 2AJUH 4GRLB 1YEFH 4JZJC 1OTSC 4XBPB 4KKLC 5L88L 1P6FA 4ZAKA 2Z31D 5EBWA 4Y4HC 1J11A 4E42B 2SEBB 4NQCE 5E8NB 3O2DA 3BKCH 3EYQC 4JFOB 1K3IA 4YBQD 5TH2B 1RQ5A 5KAQG 4MB4A 1DJSA 5EO1A 5L2KA 2CDEB 3QEGL 1YNTB 2E5EA 5EU7E 4U6HA 3VRLF 2FJHA 4ENED 5ALCH 2L4OA 3R1GH 2YN5A 4XP9L 4IRSB 4WUUD 1EV2E 1I85C 2AJYH 1W8OA 3KPMB 2VLLA 3W9EB 2VZVA 4AH2A 1QLEL 3IDIA 5E9DD 4WI8A 1F4AA 2ADFL 4J4PA 4OCNC 4YWGH 2RFXB 4NPYB 3T0EA 1XAUA 2AVGA 4E41B 5BV7H 1NL0L 2IWGA 4EDWH 4DFHA 1FORH 2EDXA 4JO4H 5CEZL 3DV4A 5EDXA 5KOMC 2FHBA 1KIQA 4G8EA 2NQCA 3QCVH 5JXAL 5MENB 1S9KC 1NFDF 3MUY1 3TFKC 3UYRH 5EFIA 2P43B 2IADA 3SQOL 4OZIE 3SDDB 3BD3A 3GMPB 4KRPC 3T2OA 1ITCA 1JWSA 3CH8A 5E6IA 4BSVA 5T1LD 1HQRA 4XMLL 2X2YA 4UNTA 4KKCC 4L4VB 5EC1B 5I1LA 1PFCA 1J12A 1CLZH 4PJ9C 1UA6H 2HG5B 3MREB 5IHLB 5DUPH 3NMEA 1J05B 4S1RL 3PWUA 4NHCL 4NUGL 1W72A 4P2OD 2Q8BL 3MRFA 3O6LH 4N0UB 4FHBD 4ZXBA 43CAB 1C5DA 2VRAA 2J88L 1Z9SA 1UENA 4NJAH 4WV1C 1KEMH 2X4TA 2ICCA 1ZVSA 2E9BA 3VWJA 2XKNA 2A74B 3KJ4C 2ADGA 1C08A 3C8DA 4ELMB 3CVHH 4YHZL 3GIVB 3MRJB 3W82A 5ICYA 1T2QL 4YEFA 4QRRD 1CK0H 1LO5B 1ZS8A 1ORQA 1ZHLA 1QP1A 1A14H 4RMVA 3SJVD 4CJ0A 4ELKA 1ZLSL 1K85A 5KSAA 4Y5YB 4RFNC 1XGUA 4I4WA 3UP1A 4NQVB 4NKMA 3L7FB 5CD5D 3QG7L 3WHXA 3B9DA 4XNUH 5GHWH 4ZQKB 3BO8B 2Q7YB 1CGTA 3EYQD 3PE9A 2FO4B 1CICD 4AEIH 5A1AA 1KN2L 2IMMA 2I5YL 1MCWM 1EAJA 5I8OH 3LHPL 4C54A 4GW5A 4J8RA 4JPKL 1U3YA 3F7YA 2DIJA 1XF1A 3DURA 1UC6A 2CUMA 4GFTB 3UZVB 5MENE 5K33A 1SMAA 3Q0HA 5TDOB 2BNUB 1G6RA 1T0MA 1UXWA 2HFTA 3LN5B 5F88A 3EYFA 3DV6B 2DRUA 4MJ5B 2FL5B 3T3MF 2HVJA 5DQDL 4ZS7L 1CR9H 1T5WA 1CQKA 4AK1A 4NN7C 2D03L 2DAVA 1WZKA 3CX5J 2VYRE 3OKEA 2FLRT 2DLTA 2DQJH 1X5JA 4CNIB 3IFPB 2Y23A 3QDMD 4N0UE 4YNYA 2YRZA 5HXMA 3NA4A 4TRPL 4OZFA 4Y5XB 3RAJH 5JLZA 3KJ6H 1YPZF 2VR9A 3NGBC 1KIUA 1EUTA 4R2GB 1UCBH 2ATKB 3MRPA 4KMTH 4U1IA 1BQUA 5F89B 5ESAB 5FUCC 3TFKD 2ZSWA 1RUMH 5DJAA 4O58L 3GBNH 4CGTA 1LP9F 4TULH 5DJCA 4X99B 4KKCD 4NFBA 3CD4A 4ODTH 4NNYA 4HT1L 2P8MB 5CIPB 5GIRA 4F9PC 1DN2A 1IFHL 2BVOB 2OL3A 2QQLH 3FTGB 4NO2A 4R4FL 1J0HA 5D6CA 3K74B 3X3FH 1NFIB 1NMBH 2AXJA 5IVZA 2DWDA 1BJ1J 3WYRA 3ARDA 5C0FB 4Z7WB 1M6OA 5IROA 4OFPA 3LKRA 2ZP0T 3DX7B 2CKBH 1MHEA 2Z31B 3QISA 4R4BA 5GRXG 1AY1L 1ZLWH 4CVXB 3VXUE 1INEH 2I07A 3C5JA 3ILQD 4K3HA 4MAYD 5D2NC 5CKAA 1S7XB 5IMKA 4MDJB 2D7MA 5E8PA 5IWLC 1J1PH 3CC5B 1EX0A 2X7LB 1YMMD 3K2UH 3A6BH 4LGPB 1DEEB 5GGRA 4PJ7A 1XCQB 4MAUL 1NGWB 4HIJA 4A6YB 2IQAB 3NIDE 4RFEB 1S7WA 4NZDA 3NIGF 4MD5A 5A43C 4LLYA 2XWJA 5C0EA 1XF4B 2Q8AL 5L6YL 2DYPD 5ID0A 2XICA 2Z8RA 4K94L 3FN0L 4H1LH 4WUUB 1I8KA 3U7WL 4PB9L 1RZ7H 3RI5K 4OIAA 4KV5F 2OTWB 1KLGB 2C7UA 4XPFH 4LGRB 3SE3C 2X4OB 5E9DB 3PXHA 4OAWB 3GM0A 3WXVL 2FB4H 3MCKA 5I19H 1J8HA 3QQ9C 3R4DA 5DA0B 5CZKA 1E28A 5ICZA 3D3VA 1CE1L 1NGXB 1YQ2A 5DMIL 1RI8A 2AP2A 1DLHA 4RGMC 4EI6B 4JFFD 3C60D 3L7EB 4S11A 4HCRH 1J87A 4DFIA 4Y0GA 3BVNA 4PD4K 4PJXB 2QR0B 3U4BH 4N90E 5DJ0B 1IEBA 1JTPA 2BOCA 3ME0A 4Y16B 3HG1B 3NH7L 1YZZA 3GRWH 1DLFL 4OLWH 1QD0A 3QO1B 4WW2C 1IBGL 1W0WB 1XGTB 2A6JB 4TNWF 1FJ1B 1U9KA 1U0QA 4UOW0 2PF6A 2DQGL 2QHLA 5ESQB 3FL7A 3GSNL 3OMZA 1MJJB 2W1NA 4R97C 4PJIB 3M1BA 1QSEA 5F6IB 3GB7B 3QIWD 3UTSB 2BJML 1U95A 4XPTL 3O3AB 1WEJH 2DKSA 5D1ZC 1TZHA 4P2OB 4TUOA 5C70A 1BOGA 1A6UH 4P9HC 5DD1H 1XIWA 3MLPA 1UZ6F 1CGYA 4PV9B 1DSFH 1DQMH 2O93L 1FFNA 1CD1A 4OM1H 5GJSL 3LS5H 4JG0L 3AS2A 4DUVA 1K4CB 3GMQA 3ZL4L 4P2QD 1A8JH 5I1IH 4WUUE 3I3EA 4FFWC 5FHAL 3MR9B 1MI5A 1QBLH 2GK2A 1ZAGA 3MRHB 3LQMA 2YD4A 3SJVB 1B3JA 4ALAL 4R0LB 3P4NA 5IF0A 4MA8L 4ZO8A 4NRYB 3UBXG 3K7UA