4QD2C

Molecular basis for disruption of e-cadherin adhesion by botulinum neurotoxin a complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
286
structure length
286
Chain Sequence
NSLNDKIVTISCKADTNLFFYQVAGNVSLFQQTRNYLERWRLIYDSNKAAYKIKSMDIHNTNLVLTWNAPTHNISTQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSNYIKFIIEDYIISDLNNFTCKISPILDLNKVVQQVDVTNLNVNLYTWDYGRNQKWTIRYNEEKAAYQFFNTILSNGVLTWIFSNGNTVRVSSSNDQNNDAQYWLINPVSDTDETYTITNLRDTTKALDLYGGQTANGTAIQVFNYHGDDNQKWNIRNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin component HA33
publication title Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Cell adhesion
total genus 72
structure length 286
sequence length 286
chains with identical sequence D, H, I
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4qd2C01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4qd2C02
3TC2A 3CA4A 3ILAA 3WMVA 2NTDA 3FJBA 3HOMA 3FFZA 4TLPA 3IM5A 2X2TA 2Q3NB 1ISXA 5DUYA 1W3AA 3N0KA 5HPZA 4OEFA 3UJ0A 4KBBA 2HWAA 2NP0A 3H6QA 1BFFA 1PC8B 3VSZA 3A21A 4QALA 4XFSA 4J2SA 1TWEA 3FUQA 5JLVA 3RMYA 2AXMA 2P23A 4F34A 1T4QA 2DRYA 3AJ5A 2D44A 4L4IA 5FZUA 3O4AA 4DEPA 3FJ9A 3WO4A 1DLLA 2KH2A 4IZXA 1V6VA 3UD7A 4EB2B 3T8SA 2WBCA 2QN4A 3S8JA 6I1BA 5FNWA 4ZOTA 3FJ8A 1ITBA 1YBIA 4IY9A 4G6JA 4P0JA 9ILBA 4IONA 2VXTI 3O49A 2R9KB 1FV2A 4A7YA 3WA1A 5G00A 3IIRA 1ISVA 5BXSA 2RSTA 5EHAA 2VU9A 4X38A 1W3FA 3CU1B 1EYLA 3FJFA 4P6AA 1Q1UA 4QD2B 4EFRA 3D7WB 1G9BA 4ENDA 3Q7YA 4I1BA 1JT4A 4XKIA 3HSMA 1PZZA 4GOYA 2KI6B 4OUJA 3O4BA 4Q9GA 1WD3A 4YOLA 3IAGC 2D22A 4I7IA 1S0LA 2GO2A 3N7KA 4DCKC 3V0BB 4LO3A 1I1BA 3PG0A 1EV2A 3FJAA 3JUTA 3AZVA 4JPZA 1T9FA 1ISWA 2QYIB 4ZLBB 1QXMA 1V6XA 3AKHA 8I1BA 4JAWA 4KEIA 4QC4A 3OBTA 3WO2A 1DIWA 3WINA 4D8HA 3NBDA 1WBAA 1PUUB 3PUBA 2KI4A 3IM6A 4QBCA 3P6JA 4FVVA 4P0LA 4QO3A 5FNXA 1JT3A 3QR5A 1NZKA 1PWAA 3V0BA 3VSFA 2Y9WC 3OJVA 4LO0A 2Q9XA 1DFCA 3WINC 4G1RA 1WBCA 4JKQA 4OWJA 4IY8A 4ISQA 3AZWA 1MD6A 2ESUA 4I4XA 4I4YA 3HBWA 5GAQA 1KNMA 3N7LA 1HWNB 4LO0C 4II0A 4G9NA 3FJEA 4OWKA 2K4AB 3HALA 2E4MC 4J2KA 4USOA 2VSAA 1SZ6B 5BXTA 1HCDA 2L5XA 3FGMA 4QKSA 1NUNA 1IT0A 3A07A 2BFHA 3BRGC 3RSJA 1Z4SA 4OWLA 1S0DA 4ISRA 4L4HA 3NJ5A 2IHOA 4ZBVB 3O4OA 4GP0A 3UDAA 4I4UA 1BARA 2J3PA 3CA0A 3V0AB 1M16A 1JQZA 1JTCA 4GAFA 1JLYA 3CA5A 3BX1C 1JLXA 3RMXA 1OQLB 4GAIA 2AAIB 4X39A 4Z9WB 2D7RA 1IOBA 1EPWA 1RMLA 3I29B 1FMZA 1HKNA 1YF8B 1JY0A 1G9AA 3WO3A 4GOVA 4JQ0A 1ISZA 4I4RA 2MLLB 1G9CA 3ZC8A 5B2HA 1TOOA 4J2XA 4ZGRB 2K43A 2FFVA 2BEAA 3AH1A 1R8OA 3SNVA 2Y9XE 3V0AA 4AN7B 3BRFA 4I4PA 5DSSB 3PMEA 4JP0A 3CA6A 1YXWA 4A7KA 1RY7A 2HZ9A 3LTQA 1F31A 4Q9PA 1IHKA 2Y9FA 1CVSA 2M49A 1P63A 1HWOB 3O4DA 2GZBA 5F8WA 4EKXB 3O3QA 1EVTA 3VWCA 3AJ6A 1HWMB 3AH4A 1G9DA 3A23A 1Z0HA 5FZYA 5FZZA 1CE7B 1HCEA 1FWVA 4I4VA 3F1RA 4D0TA 1TTUA 3MPPG 2KKIA 1YYNA 4WBCA 4D0ZA 3OJ2A 4J2YA 3N7JA 1FQ9A 4ZFYB 4KEKA 4HJJA 21BIA 1XG6A 2F2FA 4P0KA 1V6WA 2MIBA 2LIEA 2D23A 1II4A 3CA1A 3UD9A 2P39A 2ZR1B 2NM1A 4KEJA 1Q03A 3W9TA 1FMMS 3A22A 3BA7A 3VUOA 1QQKA 1ILR1 1WD4A 3CA3A 3ZX7A 5F8YA 4DENA 2UUSA 3JRRA 2F2FC 1DJSB 1VCLA 1ISYA 2DREA 3FUOA 3HMYA 4R6UB 3UD8A 3VT1A 4G9MA 4I96A 1DQOA 4I37A 3BAGA 4I4SA 3I2AA 4OW4A 1HWPB 1M2TB 4LO2A 2DS0A 4Z8SB 4ZFUB 2YUGA 1XYFA 3RTIB 2E4MA 4H9WA 1N4KA 1Q04A 1A8DA 1FGAA 1IILA 1DZDA 3BA5A 3H6SE 3NBEA 2FGFA 5BVPI 2D7IA 2VLCA 5I1BA 3BB2A 3FJKA 3VT2A 4LO2C 3FJJA 3LLPA 1AVWB 2FDBM 3BTAA 3BAHA 3ZXGA 3BAUA 4I2SA 1ONKB 1TFMB 1K5VA 1S0CA 3OGFA 4FGFA 4QKRA 3S8KA 2Z49A 5EC5A 1Z2VA 4OEEA 4G6MA 4I3NA 5BXPA 1DFQA 41BIA 3CRIA 2FO1A 4ZFWB 2ZQNA 1XHBA 4X3AA 1I1EA 1IJTA 4X37A 1R8NA 2IWTB 2ZQOA 1BFCA 1JT7A 3AKIA 3MALA 3O4CA 3OGGA 4OEGA 1S0BA 4A7ZA 1RZOB 2F8XC 3N7MA 3RTJB 5DVHA 1ABRB 3NBCA 3AKFA 2WRYA 3UJ4A 2LIQA 2ERMA 5D62A 4H04A 3HN1A 3BA4A 4PC4A 2ET2A 2HW9A 4QBVA 1TIEA 3CRHA 3Q7WA 5D63A 2Z48A 2MC2A 1TWMA 3FJCA 5BQUA 4IZEA 3BAOA 1G82A 4LO7B 3BRDA 3Q7XA 2FFUA 1E0OA 2VXRA 1W3GA 2VSEA 1BFGA 3C9ZA 5JMCA 3AH2A 3OBRA 2RG9B 1L2HA 4LO1A 3F62B 5BQUC 4I4QA 4LO8B 1V6UA 1FN0A 3FJDA 1FV3A 4I4OA 4I1EA 4IQPA 5BXRA 1HIBA 1IRPA 3BADA 1D0HA 1AFCA 2AFGA 3BAVA 2D24A 1AF9A 1RG8A 3P53A 3H6RB 3KMVA 3IM7A 5D61A 4EFPA 3E8LC 4LO1C 3FJIA 5E24E 1XZZA 4XFUA 1BA7A 4IHZA 1AVUA 4IYBA 2DRZA 3ZC9A 4I6IA 4JKXB 1AVXB 3O44A 4F83A 1BFBA 3PHZA 3EF2A 4I0YA 3CQAA 1S0EA 1S0GA 4LO7C 4ZA3B 4ZKTB 2K8RA 3FJHA 3AKGA 2I1BA 3VEQA 3ZXDA 4J23B 2NYYA 4HA2A 4CJMA 3NBNA 3H6RA 2HWMA 1AVAC 1AXMA 2NVHA 3CRGA 3WMUA 3P6IA 3BAQA 5F8SA 2D20A 1YTOA 1SR4A 4USPA 31BIA 4EFQA 1DZCA 3B9UA 4KC3A 1FWUA 1DQGA 3POKA 3O5WB 2NZ9A 4LO3C 4JRAA 1S0FA 3VT0A 1BLAA 2D1ZA 5DZUA 2Y9GA 3CAHA 7I1BA 3R4UA 5BP5A 1TP0A 3I2XA 4GP3A 1SR4C 2XOAA 4HR6C 4QD2C 1BLDA 1JT5A 1J0SA 2D43A 1GGPB 3QYDA 1BASA 2AQZA 2VUAA 2RQ9A 1IRAX 2BEBA 3K1XA 4EEEB 4Q91A 5F90A 5BOWA 4AN6A 1QQLA 3V79C 1K5UA 4XFTA 1MC9A 5BP5C 3OJMA 2X2SA 5EG6C 3R4SA 2KLLA 1PUMB 1UPSA 4I8MA
chains in the Genus database with same CATH superfamily
3TC2A 3CA4A 3ILAA 3WMVA 2NTDA 3FJBA 3HOMA 3FFZA 4TLPA 3IM5A 2X2TA 2Q3NB 1ISXA 4MZGB 5DUYA 1W3AA 3N0KA 5HPZA 4OEFA 3UJ0A 4KBBA 4MZFB 2HWAA 2NP0A 3H6QA 1BFFA 1PC8B 3VSZA 3A21A 4QALA 4XFSA 4J2SA 1TWEA 3FUQA 5JLVA 3RMYA 2AXMA 2P23A 4F34A 1T4QA 2DRYA 3AJ5A 2D44A 4L4IA 5FZUA 3O4AA 4DEPA 3FJ9A 3WO4A 1DLLA 2KH2A 4IZXA 1V6VA 3UD7A 4EB2B 3T8SA 2WBCA 2QN4A 3S8JA 6I1BA 5FNWA 4ZOTA 3FJ8A 1ITBA 1YBIA 4IY9A 4G6JA 4P0JA 9ILBA 4IONA 2VXTI 3O49A 2R9KB 1FV2A 4A7YA 3WA1A 5G00A 3IIRA 1ISVA 5BXSA 2RSTA 5EHAA 2VU9A 4X38A 1W3FA 3CU1B 1EYLA 3FJFA 4P6AA 1Q1UA 4QD2B 4EFRA 3D7WB 1G9BA 4ENDA 3Q7YA 4I1BA 1JT4A 4XKIA 3HSMA 1PZZA 4GOYA 2KI6B 4OUJA 3O4BA 4Q9GA 1WD3A 4YOLA 3IAGC 2D22A 4I7IA 1S0LA 2GO2A 3N7KA 4DCKC 3V0BB 4LO3A 1I1BA 3PG0A 1EV2A 3FJAA 3JUTA 3AZVA 4JPZA 1T9FA 1ISWA 2QYIB 4ZLBB 1QXMA 1V6XA 3AKHA 8I1BA 4JAWA 4KEIA 4QC4A 3OBTA 3WO2A 1DIWA 3WINA 4D8HA 3NBDA 1WBAA 1PUUB 3PUBA 2KI4A 3IM6A 4QBCA 3P6JA 4FVVA 4P0LA 4QO3A 5FNXA 1JT3A 3QR5A 1NZKA 1PWAA 3V0BA 3VSFA 2Y9WC 3OJVA 4LO0A 2Q9XA 1DFCA 3WINC 4G1RA 1WBCA 4JKQA 4OWJA 4IY8A 2NS2A 4ISQA 3AZWA 1MD6A 2ESUA 4I4XA 4I4YA 3HBWA 5GAQA 1KNMA 3N7LA 1HWNB 4LO0C 4II0A 4G9NA 3FJEA 4OWKA 2K4AB 3HALA 2E4MC 4J2KA 4USOA 2VSAA 1SZ6B 5BXTA 1HCDA 4UY4A 2L5XA 3FGMA 4QKSA 1NUNA 1IT0A 3A07A 2BFHA 3BRGC 3RSJA 1Z4SA 4OWLA 1S0DA 4ISRA 4L4HA 4MZHA 3NJ5A 2IHOA 4ZBVB 3O4OA 4GP0A 3UDAA 4I4UA 1BARA 2J3PA 3CA0A 3V0AB 1M16A 1JQZA 1JTCA 4GAFA 1JLYA 3CA5A 3BX1C 1JLXA 3RMXA 1OQLB 4GAIA 2AAIB 4X39A 4Z9WB 2D7RA 1IOBA 1EPWA 1RMLA 3I29B 1FMZA 1HKNA 1YF8B 1JY0A 1G9AA 3WO3A 4GOVA 4JQ0A 1ISZA 4I4RA 2MLLB 1G9CA 3ZC8A 5B2HA 1TOOA 4J2XA 4ZGRB 2K43A 2FFVA 2BEAA 3AH1A 1R8OA 3SNVA 2Y9XE 3V0AA 4AN7B 3BRFA 4I4PA 5DSSB 3PMEA 4JP0A 3CA6A 1YXWA 4A7KA 1RY7A 2HZ9A 3LTQA 1F31A 4Q9PA 1IHKA 2Y9FA 1CVSA 2M49A 1P63A 1HWOB 3O4DA 2GZBA 5F8WA 4EKXB 3O3QA 1EVTA 3VWCA 3AJ6A 1HWMB 3AH4A 1G9DA 3A23A 1Z0HA 5FZYA 5FZZA 1CE7B 1HCEA 1FWVA 4I4VA 3F1RA 4D0TA 1TTUA 3MPPG 2KKIA 1YYNA 4WBCA 4D0ZA 3OJ2A 4J2YA 3N7JA 1FQ9A 4ZFYB 4KEKA 4HJJA 21BIA 1XG6A 2F2FA 4P0KA 1V6WA 2MIBA 2LIEA 2D23A 1II4A 3CA1A 3UD9A 2P39A 2ZR1B 2NM1A 4KEJA 1Q03A 3W9TA 1FMMS 3A22A 3BA7A 3VUOA 1QQKA 1ILR1 1WD4A 3CA3A 3ZX7A 5F8YA 4DENA 2UUSA 3JRRA 2F2FC 1DJSB 1VCLA 1ISYA 2DREA 3FUOA 3HMYA 4R6UB 3UD8A 3VT1A 4G9MA 4I96A 1DQOA 4I37A 3BAGA 4I4SA 3I2AA 4OW4A 1HWPB 1M2TB 4LO2A 2DS0A 4Z8SB 4ZFUB 2YUGA 1XYFA 3RTIB 2E4MA 4H9WA 1N4KA 1Q04A 1A8DA 1FGAA 1IILA 1DZDA 3BA5A 3H6SE 3NBEA 2FGFA 5BVPI 2D7IA 2VLCA 5I1BA 3BB2A 3FJKA 3VT2A 4LO2C 3FJJA 3LLPA 1AVWB 2FDBM 3BTAA 3BAHA 3ZXGA 3BAUA 4I2SA 1ONKB 1TFMB 1K5VA 1S0CA 3OGFA 4FGFA 4QKRA 3S8KA 2Z49A 5EC5A 1Z2VA 4OEEA 4G6MA 4I3NA 5BXPA 1DFQA 41BIA 3CRIA 2FO1A 4ZFWB 2ZQNA 1XHBA 4X3AA 1I1EA 1IJTA 4X37A 1R8NA 2IWTB 2ZQOA 1BFCA 1JT7A 3AKIA 3MALA 3O4CA 3OGGA 4OEGA 1S0BA 4A7ZA 1RZOB 2F8XC 3N7MA 3RTJB 5DVHA 1ABRB 3NBCA 3AKFA 2WRYA 3UJ4A 2LIQA 2ERMA 5D62A 4H04A 3HN1A 3BA4A 4PC4A 2ET2A 2HW9A 4QBVA 1TIEA 3CRHA 3Q7WA 5D63A 2Z48A 2MC2A 1TWMA 3FJCA 5BQUA 4IZEA 3BAOA 1G82A 4LO7B 3BRDA 3Q7XA 2FFUA 1E0OA 2VXRA 1W3GA 2VSEA 1BFGA 3C9ZA 5JMCA 3AH2A 3OBRA 2RG9B 1L2HA 4LO1A 3F62B 5BQUC 4I4QA 4LO8B 1V6UA 1FN0A 3FJDA 1FV3A 4I4OA 4I1EA 4IQPA 5BXRA 1HIBA 1IRPA 3BADA 1D0HA 1AFCA 2AFGA 3BAVA 2D24A 1AF9A 1RG8A 3P53A 3H6RB 3KMVA 3IM7A 5D61A 4EFPA 3E8LC 4LO1C 3FJIA 5E24E 1XZZA 4XFUA 1BA7A 4IHZA 1AVUA 4IYBA 2DRZA 3ZC9A 4I6IA 4JKXB 1AVXB 3O44A 4F83A 1BFBA 3PHZA 3EF2A 4I0YA 3CQAA 1S0EA 1S0GA 4LO7C 4ZA3B 4ZKTB 2K8RA 3FJHA 3AKGA 2I1BA 3VEQA 3ZXDA 4J23B 2NYYA 4HA2A 4CJMA 3NBNA 3H6RA 2HWMA 1AVAC 1AXMA 2NVHA 3CRGA 3WMUA 3P6IA 3BAQA 5F8SA 2D20A 1YTOA 1SR4A 4USPA 31BIA 4EFQA 1DZCA 3B9UA 4KC3A 1FWUA 1DQGA 3POKA 3O5WB 2NZ9A 4LO3C 4JRAA 1S0FA 3VT0A 1BLAA 2D1ZA 5DZUA 2Y9GA 3CAHA 7I1BA 3R4UA 5BP5A 1TP0A 3I2XA 4GP3A 1SR4C 2XOAA 4HR6C 4QD2C 1BLDA 1JT5A 1J0SA 2D43A 1GGPB 3QYDA 1BASA 2AQZA 2VUAA 2RQ9A 1IRAX 2BEBA 3K1XA 4EEEB 4Q91A 5F90A 5BOWA 4AN6A 1QQLA 3V79C 1K5UA 4XFTA 1MC9A 5BP5C 3OJMA 2X2SA 5EG6C 3R4SA 2KLLA 1PUMB 4H75A 1UPSA 4I8MA
chains in the Genus database with same CATH topology
3TC2A 3CA4A 3ILAA 3WMVA 2NTDA 3FJBA 3HOMA 3FFZA 4TLPA 3IM5A 2X2TA 2Q3NB 1ISXA 4MZGB 5DUYA 1W3AA 3N0KA 5HPZA 4OEFA 3UJ0A 4KBBA 4MZFB 2HWAA 2NP0A 3H6QA 1BFFA 1PC8B 3VSZA 3A21A 4QALA 4XFSA 4J2SA 1TWEA 3FUQA 5JLVA 3RMYA 2AXMA 2P23A 4F34A 1T4QA 2DRYA 3AJ5A 2D44A 4L4IA 5FZUA 3O4AA 4DEPA 3FJ9A 3WO4A 1DLLA 2KH2A 4IZXA 1V6VA 3UD7A 4EB2B 3T8SA 2WBCA 2QN4A 3S8JA 6I1BA 5FNWA 4ZOTA 3FJ8A 1ITBA 1YBIA 4IY9A 4G6JA 4P0JA 9ILBA 4IONA 2VXTI 3O49A 2R9KB 1FV2A 4A7YA 3WA1A 5G00A 3IIRA 1ISVA 5BXSA 2RSTA 5EHAA 2VU9A 4X38A 1W3FA 3CU1B 1EYLA 3FJFA 4P6AA 1Q1UA 4QD2B 4EFRA 3D7WB 1G9BA 4ENDA 3Q7YA 4I1BA 1JT4A 4XKIA 3HSMA 1PZZA 4GOYA 2KI6B 4OUJA 3O4BA 4Q9GA 1WD3A 4YOLA 3IAGC 2D22A 4I7IA 1S0LA 2GO2A 3N7KA 4DCKC 3V0BB 4LO3A 1I1BA 3PG0A 1EV2A 3FJAA 3JUTA 3AZVA 4JPZA 1T9FA 1ISWA 2QYIB 4ZLBB 1QXMA 1V6XA 3AKHA 8I1BA 4JAWA 4KEIA 4QC4A 3OBTA 3WO2A 1DIWA 3WINA 4D8HA 3NBDA 1WBAA 1PUUB 3PUBA 2KI4A 3IM6A 4QBCA 3P6JA 4FVVA 4P0LA 4QO3A 5FNXA 1JT3A 3QR5A 1NZKA 1PWAA 3V0BA 3VSFA 2Y9WC 3OJVA 4LO0A 2Q9XA 1DFCA 3WINC 4G1RA 1WBCA 4JKQA 4OWJA 4IY8A 2NS2A 4ISQA 3AZWA 1MD6A 2ESUA 4I4XA 4I4YA 3HBWA 5GAQA 1KNMA 3N7LA 1HWNB 4LO0C 4II0A 4G9NA 3FJEA 4OWKA 2K4AB 3HALA 2E4MC 4J2KA 4USOA 2VSAA 1SZ6B 5BXTA 1HCDA 4UY4A 2L5XA 3FGMA 4QKSA 1NUNA 1IT0A 3A07A 2BFHA 3BRGC 3RSJA 1Z4SA 4OWLA 1S0DA 4ISRA 4L4HA 4MZHA 3NJ5A 2IHOA 4ZBVB 3O4OA 4GP0A 3UDAA 4I4UA 1BARA 2J3PA 3CA0A 3V0AB 1M16A 1JQZA 1JTCA 4GAFA 1JLYA 3CA5A 3BX1C 1JLXA 3RMXA 1OQLB 4GAIA 2AAIB 4X39A 4Z9WB 2D7RA 1IOBA 1EPWA 1RMLA 3I29B 1FMZA 1HKNA 1YF8B 1JY0A 1G9AA 3WO3A 4GOVA 4JQ0A 1ISZA 4I4RA 2MLLB 1G9CA 3ZC8A 5B2HA 1TOOA 4J2XA 4ZGRB 2K43A 2FFVA 2BEAA 3AH1A 1R8OA 3SNVA 2Y9XE 3V0AA 4AN7B 3BRFA 4I4PA 5DSSB 3PMEA 4JP0A 3CA6A 1YXWA 4A7KA 1RY7A 2HZ9A 3LTQA 1F31A 4Q9PA 1IHKA 2Y9FA 1CVSA 2M49A 1P63A 1HWOB 3O4DA 2GZBA 5F8WA 4EKXB 3O3QA 1EVTA 3VWCA 3AJ6A 1HWMB 3AH4A 1G9DA 3A23A 1Z0HA 5FZYA 5FZZA 1CE7B 1HCEA 1FWVA 4I4VA 3F1RA 4D0TA 1TTUA 3MPPG 2KKIA 1YYNA 4WBCA 4D0ZA 3OJ2A 4J2YA 3N7JA 1FQ9A 4ZFYB 4KEKA 4HJJA 21BIA 1XG6A 2F2FA 4P0KA 1V6WA 2MIBA 2LIEA 2D23A 1II4A 3CA1A 3UD9A 2P39A 2ZR1B 2NM1A 4KEJA 1Q03A 3W9TA 1FMMS 3A22A 3BA7A 3VUOA 1QQKA 1ILR1 1WD4A 3CA3A 3ZX7A 5F8YA 4DENA 2UUSA 3JRRA 2F2FC 1DJSB 1VCLA 1ISYA 2DREA 3FUOA 3HMYA 4R6UB 3UD8A 3VT1A 4G9MA 4I96A 1DQOA 4I37A 3BAGA 4I4SA 3I2AA 4OW4A 1HWPB 1M2TB 4LO2A 2DS0A 4Z8SB 4ZFUB 2YUGA 1XYFA 3RTIB 2E4MA 4H9WA 1N4KA 1Q04A 1A8DA 1FGAA 1IILA 1DZDA 3BA5A 3H6SE 3NBEA 2FGFA 5BVPI 2D7IA 2VLCA 5I1BA 3BB2A 3FJKA 3VT2A 4LO2C 3FJJA 3LLPA 1AVWB 2FDBM 3BTAA 3BAHA 3ZXGA 3BAUA 4I2SA 1ONKB 1TFMB 1K5VA 1S0CA 3OGFA 4FGFA 4QKRA 3S8KA 2Z49A 5EC5A 1Z2VA 4OEEA 4G6MA 4I3NA 5BXPA 1DFQA 41BIA 3CRIA 2FO1A 4ZFWB 2ZQNA 1XHBA 4X3AA 1I1EA 1IJTA 4X37A 1R8NA 2IWTB 2ZQOA 1BFCA 1JT7A 3AKIA 3MALA 3O4CA 3OGGA 4OEGA 1S0BA 4A7ZA 1RZOB 2F8XC 3N7MA 3RTJB 5DVHA 1ABRB 3NBCA 3AKFA 2WRYA 3UJ4A 2LIQA 2ERMA 5D62A 4H04A 3HN1A 3BA4A 4PC4A 2ET2A 2HW9A 4QBVA 1TIEA 3CRHA 3Q7WA 5D63A 2Z48A 2MC2A 1TWMA 3FJCA 5BQUA 4IZEA 3BAOA 1G82A 4LO7B 3BRDA 3Q7XA 2FFUA 1E0OA 2VXRA 1W3GA 2VSEA 1BFGA 3C9ZA 5JMCA 3AH2A 3OBRA 2RG9B 1L2HA 4LO1A 3F62B 5BQUC 4I4QA 4LO8B 1V6UA 1FN0A 3FJDA 1FV3A 4I4OA 4I1EA 4IQPA 5BXRA 1HIBA 1IRPA 3BADA 1D0HA 1AFCA 2AFGA 3BAVA 2D24A 1AF9A 1RG8A 3P53A 3H6RB 3KMVA 3IM7A 5D61A 4EFPA 3E8LC 4LO1C 3FJIA 5E24E 1XZZA 4XFUA 1BA7A 4IHZA 1AVUA 4IYBA 2DRZA 3ZC9A 4I6IA 4JKXB 1AVXB 3O44A 4F83A 1BFBA 3PHZA 3EF2A 4I0YA 3CQAA 1S0EA 1S0GA 4LO7C 4ZA3B 4ZKTB 2K8RA 3FJHA 3AKGA 2I1BA 3VEQA 3ZXDA 4J23B 2NYYA 4HA2A 4CJMA 3NBNA 3H6RA 2HWMA 1AVAC 1AXMA 2NVHA 3CRGA 3WMUA 3P6IA 3BAQA 5F8SA 2D20A 1YTOA 1SR4A 4USPA 31BIA 4EFQA 1DZCA 3B9UA 4KC3A 1FWUA 1DQGA 3POKA 3O5WB 2NZ9A 4LO3C 4JRAA 1S0FA 3VT0A 1BLAA 2D1ZA 5DZUA 2Y9GA 3CAHA 7I1BA 3R4UA 5BP5A 1TP0A 3I2XA 4GP3A 1SR4C 2XOAA 4HR6C 4QD2C 1BLDA 1JT5A 1J0SA 2D43A 1GGPB 3QYDA 1BASA 2AQZA 2VUAA 2RQ9A 1IRAX 2BEBA 3K1XA 4EEEB 4Q91A 5F90A 5BOWA 4AN6A 1QQLA 3V79C 1K5UA 4XFTA 1MC9A 5BP5C 3OJMA 2X2SA 5EG6C 3R4SA 2KLLA 1PUMB 4H75A 1UPSA 4I8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC2 A;  3CA4 A;  3ILA A;  3WMV A;  2NTD A;  3FJB A;  3HOM A;  3FFZ A;  4TLP A;  3IM5 A;  2X2T A;  2Q3N B;  1ISX A;  5DUY A;  1W3A A;  3N0K A;  5HPZ A;  4OEF A;  3UJ0 A;  4KBB A;  2HWA A;  2NP0 A;  3H6Q A;  1BFF A;  1PC8 B;  3VSZ A;  3A21 A;  4QAL A;  4XFS A;  4J2S A;  1TWE A;  3FUQ A;  5JLV A;  3RMY A;  2AXM A;  2P23 A;  4F34 A;  1T4Q A;  2DRY A;  3AJ5 A;  2D44 A;  4L4I A;  5FZU A;  3O4A A;  4DEP A;  3FJ9 A;  3WO4 A;  1DLL A;  2KH2 A;  4IZX A;  1V6V A;  3UD7 A;  4EB2 B;  3T8S A;  2WBC A;  2QN4 A;  3S8J A;  6I1B A;  5FNW A;  4ZOT A;  3FJ8 A;  1ITB A;  1YBI A;  4IY9 A;  4G6J A;  4P0J A;  9ILB A;  4ION A;  2VXT I;  3O49 A;  2R9K B;  1FV2 A;  4A7Y A;  3WA1 A;  5G00 A;  3IIR A;  1ISV A;  5BXS A;  2RST A;  5EHA A;  2VU9 A;  4X38 A;  1W3F A;  3CU1 B;  1EYL A;  3FJF A;  4P6A A;  1Q1U A;  4QD2 B;  4EFR A;  3D7W B;  1G9B A;  4END A;  3Q7Y A;  4I1B A;  1JT4 A;  4XKI A;  3HSM A;  1PZZ A;  4GOY A;  2KI6 B;  4OUJ A;  3O4B A;  4Q9G A;  1WD3 A;  4YOL A;  3IAG C;  2D22 A;  4I7I A;  1S0L A;  2GO2 A;  3N7K A;  4DCK C;  3V0B B;  4LO3 A;  1I1B A;  3PG0 A;  1EV2 A;  3FJA A;  3JUT A;  3AZV A;  4JPZ A;  1T9F A;  1ISW A;  2QYI B;  4ZLB B;  1QXM A;  1V6X A;  3AKH A;  8I1B A;  4JAW A;  4KEI A;  4QC4 A;  3OBT A;  3WO2 A;  1DIW A;  3WIN A;  4D8H A;  3NBD A;  1WBA A;  1PUU B;  3PUB A;  2KI4 A;  3IM6 A;  4QBC A;  3P6J A;  4FVV A;  4P0L A;  4QO3 A;  5FNX A;  1JT3 A;  3QR5 A;  1NZK A;  1PWA A;  3V0B A;  3VSF A;  2Y9W C;  3OJV A;  4LO0 A;  2Q9X A;  1DFC A;  3WIN C;  4G1R A;  1WBC A;  4JKQ A;  4OWJ A;  4IY8 A;  4ISQ A;  3AZW A;  1MD6 A;  2ESU A;  4I4X A;  4I4Y A;  3HBW A;  5GAQ A;  1KNM A;  3N7L A;  1HWN B;  4LO0 C;  4II0 A;  4G9N A;  3FJE A;  4OWK A;  2K4A B;  3HAL A;  2E4M C;  4J2K A;  4USO A;  2VSA A;  1SZ6 B;  5BXT A;  1HCD A;  2L5X A;  3FGM A;  4QKS A;  1NUN A;  1IT0 A;  3A07 A;  2BFH A;  3BRG C;  3RSJ A;  1Z4S A;  4OWL A;  1S0D A;  4ISR A;  4L4H A;  3NJ5 A;  2IHO A;  4ZBV B;  3O4O A;  4GP0 A;  3UDA A;  4I4U A;  1BAR A;  2J3P A;  3CA0 A;  3V0A B;  1M16 A;  1JQZ A;  1JTC A;  4GAF A;  1JLY A;  3CA5 A;  3BX1 C;  1JLX A;  3RMX A;  1OQL B;  4GAI A;  2AAI B;  4X39 A;  4Z9W B;  2D7R A;  1IOB A;  1EPW A;  1RML A;  3I29 B;  1FMZ A;  1HKN A;  1YF8 B;  1JY0 A;  1G9A A;  3WO3 A;  4GOV A;  4JQ0 A;  1ISZ A;  4I4R A;  2MLL B;  1G9C A;  3ZC8 A;  5B2H A;  1TOO A;  4J2X A;  4ZGR B;  2K43 A;  2FFV A;  2BEA A;  3AH1 A;  1R8O A;  3SNV A;  2Y9X E;  3V0A A;  4AN7 B;  3BRF A;  4I4P A;  5DSS B;  3PME A;  4JP0 A;  3CA6 A;  1YXW A;  4A7K A;  1RY7 A;  2HZ9 A;  3LTQ A;  1F31 A;  4Q9P A;  1IHK A;  2Y9F A;  1CVS A;  2M49 A;  1P63 A;  1HWO B;  3O4D A;  2GZB A;  5F8W A;  4EKX B;  3O3Q A;  1EVT A;  3VWC A;  3AJ6 A;  1HWM B;  3AH4 A;  1G9D A;  3A23 A;  1Z0H A;  5FZY A;  5FZZ A;  1CE7 B;  1HCE A;  1FWV A;  4I4V A;  3F1R A;  4D0T A;  1TTU A;  3MPP G;  2KKI A;  1YYN A;  4WBC A;  4D0Z A;  3OJ2 A;  4J2Y A;  3N7J A;  1FQ9 A;  4ZFY B;  4KEK A;  4HJJ A;  21BI A;  1XG6 A;  2F2F A;  4P0K A;  1V6W A;  2MIB A;  2LIE A;  2D23 A;  1II4 A;  3CA1 A;  3UD9 A;  2P39 A;  2ZR1 B;  2NM1 A;  4KEJ A;  1Q03 A;  3W9T A;  1FMM S;  3A22 A;  3BA7 A;  3VUO A;  1QQK A;  1ILR 1;  1WD4 A;  3CA3 A;  3ZX7 A;  5F8Y A;  4DEN A;  2UUS A;  3JRR A;  2F2F C;  1DJS B;  1VCL A;  1ISY A;  2DRE A;  3FUO A;  3HMY A;  4R6U B;  3UD8 A;  3VT1 A;  4G9M A;  4I96 A;  1DQO A;  4I37 A;  3BAG A;  4I4S A;  3I2A A;  4OW4 A;  1HWP B;  1M2T B;  4LO2 A;  2DS0 A;  4Z8S B;  4ZFU B;  2YUG A;  1XYF A;  3RTI B;  2E4M A;  4H9W A;  1N4K A;  1Q04 A;  1A8D A;  1FGA A;  1IIL A;  1DZD A;  3BA5 A;  3H6S E;  3NBE A;  2FGF A;  5BVP I;  2D7I A;  2VLC A;  5I1B A;  3BB2 A;  3FJK A;  3VT2 A;  4LO2 C;  3FJJ A;  3LLP A;  1AVW B;  2FDB M;  3BTA A;  3BAH A;  3ZXG A;  3BAU A;  4I2S A;  1ONK B;  1TFM B;  1K5V A;  1S0C A;  3OGF A;  4FGF A;  4QKR A;  3S8K A;  2Z49 A;  5EC5 A;  1Z2V A;  4OEE A;  4G6M A;  4I3N A;  5BXP A;  1DFQ A;  41BI A;  3CRI A;  2FO1 A;  4ZFW B;  2ZQN A;  1XHB A;  4X3A A;  1I1E A;  1IJT A;  4X37 A;  1R8N A;  2IWT B;  2ZQO A;  1BFC A;  1JT7 A;  3AKI A;  3MAL A;  3O4C A;  3OGG A;  4OEG A;  1S0B A;  4A7Z A;  1RZO B;  2F8X C;  3N7M A;  3RTJ B;  5DVH A;  1ABR B;  3NBC A;  3AKF A;  2WRY A;  3UJ4 A;  2LIQ A;  2ERM A;  5D62 A;  4H04 A;  3HN1 A;  3BA4 A;  4PC4 A;  2ET2 A;  2HW9 A;  4QBV A;  1TIE A;  3CRH A;  3Q7W A;  5D63 A;  2Z48 A;  2MC2 A;  1TWM A;  3FJC A;  5BQU A;  4IZE A;  3BAO A;  1G82 A;  4LO7 B;  3BRD A;  3Q7X A;  2FFU A;  1E0O A;  2VXR A;  1W3G A;  2VSE A;  1BFG A;  3C9Z A;  5JMC A;  3AH2 A;  3OBR A;  2RG9 B;  1L2H A;  4LO1 A;  3F62 B;  5BQU C;  4I4Q A;  4LO8 B;  1V6U A;  1FN0 A;  3FJD A;  1FV3 A;  4I4O A;  4I1E A;  4IQP A;  5BXR A;  1HIB A;  1IRP A;  3BAD A;  1D0H A;  1AFC A;  2AFG A;  3BAV A;  2D24 A;  1AF9 A;  1RG8 A;  3P53 A;  3H6R B;  3KMV A;  3IM7 A;  5D61 A;  4EFP A;  3E8L C;  4LO1 C;  3FJI A;  5E24 E;  1XZZ A;  4XFU A;  1BA7 A;  4IHZ A;  1AVU A;  4IYB A;  2DRZ A;  3ZC9 A;  4I6I A;  4JKX B;  1AVX B;  3O44 A;  4F83 A;  1BFB A;  3PHZ A;  3EF2 A;  4I0Y A;  3CQA A;  1S0E A;  1S0G A;  4LO7 C;  4ZA3 B;  4ZKT B;  2K8R A;  3FJH A;  3AKG A;  2I1B A;  3VEQ A;  3ZXD A;  4J23 B;  2NYY A;  4HA2 A;  4CJM A;  3NBN A;  3H6R A;  2HWM A;  1AVA C;  1AXM A;  2NVH A;  3CRG A;  3WMU A;  3P6I A;  3BAQ A;  5F8S A;  2D20 A;  1YTO A;  1SR4 A;  4USP A;  31BI A;  4EFQ A;  1DZC A;  3B9U A;  4KC3 A;  1FWU A;  1DQG A;  3POK A;  3O5W B;  2NZ9 A;  4LO3 C;  4JRA A;  1S0F A;  3VT0 A;  1BLA A;  2D1Z A;  5DZU A;  2Y9G A;  3CAH A;  7I1B A;  3R4U A;  5BP5 A;  1TP0 A;  3I2X A;  4GP3 A;  1SR4 C;  2XOA A;  4HR6 C;  4QD2 C;  1BLD A;  1JT5 A;  1J0S A;  2D43 A;  1GGP B;  3QYD A;  1BAS A;  2AQZ A;  2VUA A;  2RQ9 A;  1IRA X;  2BEB A;  3K1X A;  4EEE B;  4Q91 A;  5F90 A;  5BOW A;  4AN6 A;  1QQL A;  3V79 C;  1K5U A;  4XFT A;  1MC9 A;  5BP5 C;  3OJM A;  2X2S A;  5EG6 C;  3R4S A;  2KLL A;  1PUM B;  1UPS A;  4I8M A; 
#chains in the Genus database with same CATH topology
 3TC2 A;  3CA4 A;  3ILA A;  3WMV A;  2NTD A;  3FJB A;  3HOM A;  3FFZ A;  4TLP A;  3IM5 A;  2X2T A;  2Q3N B;  1ISX A;  4MZG B;  5DUY A;  1W3A A;  3N0K A;  5HPZ A;  4OEF A;  3UJ0 A;  4KBB A;  4MZF B;  2HWA A;  2NP0 A;  3H6Q A;  1BFF A;  1PC8 B;  3VSZ A;  3A21 A;  4QAL A;  4XFS A;  4J2S A;  1TWE A;  3FUQ A;  5JLV A;  3RMY A;  2AXM A;  2P23 A;  4F34 A;  1T4Q A;  2DRY A;  3AJ5 A;  2D44 A;  4L4I A;  5FZU A;  3O4A A;  4DEP A;  3FJ9 A;  3WO4 A;  1DLL A;  2KH2 A;  4IZX A;  1V6V A;  3UD7 A;  4EB2 B;  3T8S A;  2WBC A;  2QN4 A;  3S8J A;  6I1B A;  5FNW A;  4ZOT A;  3FJ8 A;  1ITB A;  1YBI A;  4IY9 A;  4G6J A;  4P0J A;  9ILB A;  4ION A;  2VXT I;  3O49 A;  2R9K B;  1FV2 A;  4A7Y A;  3WA1 A;  5G00 A;  3IIR A;  1ISV A;  5BXS A;  2RST A;  5EHA A;  2VU9 A;  4X38 A;  1W3F A;  3CU1 B;  1EYL A;  3FJF A;  4P6A A;  1Q1U A;  4QD2 B;  4EFR A;  3D7W B;  1G9B A;  4END A;  3Q7Y A;  4I1B A;  1JT4 A;  4XKI A;  3HSM A;  1PZZ A;  4GOY A;  2KI6 B;  4OUJ A;  3O4B A;  4Q9G A;  1WD3 A;  4YOL A;  3IAG C;  2D22 A;  4I7I A;  1S0L A;  2GO2 A;  3N7K A;  4DCK C;  3V0B B;  4LO3 A;  1I1B A;  3PG0 A;  1EV2 A;  3FJA A;  3JUT A;  3AZV A;  4JPZ A;  1T9F A;  1ISW A;  2QYI B;  4ZLB B;  1QXM A;  1V6X A;  3AKH A;  8I1B A;  4JAW A;  4KEI A;  4QC4 A;  3OBT A;  3WO2 A;  1DIW A;  3WIN A;  4D8H A;  3NBD A;  1WBA A;  1PUU B;  3PUB A;  2KI4 A;  3IM6 A;  4QBC A;  3P6J A;  4FVV A;  4P0L A;  4QO3 A;  5FNX A;  1JT3 A;  3QR5 A;  1NZK A;  1PWA A;  3V0B A;  3VSF A;  2Y9W C;  3OJV A;  4LO0 A;  2Q9X A;  1DFC A;  3WIN C;  4G1R A;  1WBC A;  4JKQ A;  4OWJ A;  4IY8 A;  2NS2 A;  4ISQ A;  3AZW A;  1MD6 A;  2ESU A;  4I4X A;  4I4Y A;  3HBW A;  5GAQ A;  1KNM A;  3N7L A;  1HWN B;  4LO0 C;  4II0 A;  4G9N A;  3FJE A;  4OWK A;  2K4A B;  3HAL A;  2E4M C;  4J2K A;  4USO A;  2VSA A;  1SZ6 B;  5BXT A;  1HCD A;  4UY4 A;  2L5X A;  3FGM A;  4QKS A;  1NUN A;  1IT0 A;  3A07 A;  2BFH A;  3BRG C;  3RSJ A;  1Z4S A;  4OWL A;  1S0D A;  4ISR A;  4L4H A;  4MZH A;  3NJ5 A;  2IHO A;  4ZBV B;  3O4O A;  4GP0 A;  3UDA A;  4I4U A;  1BAR A;  2J3P A;  3CA0 A;  3V0A B;  1M16 A;  1JQZ A;  1JTC A;  4GAF A;  1JLY A;  3CA5 A;  3BX1 C;  1JLX A;  3RMX A;  1OQL B;  4GAI A;  2AAI B;  4X39 A;  4Z9W B;  2D7R A;  1IOB A;  1EPW A;  1RML A;  3I29 B;  1FMZ A;  1HKN A;  1YF8 B;  1JY0 A;  1G9A A;  3WO3 A;  4GOV A;  4JQ0 A;  1ISZ A;  4I4R A;  2MLL B;  1G9C A;  3ZC8 A;  5B2H A;  1TOO A;  4J2X A;  4ZGR B;  2K43 A;  2FFV A;  2BEA A;  3AH1 A;  1R8O A;  3SNV A;  2Y9X E;  3V0A A;  4AN7 B;  3BRF A;  4I4P A;  5DSS B;  3PME A;  4JP0 A;  3CA6 A;  1YXW A;  4A7K A;  1RY7 A;  2HZ9 A;  3LTQ A;  1F31 A;  4Q9P A;  1IHK A;  2Y9F A;  1CVS A;  2M49 A;  1P63 A;  1HWO B;  3O4D A;  2GZB A;  5F8W A;  4EKX B;  3O3Q A;  1EVT A;  3VWC A;  3AJ6 A;  1HWM B;  3AH4 A;  1G9D A;  3A23 A;  1Z0H A;  5FZY A;  5FZZ A;  1CE7 B;  1HCE A;  1FWV A;  4I4V A;  3F1R A;  4D0T A;  1TTU A;  3MPP G;  2KKI A;  1YYN A;  4WBC A;  4D0Z A;  3OJ2 A;  4J2Y A;  3N7J A;  1FQ9 A;  4ZFY B;  4KEK A;  4HJJ A;  21BI A;  1XG6 A;  2F2F A;  4P0K A;  1V6W A;  2MIB A;  2LIE A;  2D23 A;  1II4 A;  3CA1 A;  3UD9 A;  2P39 A;  2ZR1 B;  2NM1 A;  4KEJ A;  1Q03 A;  3W9T A;  1FMM S;  3A22 A;  3BA7 A;  3VUO A;  1QQK A;  1ILR 1;  1WD4 A;  3CA3 A;  3ZX7 A;  5F8Y A;  4DEN A;  2UUS A;  3JRR A;  2F2F C;  1DJS B;  1VCL A;  1ISY A;  2DRE A;  3FUO A;  3HMY A;  4R6U B;  3UD8 A;  3VT1 A;  4G9M A;  4I96 A;  1DQO A;  4I37 A;  3BAG A;  4I4S A;  3I2A A;  4OW4 A;  1HWP B;  1M2T B;  4LO2 A;  2DS0 A;  4Z8S B;  4ZFU B;  2YUG A;  1XYF A;  3RTI B;  2E4M A;  4H9W A;  1N4K A;  1Q04 A;  1A8D A;  1FGA A;  1IIL A;  1DZD A;  3BA5 A;  3H6S E;  3NBE A;  2FGF A;  5BVP I;  2D7I A;  2VLC A;  5I1B A;  3BB2 A;  3FJK A;  3VT2 A;  4LO2 C;  3FJJ A;  3LLP A;  1AVW B;  2FDB M;  3BTA A;  3BAH A;  3ZXG A;  3BAU A;  4I2S A;  1ONK B;  1TFM B;  1K5V A;  1S0C A;  3OGF A;  4FGF A;  4QKR A;  3S8K A;  2Z49 A;  5EC5 A;  1Z2V A;  4OEE A;  4G6M A;  4I3N A;  5BXP A;  1DFQ A;  41BI A;  3CRI A;  2FO1 A;  4ZFW B;  2ZQN A;  1XHB A;  4X3A A;  1I1E A;  1IJT A;  4X37 A;  1R8N A;  2IWT B;  2ZQO A;  1BFC A;  1JT7 A;  3AKI A;  3MAL A;  3O4C A;  3OGG A;  4OEG A;  1S0B A;  4A7Z A;  1RZO B;  2F8X C;  3N7M A;  3RTJ B;  5DVH A;  1ABR B;  3NBC A;  3AKF A;  2WRY A;  3UJ4 A;  2LIQ A;  2ERM A;  5D62 A;  4H04 A;  3HN1 A;  3BA4 A;  4PC4 A;  2ET2 A;  2HW9 A;  4QBV A;  1TIE A;  3CRH A;  3Q7W A;  5D63 A;  2Z48 A;  2MC2 A;  1TWM A;  3FJC A;  5BQU A;  4IZE A;  3BAO A;  1G82 A;  4LO7 B;  3BRD A;  3Q7X A;  2FFU A;  1E0O A;  2VXR A;  1W3G A;  2VSE A;  1BFG A;  3C9Z A;  5JMC A;  3AH2 A;  3OBR A;  2RG9 B;  1L2H A;  4LO1 A;  3F62 B;  5BQU C;  4I4Q A;  4LO8 B;  1V6U A;  1FN0 A;  3FJD A;  1FV3 A;  4I4O A;  4I1E A;  4IQP A;  5BXR A;  1HIB A;  1IRP A;  3BAD A;  1D0H A;  1AFC A;  2AFG A;  3BAV A;  2D24 A;  1AF9 A;  1RG8 A;  3P53 A;  3H6R B;  3KMV A;  3IM7 A;  5D61 A;  4EFP A;  3E8L C;  4LO1 C;  3FJI A;  5E24 E;  1XZZ A;  4XFU A;  1BA7 A;  4IHZ A;  1AVU A;  4IYB A;  2DRZ A;  3ZC9 A;  4I6I A;  4JKX B;  1AVX B;  3O44 A;  4F83 A;  1BFB A;  3PHZ A;  3EF2 A;  4I0Y A;  3CQA A;  1S0E A;  1S0G A;  4LO7 C;  4ZA3 B;  4ZKT B;  2K8R A;  3FJH A;  3AKG A;  2I1B A;  3VEQ A;  3ZXD A;  4J23 B;  2NYY A;  4HA2 A;  4CJM A;  3NBN A;  3H6R A;  2HWM A;  1AVA C;  1AXM A;  2NVH A;  3CRG A;  3WMU A;  3P6I A;  3BAQ A;  5F8S A;  2D20 A;  1YTO A;  1SR4 A;  4USP A;  31BI A;  4EFQ A;  1DZC A;  3B9U A;  4KC3 A;  1FWU A;  1DQG A;  3POK A;  3O5W B;  2NZ9 A;  4LO3 C;  4JRA A;  1S0F A;  3VT0 A;  1BLA A;  2D1Z A;  5DZU A;  2Y9G A;  3CAH A;  7I1B A;  3R4U A;  5BP5 A;  1TP0 A;  3I2X A;  4GP3 A;  1SR4 C;  2XOA A;  4HR6 C;  4QD2 C;  1BLD A;  1JT5 A;  1J0S A;  2D43 A;  1GGP B;  3QYD A;  1BAS A;  2AQZ A;  2VUA A;  2RQ9 A;  1IRA X;  2BEB A;  3K1X A;  4EEE B;  4Q91 A;  5F90 A;  5BOW A;  4AN6 A;  1QQL A;  3V79 C;  1K5U A;  4XFT A;  1MC9 A;  5BP5 C;  3OJM A;  2X2S A;  5EG6 C;  3R4S A;  2KLL A;  1PUM B;  4H75 A;  1UPS A;  4I8M A; 
#chains in the Genus database with same CATH homology
 3TC2 A;  3CA4 A;  3ILA A;  3WMV A;  2NTD A;  3FJB A;  3HOM A;  3FFZ A;  4TLP A;  3IM5 A;  2X2T A;  2Q3N B;  1ISX A;  4MZG B;  5DUY A;  1W3A A;  3N0K A;  5HPZ A;  4OEF A;  3UJ0 A;  4KBB A;  4MZF B;  2HWA A;  2NP0 A;  3H6Q A;  1BFF A;  1PC8 B;  3VSZ A;  3A21 A;  4QAL A;  4XFS A;  4J2S A;  1TWE A;  3FUQ A;  5JLV A;  3RMY A;  2AXM A;  2P23 A;  4F34 A;  1T4Q A;  2DRY A;  3AJ5 A;  2D44 A;  4L4I A;  5FZU A;  3O4A A;  4DEP A;  3FJ9 A;  3WO4 A;  1DLL A;  2KH2 A;  4IZX A;  1V6V A;  3UD7 A;  4EB2 B;  3T8S A;  2WBC A;  2QN4 A;  3S8J A;  6I1B A;  5FNW A;  4ZOT A;  3FJ8 A;  1ITB A;  1YBI A;  4IY9 A;  4G6J A;  4P0J A;  9ILB A;  4ION A;  2VXT I;  3O49 A;  2R9K B;  1FV2 A;  4A7Y A;  3WA1 A;  5G00 A;  3IIR A;  1ISV A;  5BXS A;  2RST A;  5EHA A;  2VU9 A;  4X38 A;  1W3F A;  3CU1 B;  1EYL A;  3FJF A;  4P6A A;  1Q1U A;  4QD2 B;  4EFR A;  3D7W B;  1G9B A;  4END A;  3Q7Y A;  4I1B A;  1JT4 A;  4XKI A;  3HSM A;  1PZZ A;  4GOY A;  2KI6 B;  4OUJ A;  3O4B A;  4Q9G A;  1WD3 A;  4YOL A;  3IAG C;  2D22 A;  4I7I A;  1S0L A;  2GO2 A;  3N7K A;  4DCK C;  3V0B B;  4LO3 A;  1I1B A;  3PG0 A;  1EV2 A;  3FJA A;  3JUT A;  3AZV A;  4JPZ A;  1T9F A;  1ISW A;  2QYI B;  4ZLB B;  1QXM A;  1V6X A;  3AKH A;  8I1B A;  4JAW A;  4KEI A;  4QC4 A;  3OBT A;  3WO2 A;  1DIW A;  3WIN A;  4D8H A;  3NBD A;  1WBA A;  1PUU B;  3PUB A;  2KI4 A;  3IM6 A;  4QBC A;  3P6J A;  4FVV A;  4P0L A;  4QO3 A;  5FNX A;  1JT3 A;  3QR5 A;  1NZK A;  1PWA A;  3V0B A;  3VSF A;  2Y9W C;  3OJV A;  4LO0 A;  2Q9X A;  1DFC A;  3WIN C;  4G1R A;  1WBC A;  4JKQ A;  4OWJ A;  4IY8 A;  2NS2 A;  4ISQ A;  3AZW A;  1MD6 A;  2ESU A;  4I4X A;  4I4Y A;  3HBW A;  5GAQ A;  1KNM A;  3N7L A;  1HWN B;  4LO0 C;  4II0 A;  4G9N A;  3FJE A;  4OWK A;  2K4A B;  3HAL A;  2E4M C;  4J2K A;  4USO A;  2VSA A;  1SZ6 B;  5BXT A;  1HCD A;  4UY4 A;  2L5X A;  3FGM A;  4QKS A;  1NUN A;  1IT0 A;  3A07 A;  2BFH A;  3BRG C;  3RSJ A;  1Z4S A;  4OWL A;  1S0D A;  4ISR A;  4L4H A;  4MZH A;  3NJ5 A;  2IHO A;  4ZBV B;  3O4O A;  4GP0 A;  3UDA A;  4I4U A;  1BAR A;  2J3P A;  3CA0 A;  3V0A B;  1M16 A;  1JQZ A;  1JTC A;  4GAF A;  1JLY A;  3CA5 A;  3BX1 C;  1JLX A;  3RMX A;  1OQL B;  4GAI A;  2AAI B;  4X39 A;  4Z9W B;  2D7R A;  1IOB A;  1EPW A;  1RML A;  3I29 B;  1FMZ A;  1HKN A;  1YF8 B;  1JY0 A;  1G9A A;  3WO3 A;  4GOV A;  4JQ0 A;  1ISZ A;  4I4R A;  2MLL B;  1G9C A;  3ZC8 A;  5B2H A;  1TOO A;  4J2X A;  4ZGR B;  2K43 A;  2FFV A;  2BEA A;  3AH1 A;  1R8O A;  3SNV A;  2Y9X E;  3V0A A;  4AN7 B;  3BRF A;  4I4P A;  5DSS B;  3PME A;  4JP0 A;  3CA6 A;  1YXW A;  4A7K A;  1RY7 A;  2HZ9 A;  3LTQ A;  1F31 A;  4Q9P A;  1IHK A;  2Y9F A;  1CVS A;  2M49 A;  1P63 A;  1HWO B;  3O4D A;  2GZB A;  5F8W A;  4EKX B;  3O3Q A;  1EVT A;  3VWC A;  3AJ6 A;  1HWM B;  3AH4 A;  1G9D A;  3A23 A;  1Z0H A;  5FZY A;  5FZZ A;  1CE7 B;  1HCE A;  1FWV A;  4I4V A;  3F1R A;  4D0T A;  1TTU A;  3MPP G;  2KKI A;  1YYN A;  4WBC A;  4D0Z A;  3OJ2 A;  4J2Y A;  3N7J A;  1FQ9 A;  4ZFY B;  4KEK A;  4HJJ A;  21BI A;  1XG6 A;  2F2F A;  4P0K A;  1V6W A;  2MIB A;  2LIE A;  2D23 A;  1II4 A;  3CA1 A;  3UD9 A;  2P39 A;  2ZR1 B;  2NM1 A;  4KEJ A;  1Q03 A;  3W9T A;  1FMM S;  3A22 A;  3BA7 A;  3VUO A;  1QQK A;  1ILR 1;  1WD4 A;  3CA3 A;  3ZX7 A;  5F8Y A;  4DEN A;  2UUS A;  3JRR A;  2F2F C;  1DJS B;  1VCL A;  1ISY A;  2DRE A;  3FUO A;  3HMY A;  4R6U B;  3UD8 A;  3VT1 A;  4G9M A;  4I96 A;  1DQO A;  4I37 A;  3BAG A;  4I4S A;  3I2A A;  4OW4 A;  1HWP B;  1M2T B;  4LO2 A;  2DS0 A;  4Z8S B;  4ZFU B;  2YUG A;  1XYF A;  3RTI B;  2E4M A;  4H9W A;  1N4K A;  1Q04 A;  1A8D A;  1FGA A;  1IIL A;  1DZD A;  3BA5 A;  3H6S E;  3NBE A;  2FGF A;  5BVP I;  2D7I A;  2VLC A;  5I1B A;  3BB2 A;  3FJK A;  3VT2 A;  4LO2 C;  3FJJ A;  3LLP A;  1AVW B;  2FDB M;  3BTA A;  3BAH A;  3ZXG A;  3BAU A;  4I2S A;  1ONK B;  1TFM B;  1K5V A;  1S0C A;  3OGF A;  4FGF A;  4QKR A;  3S8K A;  2Z49 A;  5EC5 A;  1Z2V A;  4OEE A;  4G6M A;  4I3N A;  5BXP A;  1DFQ A;  41BI A;  3CRI A;  2FO1 A;  4ZFW B;  2ZQN A;  1XHB A;  4X3A A;  1I1E A;  1IJT A;  4X37 A;  1R8N A;  2IWT B;  2ZQO A;  1BFC A;  1JT7 A;  3AKI A;  3MAL A;  3O4C A;  3OGG A;  4OEG A;  1S0B A;  4A7Z A;  1RZO B;  2F8X C;  3N7M A;  3RTJ B;  5DVH A;  1ABR B;  3NBC A;  3AKF A;  2WRY A;  3UJ4 A;  2LIQ A;  2ERM A;  5D62 A;  4H04 A;  3HN1 A;  3BA4 A;  4PC4 A;  2ET2 A;  2HW9 A;  4QBV A;  1TIE A;  3CRH A;  3Q7W A;  5D63 A;  2Z48 A;  2MC2 A;  1TWM A;  3FJC A;  5BQU A;  4IZE A;  3BAO A;  1G82 A;  4LO7 B;  3BRD A;  3Q7X A;  2FFU A;  1E0O A;  2VXR A;  1W3G A;  2VSE A;  1BFG A;  3C9Z A;  5JMC A;  3AH2 A;  3OBR A;  2RG9 B;  1L2H A;  4LO1 A;  3F62 B;  5BQU C;  4I4Q A;  4LO8 B;  1V6U A;  1FN0 A;  3FJD A;  1FV3 A;  4I4O A;  4I1E A;  4IQP A;  5BXR A;  1HIB A;  1IRP A;  3BAD A;  1D0H A;  1AFC A;  2AFG A;  3BAV A;  2D24 A;  1AF9 A;  1RG8 A;  3P53 A;  3H6R B;  3KMV A;  3IM7 A;  5D61 A;  4EFP A;  3E8L C;  4LO1 C;  3FJI A;  5E24 E;  1XZZ A;  4XFU A;  1BA7 A;  4IHZ A;  1AVU A;  4IYB A;  2DRZ A;  3ZC9 A;  4I6I A;  4JKX B;  1AVX B;  3O44 A;  4F83 A;  1BFB A;  3PHZ A;  3EF2 A;  4I0Y A;  3CQA A;  1S0E A;  1S0G A;  4LO7 C;  4ZA3 B;  4ZKT B;  2K8R A;  3FJH A;  3AKG A;  2I1B A;  3VEQ A;  3ZXD A;  4J23 B;  2NYY A;  4HA2 A;  4CJM A;  3NBN A;  3H6R A;  2HWM A;  1AVA C;  1AXM A;  2NVH A;  3CRG A;  3WMU A;  3P6I A;  3BAQ A;  5F8S A;  2D20 A;  1YTO A;  1SR4 A;  4USP A;  31BI A;  4EFQ A;  1DZC A;  3B9U A;  4KC3 A;  1FWU A;  1DQG A;  3POK A;  3O5W B;  2NZ9 A;  4LO3 C;  4JRA A;  1S0F A;  3VT0 A;  1BLA A;  2D1Z A;  5DZU A;  2Y9G A;  3CAH A;  7I1B A;  3R4U A;  5BP5 A;  1TP0 A;  3I2X A;  4GP3 A;  1SR4 C;  2XOA A;  4HR6 C;  4QD2 C;  1BLD A;  1JT5 A;  1J0S A;  2D43 A;  1GGP B;  3QYD A;  1BAS A;  2AQZ A;  2VUA A;  2RQ9 A;  1IRA X;  2BEB A;  3K1X A;  4EEE B;  4Q91 A;  5F90 A;  5BOW A;  4AN6 A;  1QQL A;  3V79 C;  1K5U A;  4XFT A;  1MC9 A;  5BP5 C;  3OJM A;  2X2S A;  5EG6 C;  3R4S A;  2KLL A;  1PUM B;  4H75 A;  1UPS A;  4I8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...