4QCIA

Pdgf-b blocking antibody bound to pdgf-bb
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
206
structure length
206
Chain Sequence
YELTQPPSVSVAPGQTARISCSGDSLGSYFVHWYQQKPGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSAFTHNSDVFGGGTKLTVLPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
molecule keywords anti-PDGF-BB antibody - Light Chain
total genus 39
structure length 206
sequence length 206
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciA01
4NQDD 4WFED 5DJCB 2JJTC 1T21A 5T1MB 3BPLC 5ITFA 1YEEH 1A7NL 2BVQA 4UIKH 3RZCA 2V5YA 3MJ7B 4HZLA 2FEEL 3O8XC 4YHNB 4UT7L 5IMOB 3DYMA 3TIEB 5TF1L 5HGDA 5HVWA 1I85A 5KSUA 4FQCH 1OAZH 3P9LB 3JTSA 3THML 2NLJB 4WW2F 5HYQA 1MCCA 4ZUVB 4HKBA 1ZT7A 4TOYL 2CO6B 1J1OH 4S2SA 1JYWA 4JPKL 2DL2A 3MBEC 5FV2A 1NFKA 3GMRA 3GSOB 1U0QA 2PW1B 1B4JH 2R29L 2BVUA 3BPNC 4Z5RA 1UEYA 4MD0B 2WSKA 6FABH 5JW4M 1P5UA 1ZVYA 5CCKL 3KYOA 5KS9F 1ODAA 3WLWC 4Y1AE 4Q9BA 3DROB 4GOSA 3VRJA 1LNUB 3HI6H 4P4KB 4A6YH 4M8QB 1ZA6B 2GAZA 2D03L 3NMEA 3BVNB 3TZVC 4NQED 2J4WL 4XI5C 1E4WH 3QXDB 3SDCB 3S88L 5JUEL 2ICES 4GG8B 1MCDA 2J3SA 1REIA 1BZ9A 1UXSB 5C8JB 4J1UB 5A43C 1NLBH 4PLNC 5A3ID 5EIIB 2C5DC 1A6VH 5BS0B 4H1LB 1N64L 3QUZC 4KXZI 4LHUB 5EBWA 4PJXA 1RIUL 2SEBA 3SBWA 3U36B 5JORB 5IIEA 3PQYE 4RGOL 4UTBH 5C0FA 1A1NB 1J1XL 1MJJB 3OKNA 5HTSA 1X6NA 1N6QH 4YBQD 1KCVL 1TETL 1MELA 2VZOA 4PJHA 4ZPTA 4APQC 4JRXB 1CLYL 5FA4B 3WUWA 1MAJA 3MLUH 4LL9A 3EOTH 5FGBC 1MSPA 2A9MH 1BF2A 4XRCA 1QBAA 1UQSB 3QFDA 1XR9A 1NMAL 2R2BB 5C0CB 1A47A 4IRSA 5LKNA 3PWJB 4BKLB 1TCRA 2ADGA 1JPTH 1JP5A 2DIAA 4UBDD 4WJ5B 4G6FD 4HIEA 1QPPA 4ODVL 1NAKL 4KJYA 5HI4C 1HH6A 1MREL 3MRLB 3VXUA 3P4MB 3WSQL 5K9JH 3WS6C 1EVTC 1UWGL 4MCZB 3IJSA 3G04B 3N1QC 3GBNL 2EO9A 5I8EB 25C8H 3VGDA 1FYHB 3HC4H 1MH5A 4X8XA 4POUB 5EZLA 3D85B 1WFUA 4GKNB 5E99L 3C6SA 3ARBC 5IW3A 5BVPH 1FVDA 5HHOA 4XB7A 4BA8A 1KJ2L 1P4LB 2FX9H 3K7UA 5JO5A 1TVDA 1E28A 1H0DA 4X6DF 4K8RD 1LK2A 3H3PH 4RFOL 1JGEB 1OLZA 1KELH 5DA4A 3S7GA 5GGQH 5KSBB 4KGLA 4Y16B 4XPFH 2WUCL 3DGGA 4P46C 1S8DB 3PGDA 2HG5B 3MGTB 1RUQL 1NMCB 2HT4D 2IANB 1S7SA 1NFDE 4NC0B 3RWGA 3NFSL 4M4RA 3ILPA 1U8KB 3C87A 4BFIA 2BC4B 2WUCH 3PGCB 5LGJA 1EX0A 1KLUA 4M1CD 1SEQL 2R23A 2ED7A 1PSKH 4MXWL 3O6MH 1MHCB 5HI3D 5SWZB 1F4YH 3RTQB 5B3JF 1XF3A 1FG2A 1JF5A 2AKRA 2PYEE 4OZHE 5DD5L 4TPRH 1S7RB 1K9TA 4MXWH 4HWEL 2X4SB 5B8CA 3ECBB 1CL7H 3PDGA 2E7LC 4KPHH 5IG7A 4N9GA 4PJIF 3ZKXC 3QA3B 4JY6B 4Z7WF 1DFBH 1OTTC 5D5ME 3MA9H 5F9DC 3UPCA 4BQ6A 2OI9C 1BD2D 4KDVA 1WBZB 5TDOB 4CN4A 1DE4A 2G5RA 3P0VH 5T1LA 4LFHD 1ZEAL 1SY6L 4U49A 2I60H 5ISZE 4Q9QL 3QDAA 3MO1A 4RRPA 2FCBA 3BZFB 3LCYA 4PJCE 3OZ9L 1BQHA 3TP4A 1CN4A 1A7QL 3CH1A 3DRTB 4MA3A 3QO1A 1Q9WA 5C1MB 2H9GA 1UB6B 1ZT1B 5K9KA 1MFBH 4JFEB 1FZJA 3BDXA 5HBBA 2YWZA 3VWKD 5DUML 4LGPB 3RKDC 4Y19A 4UT6H 1JF1A 4E42A 3CFDA 3MR9A 2IG2L 4NDMA 3VXNA 4FP8L 4U3CA 2GQHA 1FFPA 4F9PC 5IMKB 2DI7A 2EDLA 2PNDA 3W0WA 2OL3B 4DEPB 1CGYA 4HWZA 4HUVA 4J12A 1XF1A 1BHGA 3MTRA 4IMKC 3CDGA 1AGDA 5DRWB 4GO6B 4EDXA 3VRJB 1S5HA 2C3WA 2AXJA 2X1XR 1L6ZA 2J6EL 1U8LB 2BRRH 1X5KA 1ONQB 3TH4T 2QHRL 3HCVB 3QXDA 4LVNC 3FO9A 4YXLH 1T5XB 4KY1H 2YPKA 4KTDL 1DANU 2XXCB 3ABZA 4PJ7A 3WIIL 2FYYA 4BH7B 3OKKA 4JGJA 2F54A 1XGPB 5JLZB 5BZWA 2BSTB 4M3KB 4K8RH 1BBDL 4BZYA 3ZE2E 5EORL 1CU4H 2IGFL 3TV3H 2V2XB 3B9EA 2XXMB 2NY3B 2R56H 5C0AB 3VXTB 3MRCA 2Y36L 2OR7A 4ZTPH 1UA6L 2DQUH 3OPZL 1MFNA 5IEKA 4WGVB 4BZ2L 2I07A 5HYSG 5JA8B 1ZLVH 3ALWA 2H1PL 3PQYB 4MJ2A 1LO3L 1XIWA 1K4DA 1YECH 1RK0B 1FIEA 4LMQI 5C0FB 5SWSD 5GS2H 3Q2CA 5L6YH 4MJIE 1IEAA 4KVNH 4D8PB 4RIRB 3JV6B 3B43A 4OZIB 1DVFC 2X4PA 3MV9E 4PREA 1QR4A 5JQ6L 3FRPG 4NQVB 4HXAL 1W0WA 3SDXB 4FXGB 1A6WH 4KTEL 4KVNL 4PRNB 3K3QA 2AQ2A 3UYPA 4U1LB 1MY7A 1II4E 4TTDC 1BLNB 5EBMA 3OGOE 3GKWH 2YD7A 3LVEA 1G7PB 2NW3B 4L8CA 1MRDL 3HE6B 3CFKB 5K9OA 5D1XB 5IB4A 2LTQC 5JNYB 3OHXB 3GO1L 2R1XA 4FQPA 2AV1A 1PAMA 3LKQB 2VLJB 5EG6C 5DT1L 1GZPB 4OCLC 2ATKA 4CW1A 1OARL 2JIXD 3ROLA 4WTZG 5I1LA 2ADJB 3D48R 1G7MA 4D9QE 1MFAH 4I2XE 4MS8D 5CZVH 5FXCH 3W0WD 5DUBB 4NQSA 5HHQB 3BO8B 3DVNA 1T0MB 3GBMH 4Z7VF 1Q94B 1RIHL 1XAUA 4O58H 3GIVB 4YQXH 4LEOB 5AAMA 3EO9H 1KOAA 4KKCD 3DURB 2XQBL 3NIGE 5ANME 1TFHA 3ARSA 2XA8H 1SHMA 2OLDA 3LKOB 2BZDA 5TPWL 2Y23A 2VITA 4L9LC 3MCKA 2CRIA 1DLHA 5CSBA 1JGDB 3LEVH 1QBLH 3TN0C 3QDGE 3J7HA 1ZVSA 3DSFH 3KLSA 3IFPA 3PG2A 3U4AA 2YUWA 2X70A 1EERB 2W59A 5F9JB 3CSYA 1N8ZB 3EYSL 4HKZB 5CZXC 3K8LA 5I76A 5D1QD 5EPMB 5DZNA 4OFDA 2P7TA 2VDLH 2EIBA 4JRYD 2F74B 4TSAH 2D31B 2CGRL 4NJ9H 3X3FH 3ZYOA 3DETD 1R3IH 3VWKC 3LRSA 1NEZG 4LEXH 4HG4K 1S7RA 1J88A 3LKSA 2I9LB 2YC1A 4OLUL 1AO7D 4RRPG 1CS6A 3DUUB 2ZUVA 2D03H 3ZKNC 5L2KB 1SY6A 4KUCD 3PWPA 2P24A 5D2NC 2NNAB 4LLDB 1C08B 3O9WA 1IEBA 4UOW0 3OGCB 4P4KD 1A3LH 3QUKA 3UTTE 4Z7UF 8CGTA 3U0TB 5AG8A 2VJXA 1YC8A 3IVKA 4G9FB 5TJWK 1Q0XH 3RU8L 3QG7L 1N3NB 2Z31B 3DV4A 3IXAB 2FSEA 1JWMB 4NYLB 1I7UB 3FFDA 3VD9A 1H3UA 1C12A 3WE6B 1FC2D 5GRYA 5AYQA 4BUGA 4QOKA 4UQ2A 4O9HL 1JZ3A 1P4BL 1WCQA 5B39A 2ORBL 4JZNB 4PB0L 1OY3B 5HY9B 3QH3B 3S34L 4R8WL 3AU1B 4OGAD 1A6TB 5MERB 1ORSB 3MJ9A 3BRGC 5LGHH 5GJSL 4ETQA 2XWBA 1YEIL 1TTGA 3CDCA 3I6LD 2VDMH 4LPWA 3EFFB 2B5IB 3LQAL 4GMTL 1MCWM 4PRDB 1CFBA 4R8WH 2PXYD 2J8HA 4PGJA 4S1SH 5SX4I 5DEFA 3T4YB 3FO2B 1G6RB 5T3XD 4Z7QE 3RFZC 4Z95H 2BSTA 3FRPA 5AWNL 1S3KL 2FB4H 4Z7NF 3C2SA 1M1SA 3STBA 3PIQA 4F7MB 3LPFA 1U8PA 4PR5A 2UY7A 3X11A 1SEBB 4MA7L 1HI6B 2DLHA 3TFKD 4MSWB 3ULVH 1N0LA 5HHVL 1YDPB 3NN8A 4AENA 3ULUH 2R0WH 1PEWA 1RJCA 5EU6A 3U9PL 4PD4K 3IU3B 5DD3H 4DJMA 1Q9KB 1ZHBA 2HJKA 4NRYA 1S7QA 3FQRA 4G6AD 2I07B 2GUOB 1CFQA 4BYHA 2BRRL 3QDMD 1KPRA 4GLRH 5DVKA 3VFSB 1OHQA 4DZBB 1EH9A 4NNPH 4FFVC 4YFEA 3MRDA 5KBNC 3DUSA 3QUZB 1FZMA 4U6HA 3BE1L 2EXYD 1E4XL 1OF2B 2Q6WA 3JWDH 3GMNB 2XPGB 1IGFH 5EIVA 4Q74A 3L7EA 1A21A 5DMJB 1AY1L 3F7YB 3UDWC 3GBLA 4OFPA 3S36L 1IGFL 1BQHB 2LU3A 3GGWB 4UB0L 1BBJB 5KN5B 3G6JE 4X7FC 1RZ7H 4PJFE 5B38B 4XH2B 3L3JB 3B3IB 3O4LD 1XH3A 4HQQH 3NAAL 4KGJA 1Q38A 3T0EC 4YBLB 4Y19D 4NKIL 4P23D 3VD3A 4RISH 4AIZA 3K8MA 2JJSA 5CIPH 3ILQD 2NW2B 3DMMD 1Z9MA 3CFDB 3MR9B 1Z5LB 4QOKE 4QRSB 3U4BH 4P48A 5DRZA 1EK3A 4NN5B 4YZFF 4BSJA 2CK0L 5LXGH 4GG6A 3MXVL 4JG1H 2HLAA 1FG9C 2R2EB 1WZLA 2XV6B 2WMPA 1CLCA 1LO5A 3IDIA 3VMNA 1Y6KR 4ZUWA 1T89A 1AR2A 1CLZL 4XPBH 1IVLA 3S6CA 4HLZG 4QXTA 2X70B 1MCOH 3VI4E 3VD4A 4D0BA 3K4DA 2XY1A 1YEEL 3K46A 1NC2A 2E9BA 2GSIB 3N9GL 2BJMH 1A6AB 1B2WL 5C0EB 4V1DA 4PGBA 1KUMA 4M61B 4DTGH 4XP4L 1QVOB 2ESVB 1YEGL 1IKFH 1K4CA 1T83C 3TV3L 5DC0A 5IVXB 2IH3B 2W65B 3T2PA 4K3JH 2NY6C 2VZSA 1F2QA 4JY5H 1N0XH 1ZHKB 3RWDB 4K3DH 3UZQA 4I9WE 5F1SA 1JNLL 4YO0B 5DJXB 5F96H 1DSFH 4ODTL 2J7LA 1RZIA 5M94B 3ILQC 4LF3B 1HHGB 5L8LB 1FC1A 3OGCA 2NY7L 3NCJL 3EYFA 1XIWB 3SKNB 4J23A 3BEVA 3MYJA 1RURH 4Y16D 1UADC 2QSCL 3BHBB 3V4UH 2VKXA 3NGBB 1GGBL 1FNFA 3DLQR 3FFCE 4X4ZA 1VEPA 3TC9A 4Z0BL 1HKFA 5KVEH 5IB5A 4OM1H 3H9HA 5DC9B 2P45B 1GH7A 1HQRA 3GHEL 1KJ2B 3SDXA 1R5IB 4HJGA 4DFIA 5IJVA 4XPAH 4P5KA 1QHPA 3ME0A 1EZVY 2FHCA 4P4RB 5MP6L 3BW9B 3CCHA 5IM7A 1MCLA 4HCRA 4P23A 3O4OC 1JJUA 4D94A 2EC9U 2MPAH 3GMQA 5ID0B 1CBVH 3ARWA 1NEZA 4AEFA 5A16A 3LZFL 4G80B 1J0ZA 3AUVA 3IETA 1QSFE 3TYFB 1YJDL 2WBJD 2EYRB 3PWPD 1CD1B 1NANI 3B2UD 5J1AA 2HFEB 4GMSH 1SBSL 4P4KA 4ODHL 1K8DB 4LSPH 1FO0A 1S5IL 2YUZA 1MPAH 3PWLB 4ZNCD 4ZQKB 1NMAH 1Z3GH 1A6TA 2ED8A 3QEQD 5MERA 3ULVF 3KJ4C 1A9BB 3FT4B 2FL5B 4XNYL 1Z9OA 3QYCA 1FZKB 1MVUA 4G8IB 4KMTL 4M7ZC 1B6UA 1L0YA 4AL8H 1H3WM 1JPGA 3BIBX 3ZE0E 1KGCD 1NDMA 2D0FA 3LSOA 1A1MB 3RWFB 1FRGH 3QUXA 4LPVA 2D3VA 1U42A 3A0OA 2EYSB 5CSGA 2P8LB 4NT6B 1G9ML 2NY4D 4X6CB 2XZQL 1U8HA 3HNVH 1A1OA 3MV9A 3JTTB 1ZLVK 4NN7B 3AS3A 1S7QB 3ZZ1A 3I6KB 2DQEH 1PFCA 5GGRA 4Y5VC 3VXSD 3EYUL 5F9WC 3SJVA 2VSDA 4WO4B 4GAYA 1IGCL 5EU6B 4OD2B 5JIHA 5GJSH 5D1ZC 1OAQH 1UH2A 2DLGA 1ES0A 3PV6A 3QDJA 4R3SA 4E41E 3ARPA 2R0WL 3QPQC 3LQAH 3VRLF 4OIIH 4KAQL 3S8WA 2C7UA 1N2RB 1PG7W 5C08B 4AQ1B 3ARED 4L1HA 4Y89A 2C4XA 3DTXB 1F3JA 3GSXB 3VXRE 1I3GL 2FRGP 2PR4L 1F3DJ 3GHBH 1KIUA 2EICA 2J88L 4IS6A 2ZSWB 3QDMA 5C71A 4HDIB 3CPLB 3CVHA 3R4DA 3X3GL 3C5JB 1D5IL 1F4YL 4U6XA 2AXFA 3JV0A 1WFNA 4QGTA 4ZS7H 2C1PA 4ZAKA 3TVMD 4ZOBA 1BVKA 1JGVL 3VH8A 3OWEA 3FFCD 3O9WB 1V3LA 3MRBA 4LPTA 5IB2A 1HWGB 3H3KA 3SE8H 3H7LA 4OLXL 1YEFL 2XA3A 1FH5H 5CUSL 2XICA 4Z7NE 2P5EA 2PTUA 1M05B 2OBGA 2AGJL 1DUYA 4XZUA 4X7DC 5FGRA 2GTWB 2X4NB 1FVEB 1S9XB 4RSVA 2CLZB 2H2SD 5J6GA 1SYVA 7CGTA 3BMWA 1XIWC 2FZ3B 5BW7A 4X6FB 1KCRL 2I9TA 2EE9A 4NNPL 4FQIL 2VRAA 1WF5A 1I3VA 3RWEA 4DW2L 3O4LA 2DYPB 3GMPA 2Z4QA 4F8TA 1BFOA 5HJ3A 2O5ZH 2EH7L 2Z91A 1C5BH 3V5KB 2Y07H 4K23H 1MCNA 3QQ4A 3EJYD 1U3HB 1RY7B 4CJ0A 2Y6SD 3AREC 5ENWB 2FJFA 3NFPB 4I0PB 4C56D 4MYWB 4FZEL 3QUXD 4IOFD 4LLUB 1FV1A 1BEYH 4RWYL 4HT1H 4XMPH 3OL2A 2FJHA 1Q9OB 2DIJA 4Y4HC 5IT2L 1MHEB 3VA6A 3LRGA 1TNMA 4YUEL 3TBWB 3Q5YA 3REVB 2QADB 3CZFA 3IU4L 4PJFB 1BEYL 4RWYH 4OF6A 3KPSD 1S7UA 4P5TD 2AKRB 4NZUL 5GSRB 4V1DB 1ZLWH 3EKCA 5FUOL 3KLHC 2K9UA 5D7IA 4P3DB 3WIFA 3JWOC 3AROA 3HG1B 1IAII 5DSCA 3D18A 1EJOL 3DI2B 4ELMF 4JJ5B 4KI1A 5D2LF 4NZUH 1J8HD 4KY1L 1M71B 12E8H 1WBYB 1U92A 2ERJC 4DN4L 4JN2B 4N1HB 1JMZA 5E6IC 5C09A 4H26B 2CKBH 3C5ZC 2YRLA 5GGVY 4JZJB 4Y5VA 4HKXB 4P5MB 5D71L 3B9VA 2J6EA 3SCMD 3MV8E 3RPKA 3BE1H 5CCKH 1XZ0A 4KKLC 5F6HI 5SX4H 4HULB 1AD9A 4M7KL 4JZJC 1JUFB 4DKDC 2QKIB 5TDPB 5FYLD 3QZWG 4FQ1H 3DX6A 5T1LD 5E6IB 3PWJA 1T83A 4PJCB 3T0XA 4MNQE 3RVTC 1T20A 2Q3AA 2NY0B 5EC2A 2Q20A 5C0IB 3SGDH 3ZL4L 5DT1H 5HHOE 1QLFA 3VXOB 1I1CA 1INQB 4KWUA 3RY6A 5F7LB 1WJ3A 5JHDE 3S35X 4MAYB 1MFAL 4OCRH 1L6XA 3IJSB 2MQ0A 1CLOL 2PCPB 4AG4L 1EMTL 1NFIB 3U7WH 1FL5B 3CVHH 5CIPA 3OR6B 2ATPA 1BD2A 3D87B 2AXGA 3ZL4H 5B38G 2AK4B 2GJ6A 3QXTA 5FA3A 2AJ3B 2EYTA 3OJMB 3OKLA 1AXTH 3BKCL 1DDHA 4ZDHA 4N5UA 2PUQT 3MNVA 4P23C 4OZFB 1FFOA 1ZGLP 2NPLX 3ZDYF 5MEQA 3MA7A 3B9AA 4NHUA 2P8MA 1B3JA 5D93C 3UC0L 1GXEA 3QAZB 4ZUWB 4DGVH 3OV6A 3KPSA 3VD5A 3KPRE 2J5LC 3P73A 5FM4A 1ZT4B 4RMWA 1SYSB 5LBSL 1OWRM 2NR6D 1KJVB 2MSPA 3B6SA 4S1DC 5GXBB 4NQUA 4FTVE 1RU9L 3BPLB 1CD0A 3SDYH 4BUHA 5K9JL 1NAMB 2YOCA 3PGFL 1IT9H 2A73A 2XA8L 2H6PB 5GRJH 2VR4A 5DQDL 4JZOA 1QLRA 1PKQB 1HILB 1UKQA 3EO9L 4PJ8B 2VWEE 3EOBA 1A2YB 1ZANL 4HUMB 4XNYH 4XHJC 2I24N 2UWEF 1GL4B 2ZUTA 1IGCH 4ZO6A 4PGCB 1AGFA 2GYSA 4UV4H 1J8HE 2CUMA 3MQIA 1MRFL 5DYOB 4JDZB 2DMCA 2X4RA 5EU7E 4QRTA 5EOTA 4KK9C 2BOBA 3DSFL 3O3EA 3LN4B 2A6JB 3MV11 4NN6B 5F9OL 5HHNB 3TLRA 7FABL 2FEDD 1CG9B 3QO0A 3T2NH 2HLFC 4NWTL 5EUOA 5EZOL 5DVNA 1TZHA 3D5OF 3GHEH 2YN3A 2A2QT 5EOCJ 9CGTA 2UVFA 5TQ2H 4UUJA 2R4RH 1IARB 4LEXL 4F2MA 4JANA 1QFOA 3HC0B 4K9EL 1J0YA 3HMWH 1OGTA 5DFVC 5TGBB 3KR3L 4CU7A 3D25B 2NXZD 3QO1B 3FFCA 3W9DB 4HXBH 4ZSOA 2OTWB 1T80A 3IDNA 4K7FA 2GJ6D 2GFBA 5IMMA 1E4JA 1PLGH 2IADA 1HXYB 4RAUA 4MA1B 3GZKA 1BJMA 4R96B 1YJDH 1MJ8H 3IFOB 3WFCL 2WP3O 5DD5H 2FBJL 2R0ZL 4OSUL 5GHWH 5ICYB 1CDJA 2NY5H 4F9LA 3KPTA 2IPKB 1A7QH 3C09B 5A2FA 4QRQA 1D5ZA 3VFMA 2FX7L 4HUVB 1YEIH 5FOBB 2D7OA 4H20L 2FD6L 1FO0B 5FUZH 1EA9C 3IFLH 2F19L 1GGTA 3MA9L 3GFUA 4U1HA 3AXLA 2P46B 2VDPH 3L3HA 5IVZA 4RMSA 4U6VL 1MFDH 4HUUA 4G6JL 3MMEB 4XXCC 4XMLL 1NCBL 4P2OB 5A1AA 5GZOC 4PJGA 1MIEL 2CIKB 3TN0B 4N0FA 5LGHL 1A6ZB 4CVXB 3JUYA 4DCQA 3G5YB 1YEJL 4ZFFA 2EYSA 4LCCA 4NO3B 4H25A 5E5UB 3JUZA 1S9YB 5AUMB 5F3BA 4JREC 3ZSSA 4FTVD 5LWYL 3IDYC 5I1CL 4GG6E 3PHOA 3VJ6B 1MI5A 2BFVH 4I3RH 3DUUA 2NMSA 2WQRA 4OQ1A 4N8CL 4MZ2A 2IH1B 4Q6IB 4G6KL 4NQEB 1Q1JH 3WD5L 4MX7B 1MLBB 1A64A 3QEQB 4PRPB 4Z7OE 4OZHA 5BRZE 3ULUL 2VLJE 1KJ2H 2XTJB 4KUZL 3MRGA 1UVQB 1FVCB 4BFGA 4L8BA 4ZO9A 2R0KH 4OCSH 4JO2L 5DJZA 5FCUL 3KYMB 5GZNC 4OQTL 1T20B 4W4OC 4X5LA 1AC0A 5FYKL 2F54D 2FLBT 4LVNB 2FWOA 2AXFB 3FL7A 1S9VA 4UDTA 3OHXA 1O5DT 2VXSL 5MI0C 3EO0A 3BIKA 1OSPL 2QSTA 3C5ZA 3JXAA 4K8RC 12E8L 2ATPB 1MIML 2ZOKB 3TA3B 4BQ8A 1KN4L 1WZKA 5CSZB 1EO7A 4PG9B 5EFIA 4OGYH 1IJ9A 3QULB 3I02B 35C8L 1JTPA 2PYFB 3BKJL 3QNXB 4EN3C 1GOHA 2QQNL 4OLYL 4X5XB 1U6AL 5AAWA 5AD0A 1G9NH 5T3XH 2Y07L 2GTZB 1LO2H 2W0LA 1DL7H 3OKMB 3PL6B 4ZYKB 5I2IB 3IKKA 4BSVB 4CU6A 1AD0B 4MNQB 5T33H 4GAGH 4YC2C 4OD3H 3BPCB 2D7TH 3TNNA 1EBAA 4PY8I 4I2XA 4NN5C 3ORJA 4C4KT 3UJJL 1NCCH 4D0CA 5I6XB 1XGUA 1T22B 2YPVH 1ZLUH 4ZFGH 2DQIH 4Q6IC 2XZCL 1MJJA 3OKNB 5GRVK 5ICZB 3CC5B 5F7EH 2QQLH 2NY1D 1HILA 3BH8B 5L2KE 2QR0B 1HEZA 1I1FB 4JKWA 2UZYB 3FT3A 4Z77A 4UV7L 1T2JA 2K3TA 2W9DL 3H9SA 2IQ9H 4WTXA 1XR9B 4JVUA 5I73B 3HAEB 4ELME 3LEVL 5GZND 1AO7E 3GBML 5IKCA 3SE3A 4FZEH 3WO4B 1UXWA 4OV5B 4JO1H 5EBLA 4M5ZL 4V2CB 1TJHL 1MCPH 2VLMD 3BP7A 5I15L 3EYSH 3DXAD 1F4WH 4UT7H 5FHAH 3E1F1 1FYTB 4K3JL 3BQUB 1WWCA 4B53A 2FLRT 1YPZA 1JHTB 3TO4A 5HGBB 3FCTA 5LGKA 4M7KH 4Y4KD 5I15H 2XACC 1ED3B 5CKGA 5SWZD 1AXSA 1CICB 1WCBB 3SGEH 5J1SC 5GRWA 4PLJD 4XH2A 2ZNXA 4TUJA 1F4WL 4DQOH 3TIDA 1BIIB 4DFHA 5DZOA 3R8QA 3PGFH 1IAOA 5JA9A 1LHZA 4XPAL 3HAEG 3G5XB 1NEUA 3LD8C 3HC3H 4HGWA 4IRSC 1PKQE 1CU4L 2A1WL 2F54E 4LU5H 1HN1A 1NUNB 1KTDB 2PF6A 4OCNC 1QRKA 5DEGB 5F96L 5IHZA 1XR8A 1ZTXL 5FF6B 2NY1C 3H7BB 3L3IB 5F1KC 4U0RB 1Y6MR 3IDNB 4K7FB 5KZCB 3SY0A 4KJQC 3GSRA 1YUHA 3SDAB 4YX2H 5D1ZB 3ZYJA 2BY1A 4MLIA 4XC1L 4EUPG 4JG0H 1OT1A 3QH3A 1J9CT 2XQYG 4I77L 1G9EA 4L29A 1QLEL 4KDWA 5IW1B 5IW6B 1S5IH 3G5ZB 2DJ4A 5FA3B 1S78D 1ZXQA 4AEHL 1T03H 5SWQB 4Q2ZB 3CLFH 4O2FA 4NFBA 1U95A 3RVXD 1RK1A 2X9WA 4Q9RL 1E4KC 2X9XA 3ET9F 4AMKH 1IZKA 1X7QB 2GK0B 3EGSA 3G6DL 5GS2D 1I1AC 3WFZA 2NY5L 3TPUB 2CPCA 1V8HA 5C0BB 3TEUA 4XNQB 3TBYA 1LP9A 1ZE3C 4LLMA 4O5LL 4UDUA 3GNMH 5DQ9A 1KTKE 2WBWB 3HE7C 1AHWC 2HTKD 1CTNA 1UWXH 4OZGB 2OJZL 1NH6A 1YY9D 4P49A 2NYYD 2EKSB 4JO4H 4YNYB 3PWUA 3KPSB 1YMMD 1ZHLB 5IB3A 3L7FB 1QEWB 4Y8AA 4V1DD 4YO0A 4LIQE 2ADIB 1BQHG 4NIKB 3KWWB 4MJ6B 3SGDI 3I85A 3TBVA 4LF3A 3M1BB 4I3GA 1A6PA 3U4EA 4ACPA 5CEZE 4KXZH 4JPVH 1KYOJ 3G5VA 5L9DL 1T2QL 1OLLA 1TCMA 2D9QB 4WW1B 5FB8B 4W6WB 4N8VB 1Z3GL 1BECA 1E28B 4ODXA 2FECL 3RWCA 3C08L 1UVQA 2DMKA 3CFJB 5LJYH 3QPXL 3TT3H 3KLHD 2J5LB 4M9PA 1TNNA 2XZQH 5GGUB 3DX8B 4DZ8A 1QKZL 3GK8H 2HVKA 4MX7A 4PJDF 4QWWC 3LQZA 1IM9A 2PXYA 1VGEH 3CU7A 3P77B 4L8DA 5ADOL 3HR5A 1R3HB 1NFDB 4DAGL 1U8JA 1Q0YH 3O4LE 3DIFB 1TCRB 1IEHA 5TF0A 4Y4HD 2FECI 2A6KA 2X7LB 4G9DA 2ARWA 2ZCLH 4JJHA 1TPXC 2VLKD 3E3QE 4F80A 4E0RB 2A6IB 5IF0B 2DQJH 2XN9B 3ULVE 3BPOC 1I3GH 2O5XL 5LCVH 2EYRA 4I3RL 1H3PH 3HMXL 1QOKA 2YRPA 4NCC2 3DV6A 5FYKH 4D9LL 3LN5B 5E24E 3GSUB 1FNLA 3HUJB 4HHAB 3O2WH 1NGYB 1R3LA 3HB3D 1OQOA 3BGFB 4EI6A 1JV5B 3B2VH 4PRPE 2BNRA 2EIEA 2VISB 5JXEC 3WIHH 1HHHB 2RCSH 3ARQA 1EHNA 4PGEA 2AS5M 4X6DE 3DYPA 3U0PA 5ESAB 2YPLD 4M43L 3HAEH 3G6AA 1SVCP 5DJYB 3GJEB 5IESL 1ZGLM 4YFDB 2APBA 3EDDA 1OWWA 4CADB 1TJIL 3VXRA 4R4FL 3O11B 5ANMA 4MDJB 4P0DA 2KBGA 4M6NL 5FOBA 4OCYL 4H5SB 4I0KA 4HWBH 4PJBA 3HPJA 4Z8FL 4RX4D 4EEEA 1OP3K 3PGDB 1AHWA 3P0VL 3ARZA 1EAJA 1LP9F 4JKLA 1DUZB 4L4TD 1BGXH 4I9WD 3QSKB 3LMJH 3HRZA 4GAYB 4GQ9L 4OCXL 4PS4L 5I71B 1PDKA 3GJFH 4QF1B 2HMID 4TSCH 3DUHA 3WFBH 3BMVA 5T3ZD 4PRAA 1RK0A 1FFPB 4KJQD 4AQOA 3GI8H 1HNGA 4M5YH 4KPHL 1YNKH 4D8PA 1IC4L 3IAGC 3P9MB 1EFXD 2J8UE 4XCYA 3SOBL 2AK4D 4MVBD 1FQ9C 4OFYA 2P8PA 4XTRC 1B90A 1KEML 1XF4B 5F88A 3C6LB 4WFHD 1FL3A 2J2ZA 4FFVD 1CFSB 3CFCL 5C2BH 3TH2T 2JB6A 4U6YB 3FN3A 4M93C 4UIMB 1A02N 5INDA 5F7MC 4P2RD 3ALXA 3KDMB 1ADQA 1JHTA 1MCBA 3TO4B 5E7BA 3MV9D 1YYML 3FONA 2YPVL 2N4IA 1JZ6A 4PUBL 3D2UA 2VLRA 1AI1L 3Q3GA 1CXFA 2Q1EA 1QNZH 4P2QB 1JK8B 2HKFH 2BVPA 3DECA 3KPNA 3OG6B 4R4ND 5I17A 1OAKL 1QSFB 2B4CC 3V4PH 4LP5A 4JFYB 3RA7H 4O51B 4JFFB 3SJVE 1U2HA 5CJXA 5BVJB 1XR8B 1KCKA 2GJZB 4ZFZA 4TUOB 4X80L 4LCUA 4KKBD 2H32H 1VEMA 1I7TB 2Z93A 2XT1B 1KSRA 4D9QD 1J7VR 1DLFH 1E4WL 3A6OA 2CR3A 3IFNL 4HFUH 3MV01 3L3GA 3EYOB 3Q6GH 4Y1AA 4XXDA 3MXWH 2PO6B 5IMKA 1KIRA 3MC0A 3QI9A 4OZIE 3ZDZE 5F7NC 4O2CA 2ZSVB 3RIFK 5KS9E 1ERNA 4NBYB 1P1ZA 1KNOA 4N0RA 5IB1A 4HUWB 5KANG 3OXSB 4CMHC 3BD4A 3I9GH 2YK1L 1P84K 2ARJA 1DP0A 3D0VA 4P3CH 5MP6H 4JFHD 4QY8B 4RGOH 1GVIA 4U7MA 1I1AB 4HIJB 1G0XA 5GSVA 1BPVA 3CD4A 1N6QL 1CE6B 2R1WA 3ARFB 3OR7A 3BFOA 5J12B 5DR5H 3WJJA 3FRUB 2F15A 4RGNC 4AH2A 2EZ0D 3KNBA 4WWID 5AYUL 2CRYA 2Y5TB 5C08E 3H6JA 1MRDH 2CDFA 4EXKA 3M8OH 2DIBA 2ESVD 2B39A 3MLTA 3RTQD 2BK8A 1CLYH 3LKSB 1RHHB 4JG0L 4JDVB 5D2NA 4YPGB 3FTGB 5JXAL 4OCWH 3WFDH 4Y5VB 4KMQA 3SDXE 2UWEB 5JHDA 2HFGL 1SJEB 4QRPE 4OFVA 2C4FT 5BJTB 4Y4FC 4PV8B 3CK0L 3IAQA 4FS0A 2E5EA 2ZOLA 5IOPB 3QWOA 1JN6B 3KYNB 4QGYA 3V0AC 4X7TB 3BDYL 2AJYH 3THMH 4AJ0A 1G7HB 3GEWB 4YHNA 4LSSH 4ZD3L 2GT9A 1MREH 4GJTB 4OZFH 4ZXBA 4L3CB 3OKDA 5FHAL 3SGJC 1D9KB 1UWGH 4Q0XL 3S96A 5HPMB 1MWAH 4RDQG 3A6CH 1NSNL 4PV9A 3KJ4B 2V7HB 4G42B 1X5JA 1JNHA 1G84A 4Z7WE 1GPOL 5SV4A 2NW3A 5GGTA 4L8CB 4R90H 2OK0H 4HS6A 4DQOL 5DO2D 3QZWA 4FA8A 1V3MA 5IHLB 2VC2L 2NQCA 4QTHA 5E2UL 2FH8A 3H3PL 1TQBB 4CKVX 2V9RA 5F7WC 5DRNA 3HR6A 3VXSA 1B0GA 4GXUM 2IF7A 3SJVD 1OAUH 1EHAA 3U0WH 3BO8A 4GKZA 5EN2A 3V5DB 4XBPA 1PZ5A 2Y7QA 5AZ2H 2ZKHL 5CBAB 1BQLH 3MBEA 2P5WA 3RUGE 5DS8B 2WBJB 3L5IA 3ZO0A 3PWPB 1JNLH 2Q7NA 5D9SB 2UUDK 4C56E 1XGYL 4R7DB 3TCLB 2FDBP 3T0VA 1QBMH 3UTSA 4NC1E 3HMWL 4KRPC 2UYLB 3MBXL 2VLKA 1UKTA 3V6ZB 2ZUXA 1C5DA 4CVWA 4XCEB 1YN6A 1A14H 1FFNB 2DF3A 4YWGL 1BVLB 3GM8A 3PWVB 5H35B 2DD8H 3BT2H 1KIPA 4PY8J 3K1DA 1JPST 4FNLH 5HGGS 1RZFL 4JFHE 2MKWA 3BXNB 4K07A 5D2LA 1JZ7A 4MAUL 5IV2A 4GSDL 2PN5A 3QXUA 1RIVL 3RY5A 3N1GC 1MCRA 4HWNA 2J8UB 1IGJB 3S34H 3AY4C 4GFTB 5TQ0H 2Q86A 3RL1A 3SQOH 3TA3C 1KBGL 1A4KA 3IGAA 2KUTA 2ICCA 4RGNB 1IGMH 1WVZA 3P2TA 4P4KC 3W39B 4DGIH 1DBAL 5EU3A 1U58B 5FYLE 1CD8A 5A3IC 5TH2A 5GS0H 4ZXBD 1LO4H 2DKUA 3MSPA 2GY5A 4RX4A 2ZUQC 1ITBB 4PJ7F 4TVSa 2JB6B 1HSAB 4MNQD 5GRZA 5HHQA 5FEBA 3QNZA 4XVSH 4KHXL 4KZDL 4XAWL 1MAML 1N5AB 2JK5B 5IBUB 3HMXA 1C16B 4JFFA 4RGMC 5EUOE 4OQTH 3RZCD 2EXWC 4ZFZB 2BHYA 2FB4L 2D7MA 3U36A 1P84J 2GFBB 4U0QB 3O41A 5HHOD 1ITCA 3U9PH 4JFFE 1HQ4B 5I17B 4N5ED 1I9IL 1YMMB 4NKQB 4JVWA 4Z78A 4NOBA 3KLAB 4PJXE 1C12B 1N4XH 3HNSH 1JCKA 3BSZH 1F5WA 4FQXB 1R5VB 4HH9A 4LCCC 3H2WA 3QI9B 4KTDH 3WIIH 3DRQB 1D5XA 3T8XA 2CIIB 4EZMA 4HC1A 3LEYH 4ALAL 1NCAL 3PHSA 3U46B 3ULUF 3PNWB 1CDGA 3BESR 3RVUC 4JHZA 2EXWD 1VPOH 3FOLB 1S3KH 1SMOA 3KPRB 3GSUA 3BYTA 5MEND 1DZBA 1IBGL 1A6UH 1MHPL 2Q7YA 5C09D 3UZEA 1AO7A 5JQ6H 4PJAF 5FV1L 2DQUL 2OSLA 2YPLA 3RAJH 5I8OH 1QO3B 4ISVB 1W8NA 4CVUA 5B4MD 3A6BL 4JPWH 4KVCH 4AT6B 2DBJA 4F7EB 1QTYT 4YHIA 3QUMH 4G7VH 1AIFB 3LRSB 4WW2A 3JWNC 1YEHL 1RV6X 1F45A 5E03A 2AJXH 2DQTL 3HA0A 4LRNL 1S7XA 1U2CA 3C5SA 4OM0H 2NX5E 1N5YL 1OB1B 5CJOL 5D1QB 2DQIL 3PDOB 1G1YA 2OTUB 1AGEB 5D7JD 3IDJA 4EN3D 2EDBA 2X4OB 2BCKA 4PJ5D 3MJ7A 4HZLB 5J4MA 3O2DL 4KZEH 3BKML 4WWKC 5I8KL 4W68A 3U0TA 4L8SA 1RIHH 1VACA 1Q9KA 1Y6NR 4JCMA 3RGVB 1Q72L 4CUCA 5IB5B 3ZYZA 3CVHL 4LNRA 4JKMA 4RISL 2JJSC 5DJZB 4ZFGL 2XIDA 4XVUC 5D7LB 5EA0L 1AQKL 3BP6B 1OTSC 4TRPL 4AEIL 1JWUA 3H0TB 4IRSD 3HFML 2R8SL 3B9KB 4WRLA 3IKCA 2R2HA 1Y18B 2V2TA 3VG0H 1X5IA 1CLZH 4PUBH 1HDMB 5GGTH 1Q9LA 1QVOA 2ESVA 4LVOC 1NGPL 4CNIA 2D0HA 4PB9L 2PO6C 2E9JA 3HNTL 5E6ID 2XNAB 3HKFA 2Z9TA 3O3AB 1NBZB 3PHQB 1HHJA 5D6CB 1ZHKA 4Y5YC 2CDGA 2CLRA 4LMQE 1ORQA 2HFEA 1RZJC 1WWBX 5BMFL 3VW3L 5E08L 4UV4L 1PZ5B 4M4PA 3T1FA 3NCYS 3S5LB 4U1NA 2FEEI 1VDGA 5DRNB 3MLXL 3V6OE 5GGRY 3F7PC 3FT4A 3K0WA 4U6TA 1B0GB 4I5BB 2QQQA 2AJYL 3UAJD 4LP4A 2G2RA 1CVSC 4PP1D 3SDXF 3P11H 5BRZB 1OTUD 1PQZA 3QEHA 5CJ5A 4POZC 4PLOB 4PTUB 3MJ8A 1NQBA 2ID5A 1H0DB 4JRXA 4XP9L 2Z92A 2EDOA 4YDJB 3QNYB 4FFZH 4OUUA 5LG1A 1BZ7A 3QQ9D 3KJ6L 3RZWA 4JFOA 1W72L 1UWXK 2B0SH 1A7PH 3QFDB 4A2MA 1GOGA 1S9WA 2G75B 4YIQB 1HH9A 1ZTXH 3RY4A 3UTSD 3MUZ1 4GUPB 2GHWB 3QG7H 2BY0A 2GSIA 5D7JA 3FAWA 1OCWH 5I1AA 1HK6A 1NL0L 3E8UL 1U91B 2R2BA 5BS0D 2BDNH 5FM5O 1KPVA 4PJGB 3DX9B 1LMKA 4HIXL 3S4SB 4YH6A 3MBED 3ARUA 2BSRB 2OZ4H 4CVXA 3ARBA 4HXBL 2D4DA 3RTQA 3VXSE 4HIEB 5E8PB 2BVTA 5TE4H 2Z8SA 2ZSWA 3QDMB 1F3RB 4MAYC 2YD4A 1GGBH 2Z35A 5I71C 1P6FA 2KPNA 4PJ5E 4PRNA 3HZMB 3WXVH 1UZ6F 1BX2B 2ADFL 4HPOH 3TBTA 4UINH 5FHBH 4AYFA 3HE6A 3EOTL 3P9WB 5IBLC 3S36X 1ZOXA 5IB2B 1KCUH 5EZJB 3MLVL 2BMKA 1BQSA 2ZOLB 5BV7C 1IILE 4CW1B 2CUIA 3MFFA 3ZDYE 3SBWC 1G7MB 4DGIL 5H94B 3IFLL 3LPGA 4I4WB 3MRCB 1H3XA 4YXHH 3QQ9C 1A9EB 1T2QH 3TGXA 1TVHA 4HCRL 4LASH 3GJFB 1LO5B 4KKAC 4Z7UE 3S35L 3O3BB 2I9TB 2BXZA 4G6JH 5FYJH 5C0AE 4G6KH 2EDKA 1KBGH 2CIIA 2V9QA 5LCVL 2OQJA 1ZSDB 1WV7T 2EIZB 4APQB 5J0BA 4WGWB 4L29B 5IW1A 3UBXG 1OAUL 2X4PB 3GSXA 4IDLA 2Q8BL 1YNLL 4R4NC 5BZDA 4NKOA 4OJFL 1UH3A 1LDSA 3B2VL 5DJ6A 2XI9A 4J3WA 5E8OB 1YQVL 2FX8H 3C6LC 1CCZA 2XKSA 3TJHC 3FOLA 1SEQH 4LPYA 5K9QI 1R5WA 1CXLA 5HDQL 2YUVA 4OJFH 3SDDD 4G8EB 4RAHA 2VAAA 1I8LA 5MENA 4LVHB 1FZKA 4G8IA 3LV3A 1A4JA 5D96B 1X3DA 3KXFA 5CWSB 2IAND 4ZSOE 4YWGH 5D7SL 4EXPX 1MHHA 3QWRD 1M05A 4KQ3H 5CEZH 4PJXB 3C8HA 4IRZH 4HJJH 1FFNA 1ZKAA 5TDNA 4NUGL 5JW5B 3HUJF 4OLYH 3ARRA 5BW7C 4QXUH 1QQDA 1AE6L 3LB6C 1SMAA 5D2LE 3KPSE 3T3PE 1A3QA 5J06A 4J6RL 5GGRB 8FABB 1S7TB 4R2GD 5F1IA 1BQLL 2PO6D 2VXQL 1IC4H 1F6AB 1GGIL 1ND0A 4N0UB 3M17B 2YKLL 1ZT1A 1YZZA 5T33L 4HUKB 2V17H 1BREA 4TTDD 3OJDA 4NCDA 3MGAA 3CCHB 5IM7B 1JHLL 5H2BB 1LGVA 2C3VB 4TNWK 2BNRE 3WO3B 4K71C 4NDMB 3IGAB 4ZUTB 1DFBL 1LO4L 2YKLH 1NEZB 1G6RH 3W2DL 1PGRB 1EFQA 5C0BE 3NCMA 3UO1H 1YEFH 5ETUA 5J89A 2W0FA 3FB5A 5EC2B 2XTJD 4OI8A 5I1JH 1CD1A 4YGVA 3ARGA 4X5WB 5ACZB 4NM8H 4EDWH 4LPUA 4QRRE 3ZTJG 5GGSY 4K7PY 1MH5B 3GI8L 4NNYB 4FQIH 1WFOA 3ELAT 2B2XH 1INDL 2BY3A 5IR1B 3SO5A 5KOMC 1T1ZB 3ZKND 1I9JH 4NUJB 1DBMH 2ZWLT 4I5BA 1MFEL 5FECA 5LXGL 4CVZA 1T6VN 2JCCB 4Y5XB 2I9LA 2YC1B 1MJUH 1N7ML 4JPKH 4ODTH 5H37G 2EDFA 3I6GA 4PBWD 5I1CH 2VQTA 5JOPD 4PYGA 2WP3T 5HI3C 1WT5C 4KZDH 4R6UA 4Y4HA 1HHKA 4I18A 4XVJL 3LPWA 1UA6H 1RUML 2QHRH 4OFIA 1RVFL 3BGMA 3RZCC 5LQBH 4QYOA 4V1DE 3HHRB 5CGYC 1UT9A 4LLUA 4ZO7A 1NCWL 5J6HB 5ACMA 4QRPA 1F13A 4IOFC 3HG1E 3DNKA 1A1NA 3BP4B 1BAFL 1UZ8B 1ZHNA 1MCKA 4XNQA 4L4VA 5EOCH 3MRRA 2OXGA 4LAJH 4X99B 1PBYA 4FQ1L 4L4JA 5D72H 3QUYA 5HDOA 2J12B 4F9PA 3ZT7A 3MRNB 4WUUB 1MWAB 5EO9A 3S5LG 2WINB 4EQ2A 4GLRI 3LZFH 1U3YA 1J0KA 2Y1VA 4J3XA 4KKAD 3VXUE 1AH1A 2NY7H 2NXYB 3NCJH 3PQYD 4YFLF 4M02A 4P9ML 2E7HA 3LKQA 1J1XH 3DO7B 5HHNA 3U4EB 1MPAL 5BXFB 3GO1H 1Q94A 4R4BA 4XC3H 2DQFA 5L0QB 3MRFA 4LSDA 1F2XK 1CF8L 5D8JH 5GRUH 2CLZA 2H32B 5I66B 1U93A 4L4TA 2BVPB 4TRPH 1M7IA 4FMFA 5IK3A 5GS1B 4MSWA 1LO2L 3GGWA 1KB5B 4HAGA 5DTFA 2W9LA 4WHTA 4X7EC 3V0WL 3GMPB 3QG6A 4ODWB 4UTBL 2DLFL 3MLRL 4JVPA 3RL2A 5ITFB 1SBSH 4GRWF 3Q1SL 4AIZB 4U7SA 4JFPA 4NBXB 4G7YL 3CVIL 5T5NF 1QA9A 5KG9A 3QJFA 5C0GB 1NCTA 1TVHB 1AP2B 5C0JB 5J13B 4MJIA 3IFOA 5LBSH 4JO4L 4PRHA 3BZEB 2ILLA 1Q9OA 3BKYH 2ADFH 2VERN 5I1HH 3NCCB 2X4QA 2VDRL 5HHXL 5HYJE 1IM3B 5FOJA 1QR1A 1QFUL 3HCVA 3LB6D 5EA0H 3RY6C 2W92A 3ZTNL 5HXMA 3A6CL 2DQCH 4DN3L 4NQCA 1HCFX 4Z5RB 3GHBL 2HKHH 1TQBC 2NCMA 3AM8C 3HB3C 4BH7A 2VN4A 4NNXB 4OLEA 5E4EC 3Q5TA 3LV3B 4GRMA 3ARDA 4B0MM 5J56B 2EDXA 1OAYL 1BJ8A 1MHHB 3KS0J 4MWFB 4Z9KB 4P2QE 4PJ7E 1LQSR 4XPTL 3C60B 5IJKC 1KENH 4J4PC 5FYKD 5F7DB 3QCUL 3VDCA 4XI5D 1V05A 3TYGL 1L7IL 3TT1H 1I9RL 4N90D 3SKJH 4OLXH 2OJEB 5FUCC 2ZKHH 3LOWA 3IDMB 4WFHE 4G3YH 3B6SB 2ITDA 4XNXH 1HE7A 1UCBH 3MUY1 4OF3A 3MLXH 2XZZA 1NLDL 3HG1D 4ZOAA 2VDOL 1C7SA 3T65B 4JHAL 5TDPA 5FGCE 1I1YB 2FX8L 2C3HA 1OGAD 1T5WB 3JV4A 2HMIC 3GSNB 4BSWA 3TIEA 4DOHB 4S2SB 4F58H 1MFCH 1J0HA 1IC7L 5HGHB 1TZIA 4IRJD 4LGSB 3T2NL 1T3FA 3EBAA 5DMIL 1VA9A 1E6OL 5FUZL 1AGFB 2EC9T 3HE6D 5CS7A 3TZVB 1CQYA 3MJ6A 4IIQA 2P44B 2DM4A 2XZAL 4HZAA 5EOTB 5FK9A 2DQGL 3NZ8B 1L7TH 4R7NB 5IHUH 4KHXH 3MROA 1ORSA 2B1AH 5DMGC 2VQ1B 4ETQB 1PJ9A 5CHNB 5DQJB 3LKPB 2XWJB 5E9DA 2WWKO 3WFHB 2PW2A 4F37K 3W0WB 1SM3L 4PJIA 4QRRB 1WITA 3DMMC 3RUGF 2O61B 4LCCB 3W81A 4WTZA 1JK8A 1J0JA 1SQ2N 4JRXE 4PJAA 3EOAA 4NC2B 2PYFA 5ALBL 4R0LC 4YHKL 4DKFL 2OJZH 5C86A 3HE6C 4MAYD 3WHE1 1NANH 1SJXA 2O5ZL 2QQKH 4LEOA 1O0VA 4QLRA 3EW3B 3I6GB 4LSUH 1YN7A 3SPVB 5EWIL 5DDHB 43C9A 2A74B 4DN4H 4OFYD 3TCLA 1A7RL 5GS0L 1BOGB 1FYTD 1AI1H 3CSBA 1P2CB 1GIGH 5DJ2B 3KPOB 1CZ8H 5DJ0B 3VFVA 4HKJA 4JDTH 4K3EL 1RPQA 4FQQB 1DTUA 4QRQB 2ZP0T 2OCFD 5KSAB 1VFAB 3D39E 2IALB 5DJ8A 2H45A 1DANT 4YK4C 1MLCA 1G7QB 5IVOA 3V7AE 1KN2H 2ESVE 4FP8H 2R69H 2IAMB 3QFJB 4XP6L 3U1SL 5C6PB 2X5PA 3WHXA 3ILPB 4XVJH 4PP2B 3KXFD 2XPGA 1I8MA 4RMQA 3NBNA 1KLGA 2VLLB 4TTGA 1VPOL 3AREA 4JR9H 3QWRA 3BD5A 3GI9L 4QRPD 4U6HB 4KK8D 1JGUH 2GJJA 1LEIB 3MRRB 1LEKA 1MJUL 1N7MH 1OGAA 2VAJA 2AQ3A 4M03A 1KB5L 1KG0B 2XG4A 4UTAH 1RZGB 3BKMH 1EFXB 2DKSA 3I75B 3VGEA 1EDQA 3J8F7 4KK6D 3INUL 1X5HA 1WGOA 4GKNA 3MRKB 5KN5A 5L0QC 5K59F 1M7DB 4H0HB 1VFBA 4KRPB 5IGXL 4OM0L 2AV1B 3L6FA 2VDNH 5I16A 2X4UB 4YDKL 5IOPA 5M95B 1A8JH 3INUH 1WWWX 4GW1B 5CMAA 1OSZA 3WNLA 2PTTA 2FBOJ 2D7TL 4X6CA 3I9GL 2PTVA 3DXAE 2V5MA 3RDTD 1G7IB 1GC1L 2DOCA 4OLVH 3L3DA 4Z78B 5F7FA 4QXUL 2IPKA 3FN0L 5E4EB 2LVCA 2R4SL 4LSTL 1E4XI 1BWMA 1YECL 4RFEB 3VWKA 3MRHA 1GCFA 3U7WL 5T5FL 1XGQB 1JHKH 3RBSA 1JF1B 4E42B 1FNEB 5D5MB 4Z7VB 3HAEA 3VFTA 4QXGH 3L9RA 3BKCH 4MDIA 4APQD 3BZEA 1MUJA 3KYOB 4IMLA 1LE9A 4ZNEA 3W9EA 4QEGA 3FB8A 5HYJB 3SKUD 4K2UH 3UTQA 2W0PA 3FQTA 1AGDB 2GK0A 1ZS8B 3FO1A 5JR1L 2VLRE 1JZ8A 2OS7A 4RFNB 1YEGH 4WW2B 3MUGB 2XWTB 2ZJSH 1I8LC 1S9YA 3FCTB 2DI8A 3ZTNH 3QRFM 1UJ3B 4UQ3B 4M1DH 4PJ7B 1TITA 4N9GB 4BSVA 4EVNB 4I1NB 4TQEH 2QSQA 1JNJA 2BCKB 6FABL 4O58L 3C9NB 3E3QC 4TVPD 1OM3H 4YQXL 4L8SB 2A1WH 3TJEL 3LH2H 4L4VD 4CGTA 5DD6B 5ESVB 4E41D 4P5KB 4K55A 3X12A 1SBBA 4HIXH 1YUHB 3SDAA 1EUUA 3V8CA 3AVEA 4P23B 1ADQH 4PJ9C 1NDGA 3VRIA 1MRFH 1WBXA 2AV7B 3DMMB 3QDJB 3ARDD 3KPMB 3EDEA 5FM8A 1RZKL 5CJXC 5HVHB 2BSED 3WKMH 1U8MB 3BAEH 3TCXA 3ZT5A 4NQDB 4JM2D 5A2LH 5C7XH 1NGWB 2NY4C 1CF8H 3C8DA 1G1CA 4YHPA 3IT8D 1SJHB 1I9RH 3WE6A 4I0PC 1ONQA 4JRYA 5GRVL 3HE7B 4HK0B 1HSAA 3FAXA 3ZTJH 3V95A 2L0DA 1RIUH 5GISL 3UTTD 2BNQE 4JZNA 1OARH 4OKVB 3QXAA 4OFKA 1JPGB 1T89C 1NC4D 2BDNL 4P2CG 1AXSB 1CICA 4WHCA 4GRWB 5I1EH 4L9LB 4U1SB 1F58H 3RL2B 3CMOH 1G9MC 5DJDA 2FHFA 3VGAC 4CAGA 3KHOA 3RWJA 4OI9A 4P2RB 1P4BH 1NAKH 1S78C 2JELH 2XYCA 3U2SA 4OIBA 2L7UA 1K8IB 3GSWB 3FQUA 1F58L 4DKEL 4U1JA 4X9BA 3GSVB 2DAVA 2PYEA 1C08A 3IJHB 3O11A 5ANMB 5C09E 3OXRB 1IQDB 1HSBB 4ODUA 4Y0GA 1EHLL 3ARDC 1UYWL 1Q0XL 3RU8H 3RDTC 3MRPA 1YEJH 3UJTL 4U6VH 4XPFL 1WTLA 2QKIA 1JFQL 4OGXH 1M6OA 3DXAA 4GRLC 4F37F 4G6ML 4M7JL 4O9HH 4HEME 2CDEA 3JTSB 4GW4A 4G7YH 5IF0A 2ZCLL 5SWZA 4KAQH 2LQRA 3HS0B 3LEYL 4ALAH 1T0NB 1N8ZA 5E99H 1IRAY 4XCNB 3RNQA 1Z0NA 3BKYL 4JLRA 3SKOB 4NPYA 5L7XL 1RUKH 2VXVL 1ZHLA 4OF7A 1YNTA 1LEIA 5DJAA 3TNMB 4PJGE 3HG1A 4DN3H 3QHZH 1U8NB 4OAWB 1RULL 1H3PL 3SE4A 3ROLB 1VGEL 2QQNH 3BEWB 3SDDC 1KCSH 3MV8D 3ZMRA 4P59H 1TENA 5DO2C 4IM8A 3I3EA 3RWCB 1KYOK 1T0MA 1UFUA 2MHAA 4HKXA 5HJ3B 5E94A 1XGRA 1T3FB 4FOMA 3CZJA 4K3HA 3D3VA 5EIQA 4JO3L 5J1TC 4PJXF 1PSKL 1LEGA 4Z7WA 5GPRA 1JWUB 4LHUA 1U8OB 5I1IL 1GRWA 4YHZH 4YDKH 3C6SB 2H26B 2GCYA 1T1YA 3O8XB 4HQQL 4PRIA 4N8VG 3VA2C 1E6JH 3AMLA 1EEYB 2I60L 4N68A 1YMHB 5SX5H 1W72A 4Y2DB 1S5HB 3MACH 4HS8H 2FHBA 1CXIA 3OAZK 4FXKA 4HH8A 4Z7VE 4JHWH 4PJHE 5E8NB 1CGTA 5DMIH 1IL1A 5T5FH 4D0BB 1YA5A 1FDLL 3VFNA 4OIAA 4MD0A 4X6CF 4GS7C 3GRWL 1PVHA 2DI9A 1A6AA 1IAIL 2A9NL 1T1WA 3IJYA 2HYMA 3QO0B 1A4JB 4OT1H 1D5BA 2X4TB 3GMOA 4Q58C 2B2XL 5HVGB 3CFCH 2YD6A 1ZA6A 3F7YA 1DBML 5CZXD 3REWA 3KPNB 4DCQB 1A1OB 4P9HH 3GUTA 4NSKB 4OT1L 3U7AA 3MOAH 1IKFL 1UB5B 4WEMB 4N8CH 1KC5H 4WFGD 2VZTA 4HUXA 4WTWA 3T08A 4ZSOB 1EUTA 1IQWH 3U4BL 4QWWD 1OAZL 4YPGA 4JHBA 1NGPH 3RX7A 4JY5L 1WAAF 5MEOA 3K1KC 1JWMA 4NYLA 2ZPKH 1B0RA 4JKPL 3GMLA 3O45A 2I27N 4XXDB 3IVKB 1NGQL 4OZIA 3LKRA 4POZD 2HTLC 1J05B 3WFEL 3ZKXB 4NQXA 4XWOD 3H9HB 1OW0A 1PW3A 5AEAA 2I26N 4LLYB 3RHWK 3CH1B 3DRTA 3OXSA 1F11A 3CVHB 4MB4A 3IFNH 4HFUL 4NJAL 4MA3B 3OR6A 3RGVD 1SJHA 3OX8A 1EAPB 5DFTA 2RB8A 4XNMA 4HFWB 2R69L 2IBZY 5F1NB 1OF2A 2Q6WB 1NGYA 1R3LB 4JM2A 5C6TL 2CSPA 3VU2A 4HK3N 4PRID 1BFVL 1NUFA 1NBVL 4PRDA 3FQXA 4NHCH 1ETZB 3FMGL 4ZUSA 3VFRB 1G7LB 3MLRH 1DLFL 4R0LA 4RNRB 5B8CC 1DJSA 1FIGH 1G7IA 3M8OL 1T7ZA 2RAMA 2BOCA 1AGBB 1BFVH 1H5BC 2ICWA 1NC4A 3AAZB 5IQ7H 4Z76B 3P73B 2CKBB 3IDXL 1U36A 3NIFE 4DGVL 2BVQB 1AFVL 4ZOCA 4GW5B 1C7TA 2CJUL 5DI8B 1DEEB 3RVTD 4EI5A 1XGTA 3QUMA 5GGSB 3VXMB 2B20A 3MO1B 4XNUL 3P4OB 5IBUG 2HN7B 1EHXA 3IDXH 1U8QB 3JVGC 5MHSE 1IFHH 3O2DA 5D7JC 1KACB 3T4AB 3DGGB 3ARYA 2IANE 5CD3A 4OB5L 4DAGH 4CN1A 5D2LB 1WICA 3N1PC 3V4VH 4X4XB 2IFGA 3ESVF 4R90L 3MRNA 4WUUA 2WNGA 5EO9B 1KLUB 1IGIH 1RQ5A 2LU7A 2VC2H 2YN5A 3IXTA 5EZIH 5TE6H 4QHUA 4G5ZL 1E27A 5DJAB 2OL3A 1AXIB 1MI5E 4WDIB 5TPWH 4QXGL 4MLSA 2RBLA 3SDAC 3WYRA 2MCPL 1U92B 3HNTH 4JLRB 4KRLB 5FYJL 2D2OA 3ULUC 3PP4H 1RUQH 2E8ZA 2AK1H 1CXKA 4RAVA 3VFWA 4JAMA 1YNTB 2BSSA 4I8DA 3MRQB 5HYIA 2XTJE 5TQ2L 3QEGL 5GS1A 1QP1A 2CRMA 2OR8A 3FFCB 1XZ0B 3L3OB 2AK1L 4CDHA 2YSSB 1CT8B 3GSQB 1XCQA 5A2KH 4AM0A 1YYLL 5HI4D 1F8TL 4HBCH 3HMXH 5IWLA 1NGZB 1ZK9A 1C5CL 1XMWA 4NQTA 3QIWA 3L95B 2DJUA 3SKJL 4Z7OF 4GG6B 4Z8FH 4Y5XC 3KYMA 4XNZC 1S7VA 4EUPH 1ZGLA 4MXQC 2IANA 3LMJL 4U31A 3RWEB 4PV9B 5CZKA 4MD5B 5EO0B 1NLDH 4LKCA 1FAIH 5LAXA 1UQSA 1K4DB 4BFIB 5E1AA 2G60L 4LAQL 3NACL 2D9CA 3PWNA 4U1HB 4MJ5B 2EDDA 1JI2A 2XKNA 3L3HB 5DK0B 2V9TA 4PY7A 3SCMB 3SKMB 4LHQB 2LE9A 1NCUA 2N56A 4Q2ZA 3ZDXF 2R23B 3CX2A 4ZAKD 4UNVA 1L7TL 5JOPE 2V7NB 1MHEA 3B9KD 3B2UC 2VTFA 4MWFA 3FQUB 4GG8A 1V7ML 4RMVA 4GBXC 1BVKB 5I1IH 1H15A 1NPUA 4NM4L 4ONGH 1RZ8B 2HLFD 3X17A 1FJ1A 3MLWH 4YHZL 2ATKB 1ZLUK 1FLRH 1H3TA 4OBRA 1NDMB 1IAOB 3PDOA 2YBRA 4LOUC 3SDDB 4RBPK 3VXQB 4XZUB 3PL6C 3NCBB 4ORZC 1KJMA 1R3JB 5EUKB 2LV4A 5GGVH 3ZKMC 5MEPB 3DVNB 2J6EH 1P4IL 4NFCA 2FZ3A 4LDEB 4YAQB 4G8FA 1DQJA 4N0CC 1BFSA 3FQWA 2Y4SA 2IG2H 4BSWB 15C8L 2VIRA 4PJ8A 4ELMB 1SJVA 4NQXB 5IFAH 1QSED 3O6FB 1OT2A 3N1MC 1W0YT 3AMKA 1U3HA 4JFEA 3HZYB 5C0CA 1URLA 3G6JA 5EOQL 2HKFL 2MCG1 5SWQA 2OSLB 2P5WD 1KPUA 4JFEE 1WAAA 4WY7L 2NR6C 3MREA 5HGDB 4X6CE 4X98B 1RSFA 3BUYB 1QNZL 2VXSH 1HIML 3WBDA 2OL3H 1I7RB 2EE2A 4HK3J 1KC5L 2PW2B 3BH9A 4UUJB 3E0GA 3CFIC 1D9KD 4GRLB 1YEHH 1FNGB 3C5SB 1FH5L 4ESKA 1P7KB 1W0VB 4ZOEA 2FYYB 5KANI 3UJIL 4LLVA 3A6BH 4JPWL 1X5ZA 1NCWH 2D31A 2F54B 5CIPB 2AXHA 4TSBL 5AYUH 5CEYA 4XPGL 2NY2B 4U2YA 1FE8H 4I2XB 2WBJC 1C8PA 2UYLA 1QRNB 1G7LA 3VGBA 4WWKB 5DD0H 1A7BA 4UTAL 3TWCL 4PPTA 4MB5A 2H26A 5JO5B 1NBVH 2HFFA 3T3PF 5CJOH 2GAZB 4UBDC 1J18A 1KN4H 2V5TA 3C8KA 4HV8A 5T1KB 4B41A 4LCWA 3RQ3A 4RFNC 4J6RH 1IEBB 4CN6A 3MJ9H 5CEXB 1LK3H 4LOUD 4OLVL 5ACLA 4GQ9H 5D1XC 1JYXA 1KIQA 3QXWA 4PJBB 5GIRB 3RWGB 5FM5M 5C70A 5CBEB 4XCFH 3UC0H 1MCOL 4N90E 1T4KA 5DFVD 3S3SA 4OZIF 5C0EA 2CXKA 3B9DA 1R0AL 4HBQA 1DQQA 2BJML 2WM0A 4QCIB 5JXAH 4F7TA 1BFTA 2ZG2A 1WSST 3UTZA 5EU5B 4HKBB 4AG4H 1Q8MA 1VGKB 5ADPH 5F9JA 1OP3H 3G5YA 5F7KC 3QQNA 3MNWB 2GI7A 2W60B 4F3FA 1WIUA 1P7QA 4MNHA 2HVJB 3CFBA 3V0WH 5C0RH 2PW1A 3MACL 4I48A 3VW3H 2Z35B 5CEZD 4F9LC 3S4SG 1X4ZA 1C1EL 4MJID 2HKHL 2XG5A 2BSSB 4NKMA 4UIMA 5EDXA 1OGAE 1CFNA 3N9GH 5BMFH 4FMKA 4AEIH 4QHNB 1ADQL 1PD6A 3P11L 3FO0H 3TO4C 5C0DA 3QDGD 3OKOB 1YQ2A 3D6GA 4MCYA 4HGKC 2D7NA 2QL1A 4M93B 2DQDL 4JCLA 4F57L 5BCAA 2RHEA 5KW9L 1MF2L 4JO1L 1UM6H 4FHBD 4BM7A 3PL6D 4UU9A 1O7SA 1ZWIB 2P5WE 4YIQA 5D7KD 2Z91B 4XVUD 1TXKA 4CJ1A 2H8PA 1Y18A 2AJVH 5KSVB 1N3NA 1ZVSB 2DM7A 2YXFA 1N0XL 5ENWA 1Z5LA 1X7QA 2IADB 1HDMA 3EGSB 3K4AA 5CP3H 2G5BB 1MFCL 4NOFA 1XGYH 5CSZA 4PJFA 1IAIM 5EO0A 3FQXB 4Y88A 2OX5A 1BWWA 4PRPD 3RVVC 1CFVL 2EKSA 1AR1D 1HHJB 2DDQH 3X3FL 3CZFB 2P47B 1G0YR 1YY9C 5IB3B 4R9HA 1KT2B 2YPLE 4F7PA 1UM4L 1QFWM 2ADIA 3QIUB 4JEGB 2G60H 1TETH 4LAQH 1GZQA 3UPRA 4KRNA 3O6LL 4FQXC 4FZ8L 5IFJA 3PWUB 2W9EL 1U3JA 2VAAB 5MENB 3WIFB 4MS8C 2NY2C 2OTUA 3MLYL 4KJYB 1BOGA 2AEQL 2FO4A 4KMLB 4N0FB 2P8LA 4HS3B 3SDCC 1U8QA 4LCIH 1W2KT 2IMMA 1MIEH 3TA3D 3O9WC 2J8UF 1CDBA 4HWUA 3MLZH 5AUMA 3D25A 2C1OA 4CU8A 5EBGA 1MLCB 1TZGL 3S35H 4I3SH 3BZ4A 4JRYE 4UMGA 4Z7UB 1J0IA 3WL9B 3P30H 4LCUB 5E8DL 3SDYL 5E9DD 4FG6C 4LBEB 4XPHH 1DBKH 2VL5A 2Z8WC 2YEZA 5DHXB 4WV1B 3FKUS 5D4QA 3GBNH 1UYWH 4U1GB 1J10A 3SQBA 1LP9E 3Q6FB 4KV5E 3FQRB 3ZHKA 4KK5D 5E2JA 3OJ2C 5K93A 4XPHL 3P9MA 4G8GB 2EDJA 1NC2D 4ERSH 4X6EB 4M7LL 5HHMD 5FA4A 4G9FE 1AR1C 1F4HA 3EOBB 5F88B 3SDAD 5HGAA 3F6IA 5F71A 1K2DB 5HHXH 1JFQH 4OI7A 3C08H 4DEPC 5DURB 4ERSL 1YPZB 2COQA 1NKOA 5E2WH 3F58H 4JR9L 5E00B 4RA0C 4LARH 4I0CC 1CE1L 3BSZL 1YQVH 4X9IA 5DMKB 4EBQH 2BRQA 4XP5L 5JHLH 2WIIB 3O2WL 5E8EB 3LQAC 3T2OA 4LSVH 4OZ4B 4N9OB 4Y4FB 2ARJQ 4RCAA 3TYFA 2MCPH 2CQVA 2YA2A 3CFEB 3F12B 1QSEA 4WFFE 3U9UA 4GQPH 5DRWA 4YHLH 1X5LA 1ZT4A 2X2YA 4Z0XA 2C3GA 3NA4A 4FQHA 1XF2B 4H1LA 4QRRD 3V8OA 4S11A 4RFEA 1A9BA 1BQUA 1DUZA 1YEKL 1FFRA 1BZ9B 1UXSA 3NN8B 1IC1A 1NAMA 2VDKL 1X6LA 2DL9A 1U6AH 5D5MA 5A2IH 2DD8L 2H6PA 2D0GA 3DV4B 4V2BA 1FO0H 4OZGF 5KSUB 1OVZA 3CMGA 3GDBA 2ZUUA 3NABL 4B7LA 2BSRA 1VESA 3HI1A 2DQTH 3KYAA 4JM2F 5HY9A 4HJJL 2P1YA 1SY6H 5FKAB 4XT1C 1AY1H 1U8KA 2B1HH 4DVBB 4TVPE 2WINA 1IGML 3CXDH 4NO2B 3UBXB 4TNVK 1GC1H 3QFJD 1LDPH 2CMRL 2IAMD 3WUZA 5I1KL 4QRUA 3OKYA 3T0DA 3VXQA 3M45A 5EFIB 3PABA 4ZUUA 4MCZA 3AB0B 5LWYH 1SM3H 3WFBL 1OD9A 1JHLH 4R4BB 2BVOA 3HPLB 1IKNA 2GTZA 1KFAL 2WLYA 3OZ9H 4PJEB 1CGXA 1U93B 1KEMH 4MXQD 5EOQH 2VXTH 3BI9X 4J3TA 3VXUD 4DTGL 4JFZL 1IM9B 3QUKB 4TOYH 3MV7B 4NO5A 2APTA 3LSOB 5IWLC 3BGMB 1QG3A 4NZTL 4NO0A 4NJAH 2VZ1A 3KPLB 3VI4F 2RFXA 3DYOA 4PJCA 1LK2B 5DXWA 1FVCA 5J3HD 4JFZH 4WHYG 3VI3E 3X13A 4LCYA 3LAFA 4YDLB 1NLBL 1XF5B 2DB8A 2G5BA 2JJVA 1OOAA 2IJ0C 1D9KA 1RZKC 2OM5A 3S97C 5F9AC 3BGAA 1B4JL 4G42A 4PP1C 5SWZE 1OTUC 3PJSB 4EOWH 3C5ZD 3BOVA 4IHOB 2BNUA 1IEAB 4S0SD 1K4CB 2ADGB 3IDGA 3K81A 3KNBB 1EGJH 3GI9H 4K3DL 3DO7A 4EOWL 1U41A 2HRPL 4UILL 4LFHG 4A6YB 3CPLA 3RWDA 1AKJB 4PGDB 4QTIH 3MXWL 3R06B 3G04A 1PYWB 5DQ9B 2P5ED 5F7DA 1S7UB 2Y36H 4M62H 5T3ZH 1YJDC 4R7DA 3N0PB 3UXFA 5I1EL 3RPIB 3BHBA 4H1LH 5C6WH 4YPJA 1UM5H 5F3HB 1M6OB 1TMCB 2KKQA 4MQXD 1LE5A 4OB5H 4YXHL 3ZKQD 4FFWC 1JN6A 1JNNH 3KYNA 5H37H 4NWUL 5MI0B 4MXVF 4FQXA 3QEUB 2MTPA 5ID1B 4ZPTB 3LN9A 4G43B 4LGRB 3UYRH 4HW6A 4IRJA 1QSVA 3RIAF 5ESQB 4R2GB 3QZWB 1C1EH 4O4YL 3MFGB 3H9SD 4ENEC 1HEZB 5JZ7C 4O02L 5DFWH 2EEBA 3V0VA 1JHKL 1JGLH 4CMMB 4WEBL 3T77B 3G5ZA 3H0TA 4DKAA 4H8WC 3TO2A 3TT3L 1N2RA 2APVA 3TVMC 4JPVL 3DROA 3GMNA 4KU1A 4NNXA 4HCRH 5AG9A 3BPNB 2H3NA 1QBLL 3ARDB 4BQCA 5IMLB 2NY6D 2BX5A 1T1ZA 1K8DA 5EBLB 2VQ1A 1MQKL 1QBBA 3MCG1 2Q87A 5GRJL 5EU7C 3LKNB 2CLVA 4FABH 5ADPL 1N59B 1OW0C 2H32A 5I66A 3F12A 2L4OA 4O51A 3AB0C 2PCPA 3VH8B 2BOCB 4UZGA 1QACA 4DGYH 3WXWL 1I8KB 4ZODA 5DHVA 3AS1A 4LARL 3Q0HA 4IRZL 3C6LD 5IIEB 4DVRL 4XWOC 5C0ND 1T66D 2VDQL 1TTFA 2NX5B 3CIQA 3QIBB 1GHFH 1L7IH 3TT1L 3EYOA 3ROOB 4MMZC 1HINH 4RA3A 1CGSH 1KIRB 2AAVA 5CP7B 1YYLH 4JRXD 4MJIB 4QXWA 5I73C 3VRLE 5L88L 5KTEL 1T22A 2VDQH 4U1MB 1JPSL 4M43H 1HHIA 1VEOA 4NKDB 5T1KD 5D1ZA 3F58L 4JHAH 2XFXB 4WO4A 3UDWA 1UJTA 1YEDA 1UH4A 4WFGE 5IFHH 1QSZA 5IKCB 4XMKL 5IFJB 1HOCB 1A3LL 1OP9A 2Q76A 1A5FH 2AJZA 3A67H 4DW2H 3ARBD 5FDWA 5IFHL 4LCIL 4KQ4L 3D39D 4TPRL 3SN6N 4QHKJ 1RMFH 2JIXA 2EH7H 2QADC 3WNOA 1FNSL 3WXVL 3C60A 1RJYA 5TH2B 1XF4A 5E8PA 3KS0H 1FORL 2UV3A 4L4TE 1IKNC 4PGZA 3D85D 2R1YA 3GB7A 4EI5D 4N1CA 4WEUD 3UO1L 5E5RB 3WJJC 3O6LH 3SKNA 3DO3A 3VXRD 3WLBB 5FO8B 3RWFA 4PB0H 1T7WA 5TDOA 5HHPA 1NGXA 3CLEH 5TQ0L 5I16B 4X7TA 5D7LE 2DM3A 1I1AD 4NO0B 3ARFD 2Z92B 4LVHC 5FO7B 2F53E 3PIQB 4F7MA 4P46A 4R97C 1P6AB 1DN0B 5F97E 2EXYC 1DQLL 1P4IH 3MV8B 3HPJB 1FLRL 2AQ1A 4YBHA 1Q0YL 1O7VA 3GJFA 3MLZL 5E0QA 3O4LB 3QFJA 2IAMA 1I4FB 2A38A 5FYJD 32C2B 4Y19B 5DWUL 4I3SL 3TZVA 1T7XA 3QHFL 1DLHB 2X1PA 1FNHA 4JN1L 4YDIH 3VH8G 3F5WB 2RQ8A 1LO0H 3FB7B 5AZEH 1FZOA 2V2TB 4N5EC 3LKOA 2GSGB 4KUCF 2VSCA 4MQ7A 4Z7VA 3G9AB 4Y2OA 2M1KA 5K33A 1KTRL 1FG2B 3IETB 4P9HC 3SKMA 1WWAX 4XP6H 3VCLB 4RGMB 2XNAA 1CI5A 1QFPA 1EVUA 1HXMA 2V7NA 5ITBH 2DLIA 1MAKA 3TESA 5D7IB 4P5TC 1BX2A 5CINL 1PYWA 4ORGA 3QDGB 3NCEB 2JKXA 2R56L 3AAZA 2AJ3A 4MJ4A 4POYA 3ULSA 4WFEE 2CKBL 4PJDA 4WJ5A 5HHVH 2YK1H 4LRNH 2G2RB 3X14B 3V6ZA 4X6BB 3F7VA 3RKDD 5JOFB 5BRZA 1HKLH 2GTWA 1X5FA 4LVEA 5B22A 5IVXA 1NMCC 4XP5H 5E5MB 1EEQA 3MRJB 2P24B 3NABH 3OAYK 1QYGH 2Z8VC 4N8VA 4S0TD 1Y0LB 2YMXH 3NPZB 4D9RE 5B38A 4P9MH 4IRJC 3OF6A 1JPFB 5C8JA 4PJIE 3IYLW 3UTPD 4N0YH 5CZVL 1VADA 4FXLA 1KTLA 2NZ9C 3QRGL 4IDJL 4LHJB 3WO4C 3KPMA 5C08D 1FBIL 3CAFA 1KXVC 2ITCB 3NZHH 4YDLC 5FK9B 4JZOB 4NQDA 1JGEA 4LQ1A 1IZJA 3F65A 4ZUUB 3CUPA 3L5WA 3TF7C 1IAMA 5J11C 3VFOB 2EZ0C 4XBGB 1G0DA 4PJEF 3HPLA 3KPRD 1ORQB 1HWHB 2XWBB 5DYOA 4X5WA 1R0AH 5FO9A 4LSRL 5DURD 3VGAB 5D7LD 3KDMA 3OR7B 2EDRA 2EEDA 4QO1A 1LNUA 4LLVB 4OCMC 3TIDB 4YHOH 5JPNB 1YY8B 5EZJA 5C07B 3PP3K 1IFHL 4X4YB 2A74A 4NHUB 1GJIA 4DUXA 4NBZB 2FATH 2DLTA 5FECB 5D1QC 4YHYB 5EU4B 5JHDD 4PR5B 4S1RH 5EU6D 4D3CH 4OCWL 3WFDL 1P9MA 4H8WL 4TSAL 5FYJE 3MOAL 3JWOL 4PB9H 4AK1A 2A77L 4ZPVA 3BN3B 3MODL 4XHJD 3U46A 5HPOA 4LKXB 4FFZL 1J8HB 2M2DA 4Y1AD 2C26A 4KI5F 3S9DB 1ZSDA 2EIZA 4IOIB 5IMOA 3ZE1F 1T7YA 3QUXB 4XCYB 2GUOA 1X5YA 5DLMH 1B2WH 2IAMC 1BAFH 4MGXA 2P42B 2VN7A 2VDLL 4O2CB 3HI6L 3LY6A 5IP4A 3SGJA 3E8UH 1Q9WB 5B39B 1MJ7L 4GXVH 5ICZA 3WKML 3V7AG 1N6VA 3O8XD 3B9KC 2K7QA 4O5LH 1TLKA 5T5NG 1CR9L 1K6QL 5BOZG 2AXGB 3MRDB 2B1AL 3SKOA 3KJ6H 3V7MA 3QIWD 3JVGA 1Z6JT 3PF2A 3TBTB 2FBJH 1BJ1J 2R0ZH 4JDZA 1NMBL 1HINL 1QRNE 4MA1C 4FNLL 1T04A 4RGND 1CG9A 1LE5B 1OTSD 4OLUH 1GGCL 4JN2A 4NHCL 5KS9B 4LHUG 3BP5B 1FAIL 3MBEB 5BVJA 4LRIA 1INEH 1U8PB 5C0CE 4NRXA 3D85A 3FT2B 4WEBH 1IGYB 4XX1G 3PUCA 1ZV5A 5T3ZL 4YXKH 4PTTB 1XGPA 5JLZA 3I3DA 4LSPL 4F7CA 4P57A 3CH8A 4UAOB 3V6BR 4ODBD 4OLWH 4OZFG 5FUCE 1J86A 2VKWA 3ARXA 3MGOB 5KSBE 2QADD 3VE0A 3HLAB 4QNPF 2A73B 3U82B 5DJ6B 3EYQD 4M6OH 2X7LA 2YRZA 4YR6A 3BYYA 4M7JH 5HYQB 5JMRA 1V7NH 1ZHNB 4ZAKC 2XN9A 3W9EB 3H8NA 3UAJC 5I76B 3H42L 2IPUK 2CDGB 4HIIA 1CFTA 5FGBA 4G6MH 1FZOB 3PGCA 5LGJB 5E8NA 1WIPA 2GSGA 4MQ7B 3HN3A 4GAJH 3ULVC 2FEDC 3L5JA 2FJFB 3MOQA 5INCB 1JL8A 3WCYA 2B4CH 1NCNA 2VABB 4PGBB 3WIHL 3MRLA 3VXUB 4CVZB 4D2NA 4M7ZB 4TYUA 1RFDL 3RX8A 3U1SH 5KJRH 1MHPH 4C54A 3KYKH 4XVTH 4ORGB 5F6HJ 3WS6A 3B83A 5IESH 3HC0A 4HMCA 5TGBA 4QT5A 1ND0B 2PR4H 3B3IA 1EXUA 1J5OL 1TJIH 3MRBB 4NQEA 4H0GA 4R4FH 1VERA 1J12A 4MXVE 4XPGH 1GZPA 4JO3H 3U6RB 1J1PH 1RZIB 4ZFOA 4KI5C 5HDQH 2EIDA 4N0UA 3NIDF 5D7JB 1D5IH 2CH8A 4OF5A 1HIMH 1OAQL 4JJ5A 2X09A 4QRSA 3ZKMD 4OD1H 4NZRL 3P4NB 3CSPA 4PV8A 5GS3A 1BVLA 3PWVA 2EDHA 1ZHBB 4Q9CA 1BF8A 4OZHB 1DQQB 2R0LL 4XP1L 4EIGB 2N7AA 5IHZB 2W0FB 3FB5B 1FN4B 1U3HC 5FDWB 5D7IE 1BVZA 4PLKC 5J9PB 3OB8A 5JPMA 2NX5D 4BQBA 3EJZC 1MOEA 4YHML 4XRCB 1X4YA 1WIOA 1OP5K 5HPMA 4Z7QF 1ES0B 1X4XA 3ARTA 3PV6B 4Q97A 1TVBB 1K3ZA 4HK0A 2FGWL 2P48B 4RGNE 4MMXC 4OF0A 5C08A 5I8KH 2F5BH 1FV1B 1I3RA 3DX7B 5ISZD 4WU5A 4PREB 3UEZA 2XZCH 3BWAA 4FQLL 4JM2B 4JFDA 2V17L 5JPNA 1NCDL 5HHPB 2VNCA 3CXDL 3RI5K 5CHNA 1J87A 1F90H 2WIIA 4OV6F 4TN9A 1DBJH 5ALBH 5C0DB 3ETBF 4J8RA 2H2PD 1BLNA 5ALCH 4EN3A 5D7KE 4WUUE 4FQLH 4KFZC 1YDPA 3NAAH 2VL4A 2JJWA 43CAA 4Z0XB 4YUEH 3V4PL 2FL5A 1WAAE 3IJHA 2ZCKH 5D93B 2HT3C 4LQFL 4TUJB 2ZCHL 5E08H 3MRPB 2HRLA 2CKBA 2QQLL 5IEHB 3FO0L 4R96A 4OGZA 1J05A 1BP3B 4NT6A 4F33A 3NA9L 5FF6A 4ZPVB 1P69B 1U8HB 2N7BA 4GT7A 3VXRB 4W6XB 5IT2H 1UB6A 5TE7H 4U3XA 5F6IC 3HZKB 5DJCA 3O4OB 3AXLB 4GAFB 4IOIA 5IHBA 4YHOL 1P53A 3VFNB 5EC1B 4M1DL 3ZKSD 3FT3B 1DBBL 1PZUB 2C7UB 5CFHA 1LO0L 1T1WB 5AZEL 3WDJA 1V3JA 2DQHH 4ZUVA 2CK2A 4NQVA 5CJQH 5LQBL 2ICEB 1LP9B 1ULVA 4OV5A 3ARBB 2D7QA 5J57B 5HD8D 3VMPA 3V4UL 2WBKA 5JIIA 4HS3A 4YGAB 3MODH 3MRFB 1MCHA 5L2KD 1MCWW 3FO9B 3O2VL 2UVEA 3AU1A 4PRHE 1K5NA 1RJZA 5ICXB 5JOEA 4PGCA 5SWSE 3LEXA 2MJWA 3RHWF 4PYHA 3BZ4B 4LBEA 4HGWB 2J4WH 4OKDA 2VR5A 1CLOH 1Z9LA 3MNVB 5FYJU 3NCFB 4G9FD 4FG6D 4GBXD 5DD0L 2CR6A 4YX2L 4HKJB 2DDQL 1TZHB 3ARFC 5IQ9B 5TE4L 3BX7C 2FJGB 1D5XB 1MRCL 3T8XB 3NIDE 4X6EA 3BDYH 3MGTA 1FNAA 3CX5K 4K7PL 4LLYA 3D0LB 4FZ8H 5DR5L 3CVIH 2W9EH 5GISH 3KPRA 1FZJB 2I25N 1W72B 4Y2DA 1JPTL 2YD5A 2BC4A 5DHYA 3D39B 1FIGL 1G9MH 1CK0H 3EO0B 3MNZA 4RBPH 1MQ8A 1UENA 3VXPB 5FGCB 3QXVA 4P5TA 1I7UA 1D5MB 4P3WA 2XKNB 3IAPA 3O6FD 4W81A 4IMLB 2F5AH 3QULA 3V4VL 3FQNA 1D6EA 4MNGA 1KF9B 2GIYA 2APWA 4MAYA 3IDYB 1SVZA 1JGLL 4XGZA 4OTXL 3PXHA 2P7TB 5C3TA 1Z9SA 1VKXA 4M48H 5FDYA 4NO0D 3T2QA 2AERT 3AFLA 2YXMA 4GKOA 5JDSA 1HHHA 2FNBA 1HHKB 4I18B 2F74A 1MCFA 2HWZL 4HF5L 4X8JA 2X42A 5E2TH 5EUOF 3WXWH 5E2UH 4LSVL 3QEHB 4ZFOB 3T3ME 1P2CA 2AEPH 5DI8A 1RU9H 2PTTB 1M7XA 3V79C 4P99A 4LNRB 3L95A 2OK0L 4HIHA 2DQEL 2WWMD 3O6ML 2W38A 3MJGX 4L3ED 3WJLC 3CNKA 3ULVD 1F4XL 2ERJB 4DUVA 2IQAB 4WU7A 3RRQA 2FGZA 3CDFA 2XOTA 4HLZH 3TFKC 2H41A 5CD3B 3N1FC 1NJ9A 4OUOA 3DHMA 5JHDB 3BP6A 2G9HA 1ZA3A 2DKMA 3DBXB 1FVDB 2OP4H 4CNIB 2W07A 4HFWA 1JGDA 1U8JB 5E9DB 5C0IA 4HLJA 2M8XA 4S1QH 4QRRA 1EEUA 2WUBL 4M6NH 1YC7A 3TBWA 1A7OH 5D6CA 2GT9B 4AIXA 5DQJA 3STLA 5CILH 1DN2A 5EZOH 4HBCL 2KQMA 2BHZA 4HHAA 4Q9QH 1T5XA 2A0LC 3PHQA 4L3AA 5GSRA 4OCXH 1RI8A 3F7QA 3HE7A 1NKRA 1I7ZB 3DV6B 2XN9E 2FR4A 4E5XA 4MNGE 4HMEA 5KVDH 2X4RB 4NN7C 1CICD 3K4ZA 1C16A 1PQZB 3A67L 2NY5C 3MUHL 2F53A 5CP3A 3ZHLA 2IH3A 5BV7L 4BJLA 1FNSH 1A0QH 1H5BB 1HNFA