4QDQA

Physical basis for nrp2 ligand binding
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
325
structure length
316
Chain Sequence
b'QCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTSIIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
total genus 88
structure length 316
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdqA01
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdqA02
1UZ0A 4PT6A 1JZ3A 4E8DA 4BDVB 4W50A 2VZSA 2VZOA 2Y6LA 3CQOA 3SKVA 3T2QA 2E31A 5EIYB 5JR2A 2B9VA 4JHZA 3BN6A 3A22A 1XC6A 3MV11 3FHAA 4D0QA 2Y6HA 3OEBA 3HNYM 1J83A 2HYXA 3OBAA 2E33A 1OF4A 3ETPA 5C7GA 2VZVA 4ARYA 2QQKA 4OMCA 2WO1A 5JMOA 1EUUA 1LNSA 4A45A 3I2HA 4P08A 3A7QA 3IAPA 4OZOA 2Y6GA 3D3AA 5B4NA 1W8OA 3HNMA 4OMDA 3ACFA 2KD7A 2J22A 4KWUA 3VD7A 4A6OA 3A21A 1GMMA 4LQRA 2J1VA 4FI9A 4ZY9A 1UX7A 2QQIA 3E1F1 3VD3A 2JD9A 1GOHA 3HOBA 1OD3A 2W1UA 1L7QA 2WN3A 1TG7A 2VTFA 2WDBA 5A1AA 3DYPA 5LCWL 4JX0A 2E32A 2J1TA 2W92A 1UYXA 4ET7A 3WNKA 5DN2A 4P5YA 4A41A 3MBWA 2E26A 3LPGA 3WNPA 4QB2A 3HPNA 4CVUA 3VD4A 4A42A 4CU7A 2W91A 4P00B 3HJRA 3ABZA 3I3DA 1MPXA 2VCBA 2W94A 2LW8A 3CKHA 3IDAA 1UY1A 2ZEYA 2C26A 3PUHA 3T0DA 1W9WA 3LQCA 5G05L 1NX9A 2ID4A 4QX1A 4ZXEA 3OGRA 3NJXA 4BK5A 2J1UA 2VMDA 4M4RA 4MGSA 3DYOA 2C4XA 2X09A 3VD5A 1JZ6A 1WCQA 2VZ3A 2WAOA 2VR4A 4ZZ8A 4RYDA 1UMIA 3VDBA 3W5NA 3IB3A 2QQLA 5JXJA 5JXGA 5CZKA 1CZSA 3GDBA 1GUIA 3WF1A 4UI9L 1O8SA 2VQTA 2VZUA 4XUQA 2BGPA 4DUWA 1IQDC 4XUNA 4XURA 2Z4FA 3VD9A 3HN3A 2DCKA 2QQOA 1ULPA 2W3JA 2W46A 5JUVA 1JZ4A 2BZDA 4DXTA 3SEEA 1PMJX 2W1WA 2J7MA 2XONA 3EYPA 3K77A 4KMQA 2W9XA 2J1SA 3LE0A 2W5FA 1DLCA 1BHGA 1US3A 1RYYA 4JKMA 1GNYA 1UY4A 3I2FA 2ZEXA 5F7UA 3UESA 2CDPA 1W99A 4A3ZA 4YPJA 3P6BA 1H6XA 3C7OA 4BJ0A 4MADA 3WQBA 2BERA 3A23A 1O8PA 3T0AA 3MV01 5HPOA 3ACGA 3I2IA 1SG3A 3FHQA 3ACIA 1XPWA 2JDAA 4L0PA 2EIEA 3C7HA 4HG6B 2VCCA 2RVAA 2JKXA 1DP0A 1UY3A 1H6YA 1W9TA 3K4DA 2ZEZA 4MO3M 1XNAA 2DCJA 3C7GA 3WF2A 4CU6A 5EJZB 2VMEA 5J1XA 5LA2A 1UYYA 3T2PA 2QQJA 1HN1A 1P8JA 3I97A 3T08A 1JYVA 5FUIA 2EIDA 2VZTA 4JKLA 1ULOA 2BGOA 4M4PA 1JZ7A 1GOFA 5LA1A 1PX3A 4BK4A 4D8MA 1UXXX 2B4KA 4IUGA 4OUEA 3DYMA 3OGVA 2V4VA 5DQ0A 4GZ9A 4DXSA 1GU3A 4MOAA 1K12A 1NKGA 3OG2A 4BXSV 4UOJA 3JXSA 5DMYA 2QQMA 3MUZ1 4QB1A 4XVHA 1NAEA 4GWIA 3NNGA 1W0NA 5IJRA 4UAPA 1L7RA 4E8CA 2CDOA 2HLEA 3HEIA 1KGYA 2W95A 4TXWA 3T0BA 4KI5M 4DUXA 3LEKA 4CUBA 1R64A 3K4ZA 2X10A 5JXHA 2XQXA 3HNBM 4QAWA 4XUPA 4PQQA 1OH4A 3FL7A 2C9KA 2VJXA 3ACHA 3P1IA 3SEPA 5JXIA 3I2KA 2Y8KA 1F4HA 5I0DA 3I3EA 2YFUA 4XZUG 2ZEWA 2WZ8A 4ZZ5A 1CX1A 1DYOA 1W9SA 3LEGA 4TTGA 2ZXQA 2DDUA 2Y6KA 2Y6JA 3WF4A 4DEQA 3GM8A 4XUTA 2VO5A 1I5PA 2L9LA 1SHWB 4JKKA 1CIYA 1JZ5A 4ARXA 4AAXA 2J1AA 3C7EA 2VZRA 4P02B 1JZ8A 3BGAA 2JE8A 2YC2A 1WKYA 3LPFA 3PUIA 3THDA 1F4AA 1K45A 1JU3A 4CUCA 3CZUA 1XNTA 4CUAA 1W8NA 2RJ2A 2WO3A 1UMHA 1GOGA 1UY0A 4QDRA 2W1SA 2WQ8A 1UWWA 2Y64A 4AG4A 4LKSA 4DXRA 3C7FA 2X05A 1OF3A 1PMHX 4QDQA 3GXUA 1JU4A 2EICA 3WF3A 5C70A 1PX4A 1OT5A 2VZQA 2WZEA 3WNLA 3NRUA 2BBAA 3CIHA 4QPWA 3I3BA 2WBKA 2VMCA 2QBXA 4QX2A 2YG0A 3U37A 3I2GA 3I2JA 2YC4A 4OYUA 1SDDB 1EUTA 3OEAA 3WNMA 4QX0A 2VC9A 5IYYA 1UXZA 3CZJA 3MO4A 1K42A 3W5MA 2J1EA 2W47A 3LEIA 3ECQA 1KEXA 2XHNA 2V5DA 3GGLA 2WUHA 5B4XA 1K3IA 3OGSA 4MGQA 5EJ1B 3F2ZA 4XUOA 1TVGA 2VOTA 5LA0A 2VQUA 3T09A 2PQSA 2XOMA 2QQNA 4CU8A 4DUVA 3CMGA 3SKJE 1CZTA 3K75B 1UY2A 3THCA 3CDZB 1GQPA 2R7EB 1YQ2A 3WNOA 3OB8A 2YFZA 3EB7A 2VZ1A 4PF1A 2WABA 3C8XA 3WF0A 1D7PM 5DPNA 2EIBA 1JI6A 5G04L 2ORZA 5C71A 5IHRA 2VM9A 2WYSA 4DEVA 1J84A 2VZPA 5CYYA 3WNNA 4CU9A 1JHJA 2J1RA 4LHSA 2W1QA 2W87A 4GWJA 3FN9A 1JZ2A 1US2A 1NUKA 1UYZA 3WEZA 1CZVA 3VDCA 5HXMA 2RV9A 4QDSA 4QB6A 4LPLA 4A44A 3IAQA 3K4AA 3K46A 3NJVA 2OKXA 2VL4A 4W8JA 2LS6A 3WSOA 1T2XA 2WAAA 2WN2A 2VMFA 2VCAA 1JYNA 3DECA 3T2OA 2V72A 3VDAA 4Z2AA 3ZM8A 2YB7A 5IFPA 4QX3A 4W4ZA 5IFTA 3UETA 1JYWA 3IIIA 3UNPA 3AC0A 4A4AA 2ORXA 3J7HA 1O59A 1JYXA 4RN5A 2WO2A 3NQHA 3MUY1
chains in the Genus database with same CATH superfamily
5F5IA 5T5PA 3NVCA 5FZMA 1BKZA 4E8DA 4ISRA 1BZWA 2BNNA 3OGJA 1ZBE3 1N1YA 2Y26A 3CEWA 3FLTA 2VZOA 2Y6LA 4W50A 5DAPA 3VBHA 4Y22B 2WFF3 2B9VA 2IUWA 3MV11 4Q4Y1 3N4MA 4M3CE 5FZ0A 1MEC1 2NYYA 3HNYM 1J83A 4QGNA 1H1IA 3OBAA 2BOJA 1REDA 1RUD1 5L7OA 5D21A 4QPIC 2VZVA 4ARYA 3PVBB 5T55A 2JD4A 3LCPA 1EUUA 3J8F2 3DF0A 2OPWA 3ILNA 4DINB 4AI1A 5FO8B 3A7QA 1T6GC 1BLZA 2XVLA 2WNVC 1SFNA 1W9FA 3MI8A 4AL9A 2A7AA 1RVF2 3RNSA 5FTTC 2DTYA 4OMDA 3J7MA 4U2AA 2ET1A 1O5UA 1W06A 1PO21 2J22A 2KD7A 1W6NA 2WNEA 1PVC1 4Y3OA 4FP2A 2HYKA 3KCXA 3SC7X 1RVF3 2PA7A 5GLVA 3SISA 1UQXA 3JQWA 2D44A 3KHCA 4Q27A 3BTZA 2R063 4FI9A 4JGYB 1SEFA 4Y33A 4ZY9A 1UX7A 1LEDA 3VD3A 3POEA 1G9BA 3BYWA 1GOHA 4IW3A 3ZYFA 1IKQA 2OA2A 2WN3A 4E2QA 3VKMA 2VTFA 4YZ3A 1YEWA 5IVCA 1W0OA 2NZ9A 3IWZA 2E32A 2W92A 1UYXA 5CNAA 4NOTA 5T5JA 5D2AA 1KRIA 4A41A 5JLVA 3NAPB 2ZGPA 4COWA 1RXFA 4BM8A 4LLOA 1JUHA 3MBWA 1BBT1 2WZR2 4QB2A 2AC1A 3HVDA 2WNOA 4C0HA 4Y20B 3ZFGC 3U78A 2R071 2GP5A 4N7IA 4WZFA 2GDFA 2ILMA 3AX4A 3PURA 4CYDA 5A7PA 1WCUA 5F2WA 4XQDA 1SLAA 3HQXA 1GZWB 4Y22A 2YXSA 2R0HA 2NPIA 5KHKA 2VOVA 3EMRA 3LDKA 4YLZA 1HJGA 4NN0A 1XNKA 1PGSA 4META 2W94A 2Q8OA 2LW8A 3N9OA 4F83A 1SFYA 1Q8PA 1ZBE1 2DCTA 2KA3A 4RS5A 1AR91 4ES9A 3UKTA 2IFRA 1D4M1 2ZPXA 5F3EA 4P9IA 5G05L 2YBSA 2O0OA 3H9AA 3O1VA 3WZ1A 1PZ9A 1H2KA 3HBZA 5AFBA 1RUJ2 1L7LA 4BK5A 1R1ZA 5ABJB 5FZ9A 3RZLA 3CLPA 2I74A 4ORFA 1U5IA 3BKZA 1CPNA 1ASJ3 1AYM1 1PZ7A 3ON7A 1FMD1 3BTXA 2ZAHA 2Z2SB 3OCPA 2VD7A 4Y1ZA 2X09A 4FFGA 1LHVA 1WCQA 2O1QA 3Q8FA 1DFQA 4KWLA 4FOWA 4ZZ8A 5CG8A 4COUA 3PVOA 5JIAA 1HW5A 3IB3A 2LRPA 3AB0A 3RVHA 1LGCA 5B2GB 4AW7A 1I1EA 5ACA3 3I59B 2JX9A 2XLGA 3LD8A 4XIKA 1I3HA 1ZBA3 4KNCA 3CO2A 4E9KA 1OA2A 1W90A 4YRDA 3BI3A 2HWC3 3HWJA 3WF1A 2XPJA 1F35A 1WLTA 4CCNA 3H1MA 1ENSA 4Q26A 5I0UA 3WT3A 4OZXA 5IK7A 3WDTA 2TUNA 5KXCA 5A3WA 5F9TA 3AFKA 1BYHA 2WFPA 2DUOA 2Y6FA 2WKKA 2XBO2 4IETA 3O14A 1PO13 1GKBA 2Z4FA 3M3QA 4QHBA 4QXKA 1AL23 3O0XA 2MPFA 4MX3A 4W6XA 1RUD3 3O1UA 2Q0AA 1QDCA 2W46A 1RXGA 4GQ7A 4YNIA 3SCHA 5BNNC 3WDVA 1JZ4A 3JBG2 1VRBA 1VBE3 1UKGA 2F17A 3MLJA 1J3PA 1RUD2 2J7MA 2XONA 5CFCC 5FZOB 3KCYA 3LE0A 2W5FA 1BHGA 1VBE2 3VV1A 4CCCA 4DS0A 1QXJA 4RD7A 1GNYA 4EE2A 1RUF1 5F7UA 2FDKA 4OVEA 3VZKA 1W99A 2HEWF 3TWIA 3P6BA 1W2TA 4WM8B 1H6XA 4X6RB 3ROUA 3CJIA 4NRQA 3SNMA 1S0DA 4MADA 1QJX3 2X5IB 2VBPA 3POGA 3ZFFB 5KXEA 3JQXA 4Q4Y2 3A23A 1O8PA 1CR7A 3PMEA 4MGZE 3MV01 3LOIA 4LK6A 2AZ5A 1SCSA 2GC1A 5A6XA 5C9AA 3ACIA 1ND2B 3KHBA 5FXXA 2JDAA 3FFZA 5IATA 3FUOA 3NAPA 2WWSA 3AVRA 1W2UA 4FPJA 5A3PA 4HG6B 5L7OC 5FUPA 3WX5A 5BNOB 3LAGA 1S0CA 1WWYA 1BEV2 2DU0A 2RM21 2AENA 1C5HA 1NY71 1H6YA 1AYM3 5DZFA 1W9TA 5BNPB 1OPOA 5I8SA 2PHTA 5L73A 3WG2A 1JN2P 2GMPA 2DF7A 1OA4A 1J59A 1FMD2 1H0BA 1LOFA 2C24A 4CU6A 4LA2A 4OHXA 1VBB2 2VMEA 2JWPA 3B94A 3QCWA 4XXPA 1UYYA 2K9ZA 5LA2A 3ZFFC 4AHZA 4XACA 2VXRA 3ZIWA 3PIJA 4M0HA 2G4IA 2XH6A 3MIBA 1AXZA 1EAH1 4M3CF 1ND3B 1HN1A 1FPN1 1NE6A 1DYKA 4PI2A 3HAGA 1DLLA 1XJAA 4WZCA 1WW6A 5A80A 2WNUB 4Q4V3 3MLLA 1DGWX 4MXVA 1XYOA 1G86A 4K1ZA 5JIUA 1GOFA 5DG1A 2WA4A 2BBVA 2V09A 5FCCA 2A71A 1RB8G 1CQ9A 5BNNB 1XXNA 1AR92 4JHTA 3UJQA 2QZ3A 3OGVA 2AEYA 2V4VA 3O1MA 1GNHA 3W21A 4QPIB 4CXXA 1PO11 2CNAA 1K12A 3RSJA 2ZAAA 2JG8C 5A33A 1TMF3 1Q8SA 1ZRRA 2DTWA 3OG2A 3RI8A 4OUMA 1JW6A 1VRH3 4XMAA 4AYUA 2PFWA 5IVVA 5DMYA 2QQMA 2BEOA 2RS51 3ZPOA 3KV9A 1KJRA 3AKRA 4KG8A 4XVHA 3UV9A 5FZCA 2B9UA 5J3UA 3RI9A 3RZMA 1U5YA 5E1RA 1ZREA 3GNEA 1VBE1 2ZX2A 3BODA 4NRMA 2PN5A 5JOZA 3NNGA 4O65A 1OH3A 1W0NA 2WWJA 3FMGA 3OBZA 2RMU3 1FV2A 5IJRA 4AEJA 1ZZBA 5AVAA 3WW3A 1DHKB 1YQCA 1XBFA 2CDOA 3H8XA 2CGPA 1VAKA 3PJQA 3AK0A 2XLFA 3U75A 1ZYBA 1Y4WA 3AVSA 1PM7A 3SH4A 2W95A 4TXWA 3MFAA 3T0BA 4BCUA 4HK9A 1PNFA 2G19A 4QGMA 4YM3A 4CUBA 1WMXA 5JXHA 4B1MA 2UY9A 1KJLA 2XVGA 3IIAA 3HNBM 3O1SA 4QX8A 2IWGB 2PHXA 5IVJA 4Q5OA 3OPWA 5F6KA 3ZN5A 1C1LA 2BNOA 2VNOA 2VJXA 2VBDA 3SEPA 2O8QA 5JXIA 3ZXEA 1S0FA 3M1HA 1C8M1 1F4HA 3KM5A 4IEXA 2QQPA 3I3EA 5TSWA 2YFUA 5DZGA 4DRRA 1CPMA 1J58A 4MGTA 4LR4A 1O4YA 2WZ8A 3M3IA 4HPKA 5FXVA 5T3NA 1BVVA 3JBG1 2MHFA 4ZZ5A 1DYOA 1RMU3 2A6VA 5FY9A 1W9SA 4LBQD 1G9CA 2WLPA 2ZGMA 1RUG1 3NKTA 4P9LA 4E4SA 5C8WA 5FDBA 1FX5A 4TTGA 1D4VB 2JKBA 4KBZA 1W6QB 1G6NA 4ASLA 5EHDA 5GJ6A 4B1LA 3HD8B 3GM8A 5A3OA 2ZGNA 4XUTA 2VO5A 4Y1UA 3FC0A 2FDHA 1FOD2 2L9LA 3X29B 4IDZA 3PTRB 5C4WB 1JZ5A 2R0FA 1QJY2 5FWEA 1YC61 2VZRA 4X6QB 4ZS3A 5LW9A 2OPKA 2VU9A 3NAPC 1UOGA 3LPFA 4N53B 5FAXA 3V65A 4A7ZA 4R9BA 5BPXA 4FOYA 5K8SA 4GMP1 4BLIA 4N43C 4CP9A 1JU3A 4RL7A 1AL21 4RQPB 3VZOA 2VBBA 4M0NA 1C57A 1NLRA 1XE0A 2WO3A 1QEXA 1WZXA 1NLSA 4NPRA 3DL3A 4K8FA 3RJRA 3T3YA 2VMHA 1OXCA 2QVSB 2C1FA 5AC93 2PELA 4NHYA 3N7MA 1VMFA 4AG4A 1S1AA 2R1BA 1W3XA 1WW7A 3ALQA 4PHZA 4SBVA 5AC92 4M3CB 5KR7A 4XJ9A 2XJRA 1XB9A 3WW2A 4QPIA 1W8HA 2GNDA 4D7SA 3WF3A 1POV1 4B8EA 3MF6A 3USUA 2VZQA 1U5XA 2WZEA 2HEVF 4PLNA 3U4XA 1O6UA 4L2NA 4EYUA 5LBEA 3I3BA 3AYEA 4NHLA 1ENXA 1LESA 4TWTA 1JXNA 4FQ4A 1MVEA 5FIXA 2ZKLA 3U37A 1HRI1 3I2GA 2IC1A 1EUTA 1SDDB 1W6MB 1AJOA 1F31A 2BNMA 4QX0A 5HCBA 1WGPA 4HETA 1QU0A 1QF3A 1CAVB 1LOGA 3BVCA 1UXZA 3CZJA 4AQSA 4NRPA 3W5MA 4QMAA 2J1EA 2D5HA 4MHRA 4YGEA 2C5DA 2JG8A 1LOAA 2RR12 3AP6A 4GULA 3ECQA 4XFCA 3OPTA 3VKFC 3VZNA 1QH7A 1KEXA 1X33A 4UBGA 2RR13 3VL9A 1VR3A 2B42B 5B4XA 1LULA 4HN0A 3OD4A 4MGQA 5FZFA 4XUOA 1JMUB 1R1A2 1TVGA 2JG8B 4IERA 2X53S 1UNBA 1QY4A 5FQ0B 4PDWB 4CTEA 1R092 1TME3 3K3OA 3LB9A 3B9CA 3BALA 5EV7A 1F2NA 5A6QA 1OLMA 1IGOA 5FMOS 2XOMA 2QQNA 1AL0G 3H8RA 1R093 2OUJA 3ZYHA 1SLCA 5FZ4A 4R52A 3WR0A 3ILFA 3ZFGA 2P3YA 4UW3A 3K75B 2YGMA 1K5MA 5FP3A 3ZYPA 4IESA 4RA0A 1UZVA 3JZVA 4HVQA 4L99A 4O61A 2WNUC 2R7EB 5FPUA 2FCUA 4FAGA 2LTNA 1UYPA 4A6SA 2RS33 3OB8A 1UZWA 1X7NA 3EB7A 1C1FA 3M4FA 1AR81 2WABA 4M3CA 3RZGA 3WF0A 4IEVA 5FJKA 5IW0A 3EO6A 3ZMOA 5DPNA 2EIBA 3GALA 3WDXA 3VBUA 5G04L 2FBEA 2VM9A 1POQA 1V0AA 3J8F1 3Q8BA 1NA1C 3LA7A 4IEYA 2LALA 4MV2A 1IG3A 4UW5A 1CAWB 5LBFA 3OBRA 2F6BA 1ULCA 1PO23 5LEKA 1W04A 4Z07A 4XQ4A 3S30A 3KZ4C 2UYAA 4CU9A 1OQEA 5J09A 3C2UA 1AHSA 5F5QA 3RYRA 4BQ5A 1PK6A 4N53A 4FPLA 5H9QA 3GBGA 5A7NA 1AF9A 1ND2A 1ND2C 1OMIA 1NUKA 3NO8A 4HVRA 1CZVA 1QXRA 1IS5A 1YUDA 2ZJCA 4NROA 4QD2A 4Y5SA 5EQUA 3VB9A 1LJ7A 1ALYA 1UOBA 2PTMA 2RV9A 2UWCA 4AEDC 3D8CA 1QJY1 1HX6A 3AP7A 3CF6E 3R4UA 2EAKA 4LPLA 1PO12 4O7XA 4BOWA 4EN6B 4V2VA 2GC3A 3O1RA 1VJ2A 4WM8C 1QJZA 4Q1RA 4I09A 1DYPA 2WAAA 4RS5B 5BYNA 5FQ0A 1PIV3 1VBD2 1WA4A 2NM1A 1JYNA 2FCVA 3DECA 3T2OA 3H8OA 3ATGA 1PGL2 3B3QE 4NE9A 4TLGA 3VKNA 1RUG2 3S57A 4Q0QA 3OUIA 5IFTA 2ARCA 3USUB 1ND3A 5FYSA 3QBQA 3IIIA 1UZYA 4CXWA 1VPHA 5FY0A 4LHLA 1W2NA 1WCSA 3MDPA 5A7WB 2WO2A 2W08A 2X29A 3Q8EA 3FBYA 1QJX2 2BWAA 2DCYA 3POFA 2BVVA 1EPWA 4OUSA 5A6YA 5JWPA 3F95A 1X8EA 1J1TA 1QMJA 2VQ0A 5FBJA 2FDGA 1RUE1 2FMDA 4AVBA 5F3GA 4UWDA 4XF0A 4S2FA 5C6CA 5LBBA 4BDVB 2VZSA 3AYDA 3T2QA 2PHRA 3RYKA 4XEZA 5CFCA 2HWF3 2YDEA 2YUEA 1UPSA 3KV6A 3I2OA 1RC6A 3WVJA 1N3QA 4HKLA 4YGBA 4XIOA 4R8HA 2VXJA 4LMFA 3OEBA 1V6KA 4TN7A 4CEYC 1DQ0A 2RS31 3LOBA 2JEMA 1AYM2 2A70A 2V4AA 1AYN2 5JOYA 1UZZA 2HYXA 3POWA 2WA3A 3CU7A 4Y1YA 4PDWA 4XFFA 2E33A 5BY5A 1OF4A 1O4ZA 3POSA 2ZX4A 3OY8A 5IVEA 4OMCA 4C90A 5EP9A 1X50A 1NXD1 1RUC2 1RUF2 3WW1A 4BQ3A 3PJYA 2WSVA 2CYFA 4OZOA 4DXZA 1RUC3 2ATFA 3AYCA 3NNFA 4H7LA 5T5OA 1MQTB 3L2YA 3R05A 4Q4V2 4BIOA 2PMWB 2JG9B 1RHI2 4D6QA 1JUIA 3VD7A 3NV2A 2H6CA 2VE1A 4HXCA 1CAXA 1YLLA 2Y38A 4S2HA 4CCJA 1CAWA 3A21A 1LGBA 4Q4X3 2J1VA 2ZGQA 3JUUA 1H8VA 3W58A 3WP3A 4Z8BA 1S0JA 1ACCA 3E1F1 2ERFA 3TBDA 4HLTA 2ZHLA 4MZUA 2E63A 1H8TB 3AL6A 1CJDA 1QJEA 1QQP3 5HI0A 4Z1VA 4XW3A 4FPEA 4JRLA 2J1TA 4JX0A 4YFWA 4BZ4A 3R6SA 3MIGA 3WNKA 2PYTA 4P5YA 5DN2A 1W0PA 3P5BA 4K9SA 1RL3A 3WDYA 1PGL1 4QU2A 5BNOC 5BNOA 2E26A 2FCTA 3LPGA 3LSDA 1GV9A 2BDRA 3MF9A 4A3XA 4FFFA 2ARAA 2VW2A 2ZHKA 1DBNA 3N7KA 4N8MA 4AQTA 4IEUA 1W8FA 2C0ZA 4A42A 1OFNA 4AAPA 1OURA 5JI7A 4CU7A 3BTYA 1QKQA 3H8UA 2JICA 5FO7B 3UK9A 3H42B 3ABZA 5F3CA 1G9FA 5JAXA 2BOIA 4PIZA 3I3DA 3LKJA 1MPXA 3TAYA 4JGYC 1LR5A 4JQTA 1YRZA 4I3PA 2XG3A 4LO4B 2Q4SA 3PUHA 2ES3A 3T0DA 4YW5A 1KS4A 3LQCA 2IXKA 3JB8A 2ARBA 4ZXEA 2P1BA 4ASKA 3MW4A 3P3PA 1MQTC 1XE7A 1SLLA 4ZU5A 3Q8CA 4IE5A 1ZZ6A 2YZ4A 2VPVA 4UYBA 4MGSA 1OPMA 3VBSC 3DXUA 1AL22 4Y4RA 5A1LA 2ZMKA 4F7ZA 1JZ6A 4NIHA 2VR4A 1V6JA 1W6OA 1S2EA 4CDWB 3O1TA 2HJIA 4LBQA 5F8PA 4OI2A 4F3JA 4OI0A 2VUCA 3KQ4B 2ZGSA 1UMIA 3KLSA 3W5NA 1SLBA 1F5JA 1OKOA 2QQLA 3IMMA 2CTVA 4XETA 2RDRA 4JCKA 1RUI1 3T1MA 5CZKA 1X36A 1CZSA 1N3PA 3GDBA 4RGGA 1W8UA 5CU1A 1GUIA 1QJY3 4UI9L 4L11A 3RS6A 5CBLA 3KD4A 2XJVA 1BMV1 1PM4A 2YY1A 2R32A 4WVMB 1CONA 3RWKX 2HH9A 2RDSA 4XUQA 4CP9B 3BPSA 2BGPA 1XQNA 4Y24A 3FWEA 5FPBA 3IDCB 4XCBA 4CCKA 4Q4X1 4XFIA 2W68A 3B93A 1Y43B 2O14A 3L2HA 4IEPA 4NIAA 3GJBA 3TNQA 3FZ3A 4QPGC 5LRRA 1WBLA 3VD9A 3HN3A 2DCKA 2ADEA 3PVNA 4AVVA 4EQVA 2VH9A 1ULPA 2BFUS 4CDQB 4JZRA 4XJAA 2E7TA 2ENRA 1QOTA 4LOSA 2WZPP 1BEV3 4GKYA 4Q29A 4HKWA 1PMJX 1YFXA 2W1WA 3JD73 5DAWA 4EWEA 1IHMA 4K7JA 4MXWA 1BBT2 4URTA 5DXDA 5HV0A 2J1SA 2PAMA 1US3A 2G9GA 4EROA 4URAA 5GM0A 1RYYA 2VOWA 4JKMA 1UY4A 4XDOA 4RHV1 1G7YA 1RUE2 2BTVC 3WINE 3C7OA 5JI9A 1XNDA 2R041 4OCTA 1PVC3 1YNAA 3LEMA 4PIXA 3S5QA 4COZA 5FZ3A 4AEDB 3WQBA 2AR6A 3N3HA 4FPCA 4WVVA 1A34A 4P9YA 4CCLA 5KWRA 3I2IA 4QHZA 4RHV3 1RITA 3FHQA 1U12A 2DVFA 1W03A 4LKDA 1WW5A 1XPWA 2IXIA 2QE3A 4IEWA 3ZFGB 2BFUL 5JZGB 2C6SA 4FPOB 3ZPYA 2AUYA 5E16A 4BQXA 3RZKA 2DBNA 1LHNA 3U0ZA 2LROA 4YW4A 2CWSA 1VP6A 2BWCA 4FT8A 1UY3A 1NCQB 3RFRA 2A3YA 4MO3M 3E5XA 4AE2A 2DCJA 4DFSA 4GMP0 1AX0A 4CP2A 1GNZA 3INAA 4C0BA 1LRHA 1TME2 3POJA 2I07B 4XF3A 1NCQA 3T2PA 2QQJA 4XBNA 4D7YA 4Q4W3 3ILRA 1MACA 4LUMA 3OGGA 2WQZC 3AJYA 4BA6A 3EHKA 3OD0A 3NKGA 2FHRA 4QHOA 3U11A 5JDBA 1UIJA 3ZYBA 3QH7A 5LA1A 1AUYA 2A6YA 3GCXA 2WT2A 2RS32 1UXXX 4IE4A 1FPN3 4QX7A 4XFHA 3VBOC 3OTFA 3DKWA 3GZAA 2MEV1 3LWCA 4I0AA 4OUEA 3PVEA 3KT7A 4JQRA 4UFKA 1RUOA 4XFAA 4OULA 2DVGA 2VUJA 4GZ9A 3AZZA 4QKFA 4XFBA 4BYYA 4EN0A 4EWDA 5KHIA 1HB3A 4ZONA 1JYCA 3WP6A 4AFCA 2ZGUA 2B8MA 4WVMA 2TBVA 5A3LA 5JOXA 1HXS2 1NKGA 1H1MA 1S0GA 2CGNA 2VUAA 3GYDA 4ZU7A 4CEWC 1N1SA 1NYWA 3PUSA 3W20A 4ES8A 3JXSA 4P9WA 1PK6C 1FAYA 3MUZ1 1TNRA 3H7YA 4QB1A 5FZBA 3VBFA 3VBFC 2P34A 2G9FA 2WNUA 5KHHA 1RUI3 4XXAA 1DQ6A 1RMU2 4Z92B 4XABA 1TMF1 2VY0A 5FPAA 5C9AC 4MGKE 3BTAA 4QWNA 4E8CA 2RG4A 3VZJA 5JR7B 3MW2A 3FLRA 4H14A 3KVBA 2GP3A 3HR9A 1FOD3 2DURA 2EALA 4BXFA 4IXLA 4YARA 4DUXA 3VBHC 2Y0IA 3PU8A 3LEKA 1IKPA 1R64A 2Q5TA 4CCDA 2X10A 1BK0A 1LOBA 4NPLA 5A7SA 1Y9QA 4AGRA 4LBOA 5DAVA 4PQQA 1ENRA 1OH4A 5KHGA 3JU9A 4A2UA 2ZX1A 3ACHA 1GP6A 4KWKA 3P1IA 3I7DA 1YIPA 1RUG3 4AEDA 4GH4B 1APNA 3S7EA 1YFYA 2VW1A 1V6IA 2FZ1A 4C1XA 1SDWA 4EN9B 1QNYA 3NNJA 4N9IA 1LU2A 3WY6A 5JZGA 1CX1A 3ZYJB 1FT9A 5BV6A 3LEGA 3TB0A 4QQ2A 2ZA9A 3EQEA 3U14A 2R6QA 4MXWB 4E2GA 4Z2WA 1BK1A 2DDUA 2EXHA 2WS93 2Y6KA 2Y6JA 3MIFA 4DEQA 2Y60A 4HL0A 1GYKA 4XZPA 5LBCA 2WIIB 3ZXJA 1I5PA 5LY1A 2I2SA 3AMMA 1CIYA 2WS92 2XLAA 3KCCA 2GU9A 1OD5A 4ARXA 4AAXA 1XOYA 2GZWA 3HT2A 5FZ6A 4MVTA 4XE9A 3BB6A 2JE8A 4IV3C 3PUIA 1VALA 4WV8A 3PTYA 1V9U3 4ZU4A 3A0KA 1XNTA 2F4LA 2XGXA 5AFEA 4KQ7A 1DCSA 4E4DX 2RJ2A 1W2AX 1DQ4A 2OIIA 5F5CA 3S7IA 4AQ6A 3DPRC 3LSEA 2ADDA 2XUMA 4QXCA 2RDNA 1GOGA 1UY0A 4GIQA 4YVSB 1QH6A 1A8DA 3I59A 4DNYA 1RUF3 2W52A 2JE7A 5J7MA 3I3MA 3VZMA 4CDXC 4FOVA 4DXRA 3C7FA 2X05A 4MHUA 4XBLA 1QJX1 1PX4A 1OC1A 3AJZA 1GP5A 1AX1A 1QJU2 1W9YA 4CDUB 1C5IA 2FZ2A 1FNYA 2TEPA 1HJFA 4NJ4A 3AZYA 1SLIA 2D3SA 3ENRA 5M0TA 2HWB1 1WCKA 4QX2A 3WQ1A 2H6BA 2NMNA 2Y0OA 3V0AA 2YG0A 3KB5A 1JTZX 4FO9A 1YQ6A 2XDVA 3U4SA 4LOTA 4P9XA 4PI0A 2H0VA 2IXLA 3EXUA 4QX5A 5FY1A 2YC4A 4CDXA 3TEYA 2UWBA 4OYUA 3WXPA 2ZMNA 3VBUC 1NY72 3OOXA 5IYYA 1VBC1 1WLCA 2G9ZA 2IXJA 1UOJA 1CN1A 3MO4A 3DUIA 1IG0A 2MEV2 4U36A 1A6CA 4HBNA 3ZXFA 3OJBA 4HN1A 2P5BA 4FVVA 1HRI3 3ZR5A 2YU1A 1F5FA 2NLRA 4X8PA 2ZGTA 4K20A 4AVCA 2V5DA 3K51A 1LOCA 5FLJA 3DXTA 5EJ1B 1D2SA 1SMVA 4J6GA 1OHFA 4Y1XA 4XBQA 5D8AA 3H3UA 3RG0A 4S2GA 4FXGB 5KXBA 1VB2A 2VQUA 4KU8A 4Q0UA 3B5LB 2HWC2 4M01A 4O9GA 4CDWC 1PO22 1LEMA 3H50A 5E89A 2PQSA 3TOJA 2QQVA 1RUH2 1H2LA 2ZCWA 4BQ1A 2R16A 4HSJA 4CU8A 5IUQA 5FOBB 5BNNA 5IWFA 3SKJE 2ZHMA 1FV3A 3R4SA 1UY2A 3MZHA 2QCSB 1Y7BA 2VGDA 5K0UB 5JSRA 1UMZA 2XBO3 4QXBA 3GBWA 2RJKA 3J7NA 1GQPA 1YQ2A 2OX0A 5E8AA 1POV0 2VZ1A 2A3XA 4GMP3 1ND3C 3NWKA 5CIRA 2PHFA 5FMCA 1QQP1 2JDHA 1LHUA 1NCRB 3ZYGA 5EPAA 1SQ4A 1ULGA 2ORZA 5C71A 3RDIA 3PL0A 1PIV2 1VBD3 2EVXA 5IHRA 4Z82A 4IV1C 3VGIA 4PCRA 2WO7A 4CDUA 1B35B 3PHMA 5ISLA 2VZPA 4E2SA 1CESA 5FPVA 2JB8A 4JV4A 2VECA 4PLMA 1JHJA 3AKSA 2J1RA 4XJ8A 5L7OB 4XTMA 4NVPA 1IS3A 2PLV2 2A3WA 3FN9A 1JZ2A 2AYHA 1YO8A 2AH2A 1H4HA 3T1LA 4WVZA 3LF7A 1EP0A 4OI1A 1LOEA 4GD4A 2P3IA 3VN4A 4IV3A 4IV1B 1H8TC 3ZSJA 1AXKA 3D0JA 2X5IC 3R4DB 4JDOA 1JYIA 1C8NA 4K6BA 3IAQA 5DABA 3HMYA 2WR9A 1MS4A 5KC5A 2LS6A 4ZKTB 4B7KA 1DU3D 2WN2A 2VCAA 1QWRA 5FZEA 1Q8QA 2OS2A 1J3RA 2KXLA 3MEPA 4HVOA 4Z2AA 2YB7A 3JD72 4DPNA 3WP5A 5CFCB 4UXAA 3UT0A 1UF2C 2YPJA 3HT1A 4BMEA 5IK8A 2EA7A 1JYWA 4AZZA 5LATA 3M3EA 3S0MA 2VTXJ 3RRDA 1RUE3 1GBGA 4A4AA 2ORXA 3POIA 4BQ2A 1LODA 1O59A 4QPYA 2EXJA 4YW3A 3ZKYA 4N90A 3VHNA 4Q1PA 4RN5A 5FREA 1HKDA 2ZGRA 3RZZA 3JCIA 2IVIB 1XNCA 2HWB3 1V6OA 5GLTA 1UZ0A 4PT6A 2WJSA 4NAMA 1AR61 4KGQA 5JPMB 5K9YA 2NP0A 5EIYB 5J36A 3CQOA 3SKVA 5JR2A 1CAUB 2E31A 2JIGA 1W8ZA 1CIWA 3EBRA 4CRQA 4UFJA 1E57A 5FPZA 1OFSA 1RUJ1 2IVJA 4NWVA 4AQ2A 4JHZA 1XC6A 1GZWA 3KQRA 3FHAA 5LB6A 3SITA 3MPPG 4D0QA 4RR3C 2E51A 4N9HA 4QM8A 5LWBA 1VBC2 5EFUA 2BRTA 5F5AA 4IEZA 3WHTA 4AOCA 1QQP2 3H1YA 3DCQA 1VBA1 5CVRA 5L9BA 1S4CA 2VQAA 2HWD2 5C7GA 2IFWA 4XF1A 3ZXDA 2Q1FA 1LB2A 2VMIA 2PHUA 2WO1A 3IKWA 3NV3A 5KXDA 2GMMA 1KQRA 4GWMA 1IZ3A 4MLOA 5FZKA 3I2HA 4A45A 1HIXA 4P08A 3IAPA 2JB4A 2OZ6A 2Y6GA 3D3AA 1QHDA 4XC9A 1V00A 4ZPIA 1ZRIA 1W05A 3HNMA 4M00A 3VHOA 5ANQA 3ZXAC 4FPYA 1WBFA 2HEYF 4AEKA 4B29A 5C5UA 4KWUA 4A6OA 3MPBA 1W6PB 3AMQA 3VDDA 4NIDA 2WT1A 2PAKA 1GMMA 3KF3A 4G9SB 3CHXA 3S6PA 3WCRA 3HOBA 2XKPA 2W1UA 1ONAA 4XF4A 1TG7A 4MSVA 5A1AA 5LCWL 3DYPA 1K5MC 2AACA 3RYPA 3WDWA 3VHPA 1HXS3 3ZKUA 4DY3A 1CWPA 4EN7B 1O3TA 4FTBA 4JAAA 2D97A 4RFRB 3T2TA 3ZMNA 4ONUA 4ET7A 4YW7A 5A3NA 4I2OA 1NCRA 4PBPA 1TME1 5FY8A 3ZFEB 3IBMA 3VBRC 3VBRA 4IGOA 4EWAA 4PJYA 3WQ7A 5K7PA 3BPZA 1LECA 3HPNA 5DZEA 3SCGA 1FNZA 5FY7A 4J1WA 3VD4A 4MG2A 1PZ8A 4ATFA 1M4WA 3AKQA 3SQOA 3M3OA 3PU3A 1O5LA 5FYBA 1CGPA 1YQ5A 1NA1B 2W91A 2XJUA 3GZTB 3VHRA 5CFDC 5LEJA 4P00B 2CAUA 3SXWA 1AXYA 3ZSEA 2AEZA 1FYUA 1JOJA 4DMIA 4HANA 5C8CB 2VCBA 4FPHA 2Q1ZB 3CKHA 1UY1A 3IDAA 3AP4A 4BQYA 1E5RA 4XF9A 1W9WA 3NV1A 4CPBD 1AR62 3CJIB 3LA2A 3GJAA 3ME2A 2RJLA 4LLFA 3FUQA 4QX1A 2A73B 2D3RA 4DB5A 2WFF1 4I30A 2OZJA 5KBFA 5FZIA 3SH5A 1AR63 4NHXA 2VUDA 1W8WA 3G7DA 2VMDA 3VUOA 2FQPA 5FZ1A 2WNVB 4KWJA 5FP8A 3O7OA 1ZZ7A 1AYN1 3BIWE 3DYOA 3OYWA 1RINA 2Z5WA 1O4TA 5FWJA 3VD5A 2VZ3A 1GP4A 2WAOA 1JOBA 3RWNA 1O7FA 1H9WA 4RYDA 3L9JT 4PDWC 2D93A 3WG3A 2CU5A 3VDBA 3CBNA 4Q4W1 1V70A 2QFEA 5LASA 5KHJA 3NNMA 3POYA 4Q2FA 3RQ0A 4D94A 4LT5A 3V0AB 1FXZA 3NL1A 3URFA 1SLTA 4HKOA 5FRAA 1GQHA 2W0XA 3B01A 4IGPA 1ODMA 3GHMA 5FZ8A 3VBFB 1O8SA 2VQTA 2ZGLA 4IE6A 3A4UA 4GALA 1FATA 3RMXA 5CEHA 1PVC2 4XPVA 1Q8OA 1QJU1 4H55A 1VLNA 1Y9MA 3B7MA 4LBLA 2P17A 2R061 5E88A 2BV4A 3IZOA 4RGAA 5ERLA 4B4PA 5DUXA 1D0GA 1PMIA 2YC0A 3FJSA 4Y4YA 3JD71 4XUNA 3TYJA 3P3NA 2A1XA 1QIQA 1SCRA 5FZGA 2WL1A 4ITCA 5A32A 4QT6A 5C3QA 2DFBA 2N7GA 2QQOA 4YYOA 1GANA 2EXKA 1VBA3 4LNVA 1MEC2 5JUVA 4GAZA 1YFWA 1CX4A 1BXHA 1LTEA 2BZDA 4OHYA 3SEEA 1VBA2 4KMQA 3EYPA 4IQPA 2E7AA 2WWUA 4I0BA 5FZDA 3JB4C 2W9XA 4AI2A 4XJWA 1DLCA 1XNBA 3WUCA 1YQ8A 3H3ZA 1URXA 3A0NA 2R1DA 1V6MA 2ZMLA 4XFGA 5DAXA 3UESA 2CDPA 2GH2A 2UURA 1VAVA 4YPJA 2YV8A 3I8TA 3N9NA 3AXDA 4K1YA 5C8CC 2VNRA 5CKQA 2VULA 4XAAA 3ES1A 4XILA 2BERA 4UBHA 1G9AA 5CISA 3OSDA 1H4GA 2Y34A 4QQPA 3ACGA 5HPOA 2KR2A 2Q8CA 1SG3A 1PVXA 4P5HA 4FPGA 4LO8A 1AR73 4JGYA 1C8M3 2FDJA 5CAZA 1JOPA 1Q56A 4YG0A 3RJ2X 4LE3A 4GWNA 4UW4A 1YXWA 1V6NA 2UYBA 2JKXA 1DP0A 4I0WB 4TSVA 1LHOA 5SV8A 4RSUA 3ORJA 5D8AC 1UD1A 2WYFA 1SPPA 2QNKA 2ZEZA 2KM2A 1XNAA 3R0RA 4EZHA 2XJQA 2ZGOA 1DGRA 1JH5A 1NA1A 3K3NA 5AC91 3ST7A 5EJZB 1WMEA 1UOFA 4KH9A 4CSWA 1L3JA 3E5UA 1QXPA 1REEA 3U07A 1EV13 4XCAA 4Y20A 3KSCA 4BWOA 4TYSA 5C3OA 1P8JA 3I97A 3IT8A 4FQZA 5A6ZA 5BUVA 1RUI2 3T08A 1JYVA 1I5ZA 1HB2A 5L9VA 5FPXA 2EF6A 1Q8VA 2VZTA 4GH4C 4BH9A 3DGTA 1Q43A 5FZ7A 1ST8A 2EXIA 2XB6C 4QPGA 4EV0A 4M4PA 2V5YA 1UU4A 3HBKA 2A6XA 5LY2A 1D4M3 2P3JA 1PX3A 1DGLA 4D8MA 5JPNB 2WLQA 5LA9A 2Z79A 2YGLA 1ULFA 3AM2A 4GJZA 5F37A 1MZ6A 5A33B 2B4KA 5C5TA 4K21A 5I0TA 3HN1A 1IOAA 1GR3A 1MS5A 1TNFA 3DN7A 5FYZA 5DQ0A 3ZN6B 5C4WA 4DXSA 1GU3A 1MS1A 4MOAA 1NZIA 2YROA 2ZTNA 2D40A 4OFGA 4UOJA 1HV1A 1MQTA 1VBD1 2LUWA 3RMYA 4K3UA 4XMIA 3CJXA 3VKOA 2FD8A 4LULA 1HQNA 4LORA 1HRV3 2D43A 1OOPC 5GZDA 1PIV1 2XXZA 1PNGA 3E5QA 4GWIA 3ZYIB 1EPZA 5FXZA 2BPA2 2JDNA 3ZR6A 3UKNA 3RGBA 4W6WA 1ZNPA 1OQ1A 2MNGA 4UT5A 1KITA 4LBJA 1WLDA 1W39A 3ES4A 4DZGA 2YU2A 3B69A 1UO9A 3MIDA 1Z0HA 4AEMA 2IXCA 1WA6X 2RMU1 2XQXA 4QAWA 4DOUA 4LK7A 2WNVA 1AYN3 4XUPA 1O3SA 2RS13 5FK8A 4AHWA 1F9KA 2PXJA 5DUUA 4CZSA 3J9SA 2C9KA 3OYWB 4NHMA 5EZWA 4IEOA 5L9RA 3ZLIA 2A5ZA 2E6VA 5A3MA 1DGWA 2D98A 4OQ8A 3I2KA 2RS12 3ZVXA 2Y8KA 4I3GA 4AI0A 3CJIC 5JCTA 4LO6B 1KFUL 5EYYA 4XZUG 3E6DA 3E97A 3UKVA 3SLIA 2ZEWA 3ZYRA 1Z78A 2BJSA 2VVDA 4RFT0 4BHPA 4LKEA 5JSOA 5GLZA 4QQHA 1LGNA 2VNVA 4LIUA 1ENQA 3ZFFA 2WZR3 4Q8KA 3BCWA 1W3VA 4R4ZA 3J26N 2R30A 3OUHA 2PLV1 2ZXQA 5FOJB 3WF4A 1HN0A 1TQ5A 2RE9A 2CAVA 5FR3A 1QJFA 4QQLA 3SMHA 5BNPC 2JIJA 1NCQC 1WCDJ 1ZA4A 4Q4X2 1SHWB 4UFIA 3ZIXA 1QJU3 5GLWA 2P6HA 3KT1A 2R042 1XU2A 3LIGA 2J1AA 1XSQA 2GMEA 3FLPA 2YC2A 3VDDB 2HWE3 2TNFA 3K48A 4HZFA 2VTXA 2Q30A 2HBTA 2CSGA 2JXAA 4OQ9A 1F4AA 1K45A 3ACLA 4CUCA 2FMYA 4COYA 4F8AA 4DIQA 5CKNA 1NXMA 4HMZA 1K5MB 1OLQA 4FCAA 1C3HA 4K8RB 5DUVA 1QGLA 1W8NA 2QQWA 2HWF1 5T54A 2D6MA 4L92A 3KGLA 1RUJ3 3KT4A 3IMNA 1UMHA 1UX6A 5IAXA 1VE0A 2OUHA 2MEV3 3B00A 4QDRA 4YM0A 2W1SA 3M8LA 4RQPA 4RR3A 1ASJ2 5F6LB 2ZHNA 4BE3A 5HCAA 4NIIA 4DO0A 1OLRA 3AKPA 3ITQA 1OF3A 4X8NA 4YVWB 3GXUA 4PBOA 4Q0VA 3V64A 1OT5A 3BOPA 1W6PA 5EJ3A 3WOGA 2VVEA 1CVNA 1HB1A 1RJ7A 1RIRA 2XUEA 2BBAA 5ACA2 5FLIA 4CP1A 4NO4A 4QPWA 2VNGA 1AR71 1RUH3 2JDPA 1C4RA 2QQUA 4CCOA 1T6BX 4QPGB 4NWWA 3I2JA 5J48A 1NE4A 3WNMA 3GZUC 3D5OA 2VC9A 1MS3A 4FOQA 2ET7A 1GSLA 1O3RA 1K42A 1J3QA 1GWMA 2DWRA 1GZTA 2BQPA 1DZTA 4UFHA 1X9TA 2BU9A 3S5AA 1OOPB 4WM7A 4EJRA 4LKFA 3IPVA 3LEIA 5I0SA 1PHMA 2JDMA 1IPJA 1DQ5A 3IDEA 3PNAA 2XHNA 3N9LA 3MYXA 2EAAA 1S55A 3GGLA 2WUHA 5FYIA 1K3IA 3UL2A 3F2ZA 4ASMB 1X9PA 4HOOA 2ZS6B 2YYOA 4A7YA 5CB7A 3ZFEA 3T09A 2YBKA 4NAOA 4DUVA 1ULEA 1OUXA 4XJUA 3AP9A 1BVP1 3PIGA 5GZEA 2X8KA 3VBSB 3WUDA 4AVTA 3CMGA 4LTAA 1W2OA 2PLV3 4LITA 1TEIA 5F39A 1FOD1 5FMOL 3VL8A 1Z7S3 1LCLA 3IDBB 5T50A 2AREA 4GB33 3WD5A 1AZDA 3UYJA 4BQWA 5FMBA 3N9QA 2OQ6A 1G8WA 1LU1A 1OQDA 2XJPA 1XYPA 2JDYA 4MYEA 4AF9A 4MUVA 4JGZC 1XRUA 4N43A 4LIVA 1MS8A 2XWJB 1VMHA 3C8XA 3BUCA 3B9IA 3U1XA 1MVQA 2XHKA 2XL7A 5A1FA 2QZ2A 3DPRB 2SBAA 3EJKA 3ZO0B 2BVBA 3VKLA 3NSTA 2YBPA 3AXEA 3N35A 3QH6A 4LEJA 3UGFA 1LOFC 1RUC1 2XR4A 5FY5A 3OUJA 5C3PA 3ELNA 2BP6A 5DDJ2 3C3VA 3ZSKA 1ASJ1 5SV5A 1J84A 3THTA 4Y1VA 1ODNA 4INDA 5CYYA 1COV1 5EWSA 2BYVE 2J42A 4JGZA 3WNNA 5FLHA 3TEXA 4YZ1A 3ZDSA 1D2QA 2HBUA 3NJYA 2W1QA 2W87A 1US2A 4HONA 1E5IA 4DY5A 3LZZA 4LUKA 4RHV2 1UYZA 3E6CC 3MICA 4W6YA 3VDCA 5HXMA 4LA3A 2CHHA 4YG3A 4I01A 2HWB2 3KV4A 3N36A 4QDSA 4QB6A 4NIGA 2QDRA 3FBMA 1DQ2A 4A44A 3AKTA 1YI7A 4YZ2A 2VW0A 1STMA 3K46A 3NJVA 3O5SA 5CA6A 4W8JA 2ZOEB 5F1RA 5I8TA 3W9AA 2VMFA 4AR2A 4P14A 2K2SA 2V72A 5FYMA 3VLBB 3WW4A 2WINB 1W6OB 4CDWA 5IFPA 4FSJA 2A6WA 4QX3A 3N7LA 2OW4A 2JJ6A 2XL9A 3MGUA 5HBAA 1R082 4AFDA 1OKQA 2D6NA 3AC0A 1KD7A 2YMZA 1VRH2 3H1WA 1WW4A 3HQRA 3J7HA 3O0VA 1WMDA 3OF1A 4XJZA 5DG2A 4D3WA 3TRSB 1VMJA 4YZ4A 5BNPA 2P2KA 3GCWA 2BW8A 2HKXA 2YHJA 3MUY1 3AMHA 5IT6A 4BISA 1W6MA 4B3NA 1JZ3A 2RMU2 2QKDA 4CEWA 5C33A 1FPN2 5C9AB 4EZ4A 3USSA 3AYAA 1AR72 4YM1A 3BU7A 1EV11 4ATEA 2RDQA 3UGGA 5LK7B 5GKAC 1I6XA 1YI9A 2VG9A 5DAQA 5H9PA 5BNQA 3BN6A 3A22A 4QQOA 5LRSA 3O1OA 4V2WA 3KVAA 2D6PA 2Y6HA 5LK5A 1AR83 1OLME 1XE8A 1OBNA 1CAVA 3Q9OA 4SLIA 3ZX7A 2A75A 2VOKA 1HDKA 2QUOA 1YWKA 4PIYA 2RM23 3ETPA 1RUNA 2E7QA 5I91A 4CUGA 2QQKA 4E4ZA 5I0RA 1NOVA 5A7OA 2JE9A 3ZDVA 5JMOA 2EIGA 2NQYA 2PHDA 3AFGA 2VVFA 3H3LA 1LNSA 4GH4A 4XHXA 3VBOB 2JDUA 1IQAA 4R4XA 2YPDA 3PUAA 1YIFA 3DV8A 4CDUC 4UFLA 2GNTA 5B4NA 3KGZA 4WBBA 1W8OA 2RS52 3M3CA 1R091 3OBTA 4WVWA 4BLJA 5JOWA 2PHLA 2CGOA 1YYNA 3ACFA 3BOWA 3SH3A 1N1TA 5A3TA 5F3IA 1ZZCA 2IXHA 3K2OA 1S0BA 4B4QA 3GHNA 4FFHA 1QOOA 4LQRA 1HB4A 2ZX3A 1GZ9A 2QQIA 1I9RA 2JD9A 5GZCA 2WRAA 1OD3A 2VOXA 2OT7A 1L7QA 4JVAA 1LHWA 3IM0A 5CFDB 2WDBA 4Y5TA 1G9DA 1KXGA 5ANNA 4N43B 1NQDA 3SHRA 5D8AB 5F2SA 4N53C 1KDKA 2Z69A 1S0EA 3J8F3 3ZXGA 1VBB1 4NUBA 2A6ZA 4UF0B 3WNPA 3MIEA 3ZFEC 1HRV2 4A7KA 1RUH1 5C4WC 5FMDA 5JZGC 3WNXA 4CVUA 1ZVFA 1O3QA 1EAH2 1IS4A 1HXS1 2D7FA 4TZDA 3PUQA 5DDJ1 1NG0A 1U5ZA 4D69A 3RZHA 4E4HA 1A3KA 4LBKA 1QOSA 1GLHA 3HJRA 4HSLA 4BU2A 1NZCA 2XKOA 2JDKA 1OVSA 3BU0A 2DVBA 2XJSA 4IGQA 2FDFA 5JVVA 1MZ5A 1V9U2 2ZEYA 2C26A 4R9DA 1NX9A 2ID4A 3OGRA 3NJXA 1E5SA 2I45A 3TEZA 3LDBA 1HQWA 1LENA 1WUVA 2BUKA 2J1UA 3G6JB 5FPLA 1C28A 4M4RA 4R9AA 5FO9B 5F32A 3LGRA 3ZSLA 4DQAA 5H9RA 5APAA 2CY6A 1AJKA 4FTSA 4KG0A 2C4XA 4YVWA 3O0WA 2HWD1 4JDMA 5FKBA 5A7QA 2FDIA 4C1WA 1J1LA 5IK5A 1SACA 1H2MA 3WDUA 4YM2A 5A32B 4QU1A 4AI3A 5I93A 3T30A 4L8QA 4LO5B 4KBBA 4C8DA 5JXJA 5JXGA 3AL5A 4RR3B 3ETQA 4B7EA 1KS5A 4O9EA 1NLQA 5FYUA 4YGCA 3NNLA 2P6CA 4B4RA 1GFF2 5EXOA 1REFA 2VZUA 3N9PA 5A70A 5FYYA 1YJLA 3I49A 4COVA 2Z42A 1S2BA 4XDQA 1UKRA 4QGLA 3VBOA 4CEWB 4AFAA 5HCHA 5IVFA 4BB3A 5JMCA 3D6EA 3QLQA 4DUWA 3B02A 2NN8A 1IQDC 5CKMA 4XURA 4UFMA 1HRI2 1KDMA 2RS11 1SZBA 3DKQA 4Y26A 1CD3G 1C8M2 1OVPA 5FZHA 4R9CA 1B35A 5A3UA 2W3JA 1WD3A 2WT0A 1ZRDA 4H3WA 1AX2A 1UPIA 2C9AA 1DIWA 2GALA 2OQ7A 2Y33A 1BJQA 3WG4A 4DXTA 3K77A 4DRVA 1OI6A 4LHKA 2H0BA 3OY8B 1Y3TA 1HRV1 3KF5A 5FYTA 1RMU1 3U10A 3ZN4A 1ZBA2 2VMGA 3I2FA 3LFMA 2ZEXA 3D82A 4ZXKA 4A3ZA 4IEQA 1EV12 1K5JA 2QTWB 4JDNA 1BQPA 3I3QA 1LAJA 1RVF1 4BJ0A 5C3RA 3WCSA 4D7TA 3J4UH 5CADA 1DF0A 5K4LA 3T0AA 3KV5A 4AFBA 2ZZJA 4G3YC 4RQPC 4AGVA 4BMBA 3ZSMA 2HWE1 1DGRN 1ZBE2 1NT0A 4L0PA 3VBSA 2EIEA 1D4M2 4NR1A 4YG6A 4NHKA 3C7HA 4FP3A 3WQ0A 2VCCA 2RVAA 2WFF2 3VBRB 5FP9A 1ZZ9A 1UW8A 3MLKA 4JTNA 3UGHA 4AHYA 3LIHA 1B09A 1W8TA 1Z7S1 3JBG3 4S2DA 5LZ6A 3K4DA 2PAEA 1UN1A 1UAIA 3C7GA 4YGDA 2D6KA 5C3SA 4KU7A 3WF2A 2UY8A 2RR11 2ZX0A 1JODA 3PLQA 4Q4V1 5IAVA 5J1XA 1SBFA 2DCZA 4PLOA 3QD6A 5FFOC 1UL9A 4YW2A 3O1PA 4FFIA 4AK3A 1FI2A 4BQ4A 4HK8A 4JGZB 4Q4Y3 3AMNA 5FUIA 2EIDA 4H2AA 3MHZA 4FPFA 1WLWA 4TLFA 2G1MA 4JKLA 4Q0PA 2GNMA 1ULOA 2BGOA 2HWC1 4Y5Z0 1JZ7A 1CJPA 1N3OA 1OA3A 4FXKB 5EYXA 4AI9A 4CCMA 1YJKA 3ZOIA 4BK4A 3GZEA 5H9SA 5CFDA 1QDOA 4CDQA 4CDQC 1V6LA 5L19A 2R062 4QKBA 4KL1A 2GN7A 3N9MA 3LA3A 4IUGA 4BIFA 1H1AA 2HWF2 4CEYA 3KWVA 3DYMA 1Q3EA 2XBO1 2DUQA 4AGGA 4PQ9A 1RJ8A 1HQLA 4IL7A 2W2IA 3AZVA 1FMD3 3APBA 4CE8A 1O91A 1YFUA 2K46A 2QJVA 3GF6A 5DDJ3 4BXSV 1POV3 4CEYB 1XU1A 2CV6A 2WSUA 3QOPA 1DQ1A 2AGSA 3DPRA 1EYBA 3IPVB 1MZEA 1E5HA 1NAEA 4RGKA 5GZGA 3T4HB 1R081 5L36A 1RGSA 2B46X 4NPMA 5HV4A 1SPPB 4HPKB 3TEWA 4QXHA 4UAPA 5FYCA 2DYCA 1VRH1 4XDPA 3CL1A 1L7RA 4GXLA 2HLEA 4LBMA 5J96B 3I4IA 3QACA 1UCXA 5CG9A 3HEIA 3V0BB 1KGYA 2E53A 1RHI3 5A7WA 2DUPA 4CA9A 4KI5M 5ABJA 5C8CA 2R043 4GB31 3O12A 2XQRA 4IE7A 1HV0A 3K4ZA 5AVPA 3PDQA 5T5LA 3UJOA 3GBFA 3THPA 1UU5A 1VBC3 2ARXA 1DZRA 1NQJA 1MS9A 4H7MA 2HWE2 2V73A 4LJHA 2Q8EA 3ZXLA 3FL7A 4YZ5A 3POBA 3E6BA 3ZXKA 4YVWC 2B5HA 2HWD3 2WZR1 1ZRCA 3WLUA 5I0DA 1S0IA 4KGGA 1BEV1 1DG6A 1YCIA 2O8OA 1VB4A 2ZABA 5J98B 4CDXB 1ZZ8A 2SLIA 4AVSA 4AHXA 1R1A1 3NJZA 3W59A 1HLCA 1ZX5A 4L97A 5JSPA 3FFQA 1COV2 3RZJA 3CNAA 1F8VA 1S2KA 4P9GA 3SCFA 4OHVA 4QM9A 3I2DA 2UU8A 1IS6A 2XJTA 1COV3 3WV6A 1EY2A 3N7JA 1V9U1 1MR5A 5FUNA 1MZFA 2ZKNA 3OPZA 1H9PA 1SFPA 4D6RA 4JKKA 4IV1A 4IV3B 2Q1MA 5FKCA 4E27A 3VDDC 5FBZA 5GLUA 3D0SA 3C7EA 1JZ8A 4P02B 3BGAA 2GSYA 1AVBA 1CAXB 2ZACA 3H7JA 1WKYA 3TN91 1UU6A 1QNWA 2JG9A 4XHBA 3THDA 1B35C 2OVUA 1VIWB 1AR82 3HQUA 4FBFA 3CZUA 1CAUA 2BGCA 4BPZA 4OHWA 2VCMA 2B45X 4CUAA 1IPKA 4IE0A 5FXWA 4ZHNA 5FJHA 3ASIA 5E6HA 1F15A 4W65A 5D1IA 1NCRC 1IPSA 1H8TA 2WQ8A 1A78A 2GH8A 4C91A 1UWWA 2Y64A 1XSRA 4GKXA 1PGW1 5GALA 4FAHA 1GWLA 4V1PA 4LKSA 2E9QA 3WHUA 5FK7A 3KS7A 4MGIE 1ZA7A 2JG9C 3NV4A 2UWAA 1PMHX 2RS53 3M7AA 1JYTA 2Q8DA 4QDQA 1BCXA 3KMHA 1JU4A 2EICA 4LE4A 5C70A 5K0UC 1BMV2 2ETEA 4AWDA 1KFXL 3WNLA 3Q8AA 3NRUA 4YFZA 2R072 4JTOA 1Y9GA 3CIHA 4P9JA 2XWBB 2K0GA 2D5FA 2VMCA 2QBXA 2WBKA 4XQWA 5FP4A 3VBHB 4J25A 1H2NA 2R073 1H30A 2CL2A 2X5IA 2OXBA 3WP4A 1Z7S2 5FP7A 4Q8LA 3OEAA 1ULDA 3I54A 2XMLA 4GB32 1X82A 2B39A 1SBDA 4XAEA 4CPBA 4LXLA 1JHNA 2GN3A 2GC2A 2DV9A 4CP0A 1GZCA 2ZZQA 2W47A 1ZM1A 3M70A 3T4VA 2D3PA 1W28A 1GWKA 4PF5A 1D0HA 1PK6B 2OYZA 3NMBA 1Q5OA 4XOGA 1WMFA 1EAH3 5IVBA 1N1VA 4WM8A 3OGSA 5LA0A 1N47A 3MIHA 2XVKA 3FHIB 2VOTA 2JDZA 2DU1A 4FTEA 3VBUB 2P4EA 2R49A 5I8YA 1VBB3 5IK4A 4LO7A 1BBT3 5DUWA 4UF0A 2P37A 4YWAA 2GC0A 5FZOA 4OHZA 1WD4A 4QKNA 5FYHA 3PMSA 1MS0A 2JECA 1GICA 2D6LX 3AMPA 1CZTA 1ZRFA 1OOPA 4WM7B 4I02A 3THCA 3D4KA 3VZLA 1LKNA 4AXOA 5ABJC 5J37A 4QKDA 1YHFA 3CDZB 2D6OX 2ZBJA 3V0BA 1RTVA 1DDLA 2DVAA 1DZQA 2CWMA 1W6NB 3RPQA 4D6SA 3WNOA 2VAUA 4EN8B 2YFZA 2PHWA 4GJYA 4MGYE 4RS5C 3LDRA 2GNBA 1MEC3 5HXVA 3TNPB 1AR93 4G4FA 4PF1A 4YVSC 1VAMA 1D7PM 1JI6A 1X8MA 4FPKA 4JRAA 3BIEA 3ZN6A 2IZWA 1R1A3 2WQ4A 1SBEA 1TMF2 2WYSA 2ZGKA 2P3KA 2DBIA 3MW3A 1PGW2 4DEVA 1OSGA 1R083 4MH0E 1TE1B 4NMIA 3FE5A 5KC6A 1GQGA 4LBQB 5GZFA 1A8MA 1RHI1 3DEMA 4LHSA 4N7UA 4YVSA 4GWJA 1ZBA1 5IVYA 4Q4W2 2RHPA 3WEZA 5ACA1 4HFSA 4AI8A 4OLLA 1OUSA 5FV3A 4JC1A 2F4PA 3TN93 4UW6A 4LBNA 2B7YA 5FYVA 4OI4A 4CXYA 3K4AA 2GAUA 2JENA 4ISQA 5BXXA 2OKXA 3TN92 3V56A 3AP5A 2VL4A 3WSOA 1T2XA 4L9BA 3AZWA 2DVDA 3IN9A 3HIFA 3J7LA 2DFCA 5FZLA 2WC2A 5T52A 5FY4A 5FZAA 3VDAA 3H0OA 2LM3A 4ZS2A 3ZM8A 5HCFA 4AVAA 4YSFA 1UIKA 4W4ZA 1TZOA 1W6QA 3UETA 4HT1T 4GA9A 4WM7C 1XYNA 2RM22 4YW6A 1U0AA 1JS9A 4YW1A 4CCEA 3UNPA 3NW4A 3MFCA 3LFIA 4Q0SA 4XYXA 2W39A 3FX3A 2NMOA 5K0UA 3WG1A 1M06G 2WS91 4LHNA 4AFMA 2QDNA 2PQQA 1JYXA 3AZXA 3M2MA 1JBCA 3NQHA 4J1XA 4K40A 4XTPA
chains in the Genus database with same CATH topology
1UZ0A 4PT6A 1JZ3A 4E8DA 4BDVB 4W50A 2VZSA 2VZOA 2Y6LA 3CQOA 3SKVA 3T2QA 2E31A 5EIYB 5JR2A 2B9VA 4JHZA 3BN6A 3A22A 1XC6A 3MV11 3FHAA 4D0QA 2Y6HA 3OEBA 3HNYM 1J83A 2HYXA 3OBAA 2E33A 1OF4A 3ETPA 5C7GA 2VZVA 4ARYA 2QQKA 4OMCA 2WO1A 5JMOA 1EUUA 1LNSA 4A45A 3I2HA 4P08A 3A7QA 3IAPA 4OZOA 2Y6GA 3D3AA 5B4NA 1W8OA 3HNMA 4OMDA 3ACFA 2KD7A 2J22A 4KWUA 3VD7A 4A6OA 3A21A 1GMMA 4LQRA 2J1VA 4FI9A 4ZY9A 1UX7A 2QQIA 3E1F1 3VD3A 2JD9A 1GOHA 3HOBA 1OD3A 2W1UA 1L7QA 2WN3A 1TG7A 2VTFA 2WDBA 5A1AA 3DYPA 5LCWL 4JX0A 2E32A 2J1TA 2W92A 1UYXA 4ET7A 3WNKA 5DN2A 4P5YA 4A41A 3MBWA 2E26A 3LPGA 3WNPA 4QB2A 3HPNA 4CVUA 3VD4A 4A42A 4CU7A 2W91A 4P00B 3HJRA 3ABZA 3I3DA 1MPXA 2VCBA 2W94A 2LW8A 3CKHA 3IDAA 1UY1A 2ZEYA 2C26A 3PUHA 3T0DA 1W9WA 3LQCA 5G05L 1NX9A 2ID4A 4QX1A 4ZXEA 3OGRA 3NJXA 4BK5A 2J1UA 2VMDA 4M4RA 4MGSA 3DYOA 2C4XA 2X09A 3VD5A 1JZ6A 1WCQA 2VZ3A 2WAOA 2VR4A 4ZZ8A 4RYDA 1UMIA 3VDBA 3W5NA 3IB3A 2QQLA 5JXJA 5JXGA 5CZKA 1CZSA 3GDBA 1GUIA 3WF1A 4UI9L 1O8SA 2VQTA 2VZUA 4XUQA 2BGPA 4DUWA 1IQDC 4XUNA 4XURA 2Z4FA 3VD9A 3HN3A 2DCKA 2QQOA 1ULPA 2W3JA 2W46A 5JUVA 1JZ4A 2BZDA 4DXTA 3SEEA 1PMJX 2W1WA 2J7MA 2XONA 3EYPA 3K77A 4KMQA 2W9XA 2J1SA 3LE0A 2W5FA 1DLCA 1BHGA 1US3A 1RYYA 4JKMA 1GNYA 1UY4A 3I2FA 2ZEXA 5F7UA 3UESA 2CDPA 1W99A 4A3ZA 4YPJA 3P6BA 1H6XA 3C7OA 4BJ0A 4MADA 3WQBA 2BERA 3A23A 1O8PA 3T0AA 3MV01 5HPOA 3ACGA 3I2IA 1SG3A 3FHQA 3ACIA 1XPWA 2JDAA 4L0PA 2EIEA 3C7HA 4HG6B 2VCCA 2RVAA 2JKXA 1DP0A 1UY3A 1H6YA 1W9TA 3K4DA 2ZEZA 4MO3M 1XNAA 2DCJA 3C7GA 3WF2A 4CU6A 5EJZB 2VMEA 5J1XA 5LA2A 1UYYA 3T2PA 2QQJA 1HN1A 1P8JA 3I97A 3T08A 1JYVA 5FUIA 2EIDA 2VZTA 4JKLA 1ULOA 2BGOA 4M4PA 1JZ7A 1GOFA 5LA1A 1PX3A 4BK4A 4D8MA 1UXXX 2B4KA 4IUGA 4OUEA 3DYMA 3OGVA 2V4VA 5DQ0A 4GZ9A 4DXSA 1GU3A 4MOAA 1K12A 1NKGA 3OG2A 4BXSV 4UOJA 3JXSA 5DMYA 2QQMA 3MUZ1 4QB1A 4XVHA 1NAEA 4GWIA 3NNGA 1W0NA 5IJRA 4UAPA 1L7RA 4E8CA 2CDOA 2HLEA 3HEIA 1KGYA 2W95A 4TXWA 3T0BA 4KI5M 4DUXA 3LEKA 4CUBA 1R64A 3K4ZA 2X10A 5JXHA 2XQXA 3HNBM 4QAWA 4XUPA 4PQQA 1OH4A 3FL7A 2C9KA 2VJXA 3ACHA 3P1IA 3SEPA 5JXIA 3I2KA 2Y8KA 1F4HA 5I0DA 3I3EA 2YFUA 4XZUG 2ZEWA 2WZ8A 4ZZ5A 1CX1A 1DYOA 1W9SA 3LEGA 4TTGA 2ZXQA 2DDUA 2Y6KA 2Y6JA 3WF4A 4DEQA 3GM8A 4XUTA 2VO5A 1I5PA 2L9LA 1SHWB 4JKKA 1CIYA 1JZ5A 4ARXA 4AAXA 2J1AA 3C7EA 2VZRA 4P02B 1JZ8A 3BGAA 2JE8A 2YC2A 1WKYA 3LPFA 3PUIA 3THDA 1F4AA 1K45A 1JU3A 4CUCA 3CZUA 1XNTA 4CUAA 1W8NA 2RJ2A 2WO3A 1UMHA 1GOGA 1UY0A 4QDRA 2W1SA 2WQ8A 1UWWA 2Y64A 4AG4A 4LKSA 4DXRA 3C7FA 2X05A 1OF3A 1PMHX 4QDQA 3GXUA 1JU4A 2EICA 3WF3A 5C70A 1PX4A 1OT5A 2VZQA 2WZEA 3WNLA 3NRUA 2BBAA 3CIHA 4QPWA 3I3BA 2WBKA 2VMCA 2QBXA 4QX2A 2YG0A 3U37A 3I2GA 3I2JA 2YC4A 4OYUA 1SDDB 1EUTA 3OEAA 3WNMA 4QX0A 2VC9A 5IYYA 1UXZA 3CZJA 3MO4A 1K42A 3W5MA 2J1EA 2W47A 3LEIA 3ECQA 1KEXA 2XHNA 2V5DA 3GGLA 2WUHA 5B4XA 1K3IA 3OGSA 4MGQA 5EJ1B 3F2ZA 4XUOA 1TVGA 2VOTA 5LA0A 2VQUA 3T09A 2PQSA 2XOMA 2QQNA 4CU8A 4DUVA 3CMGA 3SKJE 1CZTA 3K75B 1UY2A 3THCA 3CDZB 1GQPA 2R7EB 1YQ2A 3WNOA 3OB8A 2YFZA 3EB7A 2VZ1A 4PF1A 2WABA 3C8XA 3WF0A 1D7PM 5DPNA 2EIBA 1JI6A 5G04L 2ORZA 5C71A 5IHRA 2VM9A 2WYSA 4DEVA 1J84A 2VZPA 5CYYA 3WNNA 4CU9A 1JHJA 2J1RA 4LHSA 2W1QA 2W87A 4GWJA 3FN9A 1JZ2A 1US2A 1NUKA 1UYZA 3WEZA 1CZVA 3VDCA 5HXMA 2RV9A 4QDSA 4QB6A 4LPLA 4A44A 3IAQA 3K4AA 3K46A 3NJVA 2OKXA 2VL4A 4W8JA 2LS6A 3WSOA 1T2XA 2WAAA 2WN2A 2VMFA 2VCAA 1JYNA 3DECA 3T2OA 2V72A 3VDAA 4Z2AA 3ZM8A 2YB7A 5IFPA 4QX3A 4W4ZA 5IFTA 3UETA 1JYWA 3IIIA 3UNPA 3AC0A 4A4AA 2ORXA 3J7HA 1O59A 1JYXA 4RN5A 2WO2A 3NQHA 3MUY1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZ0 A;  4PT6 A;  1JZ3 A;  4E8D A;  4BDV B;  4W50 A;  2VZS A;  2VZO A;  2Y6L A;  3CQO A;  3SKV A;  3T2Q A;  2E31 A;  5EIY B;  5JR2 A;  2B9V A;  4JHZ A;  3BN6 A;  3A22 A;  1XC6 A;  3MV1 1;  3FHA A;  4D0Q A;  2Y6H A;  3OEB A;  3HNY M;  1J83 A;  2HYX A;  3OBA A;  2E33 A;  1OF4 A;  3ETP A;  5C7G A;  2VZV A;  4ARY A;  2QQK A;  4OMC A;  2WO1 A;  5JMO A;  1EUU A;  1LNS A;  4A45 A;  3I2H A;  4P08 A;  3A7Q A;  3IAP A;  4OZO A;  2Y6G A;  3D3A A;  5B4N A;  1W8O A;  3HNM A;  4OMD A;  3ACF A;  2KD7 A;  2J22 A;  4KWU A;  3VD7 A;  4A6O A;  3A21 A;  1GMM A;  4LQR A;  2J1V A;  4FI9 A;  4ZY9 A;  1UX7 A;  2QQI A;  3E1F 1;  3VD3 A;  2JD9 A;  1GOH A;  3HOB A;  1OD3 A;  2W1U A;  1L7Q A;  2WN3 A;  1TG7 A;  2VTF A;  2WDB A;  5A1A A;  3DYP A;  5LCW L;  4JX0 A;  2E32 A;  2J1T A;  2W92 A;  1UYX A;  4ET7 A;  3WNK A;  5DN2 A;  4P5Y A;  4A41 A;  3MBW A;  2E26 A;  3LPG A;  3WNP A;  4QB2 A;  3HPN A;  4CVU A;  3VD4 A;  4A42 A;  4CU7 A;  2W91 A;  4P00 B;  3HJR A;  3ABZ A;  3I3D A;  1MPX A;  2VCB A;  2W94 A;  2LW8 A;  3CKH A;  3IDA A;  1UY1 A;  2ZEY A;  2C26 A;  3PUH A;  3T0D A;  1W9W A;  3LQC A;  5G05 L;  1NX9 A;  2ID4 A;  4QX1 A;  4ZXE A;  3OGR A;  3NJX A;  4BK5 A;  2J1U A;  2VMD A;  4M4R A;  4MGS A;  3DYO A;  2C4X A;  2X09 A;  3VD5 A;  1JZ6 A;  1WCQ A;  2VZ3 A;  2WAO A;  2VR4 A;  4ZZ8 A;  4RYD A;  1UMI A;  3VDB A;  3W5N A;  3IB3 A;  2QQL A;  5JXJ A;  5JXG A;  5CZK A;  1CZS A;  3GDB A;  1GUI A;  3WF1 A;  4UI9 L;  1O8S A;  2VQT A;  2VZU A;  4XUQ A;  2BGP A;  4DUW A;  1IQD C;  4XUN A;  4XUR A;  2Z4F A;  3VD9 A;  3HN3 A;  2DCK A;  2QQO A;  1ULP A;  2W3J A;  2W46 A;  5JUV A;  1JZ4 A;  2BZD A;  4DXT A;  3SEE A;  1PMJ X;  2W1W A;  2J7M A;  2XON A;  3EYP A;  3K77 A;  4KMQ A;  2W9X A;  2J1S A;  3LE0 A;  2W5F A;  1DLC A;  1BHG A;  1US3 A;  1RYY A;  4JKM A;  1GNY A;  1UY4 A;  3I2F A;  2ZEX A;  5F7U A;  3UES A;  2CDP A;  1W99 A;  4A3Z A;  4YPJ A;  3P6B A;  1H6X A;  3C7O A;  4BJ0 A;  4MAD A;  3WQB A;  2BER A;  3A23 A;  1O8P A;  3T0A A;  3MV0 1;  5HPO A;  3ACG A;  3I2I A;  1SG3 A;  3FHQ A;  3ACI A;  1XPW A;  2JDA A;  4L0P A;  2EIE A;  3C7H A;  4HG6 B;  2VCC A;  2RVA A;  2JKX A;  1DP0 A;  1UY3 A;  1H6Y A;  1W9T A;  3K4D A;  2ZEZ A;  4MO3 M;  1XNA A;  2DCJ A;  3C7G A;  3WF2 A;  4CU6 A;  5EJZ B;  2VME A;  5J1X A;  5LA2 A;  1UYY A;  3T2P A;  2QQJ A;  1HN1 A;  1P8J A;  3I97 A;  3T08 A;  1JYV A;  5FUI A;  2EID A;  2VZT A;  4JKL A;  1ULO A;  2BGO A;  4M4P A;  1JZ7 A;  1GOF A;  5LA1 A;  1PX3 A;  4BK4 A;  4D8M A;  1UXX X;  2B4K A;  4IUG A;  4OUE A;  3DYM A;  3OGV A;  2V4V A;  5DQ0 A;  4GZ9 A;  4DXS A;  1GU3 A;  4MOA A;  1K12 A;  1NKG A;  3OG2 A;  4BXS V;  4UOJ A;  3JXS A;  5DMY A;  2QQM A;  3MUZ 1;  4QB1 A;  4XVH A;  1NAE A;  4GWI A;  3NNG A;  1W0N A;  5IJR A;  4UAP A;  1L7R A;  4E8C A;  2CDO A;  2HLE A;  3HEI A;  1KGY A;  2W95 A;  4TXW A;  3T0B A;  4KI5 M;  4DUX A;  3LEK A;  4CUB A;  1R64 A;  3K4Z A;  2X10 A;  5JXH A;  2XQX A;  3HNB M;  4QAW A;  4XUP A;  4PQQ A;  1OH4 A;  3FL7 A;  2C9K A;  2VJX A;  3ACH A;  3P1I A;  3SEP A;  5JXI A;  3I2K A;  2Y8K A;  1F4H A;  5I0D A;  3I3E A;  2YFU A;  4XZU G;  2ZEW A;  2WZ8 A;  4ZZ5 A;  1CX1 A;  1DYO A;  1W9S A;  3LEG A;  4TTG A;  2ZXQ A;  2DDU A;  2Y6K A;  2Y6J A;  3WF4 A;  4DEQ A;  3GM8 A;  4XUT A;  2VO5 A;  1I5P A;  2L9L A;  1SHW B;  4JKK A;  1CIY A;  1JZ5 A;  4ARX A;  4AAX A;  2J1A A;  3C7E A;  2VZR A;  4P02 B;  1JZ8 A;  3BGA A;  2JE8 A;  2YC2 A;  1WKY A;  3LPF A;  3PUI A;  3THD A;  1F4A A;  1K45 A;  1JU3 A;  4CUC A;  3CZU A;  1XNT A;  4CUA A;  1W8N A;  2RJ2 A;  2WO3 A;  1UMH A;  1GOG A;  1UY0 A;  4QDR A;  2W1S A;  2WQ8 A;  1UWW A;  2Y64 A;  4AG4 A;  4LKS A;  4DXR A;  3C7F A;  2X05 A;  1OF3 A;  1PMH X;  4QDQ A;  3GXU A;  1JU4 A;  2EIC A;  3WF3 A;  5C70 A;  1PX4 A;  1OT5 A;  2VZQ A;  2WZE A;  3WNL A;  3NRU A;  2BBA A;  3CIH A;  4QPW A;  3I3B A;  2WBK A;  2VMC A;  2QBX A;  4QX2 A;  2YG0 A;  3U37 A;  3I2G A;  3I2J A;  2YC4 A;  4OYU A;  1SDD B;  1EUT A;  3OEA A;  3WNM A;  4QX0 A;  2VC9 A;  5IYY A;  1UXZ A;  3CZJ A;  3MO4 A;  1K42 A;  3W5M A;  2J1E A;  2W47 A;  3LEI A;  3ECQ A;  1KEX A;  2XHN A;  2V5D A;  3GGL A;  2WUH A;  5B4X A;  1K3I A;  3OGS A;  4MGQ A;  5EJ1 B;  3F2Z A;  4XUO A;  1TVG A;  2VOT A;  5LA0 A;  2VQU A;  3T09 A;  2PQS A;  2XOM A;  2QQN A;  4CU8 A;  4DUV A;  3CMG A;  3SKJ E;  1CZT A;  3K75 B;  1UY2 A;  3THC A;  3CDZ B;  1GQP A;  2R7E B;  1YQ2 A;  3WNO A;  3OB8 A;  2YFZ A;  3EB7 A;  2VZ1 A;  4PF1 A;  2WAB A;  3C8X A;  3WF0 A;  1D7P M;  5DPN A;  2EIB A;  1JI6 A;  5G04 L;  2ORZ A;  5C71 A;  5IHR A;  2VM9 A;  2WYS A;  4DEV A;  1J84 A;  2VZP A;  5CYY A;  3WNN A;  4CU9 A;  1JHJ A;  2J1R A;  4LHS A;  2W1Q A;  2W87 A;  4GWJ A;  3FN9 A;  1JZ2 A;  1US2 A;  1NUK A;  1UYZ A;  3WEZ A;  1CZV A;  3VDC A;  5HXM A;  2RV9 A;  4QDS A;  4QB6 A;  4LPL A;  4A44 A;  3IAQ A;  3K4A A;  3K46 A;  3NJV A;  2OKX A;  2VL4 A;  4W8J A;  2LS6 A;  3WSO A;  1T2X A;  2WAA A;  2WN2 A;  2VMF A;  2VCA A;  1JYN A;  3DEC A;  3T2O A;  2V72 A;  3VDA A;  4Z2A A;  3ZM8 A;  2YB7 A;  5IFP A;  4QX3 A;  4W4Z A;  5IFT A;  3UET A;  1JYW A;  3III A;  3UNP A;  3AC0 A;  4A4A A;  2ORX A;  3J7H A;  1O59 A;  1JYX A;  4RN5 A;  2WO2 A;  3NQH A;  3MUY 1; 
#chains in the Genus database with same CATH topology
 5F5I A;  5T5P A;  3NVC A;  5FZM A;  1BKZ A;  4E8D A;  4ISR A;  1BZW A;  2BNN A;  3OGJ A;  1ZBE 3;  1N1Y A;  2Y26 A;  3CEW A;  3FLT A;  2VZO A;  2Y6L A;  4W50 A;  5DAP A;  3VBH A;  4Y22 B;  2WFF 3;  2B9V A;  2IUW A;  3MV1 1;  4Q4Y 1;  3N4M A;  4M3C E;  5FZ0 A;  1MEC 1;  2NYY A;  3HNY M;  1J83 A;  4QGN A;  1H1I A;  3OBA A;  2BOJ A;  1RED A;  1RUD 1;  5L7O A;  5D21 A;  4QPI C;  2VZV A;  4ARY A;  3PVB B;  5T55 A;  2JD4 A;  3LCP A;  1EUU A;  3J8F 2;  3DF0 A;  2OPW A;  3ILN A;  4DIN B;  4AI1 A;  5FO8 B;  3A7Q A;  1T6G C;  1BLZ A;  2XVL A;  2WNV C;  1SFN A;  1W9F A;  3MI8 A;  4AL9 A;  2A7A A;  1RVF 2;  3RNS A;  5FTT C;  2DTY A;  4OMD A;  3J7M A;  4U2A A;  2ET1 A;  1O5U A;  1W06 A;  1PO2 1;  2J22 A;  2KD7 A;  1W6N A;  2WNE A;  1PVC 1;  4Y3O A;  4FP2 A;  2HYK A;  3KCX A;  3SC7 X;  1RVF 3;  2PA7 A;  5GLV A;  3SIS A;  1UQX A;  3JQW A;  2D44 A;  3KHC A;  4Q27 A;  3BTZ A;  2R06 3;  4FI9 A;  4JGY B;  1SEF A;  4Y33 A;  4ZY9 A;  1UX7 A;  1LED A;  3VD3 A;  3POE A;  1G9B A;  3BYW A;  1GOH A;  4IW3 A;  3ZYF A;  1IKQ A;  2OA2 A;  2WN3 A;  4E2Q A;  3VKM A;  2VTF A;  4YZ3 A;  1YEW A;  5IVC A;  1W0O A;  2NZ9 A;  3IWZ A;  2E32 A;  2W92 A;  1UYX A;  5CNA A;  4NOT A;  5T5J A;  5D2A A;  1KRI A;  4A41 A;  5JLV A;  3NAP B;  2ZGP A;  4COW A;  1RXF A;  4BM8 A;  4LLO A;  1JUH A;  3MBW A;  1BBT 1;  2WZR 2;  4QB2 A;  2AC1 A;  3HVD A;  2WNO A;  4C0H A;  4Y20 B;  3ZFG C;  3U78 A;  2R07 1;  2GP5 A;  4N7I A;  4WZF A;  2GDF A;  2ILM A;  3AX4 A;  3PUR A;  4CYD A;  5A7P A;  1WCU A;  5F2W A;  4XQD A;  1SLA A;  3HQX A;  1GZW B;  4Y22 A;  2YXS A;  2R0H A;  2NPI A;  5KHK A;  2VOV A;  3EMR A;  3LDK A;  4YLZ A;  1HJG A;  4NN0 A;  1XNK A;  1PGS A;  4MET A;  2W94 A;  2Q8O A;  2LW8 A;  3N9O A;  4F83 A;  1SFY A;  1Q8P A;  1ZBE 1;  2DCT A;  2KA3 A;  4RS5 A;  1AR9 1;  4ES9 A;  3UKT A;  2IFR A;  1D4M 1;  2ZPX A;  5F3E A;  4P9I A;  5G05 L;  2YBS A;  2O0O A;  3H9A A;  3O1V A;  3WZ1 A;  1PZ9 A;  1H2K A;  3HBZ A;  5AFB A;  1RUJ 2;  1L7L A;  4BK5 A;  1R1Z A;  5ABJ B;  5FZ9 A;  3RZL A;  3CLP A;  2I74 A;  4ORF A;  1U5I A;  3BKZ A;  1CPN A;  1ASJ 3;  1AYM 1;  1PZ7 A;  3ON7 A;  1FMD 1;  3BTX A;  2ZAH A;  2Z2S B;  3OCP A;  2VD7 A;  4Y1Z A;  2X09 A;  4FFG A;  1LHV A;  1WCQ A;  2O1Q A;  3Q8F A;  1DFQ A;  4KWL A;  4FOW A;  4ZZ8 A;  5CG8 A;  4COU A;  3PVO A;  5JIA A;  1HW5 A;  3IB3 A;  2LRP A;  3AB0 A;  3RVH A;  1LGC A;  5B2G B;  4AW7 A;  1I1E A;  5ACA 3;  3I59 B;  2JX9 A;  2XLG A;  3LD8 A;  4XIK A;  1I3H A;  1ZBA 3;  4KNC A;  3CO2 A;  4E9K A;  1OA2 A;  1W90 A;  4YRD A;  3BI3 A;  2HWC 3;  3HWJ A;  3WF1 A;  2XPJ A;  1F35 A;  1WLT A;  4CCN A;  3H1M A;  1ENS A;  4Q26 A;  5I0U A;  3WT3 A;  4OZX A;  5IK7 A;  3WDT A;  2TUN A;  5KXC A;  5A3W A;  5F9T A;  3AFK A;  1BYH A;  2WFP A;  2DUO A;  2Y6F A;  2WKK A;  2XBO 2;  4IET A;  3O14 A;  1PO1 3;  1GKB A;  2Z4F A;  3M3Q A;  4QHB A;  4QXK A;  1AL2 3;  3O0X A;  2MPF A;  4MX3 A;  4W6X A;  1RUD 3;  3O1U A;  2Q0A A;  1QDC A;  2W46 A;  1RXG A;  4GQ7 A;  4YNI A;  3SCH A;  5BNN C;  3WDV A;  1JZ4 A;  3JBG 2;  1VRB A;  1VBE 3;  1UKG A;  2F17 A;  3MLJ A;  1J3P A;  1RUD 2;  2J7M A;  2XON A;  5CFC C;  5FZO B;  3KCY A;  3LE0 A;  2W5F A;  1BHG A;  1VBE 2;  3VV1 A;  4CCC A;  4DS0 A;  1QXJ A;  4RD7 A;  1GNY A;  4EE2 A;  1RUF 1;  5F7U A;  2FDK A;  4OVE A;  3VZK A;  1W99 A;  2HEW F;  3TWI A;  3P6B A;  1W2T A;  4WM8 B;  1H6X A;  4X6R B;  3ROU A;  3CJI A;  4NRQ A;  3SNM A;  1S0D A;  4MAD A;  1QJX 3;  2X5I B;  2VBP A;  3POG A;  3ZFF B;  5KXE A;  3JQX A;  4Q4Y 2;  3A23 A;  1O8P A;  1CR7 A;  3PME A;  4MGZ E;  3MV0 1;  3LOI A;  4LK6 A;  2AZ5 A;  1SCS A;  2GC1 A;  5A6X A;  5C9A A;  3ACI A;  1ND2 B;  3KHB A;  5FXX A;  2JDA A;  3FFZ A;  5IAT A;  3FUO A;  3NAP A;  2WWS A;  3AVR A;  1W2U A;  4FPJ A;  5A3P A;  4HG6 B;  5L7O C;  5FUP A;  3WX5 A;  5BNO B;  3LAG A;  1S0C A;  1WWY A;  1BEV 2;  2DU0 A;  2RM2 1;  2AEN A;  1C5H A;  1NY7 1;  1H6Y A;  1AYM 3;  5DZF A;  1W9T A;  5BNP B;  1OPO A;  5I8S A;  2PHT A;  5L73 A;  3WG2 A;  1JN2 P;  2GMP A;  2DF7 A;  1OA4 A;  1J59 A;  1FMD 2;  1H0B A;  1LOF A;  2C24 A;  4CU6 A;  4LA2 A;  4OHX A;  1VBB 2;  2VME A;  2JWP A;  3B94 A;  3QCW A;  4XXP A;  1UYY A;  2K9Z A;  5LA2 A;  3ZFF C;  4AHZ A;  4XAC A;  2VXR A;  3ZIW A;  3PIJ A;  4M0H A;  2G4I A;  2XH6 A;  3MIB A;  1AXZ A;  1EAH 1;  4M3C F;  1ND3 B;  1HN1 A;  1FPN 1;  1NE6 A;  1DYK A;  4PI2 A;  3HAG A;  1DLL A;  1XJA A;  4WZC A;  1WW6 A;  5A80 A;  2WNU B;  4Q4V 3;  3MLL A;  1DGW X;  4MXV A;  1XYO A;  1G86 A;  4K1Z A;  5JIU A;  1GOF A;  5DG1 A;  2WA4 A;  2BBV A;  2V09 A;  5FCC A;  2A71 A;  1RB8 G;  1CQ9 A;  5BNN B;  1XXN A;  1AR9 2;  4JHT A;  3UJQ A;  2QZ3 A;  3OGV A;  2AEY A;  2V4V A;  3O1M A;  1GNH A;  3W21 A;  4QPI B;  4CXX A;  1PO1 1;  2CNA A;  1K12 A;  3RSJ A;  2ZAA A;  2JG8 C;  5A33 A;  1TMF 3;  1Q8S A;  1ZRR A;  2DTW A;  3OG2 A;  3RI8 A;  4OUM A;  1JW6 A;  1VRH 3;  4XMA A;  4AYU A;  2PFW A;  5IVV A;  5DMY A;  2QQM A;  2BEO A;  2RS5 1;  3ZPO A;  3KV9 A;  1KJR A;  3AKR A;  4KG8 A;  4XVH A;  3UV9 A;  5FZC A;  2B9U A;  5J3U A;  3RI9 A;  3RZM A;  1U5Y A;  5E1R A;  1ZRE A;  3GNE A;  1VBE 1;  2ZX2 A;  3BOD A;  4NRM A;  2PN5 A;  5JOZ A;  3NNG A;  4O65 A;  1OH3 A;  1W0N A;  2WWJ A;  3FMG A;  3OBZ A;  2RMU 3;  1FV2 A;  5IJR A;  4AEJ A;  1ZZB A;  5AVA A;  3WW3 A;  1DHK B;  1YQC A;  1XBF A;  2CDO A;  3H8X A;  2CGP A;  1VAK A;  3PJQ A;  3AK0 A;  2XLF A;  3U75 A;  1ZYB A;  1Y4W A;  3AVS A;  1PM7 A;  3SH4 A;  2W95 A;  4TXW A;  3MFA A;  3T0B A;  4BCU A;  4HK9 A;  1PNF A;  2G19 A;  4QGM A;  4YM3 A;  4CUB A;  1WMX A;  5JXH A;  4B1M A;  2UY9 A;  1KJL A;  2XVG A;  3IIA A;  3HNB M;  3O1S A;  4QX8 A;  2IWG B;  2PHX A;  5IVJ A;  4Q5O A;  3OPW A;  5F6K A;  3ZN5 A;  1C1L A;  2BNO A;  2VNO A;  2VJX A;  2VBD A;  3SEP A;  2O8Q A;  5JXI A;  3ZXE A;  1S0F A;  3M1H A;  1C8M 1;  1F4H A;  3KM5 A;  4IEX A;  2QQP A;  3I3E A;  5TSW A;  2YFU A;  5DZG A;  4DRR A;  1CPM A;  1J58 A;  4MGT A;  4LR4 A;  1O4Y A;  2WZ8 A;  3M3I A;  4HPK A;  5FXV A;  5T3N A;  1BVV A;  3JBG 1;  2MHF A;  4ZZ5 A;  1DYO A;  1RMU 3;  2A6V A;  5FY9 A;  1W9S A;  4LBQ D;  1G9C A;  2WLP A;  2ZGM A;  1RUG 1;  3NKT A;  4P9L A;  4E4S A;  5C8W A;  5FDB A;  1FX5 A;  4TTG A;  1D4V B;  2JKB A;  4KBZ A;  1W6Q B;  1G6N A;  4ASL A;  5EHD A;  5GJ6 A;  4B1L A;  3HD8 B;  3GM8 A;  5A3O A;  2ZGN A;  4XUT A;  2VO5 A;  4Y1U A;  3FC0 A;  2FDH A;  1FOD 2;  2L9L A;  3X29 B;  4IDZ A;  3PTR B;  5C4W B;  1JZ5 A;  2R0F A;  1QJY 2;  5FWE A;  1YC6 1;  2VZR A;  4X6Q B;  4ZS3 A;  5LW9 A;  2OPK A;  2VU9 A;  3NAP C;  1UOG A;  3LPF A;  4N53 B;  5FAX A;  3V65 A;  4A7Z A;  4R9B A;  5BPX A;  4FOY A;  5K8S A;  4GMP 1;  4BLI A;  4N43 C;  4CP9 A;  1JU3 A;  4RL7 A;  1AL2 1;  4RQP B;  3VZO A;  2VBB A;  4M0N A;  1C57 A;  1NLR A;  1XE0 A;  2WO3 A;  1QEX A;  1WZX A;  1NLS A;  4NPR A;  3DL3 A;  4K8F A;  3RJR A;  3T3Y A;  2VMH A;  1OXC A;  2QVS B;  2C1F A;  5AC9 3;  2PEL A;  4NHY A;  3N7M A;  1VMF A;  4AG4 A;  1S1A A;  2R1B A;  1W3X A;  1WW7 A;  3ALQ A;  4PHZ A;  4SBV A;  5AC9 2;  4M3C B;  5KR7 A;  4XJ9 A;  2XJR A;  1XB9 A;  3WW2 A;  4QPI A;  1W8H A;  2GND A;  4D7S A;  3WF3 A;  1POV 1;  4B8E A;  3MF6 A;  3USU A;  2VZQ A;  1U5X A;  2WZE A;  2HEV F;  4PLN A;  3U4X A;  1O6U A;  4L2N A;  4EYU A;  5LBE A;  3I3B A;  3AYE A;  4NHL A;  1ENX A;  1LES A;  4TWT A;  1JXN A;  4FQ4 A;  1MVE A;  5FIX A;  2ZKL A;  3U37 A;  1HRI 1;  3I2G A;  2IC1 A;  1EUT A;  1SDD B;  1W6M B;  1AJO A;  1F31 A;  2BNM A;  4QX0 A;  5HCB A;  1WGP A;  4HET A;  1QU0 A;  1QF3 A;  1CAV B;  1LOG A;  3BVC A;  1UXZ A;  3CZJ A;  4AQS A;  4NRP A;  3W5M A;  4QMA A;  2J1E A;  2D5H A;  4MHR A;  4YGE A;  2C5D A;  2JG8 A;  1LOA A;  2RR1 2;  3AP6 A;  4GUL A;  3ECQ A;  4XFC A;  3OPT A;  3VKF C;  3VZN A;  1QH7 A;  1KEX A;  1X33 A;  4UBG A;  2RR1 3;  3VL9 A;  1VR3 A;  2B42 B;  5B4X A;  1LUL A;  4HN0 A;  3OD4 A;  4MGQ A;  5FZF A;  4XUO A;  1JMU B;  1R1A 2;  1TVG A;  2JG8 B;  4IER A;  2X53 S;  1UNB A;  1QY4 A;  5FQ0 B;  4PDW B;  4CTE A;  1R09 2;  1TME 3;  3K3O A;  3LB9 A;  3B9C A;  3BAL A;  5EV7 A;  1F2N A;  5A6Q A;  1OLM A;  1IGO A;  5FMO S;  2XOM A;  2QQN A;  1AL0 G;  3H8R A;  1R09 3;  2OUJ A;  3ZYH A;  1SLC A;  5FZ4 A;  4R52 A;  3WR0 A;  3ILF A;  3ZFG A;  2P3Y A;  4UW3 A;  3K75 B;  2YGM A;  1K5M A;  5FP3 A;  3ZYP A;  4IES A;  4RA0 A;  1UZV A;  3JZV A;  4HVQ A;  4L99 A;  4O61 A;  2WNU C;  2R7E B;  5FPU A;  2FCU A;  4FAG A;  2LTN A;  1UYP A;  4A6S A;  2RS3 3;  3OB8 A;  1UZW A;  1X7N A;  3EB7 A;  1C1F A;  3M4F A;  1AR8 1;  2WAB A;  4M3C A;  3RZG A;  3WF0 A;  4IEV A;  5FJK A;  5IW0 A;  3EO6 A;  3ZMO A;  5DPN A;  2EIB A;  3GAL A;  3WDX A;  3VBU A;  5G04 L;  2FBE A;  2VM9 A;  1POQ A;  1V0A A;  3J8F 1;  3Q8B A;  1NA1 C;  3LA7 A;  4IEY A;  2LAL A;  4MV2 A;  1IG3 A;  4UW5 A;  1CAW B;  5LBF A;  3OBR A;  2F6B A;  1ULC A;  1PO2 3;  5LEK A;  1W04 A;  4Z07 A;  4XQ4 A;  3S30 A;  3KZ4 C;  2UYA A;  4CU9 A;  1OQE A;  5J09 A;  3C2U A;  1AHS A;  5F5Q A;  3RYR A;  4BQ5 A;  1PK6 A;  4N53 A;  4FPL A;  5H9Q A;  3GBG A;  5A7N A;  1AF9 A;  1ND2 A;  1ND2 C;  1OMI A;  1NUK A;  3NO8 A;  4HVR A;  1CZV A;  1QXR A;  1IS5 A;  1YUD A;  2ZJC A;  4NRO A;  4QD2 A;  4Y5S A;  5EQU A;  3VB9 A;  1LJ7 A;  1ALY A;  1UOB A;  2PTM A;  2RV9 A;  2UWC A;  4AED C;  3D8C A;  1QJY 1;  1HX6 A;  3AP7 A;  3CF6 E;  3R4U A;  2EAK A;  4LPL A;  1PO1 2;  4O7X A;  4BOW A;  4EN6 B;  4V2V A;  2GC3 A;  3O1R A;  1VJ2 A;  4WM8 C;  1QJZ A;  4Q1R A;  4I09 A;  1DYP A;  2WAA A;  4RS5 B;  5BYN A;  5FQ0 A;  1PIV 3;  1VBD 2;  1WA4 A;  2NM1 A;  1JYN A;  2FCV A;  3DEC A;  3T2O A;  3H8O A;  3ATG A;  1PGL 2;  3B3Q E;  4NE9 A;  4TLG A;  3VKN A;  1RUG 2;  3S57 A;  4Q0Q A;  3OUI A;  5IFT A;  2ARC A;  3USU B;  1ND3 A;  5FYS A;  3QBQ A;  3III A;  1UZY A;  4CXW A;  1VPH A;  5FY0 A;  4LHL A;  1W2N A;  1WCS A;  3MDP A;  5A7W B;  2WO2 A;  2W08 A;  2X29 A;  3Q8E A;  3FBY A;  1QJX 2;  2BWA A;  2DCY A;  3POF A;  2BVV A;  1EPW A;  4OUS A;  5A6Y A;  5JWP A;  3F95 A;  1X8E A;  1J1T A;  1QMJ A;  2VQ0 A;  5FBJ A;  2FDG A;  1RUE 1;  2FMD A;  4AVB A;  5F3G A;  4UWD A;  4XF0 A;  4S2F A;  5C6C A;  5LBB A;  4BDV B;  2VZS A;  3AYD A;  3T2Q A;  2PHR A;  3RYK A;  4XEZ A;  5CFC A;  2HWF 3;  2YDE A;  2YUE A;  1UPS A;  3KV6 A;  3I2O A;  1RC6 A;  3WVJ A;  1N3Q A;  4HKL A;  4YGB A;  4XIO A;  4R8H A;  2VXJ A;  4LMF A;  3OEB A;  1V6K A;  4TN7 A;  4CEY C;  1DQ0 A;  2RS3 1;  3LOB A;  2JEM A;  1AYM 2;  2A70 A;  2V4A A;  1AYN 2;  5JOY A;  1UZZ A;  2HYX A;  3POW A;  2WA3 A;  3CU7 A;  4Y1Y A;  4PDW A;  4XFF A;  2E33 A;  5BY5 A;  1OF4 A;  1O4Z A;  3POS A;  2ZX4 A;  3OY8 A;  5IVE A;  4OMC A;  4C90 A;  5EP9 A;  1X50 A;  1NXD 1;  1RUC 2;  1RUF 2;  3WW1 A;  4BQ3 A;  3PJY A;  2WSV A;  2CYF A;  4OZO A;  4DXZ A;  1RUC 3;  2ATF A;  3AYC A;  3NNF A;  4H7L A;  5T5O A;  1MQT B;  3L2Y A;  3R05 A;  4Q4V 2;  4BIO A;  2PMW B;  2JG9 B;  1RHI 2;  4D6Q A;  1JUI A;  3VD7 A;  3NV2 A;  2H6C A;  2VE1 A;  4HXC A;  1CAX A;  1YLL A;  2Y38 A;  4S2H A;  4CCJ A;  1CAW A;  3A21 A;  1LGB A;  4Q4X 3;  2J1V A;  2ZGQ A;  3JUU A;  1H8V A;  3W58 A;  3WP3 A;  4Z8B A;  1S0J A;  1ACC A;  3E1F 1;  2ERF A;  3TBD A;  4HLT A;  2ZHL A;  4MZU A;  2E63 A;  1H8T B;  3AL6 A;  1CJD A;  1QJE A;  1QQP 3;  5HI0 A;  4Z1V A;  4XW3 A;  4FPE A;  4JRL A;  2J1T A;  4JX0 A;  4YFW A;  4BZ4 A;  3R6S A;  3MIG A;  3WNK A;  2PYT A;  4P5Y A;  5DN2 A;  1W0P A;  3P5B A;  4K9S A;  1RL3 A;  3WDY A;  1PGL 1;  4QU2 A;  5BNO C;  5BNO A;  2E26 A;  2FCT A;  3LPG A;  3LSD A;  1GV9 A;  2BDR A;  3MF9 A;  4A3X A;  4FFF A;  2ARA A;  2VW2 A;  2ZHK A;  1DBN A;  3N7K A;  4N8M A;  4AQT A;  4IEU A;  1W8F A;  2C0Z A;  4A42 A;  1OFN A;  4AAP A;  1OUR A;  5JI7 A;  4CU7 A;  3BTY A;  1QKQ A;  3H8U A;  2JIC A;  5FO7 B;  3UK9 A;  3H42 B;  3ABZ A;  5F3C A;  1G9F A;  5JAX A;  2BOI A;  4PIZ A;  3I3D A;  3LKJ A;  1MPX A;  3TAY A;  4JGY C;  1LR5 A;  4JQT A;  1YRZ A;  4I3P A;  2XG3 A;  4LO4 B;  2Q4S A;  3PUH A;  2ES3 A;  3T0D A;  4YW5 A;  1KS4 A;  3LQC A;  2IXK A;  3JB8 A;  2ARB A;  4ZXE A;  2P1B A;  4ASK A;  3MW4 A;  3P3P A;  1MQT C;  1XE7 A;  1SLL A;  4ZU5 A;  3Q8C A;  4IE5 A;  1ZZ6 A;  2YZ4 A;  2VPV A;  4UYB A;  4MGS A;  1OPM A;  3VBS C;  3DXU A;  1AL2 2;  4Y4R A;  5A1L A;  2ZMK A;  4F7Z A;  1JZ6 A;  4NIH A;  2VR4 A;  1V6J A;  1W6O A;  1S2E A;  4CDW B;  3O1T A;  2HJI A;  4LBQ A;  5F8P A;  4OI2 A;  4F3J A;  4OI0 A;  2VUC A;  3KQ4 B;  2ZGS A;  1UMI A;  3KLS A;  3W5N A;  1SLB A;  1F5J A;  1OKO A;  2QQL A;  3IMM A;  2CTV A;  4XET A;  2RDR A;  4JCK A;  1RUI 1;  3T1M A;  5CZK A;  1X36 A;  1CZS A;  1N3P A;  3GDB A;  4RGG A;  1W8U A;  5CU1 A;  1GUI A;  1QJY 3;  4UI9 L;  4L11 A;  3RS6 A;  5CBL A;  3KD4 A;  2XJV A;  1BMV 1;  1PM4 A;  2YY1 A;  2R32 A;  4WVM B;  1CON A;  3RWK X;  2HH9 A;  2RDS A;  4XUQ A;  4CP9 B;  3BPS A;  2BGP A;  1XQN A;  4Y24 A;  3FWE A;  5FPB A;  3IDC B;  4XCB A;  4CCK A;  4Q4X 1;  4XFI A;  2W68 A;  3B93 A;  1Y43 B;  2O14 A;  3L2H A;  4IEP A;  4NIA A;  3GJB A;  3TNQ A;  3FZ3 A;  4QPG C;  5LRR A;  1WBL A;  3VD9 A;  3HN3 A;  2DCK A;  2ADE A;  3PVN A;  4AVV A;  4EQV A;  2VH9 A;  1ULP A;  2BFU S;  4CDQ B;  4JZR A;  4XJA A;  2E7T A;  2ENR A;  1QOT A;  4LOS A;  2WZP P;  1BEV 3;  4GKY A;  4Q29 A;  4HKW A;  1PMJ X;  1YFX A;  2W1W A;  3JD7 3;  5DAW A;  4EWE A;  1IHM A;  4K7J A;  4MXW A;  1BBT 2;  4URT A;  5DXD A;  5HV0 A;  2J1S A;  2PAM A;  1US3 A;  2G9G A;  4ERO A;  4URA A;  5GM0 A;  1RYY A;  2VOW A;  4JKM A;  1UY4 A;  4XDO A;  4RHV 1;  1G7Y A;  1RUE 2;  2BTV C;  3WIN E;  3C7O A;  5JI9 A;  1XND A;  2R04 1;  4OCT A;  1PVC 3;  1YNA A;  3LEM A;  4PIX A;  3S5Q A;  4COZ A;  5FZ3 A;  4AED B;  3WQB A;  2AR6 A;  3N3H A;  4FPC A;  4WVV A;  1A34 A;  4P9Y A;  4CCL A;  5KWR A;  3I2I A;  4QHZ A;  4RHV 3;  1RIT A;  3FHQ A;  1U12 A;  2DVF A;  1W03 A;  4LKD A;  1WW5 A;  1XPW A;  2IXI A;  2QE3 A;  4IEW A;  3ZFG B;  2BFU L;  5JZG B;  2C6S A;  4FPO B;  3ZPY A;  2AUY A;  5E16 A;  4BQX A;  3RZK A;  2DBN A;  1LHN A;  3U0Z A;  2LRO A;  4YW4 A;  2CWS A;  1VP6 A;  2BWC A;  4FT8 A;  1UY3 A;  1NCQ B;  3RFR A;  2A3Y A;  4MO3 M;  3E5X A;  4AE2 A;  2DCJ A;  4DFS A;  4GMP 0;  1AX0 A;  4CP2 A;  1GNZ A;  3INA A;  4C0B A;  1LRH A;  1TME 2;  3POJ A;  2I07 B;  4XF3 A;  1NCQ A;  3T2P A;  2QQJ A;  4XBN A;  4D7Y A;  4Q4W 3;  3ILR A;  1MAC A;  4LUM A;  3OGG A;  2WQZ C;  3AJY A;  4BA6 A;  3EHK A;  3OD0 A;  3NKG A;  2FHR A;  4QHO A;  3U11 A;  5JDB A;  1UIJ A;  3ZYB A;  3QH7 A;  5LA1 A;  1AUY A;  2A6Y A;  3GCX A;  2WT2 A;  2RS3 2;  1UXX X;  4IE4 A;  1FPN 3;  4QX7 A;  4XFH A;  3VBO C;  3OTF A;  3DKW A;  3GZA A;  2MEV 1;  3LWC A;  4I0A A;  4OUE A;  3PVE A;  3KT7 A;  4JQR A;  4UFK A;  1RUO A;  4XFA A;  4OUL A;  2DVG A;  2VUJ A;  4GZ9 A;  3AZZ A;  4QKF A;  4XFB A;  4BYY A;  4EN0 A;  4EWD A;  5KHI A;  1HB3 A;  4ZON A;  1JYC A;  3WP6 A;  4AFC A;  2ZGU A;  2B8M A;  4WVM A;  2TBV A;  5A3L A;  5JOX A;  1HXS 2;  1NKG A;  1H1M A;  1S0G A;  2CGN A;  2VUA A;  3GYD A;  4ZU7 A;  4CEW C;  1N1S A;  1NYW A;  3PUS A;  3W20 A;  4ES8 A;  3JXS A;  4P9W A;  1PK6 C;  1FAY A;  3MUZ 1;  1TNR A;  3H7Y A;  4QB1 A;  5FZB A;  3VBF A;  3VBF C;  2P34 A;  2G9F A;  2WNU A;  5KHH A;  1RUI 3;  4XXA A;  1DQ6 A;  1RMU 2;  4Z92 B;  4XAB A;  1TMF 1;  2VY0 A;  5FPA A;  5C9A C;  4MGK E;  3BTA A;  4QWN A;  4E8C A;  2RG4 A;  3VZJ A;  5JR7 B;  3MW2 A;  3FLR A;  4H14 A;  3KVB A;  2GP3 A;  3HR9 A;  1FOD 3;  2DUR A;  2EAL A;  4BXF A;  4IXL A;  4YAR A;  4DUX A;  3VBH C;  2Y0I A;  3PU8 A;  3LEK A;  1IKP A;  1R64 A;  2Q5T A;  4CCD A;  2X10 A;  1BK0 A;  1LOB A;  4NPL A;  5A7S A;  1Y9Q A;  4AGR A;  4LBO A;  5DAV A;  4PQQ A;  1ENR A;  1OH4 A;  5KHG A;  3JU9 A;  4A2U A;  2ZX1 A;  3ACH A;  1GP6 A;  4KWK A;  3P1I A;  3I7D A;  1YIP A;  1RUG 3;  4AED A;  4GH4 B;  1APN A;  3S7E A;  1YFY A;  2VW1 A;  1V6I A;  2FZ1 A;  4C1X A;  1SDW A;  4EN9 B;  1QNY A;  3NNJ A;  4N9I A;  1LU2 A;  3WY6 A;  5JZG A;  1CX1 A;  3ZYJ B;  1FT9 A;  5BV6 A;  3LEG A;  3TB0 A;  4QQ2 A;  2ZA9 A;  3EQE A;  3U14 A;  2R6Q A;  4MXW B;  4E2G A;  4Z2W A;  1BK1 A;  2DDU A;  2EXH A;  2WS9 3;  2Y6K A;  2Y6J A;  3MIF A;  4DEQ A;  2Y60 A;  4HL0 A;  1GYK A;  4XZP A;  5LBC A;  2WII B;  3ZXJ A;  1I5P A;  5LY1 A;  2I2S A;  3AMM A;  1CIY A;  2WS9 2;  2XLA A;  3KCC A;  2GU9 A;  1OD5 A;  4ARX A;  4AAX A;  1XOY A;  2GZW A;  3HT2 A;  5FZ6 A;  4MVT A;  4XE9 A;  3BB6 A;  2JE8 A;  4IV3 C;  3PUI A;  1VAL A;  4WV8 A;  3PTY A;  1V9U 3;  4ZU4 A;  3A0K A;  1XNT A;  2F4L A;  2XGX A;  5AFE A;  4KQ7 A;  1DCS A;  4E4D X;  2RJ2 A;  1W2A X;  1DQ4 A;  2OII A;  5F5C A;  3S7I A;  4AQ6 A;  3DPR C;  3LSE A;  2ADD A;  2XUM A;  4QXC A;  2RDN A;  1GOG A;  1UY0 A;  4GIQ A;  4YVS B;  1QH6 A;  1A8D A;  3I59 A;  4DNY A;  1RUF 3;  2W52 A;  2JE7 A;  5J7M A;  3I3M A;  3VZM A;  4CDX C;  4FOV A;  4DXR A;  3C7F A;  2X05 A;  4MHU A;  4XBL A;  1QJX 1;  1PX4 A;  1OC1 A;  3AJZ A;  1GP5 A;  1AX1 A;  1QJU 2;  1W9Y A;  4CDU B;  1C5I A;  2FZ2 A;  1FNY A;  2TEP A;  1HJF A;  4NJ4 A;  3AZY A;  1SLI A;  2D3S A;  3ENR A;  5M0T A;  2HWB 1;  1WCK A;  4QX2 A;  3WQ1 A;  2H6B A;  2NMN A;  2Y0O A;  3V0A A;  2YG0 A;  3KB5 A;  1JTZ X;  4FO9 A;  1YQ6 A;  2XDV A;  3U4S A;  4LOT A;  4P9X A;  4PI0 A;  2H0V A;  2IXL A;  3EXU A;  4QX5 A;  5FY1 A;  2YC4 A;  4CDX A;  3TEY A;  2UWB A;  4OYU A;  3WXP A;  2ZMN A;  3VBU C;  1NY7 2;  3OOX A;  5IYY A;  1VBC 1;  1WLC A;  2G9Z A;  2IXJ A;  1UOJ A;  1CN1 A;  3MO4 A;  3DUI A;  1IG0 A;  2MEV 2;  4U36 A;  1A6C A;  4HBN A;  3ZXF A;  3OJB A;  4HN1 A;  2P5B A;  4FVV A;  1HRI 3;  3ZR5 A;  2YU1 A;  1F5F A;  2NLR A;  4X8P A;  2ZGT A;  4K20 A;  4AVC A;  2V5D A;  3K51 A;  1LOC A;  5FLJ A;  3DXT A;  5EJ1 B;  1D2S A;  1SMV A;  4J6G A;  1OHF A;  4Y1X A;  4XBQ A;  5D8A A;  3H3U A;  3RG0 A;  4S2G A;  4FXG B;  5KXB A;  1VB2 A;  2VQU A;  4KU8 A;  4Q0U A;  3B5L B;  2HWC 2;  4M01 A;  4O9G A;  4CDW C;  1PO2 2;  1LEM A;  3H50 A;  5E89 A;  2PQS A;  3TOJ A;  2QQV A;  1RUH 2;  1H2L A;  2ZCW A;  4BQ1 A;  2R16 A;  4HSJ A;  4CU8 A;  5IUQ A;  5FOB B;  5BNN A;  5IWF A;  3SKJ E;  2ZHM A;  1FV3 A;  3R4S A;  1UY2 A;  3MZH A;  2QCS B;  1Y7B A;  2VGD A;  5K0U B;  5JSR A;  1UMZ A;  2XBO 3;  4QXB A;  3GBW A;  2RJK A;  3J7N A;  1GQP A;  1YQ2 A;  2OX0 A;  5E8A A;  1POV 0;  2VZ1 A;  2A3X A;  4GMP 3;  1ND3 C;  3NWK A;  5CIR A;  2PHF A;  5FMC A;  1QQP 1;  2JDH A;  1LHU A;  1NCR B;  3ZYG A;  5EPA A;  1SQ4 A;  1ULG A;  2ORZ A;  5C71 A;  3RDI A;  3PL0 A;  1PIV 2;  1VBD 3;  2EVX A;  5IHR A;  4Z82 A;  4IV1 C;  3VGI A;  4PCR A;  2WO7 A;  4CDU A;  1B35 B;  3PHM A;  5ISL A;  2VZP A;  4E2S A;  1CES A;  5FPV A;  2JB8 A;  4JV4 A;  2VEC A;  4PLM A;  1JHJ A;  3AKS A;  2J1R A;  4XJ8 A;  5L7O B;  4XTM A;  4NVP A;  1IS3 A;  2PLV 2;  2A3W A;  3FN9 A;  1JZ2 A;  2AYH A;  1YO8 A;  2AH2 A;  1H4H A;  3T1L A;  4WVZ A;  3LF7 A;  1EP0 A;  4OI1 A;  1LOE A;  4GD4 A;  2P3I A;  3VN4 A;  4IV3 A;  4IV1 B;  1H8T C;  3ZSJ A;  1AXK A;  3D0J A;  2X5I C;  3R4D B;  4JDO A;  1JYI A;  1C8N A;  4K6B A;  3IAQ A;  5DAB A;  3HMY A;  2WR9 A;  1MS4 A;  5KC5 A;  2LS6 A;  4ZKT B;  4B7K A;  1DU3 D;  2WN2 A;  2VCA A;  1QWR A;  5FZE A;  1Q8Q A;  2OS2 A;  1J3R A;  2KXL A;  3MEP A;  4HVO A;  4Z2A A;  2YB7 A;  3JD7 2;  4DPN A;  3WP5 A;  5CFC B;  4UXA A;  3UT0 A;  1UF2 C;  2YPJ A;  3HT1 A;  4BME A;  5IK8 A;  2EA7 A;  1JYW A;  4AZZ A;  5LAT A;  3M3E A;  3S0M A;  2VTX J;  3RRD A;  1RUE 3;  1GBG A;  4A4A A;  2ORX A;  3POI A;  4BQ2 A;  1LOD A;  1O59 A;  4QPY A;  2EXJ A;  4YW3 A;  3ZKY A;  4N90 A;  3VHN A;  4Q1P A;  4RN5 A;  5FRE A;  1HKD A;  2ZGR A;  3RZZ A;  3JCI A;  2IVI B;  1XNC A;  2HWB 3;  1V6O A;  5GLT A;  1UZ0 A;  4PT6 A;  2WJS A;  4NAM A;  1AR6 1;  4KGQ A;  5JPM B;  5K9Y A;  2NP0 A;  5EIY B;  5J36 A;  3CQO A;  3SKV A;  5JR2 A;  1CAU B;  2E31 A;  2JIG A;  1W8Z A;  1CIW A;  3EBR A;  4CRQ A;  4UFJ A;  1E57 A;  5FPZ A;  1OFS A;  1RUJ 1;  2IVJ A;  4NWV A;  4AQ2 A;  4JHZ A;  1XC6 A;  1GZW A;  3KQR A;  3FHA A;  5LB6 A;  3SIT A;  3MPP G;  4D0Q A;  4RR3 C;  2E51 A;  4N9H A;  4QM8 A;  5LWB A;  1VBC 2;  5EFU A;  2BRT A;  5F5A A;  4IEZ A;  3WHT A;  4AOC A;  1QQP 2;  3H1Y A;  3DCQ A;  1VBA 1;  5CVR A;  5L9B A;  1S4C A;  2VQA A;  2HWD 2;  5C7G A;  2IFW A;  4XF1 A;  3ZXD A;  2Q1F A;  1LB2 A;  2VMI A;  2PHU A;  2WO1 A;  3IKW A;  3NV3 A;  5KXD A;  2GMM A;  1KQR A;  4GWM A;  1IZ3 A;  4MLO A;  5FZK A;  3I2H A;  4A45 A;  1HIX A;  4P08 A;  3IAP A;  2JB4 A;  2OZ6 A;  2Y6G A;  3D3A A;  1QHD A;  4XC9 A;  1V00 A;  4ZPI A;  1ZRI A;  1W05 A;  3HNM A;  4M00 A;  3VHO A;  5ANQ A;  3ZXA C;  4FPY A;  1WBF A;  2HEY F;  4AEK A;  4B29 A;  5C5U A;  4KWU A;  4A6O A;  3MPB A;  1W6P B;  3AMQ A;  3VDD A;  4NID A;  2WT1 A;  2PAK A;  1GMM A;  3KF3 A;  4G9S B;  3CHX A;  3S6P A;  3WCR A;  3HOB A;  2XKP A;  2W1U A;  1ONA A;  4XF4 A;  1TG7 A;  4MSV A;  5A1A A;  5LCW L;  3DYP A;  1K5M C;  2AAC A;  3RYP A;  3WDW A;  3VHP A;  1HXS 3;  3ZKU A;  4DY3 A;  1CWP A;  4EN7 B;  1O3T A;  4FTB A;  4JAA A;  2D97 A;  4RFR B;  3T2T A;  3ZMN A;  4ONU A;  4ET7 A;  4YW7 A;  5A3N A;  4I2O A;  1NCR A;  4PBP A;  1TME 1;  5FY8 A;  3ZFE B;  3IBM A;  3VBR C;  3VBR A;  4IGO A;  4EWA A;  4PJY A;  3WQ7 A;  5K7P A;  3BPZ A;  1LEC A;  3HPN A;  5DZE A;  3SCG A;  1FNZ A;  5FY7 A;  4J1W A;  3VD4 A;  4MG2 A;  1PZ8 A;  4ATF A;  1M4W A;  3AKQ A;  3SQO A;  3M3O A;  3PU3 A;  1O5L A;  5FYB A;  1CGP A;  1YQ5 A;  1NA1 B;  2W91 A;  2XJU A;  3GZT B;  3VHR A;  5CFD C;  5LEJ A;  4P00 B;  2CAU A;  3SXW A;  1AXY A;  3ZSE A;  2AEZ A;  1FYU A;  1JOJ A;  4DMI A;  4HAN A;  5C8C B;  2VCB A;  4FPH A;  2Q1Z B;  3CKH A;  1UY1 A;  3IDA A;  3AP4 A;  4BQY A;  1E5R A;  4XF9 A;  1W9W A;  3NV1 A;  4CPB D;  1AR6 2;  3CJI B;  3LA2 A;  3GJA A;  3ME2 A;  2RJL A;  4LLF A;  3FUQ A;  4QX1 A;  2A73 B;  2D3R A;  4DB5 A;  2WFF 1;  4I30 A;  2OZJ A;  5KBF A;  5FZI A;  3SH5 A;  1AR6 3;  4NHX A;  2VUD A;  1W8W A;  3G7D A;  2VMD A;  3VUO A;  2FQP A;  5FZ1 A;  2WNV B;  4KWJ A;  5FP8 A;  3O7O A;  1ZZ7 A;  1AYN 1;  3BIW E;  3DYO A;  3OYW A;  1RIN A;  2Z5W A;  1O4T A;  5FWJ A;  3VD5 A;  2VZ3 A;  1GP4 A;  2WAO A;  1JOB A;  3RWN A;  1O7F A;  1H9W A;  4RYD A;  3L9J T;  4PDW C;  2D93 A;  3WG3 A;  2CU5 A;  3VDB A;  3CBN A;  4Q4W 1;  1V70 A;  2QFE A;  5LAS A;  5KHJ A;  3NNM A;  3POY A;  4Q2F A;  3RQ0 A;  4D94 A;  4LT5 A;  3V0A B;  1FXZ A;  3NL1 A;  3URF A;  1SLT A;  4HKO A;  5FRA A;  1GQH A;  2W0X A;  3B01 A;  4IGP A;  1ODM A;  3GHM A;  5FZ8 A;  3VBF B;  1O8S A;  2VQT A;  2ZGL A;  4IE6 A;  3A4U A;  4GAL A;  1FAT A;  3RMX A;  5CEH A;  1PVC 2;  4XPV A;  1Q8O A;  1QJU 1;  4H55 A;  1VLN A;  1Y9M A;  3B7M A;  4LBL A;  2P17 A;  2R06 1;  5E88 A;  2BV4 A;  3IZO A;  4RGA A;  5ERL A;  4B4P A;  5DUX A;  1D0G A;  1PMI A;  2YC0 A;  3FJS A;  4Y4Y A;  3JD7 1;  4XUN A;  3TYJ A;  3P3N A;  2A1X A;  1QIQ A;  1SCR A;  5FZG A;  2WL1 A;  4ITC A;  5A32 A;  4QT6 A;  5C3Q A;  2DFB A;  2N7G A;  2QQO A;  4YYO A;  1GAN A;  2EXK A;  1VBA 3;  4LNV A;  1MEC 2;  5JUV A;  4GAZ A;  1YFW A;  1CX4 A;  1BXH A;  1LTE A;  2BZD A;  4OHY A;  3SEE A;  1VBA 2;  4KMQ A;  3EYP A;  4IQP A;  2E7A A;  2WWU A;  4I0B A;  5FZD A;  3JB4 C;  2W9X A;  4AI2 A;  4XJW A;  1DLC A;  1XNB A;  3WUC A;  1YQ8 A;  3H3Z A;  1URX A;  3A0N A;  2R1D A;  1V6M A;  2ZML A;  4XFG A;  5DAX A;  3UES A;  2CDP A;  2GH2 A;  2UUR A;  1VAV A;  4YPJ A;  2YV8 A;  3I8T A;  3N9N A;  3AXD A;  4K1Y A;  5C8C C;  2VNR A;  5CKQ A;  2VUL A;  4XAA A;  3ES1 A;  4XIL A;  2BER A;  4UBH A;  1G9A A;  5CIS A;  3OSD A;  1H4G A;  2Y34 A;  4QQP A;  3ACG A;  5HPO A;  2KR2 A;  2Q8C A;  1SG3 A;  1PVX A;  4P5H A;  4FPG A;  4LO8 A;  1AR7 3;  4JGY A;  1C8M 3;  2FDJ A;  5CAZ A;  1JOP A;  1Q56 A;  4YG0 A;  3RJ2 X;  4LE3 A;  4GWN A;  4UW4 A;  1YXW A;  1V6N A;  2UYB A;  2JKX A;  1DP0 A;  4I0W B;  4TSV A;  1LHO A;  5SV8 A;  4RSU A;  3ORJ A;  5D8A C;  1UD1 A;  2WYF A;  1SPP A;  2QNK A;  2ZEZ A;  2KM2 A;  1XNA A;  3R0R A;  4EZH A;  2XJQ A;  2ZGO A;  1DGR A;  1JH5 A;  1NA1 A;  3K3N A;  5AC9 1;  3ST7 A;  5EJZ B;  1WME A;  1UOF A;  4KH9 A;  4CSW A;  1L3J A;  3E5U A;  1QXP A;  1REE A;  3U07 A;  1EV1 3;  4XCA A;  4Y20 A;  3KSC A;  4BWO A;  4TYS A;  5C3O A;  1P8J A;  3I97 A;  3IT8 A;  4FQZ A;  5A6Z A;  5BUV A;  1RUI 2;  3T08 A;  1JYV A;  1I5Z A;  1HB2 A;  5L9V A;  5FPX A;  2EF6 A;  1Q8V A;  2VZT A;  4GH4 C;  4BH9 A;  3DGT A;  1Q43 A;  5FZ7 A;  1ST8 A;  2EXI A;  2XB6 C;  4QPG A;  4EV0 A;  4M4P A;  2V5Y A;  1UU4 A;  3HBK A;  2A6X A;  5LY2 A;  1D4M 3;  2P3J A;  1PX3 A;  1DGL A;  4D8M A;  5JPN B;  2WLQ A;  5LA9 A;  2Z79 A;  2YGL A;  1ULF A;  3AM2 A;  4GJZ A;  5F37 A;  1MZ6 A;  5A33 B;  2B4K A;  5C5T A;  4K21 A;  5I0T A;  3HN1 A;  1IOA A;  1GR3 A;  1MS5 A;  1TNF A;  3DN7 A;  5FYZ A;  5DQ0 A;  3ZN6 B;  5C4W A;  4DXS A;  1GU3 A;  1MS1 A;  4MOA A;  1NZI A;  2YRO A;  2ZTN A;  2D40 A;  4OFG A;  4UOJ A;  1HV1 A;  1MQT A;  1VBD 1;  2LUW A;  3RMY A;  4K3U A;  4XMI A;  3CJX A;  3VKO A;  2FD8 A;  4LUL A;  1HQN A;  4LOR A;  1HRV 3;  2D43 A;  1OOP C;  5GZD A;  1PIV 1;  2XXZ A;  1PNG A;  3E5Q A;  4GWI A;  3ZYI B;  1EPZ A;  5FXZ A;  2BPA 2;  2JDN A;  3ZR6 A;  3UKN A;  3RGB A;  4W6W A;  1ZNP A;  1OQ1 A;  2MNG A;  4UT5 A;  1KIT A;  4LBJ A;  1WLD A;  1W39 A;  3ES4 A;  4DZG A;  2YU2 A;  3B69 A;  1UO9 A;  3MID A;  1Z0H A;  4AEM A;  2IXC A;  1WA6 X;  2RMU 1;  2XQX A;  4QAW A;  4DOU A;  4LK7 A;  2WNV A;  1AYN 3;  4XUP A;  1O3S A;  2RS1 3;  5FK8 A;  4AHW A;  1F9K A;  2PXJ A;  5DUU A;  4CZS A;  3J9S A;  2C9K A;  3OYW B;  4NHM A;  5EZW A;  4IEO A;  5L9R A;  3ZLI A;  2A5Z A;  2E6V A;  5A3M A;  1DGW A;  2D98 A;  4OQ8 A;  3I2K A;  2RS1 2;  3ZVX A;  2Y8K A;  4I3G A;  4AI0 A;  3CJI C;  5JCT A;  4LO6 B;  1KFU L;  5EYY A;  4XZU G;  3E6D A;  3E97 A;  3UKV A;  3SLI A;  2ZEW A;  3ZYR A;  1Z78 A;  2BJS A;  2VVD A;  4RFT 0;  4BHP A;  4LKE A;  5JSO A;  5GLZ A;  4QQH A;  1LGN A;  2VNV A;  4LIU A;  1ENQ A;  3ZFF A;  2WZR 3;  4Q8K A;  3BCW A;  1W3V A;  4R4Z A;  3J26 N;  2R30 A;  3OUH A;  2PLV 1;  2ZXQ A;  5FOJ B;  3WF4 A;  1HN0 A;  1TQ5 A;  2RE9 A;  2CAV A;  5FR3 A;  1QJF A;  4QQL A;  3SMH A;  5BNP C;  2JIJ A;  1NCQ C;  1WCD J;  1ZA4 A;  4Q4X 2;  1SHW B;  4UFI A;  3ZIX A;  1QJU 3;  5GLW A;  2P6H A;  3KT1 A;  2R04 2;  1XU2 A;  3LIG A;  2J1A A;  1XSQ A;  2GME A;  3FLP A;  2YC2 A;  3VDD B;  2HWE 3;  2TNF A;  3K48 A;  4HZF A;  2VTX A;  2Q30 A;  2HBT A;  2CSG A;  2JXA A;  4OQ9 A;  1F4A A;  1K45 A;  3ACL A;  4CUC A;  2FMY A;  4COY A;  4F8A A;  4DIQ A;  5CKN A;  1NXM A;  4HMZ A;  1K5M B;  1OLQ A;  4FCA A;  1C3H A;  4K8R B;  5DUV A;  1QGL A;  1W8N A;  2QQW A;  2HWF 1;  5T54 A;  2D6M A;  4L92 A;  3KGL A;  1RUJ 3;  3KT4 A;  3IMN A;  1UMH A;  1UX6 A;  5IAX A;  1VE0 A;  2OUH A;  2MEV 3;  3B00 A;  4QDR A;  4YM0 A;  2W1S A;  3M8L A;  4RQP A;  4RR3 A;  1ASJ 2;  5F6L B;  2ZHN A;  4BE3 A;  5HCA A;  4NII A;  4DO0 A;  1OLR A;  3AKP A;  3ITQ A;  1OF3 A;  4X8N A;  4YVW B;  3GXU A;  4PBO A;  4Q0V A;  3V64 A;  1OT5 A;  3BOP A;  1W6P A;  5EJ3 A;  3WOG A;  2VVE A;  1CVN A;  1HB1 A;  1RJ7 A;  1RIR A;  2XUE A;  2BBA A;  5ACA 2;  5FLI A;  4CP1 A;  4NO4 A;  4QPW A;  2VNG A;  1AR7 1;  1RUH 3;  2JDP A;  1C4R A;  2QQU A;  4CCO A;  1T6B X;  4QPG B;  4NWW A;  3I2J A;  5J48 A;  1NE4 A;  3WNM A;  3GZU C;  3D5O A;  2VC9 A;  1MS3 A;  4FOQ A;  2ET7 A;  1GSL A;  1O3R A;  1K42 A;  1J3Q A;  1GWM A;  2DWR A;  1GZT A;  2BQP A;  1DZT A;  4UFH A;  1X9T A;  2BU9 A;  3S5A A;  1OOP B;  4WM7 A;  4EJR A;  4LKF A;  3IPV A;  3LEI A;  5I0S A;  1PHM A;  2JDM A;  1IPJ A;  1DQ5 A;  3IDE A;  3PNA A;  2XHN A;  3N9L A;  3MYX A;  2EAA A;  1S55 A;  3GGL A;  2WUH A;  5FYI A;  1K3I A;  3UL2 A;  3F2Z A;  4ASM B;  1X9P A;  4HOO A;  2ZS6 B;  2YYO A;  4A7Y A;  5CB7 A;  3ZFE A;  3T09 A;  2YBK A;  4NAO A;  4DUV A;  1ULE A;  1OUX A;  4XJU A;  3AP9 A;  1BVP 1;  3PIG A;  5GZE A;  2X8K A;  3VBS B;  3WUD A;  4AVT A;  3CMG A;  4LTA A;  1W2O A;  2PLV 3;  4LIT A;  1TEI A;  5F39 A;  1FOD 1;  5FMO L;  3VL8 A;  1Z7S 3;  1LCL A;  3IDB B;  5T50 A;  2ARE A;  4GB3 3;  3WD5 A;  1AZD A;  3UYJ A;  4BQW A;  5FMB A;  3N9Q A;  2OQ6 A;  1G8W A;  1LU1 A;  1OQD A;  2XJP A;  1XYP A;  2JDY A;  4MYE A;  4AF9 A;  4MUV A;  4JGZ C;  1XRU A;  4N43 A;  4LIV A;  1MS8 A;  2XWJ B;  1VMH A;  3C8X A;  3BUC A;  3B9I A;  3U1X A;  1MVQ A;  2XHK A;  2XL7 A;  5A1F A;  2QZ2 A;  3DPR B;  2SBA A;  3EJK A;  3ZO0 B;  2BVB A;  3VKL A;  3NST A;  2YBP A;  3AXE A;  3N35 A;  3QH6 A;  4LEJ A;  3UGF A;  1LOF C;  1RUC 1;  2XR4 A;  5FY5 A;  3OUJ A;  5C3P A;  3ELN A;  2BP6 A;  5DDJ 2;  3C3V A;  3ZSK A;  1ASJ 1;  5SV5 A;  1J84 A;  3THT A;  4Y1V A;  1ODN A;  4IND A;  5CYY A;  1COV 1;  5EWS A;  2BYV E;  2J42 A;  4JGZ A;  3WNN A;  5FLH A;  3TEX A;  4YZ1 A;  3ZDS A;  1D2Q A;  2HBU A;  3NJY A;  2W1Q A;  2W87 A;  1US2 A;  4HON A;  1E5I A;  4DY5 A;  3LZZ A;  4LUK A;  4RHV 2;  1UYZ A;  3E6C C;  3MIC A;  4W6Y A;  3VDC A;  5HXM A;  4LA3 A;  2CHH A;  4YG3 A;  4I01 A;  2HWB 2;  3KV4 A;  3N36 A;  4QDS A;  4QB6 A;  4NIG A;  2QDR A;  3FBM A;  1DQ2 A;  4A44 A;  3AKT A;  1YI7 A;  4YZ2 A;  2VW0 A;  1STM A;  3K46 A;  3NJV A;  3O5S A;  5CA6 A;  4W8J A;  2ZOE B;  5F1R A;  5I8T A;  3W9A A;  2VMF A;  4AR2 A;  4P14 A;  2K2S A;  2V72 A;  5FYM A;  3VLB B;  3WW4 A;  2WIN B;  1W6O B;  4CDW A;  5IFP A;  4FSJ A;  2A6W A;  4QX3 A;  3N7L A;  2OW4 A;  2JJ6 A;  2XL9 A;  3MGU A;  5HBA A;  1R08 2;  4AFD A;  1OKQ A;  2D6N A;  3AC0 A;  1KD7 A;  2YMZ A;  1VRH 2;  3H1W A;  1WW4 A;  3HQR A;  3J7H A;  3O0V A;  1WMD A;  3OF1 A;  4XJZ A;  5DG2 A;  4D3W A;  3TRS B;  1VMJ A;  4YZ4 A;  5BNP A;  2P2K A;  3GCW A;  2BW8 A;  2HKX A;  2YHJ A;  3MUY 1;  3AMH A;  5IT6 A;  4BIS A;  1W6M A;  4B3N A;  1JZ3 A;  2RMU 2;  2QKD A;  4CEW A;  5C33 A;  1FPN 2;  5C9A B;  4EZ4 A;  3USS A;  3AYA A;  1AR7 2;  4YM1 A;  3BU7 A;  1EV1 1;  4ATE A;  2RDQ A;  3UGG A;  5LK7 B;  5GKA C;  1I6X A;  1YI9 A;  2VG9 A;  5DAQ A;  5H9P A;  5BNQ A;  3BN6 A;  3A22 A;  4QQO A;  5LRS A;  3O1O A;  4V2W A;  3KVA A;  2D6P A;  2Y6H A;  5LK5 A;  1AR8 3;  1OLM E;  1XE8 A;  1OBN A;  1CAV A;  3Q9O A;  4SLI A;  3ZX7 A;  2A75 A;  2VOK A;  1HDK A;  2QUO A;  1YWK A;  4PIY A;  2RM2 3;  3ETP A;  1RUN A;  2E7Q A;  5I91 A;  4CUG A;  2QQK A;  4E4Z A;  5I0R A;  1NOV A;  5A7O A;  2JE9 A;  3ZDV A;  5JMO A;  2EIG A;  2NQY A;  2PHD A;  3AFG A;  2VVF A;  3H3L A;  1LNS A;  4GH4 A;  4XHX A;  3VBO B;  2JDU A;  1IQA A;  4R4X A;  2YPD A;  3PUA A;  1YIF A;  3DV8 A;  4CDU C;  4UFL A;  2GNT A;  5B4N A;  3KGZ A;  4WBB A;  1W8O A;  2RS5 2;  3M3C A;  1R09 1;  3OBT A;  4WVW A;  4BLJ A;  5JOW A;  2PHL A;  2CGO A;  1YYN A;  3ACF A;  3BOW A;  3SH3 A;  1N1T A;  5A3T A;  5F3I A;  1ZZC A;  2IXH A;  3K2O A;  1S0B A;  4B4Q A;  3GHN A;  4FFH A;  1QOO A;  4LQR A;  1HB4 A;  2ZX3 A;  1GZ9 A;  2QQI A;  1I9R A;  2JD9 A;  5GZC A;  2WRA A;  1OD3 A;  2VOX A;  2OT7 A;  1L7Q A;  4JVA A;  1LHW A;  3IM0 A;  5CFD B;  2WDB A;  4Y5T A;  1G9D A;  1KXG A;  5ANN A;  4N43 B;  1NQD A;  3SHR A;  5D8A B;  5F2S A;  4N53 C;  1KDK A;  2Z69 A;  1S0E A;  3J8F 3;  3ZXG A;  1VBB 1;  4NUB A;  2A6Z A;  4UF0 B;  3WNP A;  3MIE A;  3ZFE C;  1HRV 2;  4A7K A;  1RUH 1;  5C4W C;  5FMD A;  5JZG C;  3WNX A;  4CVU A;  1ZVF A;  1O3Q A;  1EAH 2;  1IS4 A;  1HXS 1;  2D7F A;  4TZD A;  3PUQ A;  5DDJ 1;  1NG0 A;  1U5Z A;  4D69 A;  3RZH A;  4E4H A;  1A3K A;  4LBK A;  1QOS A;  1GLH A;  3HJR A;  4HSL A;  4BU2 A;  1NZC A;  2XKO A;  2JDK A;  1OVS A;  3BU0 A;  2DVB A;  2XJS A;  4IGQ A;  2FDF A;  5JVV A;  1MZ5 A;  1V9U 2;  2ZEY A;  2C26 A;  4R9D A;  1NX9 A;  2ID4 A;  3OGR A;  3NJX A;  1E5S A;  2I45 A;  3TEZ A;  3LDB A;  1HQW A;  1LEN A;  1WUV A;  2BUK A;  2J1U A;  3G6J B;  5FPL A;  1C28 A;  4M4R A;  4R9A A;  5FO9 B;  5F32 A;  3LGR A;  3ZSL A;  4DQA A;  5H9R A;  5APA A;  2CY6 A;  1AJK A;  4FTS A;  4KG0 A;  2C4X A;  4YVW A;  3O0W A;  2HWD 1;  4JDM A;  5FKB A;  5A7Q A;  2FDI A;  4C1W A;  1J1L A;  5IK5 A;  1SAC A;  1H2M A;  3WDU A;  4YM2 A;  5A32 B;  4QU1 A;  4AI3 A;  5I93 A;  3T30 A;  4L8Q A;  4LO5 B;  4KBB A;  4C8D A;  5JXJ A;  5JXG A;  3AL5 A;  4RR3 B;  3ETQ A;  4B7E A;  1KS5 A;  4O9E A;  1NLQ A;  5FYU A;  4YGC A;  3NNL A;  2P6C A;  4B4R A;  1GFF 2;  5EXO A;  1REF A;  2VZU A;  3N9P A;  5A70 A;  5FYY A;  1YJL A;  3I49 A;  4COV A;  2Z42 A;  1S2B A;  4XDQ A;  1UKR A;  4QGL A;  3VBO A;  4CEW B;  4AFA A;  5HCH A;  5IVF A;  4BB3 A;  5JMC A;  3D6E A;  3QLQ A;  4DUW A;  3B02 A;  2NN8 A;  1IQD C;  5CKM A;  4XUR A;  4UFM A;  1HRI 2;  1KDM A;  2RS1 1;  1SZB A;  3DKQ A;  4Y26 A;  1CD3 G;  1C8M 2;  1OVP A;  5FZH A;  4R9C A;  1B35 A;  5A3U A;  2W3J A;  1WD3 A;  2WT0 A;  1ZRD A;  4H3W A;  1AX2 A;  1UPI A;  2C9A A;  1DIW A;  2GAL A;  2OQ7 A;  2Y33 A;  1BJQ A;  3WG4 A;  4DXT A;  3K77 A;  4DRV A;  1OI6 A;  4LHK A;  2H0B A;  3OY8 B;  1Y3T A;  1HRV 1;  3KF5 A;  5FYT A;  1RMU 1;  3U10 A;  3ZN4 A;  1ZBA 2;  2VMG A;  3I2F A;  3LFM A;  2ZEX A;  3D82 A;  4ZXK A;  4A3Z A;  4IEQ A;  1EV1 2;  1K5J A;  2QTW B;  4JDN A;  1BQP A;  3I3Q A;  1LAJ A;  1RVF 1;  4BJ0 A;  5C3R A;  3WCS A;  4D7T A;  3J4U H;  5CAD A;  1DF0 A;  5K4L A;  3T0A A;  3KV5 A;  4AFB A;  2ZZJ A;  4G3Y C;  4RQP C;  4AGV A;  4BMB A;  3ZSM A;  2HWE 1;  1DGR N;  1ZBE 2;  1NT0 A;  4L0P A;  3VBS A;  2EIE A;  1D4M 2;  4NR1 A;  4YG6 A;  4NHK A;  3C7H A;  4FP3 A;  3WQ0 A;  2VCC A;  2RVA A;  2WFF 2;  3VBR B;  5FP9 A;  1ZZ9 A;  1UW8 A;  3MLK A;  4JTN A;  3UGH A;  4AHY A;  3LIH A;  1B09 A;  1W8T A;  1Z7S 1;  3JBG 3;  4S2D A;  5LZ6 A;  3K4D A;  2PAE A;  1UN1 A;  1UAI A;  3C7G A;  4YGD A;  2D6K A;  5C3S A;  4KU7 A;  3WF2 A;  2UY8 A;  2RR1 1;  2ZX0 A;  1JOD A;  3PLQ A;  4Q4V 1;  5IAV A;  5J1X A;  1SBF A;  2DCZ A;  4PLO A;  3QD6 A;  5FFO C;  1UL9 A;  4YW2 A;  3O1P A;  4FFI A;  4AK3 A;  1FI2 A;  4BQ4 A;  4HK8 A;  4JGZ B;  4Q4Y 3;  3AMN A;  5FUI A;  2EID A;  4H2A A;  3MHZ A;  4FPF A;  1WLW A;  4TLF A;  2G1M A;  4JKL A;  4Q0P A;  2GNM A;  1ULO A;  2BGO A;  2HWC 1;  4Y5Z 0;  1JZ7 A;  1CJP A;  1N3O A;  1OA3 A;  4FXK B;  5EYX A;  4AI9 A;  4CCM A;  1YJK A;  3ZOI A;  4BK4 A;  3GZE A;  5H9S A;  5CFD A;  1QDO A;  4CDQ A;  4CDQ C;  1V6L A;  5L19 A;  2R06 2;  4QKB A;  4KL1 A;  2GN7 A;  3N9M A;  3LA3 A;  4IUG A;  4BIF A;  1H1A A;  2HWF 2;  4CEY A;  3KWV A;  3DYM A;  1Q3E A;  2XBO 1;  2DUQ A;  4AGG A;  4PQ9 A;  1RJ8 A;  1HQL A;  4IL7 A;  2W2I A;  3AZV A;  1FMD 3;  3APB A;  4CE8 A;  1O91 A;  1YFU A;  2K46 A;  2QJV A;  3GF6 A;  5DDJ 3;  4BXS V;  1POV 3;  4CEY B;  1XU1 A;  2CV6 A;  2WSU A;  3QOP A;  1DQ1 A;  2AGS A;  3DPR A;  1EYB A;  3IPV B;  1MZE A;  1E5H A;  1NAE A;  4RGK A;  5GZG A;  3T4H B;  1R08 1;  5L36 A;  1RGS A;  2B46 X;  4NPM A;  5HV4 A;  1SPP B;  4HPK B;  3TEW A;  4QXH A;  4UAP A;  5FYC A;  2DYC A;  1VRH 1;  4XDP A;  3CL1 A;  1L7R A;  4GXL A;  2HLE A;  4LBM A;  5J96 B;  3I4I A;  3QAC A;  1UCX A;  5CG9 A;  3HEI A;  3V0B B;  1KGY A;  2E53 A;  1RHI 3;  5A7W A;  2DUP A;  4CA9 A;  4KI5 M;  5ABJ A;  5C8C A;  2R04 3;  4GB3 1;  3O12 A;  2XQR A;  4IE7 A;  1HV0 A;  3K4Z A;  5AVP A;  3PDQ A;  5T5L A;  3UJO A;  3GBF A;  3THP A;  1UU5 A;  1VBC 3;  2ARX A;  1DZR A;  1NQJ A;  1MS9 A;  4H7M A;  2HWE 2;  2V73 A;  4LJH A;  2Q8E A;  3ZXL A;  3FL7 A;  4YZ5 A;  3POB A;  3E6B A;  3ZXK A;  4YVW C;  2B5H A;  2HWD 3;  2WZR 1;  1ZRC A;  3WLU A;  5I0D A;  1S0I A;  4KGG A;  1BEV 1;  1DG6 A;  1YCI A;  2O8O A;  1VB4 A;  2ZAB A;  5J98 B;  4CDX B;  1ZZ8 A;  2SLI A;  4AVS A;  4AHX A;  1R1A 1;  3NJZ A;  3W59 A;  1HLC A;  1ZX5 A;  4L97 A;  5JSP A;  3FFQ A;  1COV 2;  3RZJ A;  3CNA A;  1F8V A;  1S2K A;  4P9G A;  3SCF A;  4OHV A;  4QM9 A;  3I2D A;  2UU8 A;  1IS6 A;  2XJT A;  1COV 3;  3WV6 A;  1EY2 A;  3N7J A;  1V9U 1;  1MR5 A;  5FUN A;  1MZF A;  2ZKN A;  3OPZ A;  1H9P A;  1SFP A;  4D6R A;  4JKK A;  4IV1 A;  4IV3 B;  2Q1M A;  5FKC A;  4E27 A;  3VDD C;  5FBZ A;  5GLU A;  3D0S A;  3C7E A;  1JZ8 A;  4P02 B;  3BGA A;  2GSY A;  1AVB A;  1CAX B;  2ZAC A;  3H7J A;  1WKY A;  3TN9 1;  1UU6 A;  1QNW A;  2JG9 A;  4XHB A;  3THD A;  1B35 C;  2OVU A;  1VIW B;  1AR8 2;  3HQU A;  4FBF A;  3CZU A;  1CAU A;  2BGC A;  4BPZ A;  4OHW A;  2VCM A;  2B45 X;  4CUA A;  1IPK A;  4IE0 A;  5FXW A;  4ZHN A;  5FJH A;  3ASI A;  5E6H A;  1F15 A;  4W65 A;  5D1I A;  1NCR C;  1IPS A;  1H8T A;  2WQ8 A;  1A78 A;  2GH8 A;  4C91 A;  1UWW A;  2Y64 A;  1XSR A;  4GKX A;  1PGW 1;  5GAL A;  4FAH A;  1GWL A;  4V1P A;  4LKS A;  2E9Q A;  3WHU A;  5FK7 A;  3KS7 A;  4MGI E;  1ZA7 A;  2JG9 C;  3NV4 A;  2UWA A;  1PMH X;  2RS5 3;  3M7A A;  1JYT A;  2Q8D A;  4QDQ A;  1BCX A;  3KMH A;  1JU4 A;  2EIC A;  4LE4 A;  5C70 A;  5K0U C;  1BMV 2;  2ETE A;  4AWD A;  1KFX L;  3WNL A;  3Q8A A;  3NRU A;  4YFZ A;  2R07 2;  4JTO A;  1Y9G A;  3CIH A;  4P9J A;  2XWB B;  2K0G A;  2D5F A;  2VMC A;  2QBX A;  2WBK A;  4XQW A;  5FP4 A;  3VBH B;  4J25 A;  1H2N A;  2R07 3;  1H30 A;  2CL2 A;  2X5I A;  2OXB A;  3WP4 A;  1Z7S 2;  5FP7 A;  4Q8L A;  3OEA A;  1ULD A;  3I54 A;  2XML A;  4GB3 2;  1X82 A;  2B39 A;  1SBD A;  4XAE A;  4CPB A;  4LXL A;  1JHN A;  2GN3 A;  2GC2 A;  2DV9 A;  4CP0 A;  1GZC A;  2ZZQ A;  2W47 A;  1ZM1 A;  3M70 A;  3T4V A;  2D3P A;  1W28 A;  1GWK A;  4PF5 A;  1D0H A;  1PK6 B;  2OYZ A;  3NMB A;  1Q5O A;  4XOG A;  1WMF A;  1EAH 3;  5IVB A;  1N1V A;  4WM8 A;  3OGS A;  5LA0 A;  1N47 A;  3MIH A;  2XVK A;  3FHI B;  2VOT A;  2JDZ A;  2DU1 A;  4FTE A;  3VBU B;  2P4E A;  2R49 A;  5I8Y A;  1VBB 3;  5IK4 A;  4LO7 A;  1BBT 3;  5DUW A;  4UF0 A;  2P37 A;  4YWA A;  2GC0 A;  5FZO A;  4OHZ A;  1WD4 A;  4QKN A;  5FYH A;  3PMS A;  1MS0 A;  2JEC A;  1GIC A;  2D6L X;  3AMP A;  1CZT A;  1ZRF A;  1OOP A;  4WM7 B;  4I02 A;  3THC A;  3D4K A;  3VZL A;  1LKN A;  4AXO A;  5ABJ C;  5J37 A;  4QKD A;  1YHF A;  3CDZ B;  2D6O X;  2ZBJ A;  3V0B A;  1RTV A;  1DDL A;  2DVA A;  1DZQ A;  2CWM A;  1W6N B;  3RPQ A;  4D6S A;  3WNO A;  2VAU A;  4EN8 B;  2YFZ A;  2PHW A;  4GJY A;  4MGY E;  4RS5 C;  3LDR A;  2GNB A;  1MEC 3;  5HXV A;  3TNP B;  1AR9 3;  4G4F A;  4PF1 A;  4YVS C;  1VAM A;  1D7P M;  1JI6 A;  1X8M A;  4FPK A;  4JRA A;  3BIE A;  3ZN6 A;  2IZW A;  1R1A 3;  2WQ4 A;  1SBE A;  1TMF 2;  2WYS A;  2ZGK A;  2P3K A;  2DBI A;  3MW3 A;  1PGW 2;  4DEV A;  1OSG A;  1R08 3;  4MH0 E;  1TE1 B;  4NMI A;  3FE5 A;  5KC6 A;  1GQG A;  4LBQ B;  5GZF A;  1A8M A;  1RHI 1;  3DEM A;  4LHS A;  4N7U A;  4YVS A;  4GWJ A;  1ZBA 1;  5IVY A;  4Q4W 2;  2RHP A;  3WEZ A;  5ACA 1;  4HFS A;  4AI8 A;  4OLL A;  1OUS A;  5FV3 A;  4JC1 A;  2F4P A;  3TN9 3;  4UW6 A;  4LBN A;  2B7Y A;  5FYV A;  4OI4 A;  4CXY A;  3K4A A;  2GAU A;  2JEN A;  4ISQ A;  5BXX A;  2OKX A;  3TN9 2;  3V56 A;  3AP5 A;  2VL4 A;  3WSO A;  1T2X A;  4L9B A;  3AZW A;  2DVD A;  3IN9 A;  3HIF A;  3J7L A;  2DFC A;  5FZL A;  2WC2 A;  5T52 A;  5FY4 A;  5FZA A;  3VDA A;  3H0O A;  2LM3 A;  4ZS2 A;  3ZM8 A;  5HCF A;  4AVA A;  4YSF A;  1UIK A;  4W4Z A;  1TZO A;  1W6Q A;  3UET A;  4HT1 T;  4GA9 A;  4WM7 C;  1XYN A;  2RM2 2;  4YW6 A;  1U0A A;  1JS9 A;  4YW1 A;  4CCE A;  3UNP A;  3NW4 A;  3MFC A;  3LFI A;  4Q0S A;  4XYX A;  2W39 A;  3FX3 A;  2NMO A;  5K0U A;  3WG1 A;  1M06 G;  2WS9 1;  4LHN A;  4AFM A;  2QDN A;  2PQQ A;  1JYX A;  3AZX A;  3M2M A;  1JBC A;  3NQH A;  4J1X A;  4K40 A;  4XTP A; 
#chains in the Genus database with same CATH homology
 1UZ0 A;  4PT6 A;  1JZ3 A;  4E8D A;  4BDV B;  4W50 A;  2VZS A;  2VZO A;  2Y6L A;  3CQO A;  3SKV A;  3T2Q A;  2E31 A;  5EIY B;  5JR2 A;  2B9V A;  4JHZ A;  3BN6 A;  3A22 A;  1XC6 A;  3MV1 1;  3FHA A;  4D0Q A;  2Y6H A;  3OEB A;  3HNY M;  1J83 A;  2HYX A;  3OBA A;  2E33 A;  1OF4 A;  3ETP A;  5C7G A;  2VZV A;  4ARY A;  2QQK A;  4OMC A;  2WO1 A;  5JMO A;  1EUU A;  1LNS A;  4A45 A;  3I2H A;  4P08 A;  3A7Q A;  3IAP A;  4OZO A;  2Y6G A;  3D3A A;  5B4N A;  1W8O A;  3HNM A;  4OMD A;  3ACF A;  2KD7 A;  2J22 A;  4KWU A;  3VD7 A;  4A6O A;  3A21 A;  1GMM A;  4LQR A;  2J1V A;  4FI9 A;  4ZY9 A;  1UX7 A;  2QQI A;  3E1F 1;  3VD3 A;  2JD9 A;  1GOH A;  3HOB A;  1OD3 A;  2W1U A;  1L7Q A;  2WN3 A;  1TG7 A;  2VTF A;  2WDB A;  5A1A A;  3DYP A;  5LCW L;  4JX0 A;  2E32 A;  2J1T A;  2W92 A;  1UYX A;  4ET7 A;  3WNK A;  5DN2 A;  4P5Y A;  4A41 A;  3MBW A;  2E26 A;  3LPG A;  3WNP A;  4QB2 A;  3HPN A;  4CVU A;  3VD4 A;  4A42 A;  4CU7 A;  2W91 A;  4P00 B;  3HJR A;  3ABZ A;  3I3D A;  1MPX A;  2VCB A;  2W94 A;  2LW8 A;  3CKH A;  3IDA A;  1UY1 A;  2ZEY A;  2C26 A;  3PUH A;  3T0D A;  1W9W A;  3LQC A;  5G05 L;  1NX9 A;  2ID4 A;  4QX1 A;  4ZXE A;  3OGR A;  3NJX A;  4BK5 A;  2J1U A;  2VMD A;  4M4R A;  4MGS A;  3DYO A;  2C4X A;  2X09 A;  3VD5 A;  1JZ6 A;  1WCQ A;  2VZ3 A;  2WAO A;  2VR4 A;  4ZZ8 A;  4RYD A;  1UMI A;  3VDB A;  3W5N A;  3IB3 A;  2QQL A;  5JXJ A;  5JXG A;  5CZK A;  1CZS A;  3GDB A;  1GUI A;  3WF1 A;  4UI9 L;  1O8S A;  2VQT A;  2VZU A;  4XUQ A;  2BGP A;  4DUW A;  1IQD C;  4XUN A;  4XUR A;  2Z4F A;  3VD9 A;  3HN3 A;  2DCK A;  2QQO A;  1ULP A;  2W3J A;  2W46 A;  5JUV A;  1JZ4 A;  2BZD A;  4DXT A;  3SEE A;  1PMJ X;  2W1W A;  2J7M A;  2XON A;  3EYP A;  3K77 A;  4KMQ A;  2W9X A;  2J1S A;  3LE0 A;  2W5F A;  1DLC A;  1BHG A;  1US3 A;  1RYY A;  4JKM A;  1GNY A;  1UY4 A;  3I2F A;  2ZEX A;  5F7U A;  3UES A;  2CDP A;  1W99 A;  4A3Z A;  4YPJ A;  3P6B A;  1H6X A;  3C7O A;  4BJ0 A;  4MAD A;  3WQB A;  2BER A;  3A23 A;  1O8P A;  3T0A A;  3MV0 1;  5HPO A;  3ACG A;  3I2I A;  1SG3 A;  3FHQ A;  3ACI A;  1XPW A;  2JDA A;  4L0P A;  2EIE A;  3C7H A;  4HG6 B;  2VCC A;  2RVA A;  2JKX A;  1DP0 A;  1UY3 A;  1H6Y A;  1W9T A;  3K4D A;  2ZEZ A;  4MO3 M;  1XNA A;  2DCJ A;  3C7G A;  3WF2 A;  4CU6 A;  5EJZ B;  2VME A;  5J1X A;  5LA2 A;  1UYY A;  3T2P A;  2QQJ A;  1HN1 A;  1P8J A;  3I97 A;  3T08 A;  1JYV A;  5FUI A;  2EID A;  2VZT A;  4JKL A;  1ULO A;  2BGO A;  4M4P A;  1JZ7 A;  1GOF A;  5LA1 A;  1PX3 A;  4BK4 A;  4D8M A;  1UXX X;  2B4K A;  4IUG A;  4OUE A;  3DYM A;  3OGV A;  2V4V A;  5DQ0 A;  4GZ9 A;  4DXS A;  1GU3 A;  4MOA A;  1K12 A;  1NKG A;  3OG2 A;  4BXS V;  4UOJ A;  3JXS A;  5DMY A;  2QQM A;  3MUZ 1;  4QB1 A;  4XVH A;  1NAE A;  4GWI A;  3NNG A;  1W0N A;  5IJR A;  4UAP A;  1L7R A;  4E8C A;  2CDO A;  2HLE A;  3HEI A;  1KGY A;  2W95 A;  4TXW A;  3T0B A;  4KI5 M;  4DUX A;  3LEK A;  4CUB A;  1R64 A;  3K4Z A;  2X10 A;  5JXH A;  2XQX A;  3HNB M;  4QAW A;  4XUP A;  4PQQ A;  1OH4 A;  3FL7 A;  2C9K A;  2VJX A;  3ACH A;  3P1I A;  3SEP A;  5JXI A;  3I2K A;  2Y8K A;  1F4H A;  5I0D A;  3I3E A;  2YFU A;  4XZU G;  2ZEW A;  2WZ8 A;  4ZZ5 A;  1CX1 A;  1DYO A;  1W9S A;  3LEG A;  4TTG A;  2ZXQ A;  2DDU A;  2Y6K A;  2Y6J A;  3WF4 A;  4DEQ A;  3GM8 A;  4XUT A;  2VO5 A;  1I5P A;  2L9L A;  1SHW B;  4JKK A;  1CIY A;  1JZ5 A;  4ARX A;  4AAX A;  2J1A A;  3C7E A;  2VZR A;  4P02 B;  1JZ8 A;  3BGA A;  2JE8 A;  2YC2 A;  1WKY A;  3LPF A;  3PUI A;  3THD A;  1F4A A;  1K45 A;  1JU3 A;  4CUC A;  3CZU A;  1XNT A;  4CUA A;  1W8N A;  2RJ2 A;  2WO3 A;  1UMH A;  1GOG A;  1UY0 A;  4QDR A;  2W1S A;  2WQ8 A;  1UWW A;  2Y64 A;  4AG4 A;  4LKS A;  4DXR A;  3C7F A;  2X05 A;  1OF3 A;  1PMH X;  4QDQ A;  3GXU A;  1JU4 A;  2EIC A;  3WF3 A;  5C70 A;  1PX4 A;  1OT5 A;  2VZQ A;  2WZE A;  3WNL A;  3NRU A;  2BBA A;  3CIH A;  4QPW A;  3I3B A;  2WBK A;  2VMC A;  2QBX A;  4QX2 A;  2YG0 A;  3U37 A;  3I2G A;  3I2J A;  2YC4 A;  4OYU A;  1SDD B;  1EUT A;  3OEA A;  3WNM A;  4QX0 A;  2VC9 A;  5IYY A;  1UXZ A;  3CZJ A;  3MO4 A;  1K42 A;  3W5M A;  2J1E A;  2W47 A;  3LEI A;  3ECQ A;  1KEX A;  2XHN A;  2V5D A;  3GGL A;  2WUH A;  5B4X A;  1K3I A;  3OGS A;  4MGQ A;  5EJ1 B;  3F2Z A;  4XUO A;  1TVG A;  2VOT A;  5LA0 A;  2VQU A;  3T09 A;  2PQS A;  2XOM A;  2QQN A;  4CU8 A;  4DUV A;  3CMG A;  3SKJ E;  1CZT A;  3K75 B;  1UY2 A;  3THC A;  3CDZ B;  1GQP A;  2R7E B;  1YQ2 A;  3WNO A;  3OB8 A;  2YFZ A;  3EB7 A;  2VZ1 A;  4PF1 A;  2WAB A;  3C8X A;  3WF0 A;  1D7P M;  5DPN A;  2EIB A;  1JI6 A;  5G04 L;  2ORZ A;  5C71 A;  5IHR A;  2VM9 A;  2WYS A;  4DEV A;  1J84 A;  2VZP A;  5CYY A;  3WNN A;  4CU9 A;  1JHJ A;  2J1R A;  4LHS A;  2W1Q A;  2W87 A;  4GWJ A;  3FN9 A;  1JZ2 A;  1US2 A;  1NUK A;  1UYZ A;  3WEZ A;  1CZV A;  3VDC A;  5HXM A;  2RV9 A;  4QDS A;  4QB6 A;  4LPL A;  4A44 A;  3IAQ A;  3K4A A;  3K46 A;  3NJV A;  2OKX A;  2VL4 A;  4W8J A;  2LS6 A;  3WSO A;  1T2X A;  2WAA A;  2WN2 A;  2VMF A;  2VCA A;  1JYN A;  3DEC A;  3T2O A;  2V72 A;  3VDA A;  4Z2A A;  3ZM8 A;  2YB7 A;  5IFP A;  4QX3 A;  4W4Z A;  5IFT A;  3UET A;  1JYW A;  3III A;  3UNP A;  3AC0 A;  4A4A A;  2ORX A;  3J7H A;  1O59 A;  1JYX A;  4RN5 A;  2WO2 A;  3NQH A;  3MUY 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...