4QDUA

Crystal structure of antigen 85c co-crystallized with ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
281
Chain Sequence
AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 281
sequence length 283
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qduA00
4UBOA 4X6XA 3QYJA 2JGLA 4Q1VA 4M0EA 4FFVA 5FUMA 3G0CA 4GBGA 1EVQA 1VA4A 4KJXA 4GDMA 4K5QA 2WM2A 5LZ2A 1M33A 2Z3WA 5EFZA 4P08A 3D2BA 2PSJA 3C70A 3AIOA 3FNBA 3HI4A 3STVA 4U2FA 3V1NA 1FSSA 6YASA 2OAGA 2QJWA 4BVKA 4BP9A 1QIHA 3HABA 3MUOA 3DL7A 1X70A 4HVTA 4DYHA 3ESAA 4XWGA 4O08A 1XZHA 5AK6A 2QZPA 3M3DA 3RK4A 1CUHA 4Y9SA 4FFWA 5H3HA 1CUAA 3OOSA 4BCCA 1A8QA 3ANTA 2Y2VA 4U2CA 4QLOA 5DTIA 2PBLA 4ZRDA 5I9IA 2WTMA 3H19A 2AJCA 5LZ5A 5JD4A 4QLAA 4AX4A 4WFKA 1A7UA 1ETHA 1ZD3A 4X6YA 5BOVA 3KD2A 1A8UA 1L7RA 1W75A 5HK9A 1KU6A 1JFRA 3M83A 5K3AA 4J7AA 3HRHA 2XUQA 2OQIA 5AM2A 4W1PA 5AM4A 1HKHA 2Y2UA 3ICWA 4H7EA 3TRDA 5AI5A 2J3QA 4Y2YA 2VAXA 3G9XA 1AX9A 3H2IA 3TEJA 4FBLA 1ACLA 1ZJ5A 1ZOIA 2WJ3A 2HA5A 5EIAA 2O2IA 3A6ZA 1LPBB 4WFIA 2YXPX 4HRYA 4JNCA 3WL7A 4EY7A 4BC0A 3GA7A 3WWCA 2GBCA 4B9EA 4IHAA 1EINA 4X90A 2XUHA 2X5XA 4KRXA 5ALWA 1B41A 1AUOA 1XZMA 1IZ8A 1JMKC 2JF0A 4DNPA 4BVJA 1QIDA 5ALXA 3VJMA 1XZAA 3ZI7A 1U65A 2EDAA 4I19A 4L0CA 4WJLA 3ZLTA 3D5EA 3E1GA 4ZREA 3WKCA 5C7YA 2ACKA 2WIKA 4EZIA 3AZPA 3CCCA 4IO0A 3LP5A 1Y7IA 3NUZA 1BE0A 1XQWA 3HEAA 1DU4A 3HYSA 5ALTA 5FKJA 4N5HX 2GYVA 5LKAA 5AKJA 1ZGBA 1QTRA 2C5FA 4HAIA 2C58A 4FDMA 1MU0A 4Q82A 4Y2RA 1UK6A 1G66A 1PV1A 4Q3OA 5AM0A 5EHXA 3GFFA 5LZ9A 4K6HA 5ALJA 3VKFA 4B84A 1UT6A 1QFSA 3W04A 1IUPA 3QVMA 1O6GA 2HM7A 3BXPA 2XDWA 1CUJA 3D2CA 1R88A 4FBMA 3O95A 4G8CA 5DYWA 1DT3A 1LPPA 1CEXA 1XZBA 2GYUA 4W63A 4LHEA 5AM5A 1D07A 2ES4A 1LPNA 3V48A 5CT9A 3VJLA 1R9NA 2BJHA 3HSSA 4Y2JA 4IQ4A 4KAAA 1J1IA 3AZOA 3H1BA 3R40A 2J3DA 3W9UA 4HXEB 3C43A 5LZ4A 4QWMA 1JJFA 4AMZA 1LGYA 4QNNA 5KWIA 1PFQA 1EDDA 2JGKA 2O7RA 3I28A 2PSDA 1A8SA 1MJ5A 1HPLA 5HCUA 1HQDA 1RWQA 3H2GA 2XUOA 5FPQA 2GYWA 4G5XA 3EBLA 1XQVA 5JAHA 2HRRA 3G8YA 3B3QA 1LLFA 4RE5A 1EB8A 3WWEA 3WA6A 3EF3A 3WWOA 5YASA 4EY8A 3WYNA 1CUDA 3CXUA 4X97A 4X3CA 1MN6A 2PSHA 5E4YA 1MPXA 1P0PA 1GKKA 5SYNA 4MEBA 1YA4A 5AKIA 5K5EA 2CBGA 1IUOA 3A2MA 1QO9A 5ALGA 2ZYRA 3PI6A 1VKHA 1EHYA 4FKBA 1Y37A 1ZJ4A 2VT6A 5FPPA 2XUIA 2BAGA 4N8SA 3FCYA 4NS4A 2QS9A 3FSGA 4OU4A 3VJKA 3G0BA 3F9CA 4K6KA 3GROA 5K3DA 4UBLA 2HIHA 1GPKA 5I8PA 2XMGA 2RIPA 3F98A 2WU4A 3LS2A 3V1KA 4UBNA 1TQHA 4DIUA 3G0GA 4PW0A 1XZGA 3X3HA 4BDSA 4DSAA 3I2JA 2B20A 3GUUA 3V1MA 3WK7A 3FYUC 4GEGA 3ZLUA 3STUA 2XQGA 4TGLA 5HF6A 4YPVA 3B12A 4DNQA 3KDAA 4G1FA 3Q8WA 1DQYA 1GZ7A 4C4ZA 3RM3A 4W1RA 2WIDA 2CMFA 1CIJA 4OU5A 4PSUA 1YB7A 1K8QA 4UFNA 5AM3A 3G9UA 4GWLA 3O4JA 4AO6A 2DHDA 3O0DA 1H23A 2OGTA 3AJAA 4MWSA 2FUKA 1LBSA 1VLQA 4N8EA 4N8DA 3FYUB 1LPOA 1NU8A 2NW6A 5EHNA 4WDRA 1WHTA 3AZQA 4LKOA 2GZSA 4C01A 5CT6A 1F0PA 4H7DA 4BAGA 1MX5A 3IVMA 3RARA 4AMYA 4INZA 5D6OA 5KREA 3WYDA 2YYSA 4W9RA 2WUEA 3I1YA 2PM8A 4BCBA 1N1MA 3FVTA 4OYLA 5C8ZA 2ZYHA 4L72A 3AUKA 4W1SA 5ALZA 1UKCA 2PU7A 5SYMA 2QTBA 4OB8A 1J06A 3KXPA 4OPMA 2DQZA 3I2GA 4C4YA 3EIOA 3BDVA 3QBJA 4J0DA 1H2WA 5JANA 2G63A 5FLKA 2H7YA 5ALFA 5D7BA 3D7RA 3VDXA 2R11A 4QZVA 5AKEA 1WB4A 3PFCA 4Y2SA 2G4LA 2AJ8A 1XFDA 4NZZA 1ZIXA 4A5SA 2BGNA 3F67A 3FAKA 3L1JA 4AO8A 2WG2A 3STTA 3O4GA 3VISA 1FFAA 2BUAA 1QLWA 3C87A 1XLWA 4UHHA 2ACEA 5EGNA 1ACJA 1LBTA 5CTAA 2QUBA 3A2LA 3C8HA 4BZWA 5DWDA 3MVEA 5ALKA 4L9AA 3I2IA 4G8DA 2QKYA 4GHWA 1EK1A 1ZI6A 2CJPA 1UK7A 3IA2A 3IIIA 5K3BA 1THTA 2J4FA 1XZDA 3FYUA 1MNQA 4UBKA 5LLSA 2WFLB 3H0CA 1H2YA 1YR2A 4EHBA 1XKTA 1XZEA 3H1AA 1ZD4A 4PO3X 4I3FA 1HL7A 1ISPA 2WFMA 1ZI9A 2I3DA 3WJ2A 2CKMA 2DCMA 2XMCA 4B7ZA 1XRMA 3IDAA 5JAUA 3OM8A 3AIMA 2HFKA 5AO9A 1E89A 4RPCA 5DYYA 1K5PA 3JWEA 4CG3A 4M0MA 1MT3A 4BTVA 1KEZA 2HA0A 1K6EA 4TPKA 2ZJ6A 4V2IA 3W2TA 4MXDA 1WHSA 1MTZA 4P92A 1P0MA 1JI3A 4BAUA 2QR5A 3IURA 4WDQA 4UBJA 2V97A 3V9AA 3WQHA 4UHCA 3ZLVA 1XQYA 2Y6UA 1W4LA 3ED1A 3DDUA 1W6RA 1YS2X 1BRTA 4OSEA 5HKAA 5ALOA 5HFNA 2DHCA 4U2GA 4Y2TA 1XZKA 1LPAB 4DGQA 2G5PA 1SC9A 5CH8A 4EB0A 3SC2A 3A2NA 3UUFA 4A23A 3VXKA 3O9VA 5ALRA 3U1TA 1E8DA 4CIAA 2DHEA 1VE6A 2QXUA 1UOOA 1VE7A 1AMNA 3FVRA 1ZD5A 3QMWA 4X85A 4CCYB 4K2AA 4DNOA 1YASA 1LPMA 3L1IA 4UHEA 2W22A 4QE3A 3IULA 1SCIA 3SK0A 5ALHA 1DT5A 3WJ1A 3OURA 5ALIA 5AI0A 4DLNA 2WG0A 2Y1KA 1MO2A 2JIDA 3OPMA 4J03A 1QIIA 1GKLA 4BVLA 2AJLI 3D4LA 3K9BA 2WFZA 5DNVA 4C88A 2XMBA 2H7CA 2XMZA 3H2JA 5LP1A 5A71A 5T4HA 2RONA 4J0GA 5JIBA 4OYYA 5ALMA 3G7NA 3VVLA 5AH0A 4X93A 4GW3A 3R3XA 5ALEA 5DLPA 2VJCA 3BJMA 3R3UA 1AC5A 1QZ3A 1TAHA 4UUQA 1MX9A 3W05A 2QMQA 1EX9A 5AKZA 3A70A 5AHXA 3IUMA 4M0FA 4BP8A 1VXRA 2OAEA 3ILSA 3Q0TA 4I4CA 5AKXA 5C81A 2WUDA 2V96A 4LIPD 5AI8A 2P8SA 1OXMA 2C7BA 4LXHA 4ROTA 2HA6A 3QITA 3IUNA 3N0TA 4AO7A 4PV7A 3HACA 4BZZA 1PJAA 1R9MA 1WB5A 1XZCA 3SWWA 3I6YA 1J2EA 1E66A 1CQZA 5T4EA 4EBBA 3FCXA 2XT0A 4WY5A 2EDCA 3H17A 2B61A 4D9JA 4HXFB 4CG1A 1WM1A 4B0PA 1VA5A 2FJPA 1QGED 2I03A 3QM1A 4J0JA 2ONCA 2WHQA 3F97A 1BCRA 2K2QB 5AICA 2H1IA 2ZJ7A 3G0DA 2C4HA 1VZ2A 4GECA 3DCNA 3E0XA 5AOBA 2VQ6A 4UHDA 3WA7A 4BYMA 2JGEA 3BIWA 4HS9A 4X7BA 3G9TA 1G42A 4PQEA 1TKRA 3WK8A 4Y2QA 5LZ7A 1SOMA 2O7VA 1GPNA 2E3JA 2VF2A 4KACA 1GXSA 1JU3A 1SCQA 4BATA 4FOLA 4KRYA 1XZIA 2FX5A 4EA6A 4H77A 1Q0RA 1T4MA 1XRLA 2OLEA 4ZV9A 5CT5A 4CI9A 2VJDA 1DTEA 1CUUA 3DOHA 4FHZA 4KAFA 4NMWA 4MEAA 1G5FA 1ZIYA 3O4IA 5ALPA 3IUJA 1RP1A 1YAHA 5E4TA 5JALA 3D59A 3S8YA 3DJYA 2OPHA 5A62A 3WWPA 4MQMA 2HRQA 3HXKA 4Y2XA 1LZKA 2ZYSA 3E3AA 2PVSA 2HA2A 1W1IA 3IUQA 4AN1A 1EVEA 3LIIA 1T2NA 5JD6A 5AKYA 2XQJA 2D5LA 3O9MA 1K63A 3DD5A 4AQDA 3PF9A 1IZ7A 1TIBA 3WL8A 1QJ4A 1AKNA 4E11A 3NWOA 2WILA 3BF7A 2XUFA 1UWCA 1CLEA 5E2IA 1HLGA 4FNGA 4B85A 2VT7A 1TCAA 2BUCA 5T4BA 4B82A 1GQSA 4QDTA 1XKLA 2ZSIA 4OCZA 3BF8A 3UUEA 2PSEA 4X92A 1H2ZA 1A88A 2WU3A 5JATA 1Y7HA 4XX1A 1THGA 1W76A 2GBGA 4ZV7A 1ODTC 1JKMA 4B6GA 1ORVA 4HZGA 5K3FB 2WKWA 3BIXA 5JZ9A 1EB9A 3WK9A 1XLUA 4JYPA 4H7HA 1CFJA 1FFBA 4DMFA 4HTAA 5AOAA 4Z49A 5CURA 4KE8A 3LLCA 3BL8A 3IBTA 4ZWNA 4G4JA 4IH4A 4A16A 5FDFA 4X91A 2XMQA 2IX9A 4MYDA 2PSFA 5EIEA 5EIHA 1BU8A 3R0VA 4QWWA 5DNUA 3DEAA 4BE4A 4Q3KA 2RI6A 5FXMA 5CXUA 4F5ZA 4F60A 3DOIA 4CG2A 4LYEA 4X00A 5HF8A 3WL6A 2GZRA 5I7UA 3AIKA 2Z8XA 4DM7A 1CUGA 1CUVA 3KOOA 1XQXA 2XUGA 3PUHA 5ESRA 2WHPB 3HZOA 2WJ4A 3RKSA 3L1HA 5CT8A 4AB1A 3I6ZA 4FTWA 4BBZA 1YAJA 2XE4A 4J0KA 3ZWQA 3WIOA 2WLSA 3YASA 1BS9A 2HA7A 3DYIA 5BWCA 3ICVA 4G9GA 3EQ8A 4J0CA 1AZWA 1UZAA 5AKHA 3KSRA 3C45A 5CT4A 4B0OA 3DKKA 4HXGA 4C4XA 3FYTA 5FV4A 2PX6A 4U2EA 4H7JA 4WFJA 1DX4A 3K2IA 3FLAA 3LIPA 1WB6A 4DNFA 4EUSA 2ECFA 2HA3A 5FP0A 2XUKA 2PU5A 4F21A 2JGIA 4UBIA 1BROA 4B81A 3OG9A 4QDUA 4ZGBA 1CUWA 3FBWA 1DWOA 1FJ2A 2OXEA 3R3VA 3NGMA 5DNWA 4AXBA 3PUIA 5BV7A 4J0IA 1CUEA 1H2XA 1F8UA 4G4GA 2OGSA 5K3FA 1DINA 2C5GA 3DYVA 2I3ZA 4GXNA 4CCWA 2HU5A 4ZXFA 1S8OA 2V9ZA 5D3KA 4OB6A 1ZD2P 2QUAA 4J0HA 1UK8A 4DMKA 1C7IA 4QDOA 2XMRA 1QIEA 2V98A 3ZV7A 5J3JA 4EY6A 1NU6A 4QDZA 3ESBA 5ALLA 2WIJA 1CR6A 3WKBA 3CN7A 3DQZA 5DJ5A 1X2BA 1SCKA 1USWA 5ISMA 4JYMA 3MGAA 2PUJA 2BGRA 2RAUA 1X2EA 5CXXA 4G9EA 4RGYA 2XLCA 3I2HA 5AI4A 4XVCA 4UFOA 1MAHA 1U2EA 3O4HA 1BN6A 5JAPA 1Q84A 1N5RA 2D0DA 3D0KA 1CUIA 4OD0A 4L3WA 4TVKA 2WHRA 3U0VA 1TRHA 4BRSA 3C6BA 4BE9A 4IH1A 3BJRA 3KWFA 4ITVA 4E46A 2AJBA 5AP9A 1YS1X 4QEKA 5CRIA 3WK4A 1BEZA 3QMMA 3H04A 3IB3A 4UBMA 4FLMA 4ARBA 2VA9A 1QIFA 2WG1A 4LXIA 2HFJA 3AILA 3DLTA 5AK3A 1CPYA 3EQ7A 1TCBA 3WK5A 5HKBA 1CUBA 5ALNA 1UKBA 3OTQA 4Y2VA 2QJRA 3C6XA 3C6YA 2JGMA 3T4UA 1C7JA 1DWQA 5AKKA 3QPDA 1EI9A 2AXEA 3BDIA 4FLEA 5A7HA 5ALYA 4B80A 1AQLA 4ETWA 3MUNA 1AURA 1DWPA 4EY4A 5AIBA 2CZQA 2XI4A 4B83A 2DFPA 4H7KA 3DNMA 4UHBA 4DMCA 2RHTA 3G0IA 3R41A 2WTNA 4P9NA 4CIBA 1OCEA 3HC7A 1UOQA 3NOXA 4QA9A 2HL6A 5LYYA 2WJ6A 4H0CA 1L7AA 3TJMA 2WSLA 4JUIA 3SX4A 5AI9A 4RNCA 1CUFA 2R8BA 5AKLA 5ALQA 5T4FA 2XUPA 1YA8A 3RLIA 2BCEA 2CUTA 2OCGA 4YX9A 2JBWA 1MNAA 5JD5A 2WIFA 1EK2A 2QT9A 1EH5A 1VZ3A 1UFOA 2WFLA 1G4HA 5C8VA 1CUZA 1BN7A 1QONA 1J07A 5IH7A 5DTJA 4H7FA 3HLKA 1XZFA 1JT2A 1L7QA 3QPAA 1W52X 1IVYA 1U4NA 5CMLA 2XQFA 5ALVA 1JMYA 5A7FA 3I1IA 3AFIA 1Q83A 1LNSA 4AN0A 1TCCA 5ALDA 1CVLA 1Z68A 5IVKA 3C6ZA 4FWBA 1CUSA 4H35A 1WPRA 5AI6A 5JARA 4MJ3A 3C5VA 3ZPXA 1E5TA 2RHWA 1GPLA 5AJHA 1VJ5A 2WQZA 3BWXA 4BAZA 3P2MA 3QMVA 4C87A 2DQYA 1O6FA 3I2KA 2HU7A 4FLFA 3LCRA 1E8NA 2IITA 4Y2PA 4Y7DA 5CW2A 1QO7A 1I6WA 1R3DA 3PDCA 1QOZA 5EI5A 5D3ZA 1CUCA 2G5TA 2VTVA 2OQVA 2I78A 1E8MA 2H7XA 1XRNA 2BFNA 1F6WA 2OCLA 4KYVA 1R4ZA 4Q05A 4H7IA 3T52A 1IUNA 1ZI8A 3D3NA 4JEIA 3WIBA 1QIMA 1UXOA 5IVHA 2X8BA 2QRUA 1OILA 3GZJA 3WWDA 5BWBA 2ZSHA 2HDWA 5JAOA 2DR0A 1XZLA 4OB7A 4XJVA 2XQIA 4CCYA 4AZ3A 4AZ0A 2HHAA 2J4CA 4W1QA 1HDEA 5JYCA 3F8SA 2ZVDA 1LZLA 2QM0A 4G8BA 3WK6A 2O2HA 5AKGA 1AGYA 4BTLA 4UHFA 3H2HA 3D2AA 3WKDA 3ESDA 4LXGA 4WY8A 1YCDA 2QOEA 1P0QA 3C8DA 5FOQA 3QPCA 1ZICA 1R1DA 3DL4A 4JH0A 2PKYX 4GI1A 3R3ZA 3STXA 4YASA 3G02A 2DSNA 4OUKX 4QDXA 3ESCA 1ORWA 2VAVA 5A7GA 4KE6A 4PNZA 1GGVA 4X71A 5FRDA 3QZUA 2OCKA 5IVIA 5ALSA 2VSQA 5IKXA 5AIAA 3STWA 1HBJA 2Z5GA 2B4KA 2XUDA 3FWHA 1E3QA 5DYTA 2VJBA 4NVRA 3HJUA 2XUJA 1C4XA 1EA5A 2ZJFA 2Z3ZA 5AM1A 5AOCA 1XZJA 3F96A 1WOMA 3QH4A 1EXWA 3N2ZB 1VOTA 4BCDA 1R50A 4RE6A 2JGJA 3V1LA 2OCIA 3R3YA 1FFDA 5JZBA 4Y2UA 2XLBA 2VEOA 1MAAA 3WKAA 2YASA 2BKLA 4C89A 2X76A 1LPSA 5HFAA 3S2ZA 1EDEA 1GQRA 1CV2A 3WZMA 1DQZA 2EEPA 5K3CA 5HQ3B 3FLEA 2O2GA 2RGUA 5CBKA 1YSCA 4K6GA 2GBIA 1ZGCA 4U2BA 4FNMA 1XLVA 2Y6VA 4BDTA 4MWTA 3W06A 1QFMA 5CH3A 3AINA 1QIKA 2W6CX 3JYHA 1SFRA 1QTIA 4PSDA 1FFCA 2IIVA 3C5WP 4BC1A 3FSGD 4J3JA 2PPLA 2PUHA 3EQ9A 1N5MA 2XMDA 1XRQA 3H18A 5JASA 2JGFA 1JJIA 4S0XA 4F0JA 1JU4A 4N5IX 3R3WA 2H9YA 4MYSA 3WKEA 2C0PA 2ZYIA 3CN9A 3M82A 1U8EA 4B9AA 4DMHA 1EDBA 4DSZA 5EHZA 5HF9A 4KAJA 5KWJA 2OG1A 1QE3A 1H22A 4Q3LA 1F0NA 2XUAA 3UMJA 4ARAA 4LYDA 2VATA 5CH5A 5LZ8A 4E15A 5HF5A 1B6GA 1JJBA 2HADA 1UOPA 4MQLA 3BE8A 4XIIA 5IVDA 3WL5A 2OGZA 3H2KA 3PICA 2QVBA 4HRXA 3STYA 4KR0A 1UK9A 5JADA 3CCBA 4E14A 4BRZA 4IH9A 2VJAA 5KBYA 4H18A 4PSCA 3PF8A 7YASA 4WCVA 1ODCA 2HU8A 4DTCA 1QIJA 3B5EA 1XRRA 5LIPA 2CEKA 1NX9A 1UKAA 2CB9A 2WIGA 2XB6A 5ALUA 1FFEA 1MX1A 4X95A 1P0IA 1BEEA 3GELA 1KU0A 3TGLA 3ANSA 1TK3A 3K6KA 2JEZA 1DX6A 4ZI5A 4KE7A 5HQ3A 2YH2A 3FOBA 3PE6A 4CFSA 2B9VA 4FMPA 3GBSA 1ODSA 2JEYA 2UZ0A 5C8XA 1K4YA 1GT6A 3M81A 3I2FA 4UFPA 4GLBA 1VXOA 5HZGA 3DKRA 1BCSA 2Z8ZA 4BB0A 2LIPA 2BUBA 5AK4A 3KWJA 2XMSA 2GBFA 1XROA 5HK8A 5K3EA 3W9BA 5AK5A 2WUFA 1YB6A 1WCYA 4X94A 5A2GA 1Q0ZA 2FJ0A 3E4DA 3OC0A 5LKRA 1IMJA 4P93A 5F4ZA 2C0QA 3DS8A 3PFBA 2PL5A 4X6UA 1N8SA 5EHQA 4C6HA 3VVMA 1XRPA 4U2DA 3G9ZA 2WHPA 3I6MA 2AJDA 2QXTA 4KE9A 2HA4A 2Q0XA 3JW8A 5E4JA 3WLAA 2ROQA 3WZLA 2XQKA 3WMRA 3WI7A 5JZSA 4YK7A 4PF1A 1RYYA 1CUXA 4Q34A 1CQWA 5A6VA 3FLBA 1CRLA 4UPDA 1WPXA 2ORYA 1CUYA 4EY5A 4G4IA 2WUGA 4KEAA 1QIGA
chains in the Genus database with same CATH superfamily
5JQGF 2OLKA 1HL3A 3HFSA 3O3OB 2GTHA 3COJA 2A0WA 3OT1A 1DIRA 3RSOA 3MJFA 3BTVA 3WYCA 2NXCA 4I5FA 5D85A 5G3ZA 1SMKA 3G2HA 1P2UA 4M0EA 1NW4A 4ZMSA 1UKEA 1EVQA 2NNLD 4QC2A 4UCQA 1T3TA 3ZEIA 1JR4A 1R2QA 5HGXA 2RAFA 3PEVA 4DT1A 3KSMA 1P31A 3LLVA 5EIBC 1DJOA 1RXVA 4X65B 1IZ0A 1TU3A 3C70A 3K1ZA 3FNBA 3H8JA 5EJ6A 3AERB 3I3OA 2Y92A 3VBCA 2EAUA 1H4VB 5FUQA 2IZ5A 5LQDA 4H31A 4A6PA 4U2FA 2PZLA 2YWJA 1A8IA 3MS7A 5KNDA 2V6GA 2QJWA 3PXAA 2WAMA 3Q40A 4MJ7A 3SYMA 4YRIA 2NXWA 3E03A 3ORFA 3RVBA 5JS1A 2FZ4A 1NC3A 5E0KB 3WGIA 1ATZA 3K0FA 5KTKA 2SICE 4HZUA 4B3DA 3DBHB 4R41A 2GPNA 4J7XA 4QKQA 1M6HA 3UB3A 4TXHA 5DLQC 2NVUA 4ZYLA 4MIEA 5KNDD 1PSDA 1K7EB 2GZDA 1SUPA 5H16A 3VPSA 2AYYA 4CV2A 2AZXA 1U3WA 4IL5A 1UODA 4YAWA 2ZBGA 4GI7A 5PNTA 2OHIA 1ORTA 2FK7A 4LK3A 1S7CA 3RDPA 5JRJA 1RI5A 3E2PA 3BS4A 1XZHA 4KWCA 3TQRA 4CNQA 5K7SA 1RQ2A 4HLQB 2NT4A 3FZNA 1ZS9A 4XUDA 4RTKA 2LGJA 2Q4EA 3M3DA 1DAFA 1GGMA 1R37A 1XEFA 3K35A 1HTTA 4FFWA 4RIFA 4EPWA 4FD3A 1OPXA 4QU0A 1SIOA 5H3HA 4L4YA 2A5DA 4ML3A 4Q1AA 2QTCA 1SVNA 1UAYA 3AVPA 3ZCUA 3A0UA 4DEVA 3LV8A 2NX2A 4E94A 1UPUA 1AMOA 1Y9ZA 3UY4A 5TX7A 1D4OA 5KJFA 3W5UA 2HV8A 1HYEA 5DTIA 1UJ5A 2GVDC 3BCUA 3ELYA 4ZRDA 4G0PA 2CXNA 1KSFX 3MJCA 5FBZA 3QIAA 1MHTA 2PX8A 4M0LA 1UBSB 3EMKA 4CTJA 5K0BA 1FMCA 2WTMA 5JSHA 1XNGA 3RHZA 1JA9A 3UK2A 4F06A 3LAWA 4M1KA 3GDFA 1X7DA 1I8TA 5GGXA 1DX9A 3HZHA 3OZGA 1E6UA 7MHTA 1P18A 4EM6A 2ISQA 4EMUA 4HDOB 1A7UA 2WVGA 2IV3A 4Z4FA 3WIUA 1K0FA 4X6YA 1I36A 1SUEA 1DXYA 2IS4A 4U7DA 2B1GA 4D7AA 3KD2A 3G8AA 3O94A 5FORA 2O5EA 4B4UA 2R8EA 4B31A 4B3FX 1TM4E 3MA0A 4D4KA 3WNZA 4AF8A 1WQ1R 3G6WA 3FYDA 1GNQA 1W75A 3EOBI 1NUTA 4TWBA 3S5JA 3UENA 2W90A 4B8WA 4RBNA 4NONA 3PTAA 3BT7A 4RDHA 3IEMA 5E1OA 4J7AA 5DTRA 4TMYA 3G9QA 4PG8A 1RIIA 2QRZA 3DSRA 3MWDB 2P69A 5CYPA 1Z4QA 2H4WA 1K3UB 3KLPX 4KPUA 1N5JA 1YVEI 3G9XA 2O1EA 2X14A 1LC3A 2ECOA 5CNKA 4NAVA 4PLZA 4CHGA 2F2TA 3D1VA 1KYVA 1NOKA 4FBLA 1PZGA 2GPWA 2GPBA 1W88B 3A6ZA 2NTJA 4ME6A 1MJFA 4MVJG 5EIAA 3OQVA 1OYVA 4HRYA 1EBFA 3SC6A 4XUCA 1YGYA 5KTYA 1YJCA 2RI0A 4NL4H 2FCRA 5JSQA 3GLFA 2ILVA 2Y1DA 1IM8A 2Y8EA 3GA7A 4HEQA 3VH2A 1FUUA 4LF6B 1QP4A 3SHFA 2B5WA 4NMHA 1FUIA 3B8EA 3CF4G 1LVHA 4M3NA 4P4SA 2ZRGA 3GT3A 4X90A 4D0LB 2XUHA 2PFSA 3DZKA 2Q27A 5HDBB 1AKEA 3SZOA 1FSGA 1G5TA 2E4WA 1XCLA 1UBEA 3ZEAA 3HXMA 1YQGA 3GLVA 4GOOD 1XWWA 1JMKC 3H9BA 4IV0A 1W4CA 3QFSA 3MG9A 2ATVA 1YE3A 5G0WA 4DNPA 2UUPA 4JVLA 2BD0A 4M8KA 1IE3A 3FCSB 5FJIA 1FX0B 1PDOA 4K8OA 4XCXA 3VJMA 3SQXA 3FTDA 1O03A 1XZAA 2O2EA 3G2NA 3Q3JB 4MROA 2DFTA 2Z58A 3W0LB 5BSUA 9LDTA 2P6NA 4I19A 4L0CA 5IT9A 3ZLTA 1EWYA 1G1AA 3OOJA 4C1BA 4R40A 1WZCA 3E1GA 3S28A 3WKCA 3CVUA 4XW2A 1ZONA 2RE8A 3X43A 2PT7A 4CMEA 4OP1A 4Y0VA 4A1OA 2FLWA 2YMPA 4EQZA 1MDBA 4WE3A 2FPUA 3DEJA 3AZPA 3K7EA 7AT1A 3I64A 1FX1A 3LP5A 3FVQA 3UCXA 2BM9A 2L42A 2H51A 3TW6A 2J3HA 2VNHA 4S1TA 4BVAA 3P26A 1NXVA 5C52B 2N75A 1BE0A 3WO0A 4EDHA 3R6TA 1E1CA 4MB2A 1NVDA 5HSGA 5DHUA 1USVA 4BO0A 2PBZA 2BMAA 2D1TA 5FQOA 4H1HA 3OPVA 4URVR 1FF9A 2G83A 1QRSA 3R6WA 4S2EA 3ZVLA 5LKAA 3IOYA 3U7GA 3IVXA 3KB8A 1LXCA 5AKJA 5MDHA 5KTOA 4PR3A 1QTRA 2AKEA 4PCUA 3G13A 1HY3A 3TLCA 2AG8A 5DGDA 2ZZMA 1JHMA 2IH2A 2W6ID 1N9GB 3BAFA 2WB2A 3Q6IA 1UK6A 4OUDA 1FU8A 1L5WA 3EGVA 3LT1A 2AQ8A 4ZCSA 5AM0A 3LX5A 4TT3D 1ZN7A 2Q3JA 2GXUA 3GFFA 4KAXA 1ECFA 3VKGA 1X7YA 5ALJA 4TKVA 1T25A 2QLNA 4X63A 5BW4A 3AY6A 2AFIE 4D8XA 1DWUA 2BMEA 2FETA 3EW9A 4LJ8A 5JROA 2V74B 4HYQA 6ADHA 3IELA 4RSRA 1BFUA 3R0XA 3FNQA 5EHIA 1U2DC 1WW8A 3EWAA 3CLUD 3GJ3A 2X9VA 3H0EA 3LLSA 1AJEA 3RGWS 1NSFA 1INLA 4PLYA 3U7IA 2GEJA 2XDWA 4J16A 4A8JA 3AR4A 1I3NA 1BRMA 3GEGA 2C20A 1QLHA 2I33A 1CUJA 4MIYA 3T1NA 1L9KA 3M9WA 3CHYA 3VKWA 5HQTA 1MC4A 3VR4H 4OQDA 3O95A 5TVGA 2P2CA 2IF2A 3F7NA 4OA5A 5EZYA 3DGEC 2C7QA 1ZITA 4HAOA 3L4BC 1I2DA 4BQOA 4GPEA 2GCIA 1PDWA 4MUMA 3VC3A 4XLLA 1IH8A 4DLWA 1ZM9A 5I9TA 1T5OA 1QXSA 2HDNB 3UAXA 3WTCA 2RG1A 3K30A 4RPHA 3QFFA 4ZHSA 3NEJA 5FNVB 3W5SA 4ZAGA 3C1TA 4XWTA 3FPHA 3HLYA 3IMCA 5CT9A 4YP0A 3E9RA 2HCJB 5CG2A 1Y7LA 2GN0A 2H4JA 2YN0A 3HSSA 2DJ5A 3FDIA 1JG2A 1NUQA 4Y2JA 4IQ4A 1E7SA 4KAAA 1O97D 2FG5A 2JIOA 3AZOA 5FYDA 5LWQA 2HJ9A 1C0EA 3AC0A 3CU5A 3R40A 5HCIA 2XXAB 1E2BA 3M6AA 3I8OA 4AURA 4COOA 1O89A 5EG5A 4EA7A 4M89A 2Y1XA 4MRSA 4BQRA 1E2EA 2GJAA 4IICA 3X2EA 4B17A 3B51X 3L77A 1X86B 4ADSG 5H68A 2XT6A 4HX9A 1JJFA 5HZMA 2Z98A 3C97A 1L5YA 1C1YA 2AEFA 3KU1A 1LGYA 1RWNA 2JLAA 3PC4A 4QNNA 4RXMA 1G4UR 3P96A 5FNZA 1C3JA 1H85A 4CE6A 1DTWA 2ZJ8A 3R6GA 4KOAA 4TKUB 4D9EA 4BV9A 1PFQA 1WTCA 3OTOB 4AY2A 3R4VA 3OLCX 1TL7C 4IP0A 2ZU0C 2RK6A 2AC2A 3L7NA 1G9TA 3KL4A 3WLPA 3EFBA 1A8SA 1T9KA 5C7IO 3HYCA 5DM0A 5BUQA 1JR3D 2GASA 1YGPA 1D2AA 4XX0A 1NBWB 5ER6A 3ZTWA 1H2AS 2JGRA 4F3NA 2G9ZA 1QHYA 2NU7B 5IN5A 3SVZA 3ONVA 3HHPA 1E0DA 2W5UA 4JYZA 4F4JA 1JVSA 1J7JA 4PBRA 2GYWA 3SR3A 3L5OA 1XQVA 1AKYA 3HB1A 4JLMA 2HRRA 1W4BA 5AXDA 4IJ6A 4ZODA 4PLFA 2JZNA 1PS8A 2EC5A 3PQDA 5A4FS 3AP3A 1JKJB 1U9IC 2VJNA 3JR7A 4YP7A 5CXSA 5AFSA 2J5BA 5YASA 4EY8A 3RVKA 5DGXA 3CXUA 2DMRA 1JKXA 4R51A 5JVDB 3GJ6A 5CR9A 2QRVB 3IAHA 1BDHA 1IK6A 1SBZA 4X97A 5ECWA 3ZV5A 3VA7A 2XIJA 2ZTUA 3L9XA 3AM5A 3OQHA 4FYJA 4OH1A 1RKBA 4NOMA 4MZXA 1DRJA 2PSHA 3D7KA 4RABA 3OCVA 3NOVA 1MPXA 3AETA 3EEOA 4B3TB 2YYZA 1P0PA 3B48A 3DB1A 3UHPA 3HCAA 1S89A 5K6RA 4IMRA 2V7EA 3GNQA 3O90A 3EUFA 2QN9A 3DM5A 4B09A 1AK2A 1E4OA 4HNGA 2DVMA 4KTTE 3E3OA 2WVJA 5DN9A 1FTWA 4QJ3A 2OECA 2CBGA 1IUOA 1R5NA 2A0YA 2JI4A 3CRQA 2QQGA 4F5WA 1ZISA 2JZOA 3PI6A 4ZO4A 2W2PA 3JPYA 3S1SA 5HRCA 1VKHA 4QFBA 4G0MA 1XI2A 1XQ6A 3CF2A 1EVIA 5U9CA 5C46F 1LW6E 4MRVA 1ODJA 1D03A 1Z6ZA 5FNVF 2FPXA 1ZG3A 1PJSA 4QYTA 1K08A 5HHTA 2DR2A 2ZT6A 1BGWA 1OH7A 1XK7A 3BFKA 3FCUB 4URUR 2QS9A 1RZ3A 3FSGA 5LP6B 3CR8A 3KHUA 1OD6A 1BXKA 1C7ZA 2FQWA 2VQSA 3L8CA 1ONOA 2I2FA 3FCAA 3G0BA 3PPVA 4R1OA 5DH9A 3MTDA 3WYNA 1UMCA 1CE8B 3P71T 1Y48E 4E2WA 3FZYA 5B3LA 1DQPA 4AJEA 3VJRA 1GFZA 2CVQA 4BX2A 3ERCA 2WF9A 5BSEA 3MAAC 2V9CA 4JA0A 1KO4A 4C4OA 5J4LA 1SJ9A 4OTZA 1QDUA 1UMBB 1GPKA 4C03A 3A9RA 1YF3A 4KVZA 4PG6A 2C5EA 4MDHA 4KO3S 1KI9A 1U8YA 3NHYA 3ZDRA 3ZBUA 2D8MA 4EW6A 2QN3A 3OUTA 4ILEA 4RHUA 3TZQA 3R5KA 3M5CA 4XM0A 1J39A 1RYDA 3RUPA 2IUYA 1LI4A 3RU9A 1P7WA 1QCCA 1V8DA 3H42B 1CNEA 3LO8A 3X1KA 5H8WA 4WLUA 1JPJA 1KQPA 3GJRA 3SXUB 2A33A 1V2HE 4BDSA 4E88A 2R66A 1RXIA 2Z2JA 3J7TA 1H8EA 2XJ9A 3JQ9A 3UJAA 1W2HA 1YDEA 1T8WA 2GARA 1P19A 3HDQA 4II7A 3OZ7A 1TAQA 3ZZTA 1E96A 3MJRA 5IJXA 1EUDA 4EJSB 4KJZA 3ZZNA 2H1FA 1WETA 1PCXA 1PKXA 2EFYA 1R3UA 2VPPA 4FB4A 4WXPA 3TIIA 1ZXXA 3C15C 1P6XA 3NYIA 5JSZB 4QX6A 3INRA 4LPKA 3KDAA 2CZCA 3D6TB 2X42A 1XTIA 2YJGA 4FCCA 3LGAA 2YUTA 1ZC4A 2YZKA 4FI3C 4UM9B 5IEJA 1U2GC 4AXBA 3RSHA 3SKYA 4PZEA 1M0WA 4LDPA 1XEWX 3TSZA 1QANA 2RHHA 4PC7A 4BN5A 1UQUA 2EYUA 4PYRA 5JVDF 5D87A 5EMMA 2GLXA 3MTBA 4F86A 1FRQA 4ZARA 4WN9A 1EFUA 3SEFA 2QAGB 3ZE7A 3EASA 4Y98A 2XR1A 4X20B 4I1IA 2AUTA 5CFLA 2Q6OA 2AS0A 4GKBA 3SQLA 4F2HA 1Y8QA 1GLVA 3FKQA 4ZTUB 2HRDA 2J3IA 5AM3A 1TLLA 5K4AA 4AJ4A 4P7JA 1M7BA 1E3JA 3G9UA 3AY3A 3QMPA 5BSFA 4XOIA 1JDZA 3O4JA 4AO6A 2O23A 4BU1A 3K9QO 5LD2C 4WZAA 3RWMB 3V34A 5CD9A 1LBSA 1VLQA 1I6KA 1M1YA 1ZGAA 3A7DA 5FWYB 3A4LA 3U9TA 2A1TS 2PN1A 1MF7A 3H4MA 3B9QA 4LZNA 4O3FA 1FLNA 4URWR 3N58A 1G8MA 1K68A 1ZEMA 5IP5A 1R6UA 1NVUQ 1WNFA 4F72A 4LKOA 1PSWA 2B6NA 1B74A 1PNVA 5CT6A 4DRYA 2R2GA 3LDFA 4OQ4A 1F0PA 1OJ7A 3PHBE 4DIEA 1Z22A 2RGAA 3UC5A 2JJ1A 2VUHB 3ANNA 4F96A 2QM7A 3DDCA 3TBKA 4INZA 2W6QA 4PEVA 4KOEC 2OORC 2O0MA 4LOKA 3IP5A 4RL4A 3ROKA 2ZSJA 3T7KA 4ZOLB 4CF6A 4JBWA 4RGVA 1H42A 2VFAA 1TJYA 2PUBA 3E9YA 4W9RA 2ZOSA 4EMBA 3JQBA 4OSOA 3P2KA 4MWGA 2AZTA 2QHXA 1IQ0A 3HM2A 2JJ1D 4AYWA 5KYWA 4BQPA 1E3DA 2HF9A 2CJXA 2O7NA 4MW5A 2O20A 3FVTA 4WOJA 4RTSA 1KOLA 3PEFA 4M9RA 4OYLA 4IOLA 3AEQA 1GL6A 2BC9A 4IUBS 2JCXA 4ZOEA 4DA9A 5FA8A 3O6VA 3U4GA 2DERA 1I3OA 5FTJA 2GUWA 5HGJA 5C8ZA 1SPBS 1RRVA 2I99A 5IG2A 4L72A 4Y6OA 1AM4D 2H85A 5TPZA 3U4CA 1WSBA 1T0BA 1ZHHA 3KZKA 5DE3A 3TS1A 4D9CA 3GZNA 5SYMA 3BILA 3OSZA 2QW8A 2QTBA 4NYIR 1NF2A 1J06A 1JQLB 1LFAA 2XYGA 1CDZA 2BMWA 2D54A 1KMNA 2H1CA 1TQ2A 3EIOA 3EXHB 3GRAA 3WNCA 1KAGA 4Z7QB 5CCXA 1ZH2A 4RHTA 1EJ0A 2SKDA 2YR0A 3LBYA 2VTBA 3OP4A 1IDOA 5BXYA 1X1QA 4FOOA 2IW1A 3E22B 4R84A 5DTQA 1C1DA 1MX3A 1A7AA 2HUNA 1QGZA 2G63A 4R2LA 1EFAA 1O95C 4YYEA 5DHQA 3H97A 4ZVNA 4A36A 2I76A 1M0EA 2CSUA 5EIFA 2H7YA 1M2GA 4WGGA 1J7KA 1Y3IA 3DZHA 5ALFA 5E9JA 2QN6A 3PNQA 3TNFA 3VDXA 3ZCPA 2IEYA 3OOWA 1I7NA 4I9HA 3IJ5A 4LPSA 5D84A 3PUWA 4TZ0A 1UJMA 2VOEA 2QR3A 1V45E 4Z3DA 4D79A 2J46A 3IOBA 2DETA 1E3TA 2TS1A 3NFYA 4QZVA 4C7OB 1RTKA 4LVUA 2ZSDA 1W30A 2KE5A 4ETMA 4EFKA 3CM0A 5JO0A 2ZXEA 1C81A 4UTRA 3G1TA 1H4SA 1SCJA 4IQGA 4EA9A 1MEEA 2PKEA 1Z39A 2CDCA 3CEHA 3RUEA 3X1DA 2I62A 4NZZA 4DSNA 1EDOA 2OV2A 2PQ0A 3CIOA 1GNSA 4NYIQ 3BSYA 1E62A 3LT5A 2JASA 1X0VA 1EGQA 2K2WA 3QEMA 3CZ5A 3RUCA 1IBLB 4N7MA 3RUFA 2I3GA 1JHVA 3STTA 3OF3A 4QIHA 4MDFA 4HMQA 3VISA 3PGA1 3B5IA 4NH4A 4JBYA 1SBHA 1TW2A 1Z8DA 1SKYE 2A1TR 1E6LA 4LRYA 1P80A 1Y1PA 1W34A 1Z36A 2JI6A 4IHJA 1GDHA 2BR3A 3SOPA 2ACEA 2H31A 5EGNA 4DEXA 4AK9A 5J1SB 1LBTA 3SQWA 5CTAA 2VZEA 1D4ZA 1Q0LA 2ISCA 3RSLA 5GP1A 4YALA 3WIDA 4A6XA 1OXXK 2AMYA 1Q15A 3MHTA 1G6KA 1ICIA 3LFHA 4NPCA 3ZQ4A 1SXIA 2EGHA 4F7WA 1YFLA 3OFSA 3PR3A 1JR6A 4JP2A 2WQ6A 4GHWA 2GB4A 3ODGA 3R6DA 4MDEA 3DBRB 4TTAA 4ZOLF 1MEJA 5BQ5A 2NU9A 3KU4A 1TMKA 4DQ0A 5DVZA 2CLKB 1NV8A 1LRLA 3D8NA 4JI1B 3G1UA 1JF8A 3IIIA 4P36A 1JE0A 2DUWA 1Z3CA 5H83A 2YZNA 1GL3A 3CE6A 3G8BA 2MU1A 2FFRA 1D2GA 3JRXA 5KKAA 1RCFA 2P40A 3HG7A 3PWSA 4PG4A 1AHIA 2J4FA 4M1YA 5B2EA 1XZDA 2XMPA 3FYUA 1VKRA 1ORIA 1J5PA 4NBNA 4UBKA 3EIEA 5E1DA 3TLJA 1A9XA 2WFLB 2XRZA 3OX4A 4J75A 4BYGA 1FP1D 5AQEA 1XKTA 4JUDX 1ZD4A 4BO5A 1L5FA 2FVYA 4JVSB 4YJGA 2PT6A 1L7OA 1Z2OX 3JD2A 2CBXA 2WFMA 1B3BA 1U0NA 3VI4B 2A35A 4ACAA 2I3DA 2ZJ1A 3GWZA 2CKMA 3WJ2A 4B34A 5A3VA 2D5BA 2C3UA 2CVZA 1KA9H 3MWJA 3TRJA 1XRMA 3OP1A 5E1BA 4WZAE 3IDAA 3K1YA 2YNMA 4Q9HA 3ZE2B 3DEZA 3WOVA 4CKCA 4RVNA 5JAUA 5EXPA 2BI8A 4DWWA 5K0EA 5AO9A 2DSTA 2FW8A 4E5SA 1A3CA 5M3BA 2NACA 2AR0A 5DYYA 3C8MA 3TI9A 3QU9A 3LQFA 5KZMB 1DARA 4REQB 5IUKC 4RVOA 4CG3A 1I7QB 3AR8A 5IWAB 2XCIA 2YNMD 4Y6GB 1JL3A 4BXOA 3COWA 3EVBA 4BTVA 3IV7A 4QT0A 2V6FA 4BY9E 4XVHA 2HA0A 2PLWA 1JB9A 3HFJA 1SBQA 3L7LA 2ZJAA 4NENA 3L43A 2WWXA 5REQA 1YS7A 2NSDA 1TF5A 2ZJ6A 3GA5A 1BOFA 2ODTX 4HCJA 2XNSA 3LDUA 3WLHA 1F14A 3JPWA 3M7IA 2EW8A 3UMBA 2C9BA 3EA5A 3KHSA 1TA0A 1I10A 3F7TA 4DL9A 5ITZB 3ZJUA 1JMVA 2OCXA 3V3TA 1AS0A 1HWYA 5HG0A 1VPVA 3Q3GE 4L7VA 2UZAA 3DOJA 4A73A 1PL8A 3THRA 3V9AA 5CA0B 4GNRA 2ZUVA 4UHCA 2A58A 2WM3A 5G1PA 2A7XA 1MFZA 2R8OA 2XTJA 3ZWAA 5A4JA 5F73A 5IH3A 2PIDA 3ED1A 2IYWA 3KEFA 4B6RA 5TMEA 1PWYE 1YQTA 4HMPA 2D2IA 5HFNA 3CEAA 4J3FA 4Y6QA 3ZXXA 5HKAA 1NVBA 1JHDA 2G8LA 2PEYA 5JCJA 3O82A 2GWHA 3RBAA 3ZNQA 5B6PA 1VPWA 1Y3BE 4BB6A 2DKNA 1E2JA 4PAGA 1F6DA 2J7PA 5FO1A 3GNLA 3HVHA 4M1ZA 1UF9A 5CAEB 2TYSB 2HF2A 3PX7A 4DOMA 5FX2A 1G8HA 2ZI7A 2J5KA 4C7XA 2WUWE 5JCJD 5H1YA 3EZ6A 3ICOA 5JZMA 4FPXA 1FVXA 2HMUA 2HQSA 2X23A 3I0MA 1GGFA 1FDIA 3P0RA 4K6MA 3VXKA 3R3HA 3I9KA 3RV3A 1KEWA 1YDHA 1IWPB 3UYLA 4PC1A 4EFNA 3GP8A 1ZMBA 2IEZA 1MJGM 2DUJA 5F3WB 8AT1A 1VE6A 3SFZA 3A6LA 3CTPA 2V54A 1NMSA 3MCWA 5B6IA 4GMGA 1MRNA 4NMLA 4UOQA 4CQMB 1FB5A 4LF5B 4XSGA 4O4JB 1V1RB 4UZEA 3IBCA 4KI7A 4NBWA 1ARZA 3MJVA 4OATA 4XCVA 3T5MA 3UK7A 4KDRA 4MO9A 4N1AA 1BGXT 3JATA 1W93A 4MR8A 5EKSA 3IKJA 4D96A 1JEYA 4K2AA 3FWPA 3CO0S 5B7NA 4L6CA 3QTBA 1E32A 1UC8A 4F9TA 3QW2A 3NBZC 4RJIA 5CFQA 4UZSA 3O47A 2YJ4A 3MAGA 3EGDB 3DTVD 3WNBA 2W22A 3AF5A 4IGKA 4MV6A 1QH1A 3IALA 3ZW7A 2HSGA 3L6CA 4LYJA 4YAIA 1WS6A 5BR4A 3SK0A 3QVLA 3NYWA 1Y5NA 3WLMA 3L1UA 1JWBB 2CLOB 2PTGA 2NNWB 3GXOA 4C08A 3V8EA 4O3MA 1AHNA 5I8WA 2O8DA 1FP4B 2YOGA 3DONA 4XTCS 4LAFA 2WMDA 2IOHA 5FQNA 4GPZA 1MB2A 3EC7A 3T5PA 4LJ4A 2O2YA 1NYRA 3PDIB 4FZVA 1TCVA 4IO1A 1MO2A 3SFVA 4CPDA 2LKCA 5I7AA 2J09A 1ODFA 3E5NA 2GESA 1GKLA 2AJLI 3I09A 3Q3EA 3B1ZA 2B92A 3ZKAA 4E03A 1E3WB 1YC5A 2RSLA 2QBYB 4C88A 1QHXA 2GD2A 1F0YA 1NR1A 1LUAA 1MXFA 4JVNA 2HLNA 2VHEA 4YV1A 5A71A 5FTKA 3CRZA 3MJ4A 3NJ8A 2AXNA 2PLAA 4NYMR 4IPTA 4WW0A 1WXHA 5J2UB 2R60A 5C31A 3T3PB 4BGIA 3FRJA 4PTYA 1ZNWA 1N2OA 4L7QA 4RAQA 4U8HA 4X8HA 4WV3A 3AFMA 1QCDA 1UOEA 2QYOA 3R7FA 3G7NA 5KVCA 4WL0A 1EQ2A 3C7DB 4HLDA 3GDGA 3EXIB 3IHTA 5CA0F 4I46A 3BJMA 3R3UA 3AERA 4K6FA 4MRMA 2PO5A 5EE3A 2JFOA 5EJ5A 2BMVA 2ZRBA 4UUQA 1TJPB 4V02A 1PR4A 2O48X 2HHLA 2XNKA 2ZB7A 1I0IA 1S2GA 3KJNA 2G08A 3JVUA 4FC6A 2Y4NA 4U4AA 2PJZA 4M0FA 2OHGA 4RTLA 4QAJA 4HWKA 3DBHA 1Q0HA 1U8XX 3O8CA 4HBGA 3M6IA 4MV4A 4BZQA 4BP8A 1Z17A 2FSUA 4DDUA 3J80A 4N7JA 3Q0TA 1I4OA 2ZAMA 1NV9A 1THMA 1R0LA 1XIVA 2Z1DA 4K9MA 4NZPA 2NYAA 4BX9A 2QVXX 5AI8A 1G7RA 3EDMA 3HKBB 3EULA 4B87A 9ABPA 4V0SA 2G0TA 4R6WA 2XIQA 4R3WA 1L5RA 1C9EA 1LV7A 2HDHA 2QLLA 1UC5B 4JU9A 4B47A 4EF4A 3W8EA 2JL1A 3B85A 4NYMQ 1E1LA 4MS1B 3JQAB 4DLZA 4U7HA 1COWA 2E82A 2H17A 3PFFA 2JA1A 4YJFA 1F8XA 3N0TA 4FJ2A 1CEQA 3A14A 2JLCA 4O0MA 4PV7A 2IUUA 4ICIA 4A91A 3I72A 4LJLA 5FOUA 4I3HA 1Q2XA 3T5GA 2R7MA 3UH0A 1XZCA 4O4JF 2BYTA 3SC4A 1ZQ1A 5K0GA 4C6TB 1E66A 4YV0A 1YCFA 3PPWA 3RBVA 2H92A 5L4SA 4QXAA 5T4EA 3GLFB 4KPFC 3UO8B 3WQRA 1P2TA 3FCXA 4TRMA 4A5OA 1MQ8B 1TQ4A 4Q9DA 1QK5A 3F5QA 3H17A 1WY7A 1E9BA 2C03A 3ECCA 3B38A 2EFDB 2I67A 1X1AA 2FN8A 1BHJA 3H4VA 4CL0A 2AJTA 2VPYA 2I03A 4J0JA 3L0SA 3PP8A 4XZ3A 2YWCA 2ZWPA 3TPFA 4LQ4A 2V03A 1E7MA 2DFDA 2WHQA 3S4YA 5CM9C 3OZWA 2QMUA 4I5DA 1V5FA 4RJ2A 2E6UX 4H27A 4QARA 2BGKA 1M9NA 1FMTA 2HBYA 4DHWA 3PBKA 2G9NA 2EJVA 3FSEA 1O96A 3IEPA 1LJLA 2AF4C 2B78A 1RDFA 1TT7A 3HN2A 2M2IA 1UT5A 5KYNA 4TS4A 1KOFA 2QXYA 4KRFA 3A7EA 1XF1A 2RCYA 3U3DA 3TUZC 3F1LA 3ZV3A 3WA7A 1HC7A 4BYMA 2EFJA 3FDJA 4HS9A 4UM8B 4X45A 4I8IA 3HDGA 3V46A 1I1HA 4LF8B 1EVZA 1OC4A 2IDZA 3LWZA 1TKRA 4TXNA 5ARCA 3M6XA 2XYRA 2O1XA 2FPGA 4L02A 5DZSA 1M66A 3OE1A 4BRWA 5LZ7A 1QUFA 5F33A 2AZMA 4HB4A 2O7VA 2WU1A 1YR6A 2VDLB 5L6LB 5KNCD 4Q01A 5DXAA 3Q85A 4LJ6A 1P6QA 5J2UF 2ANBA 5JBQA 4B4DA 4WKNA 2E3JA 4BMVA 5TXGA 2VPZA 1QK4A 5SY6A 4CTOA 5H5JA 3Q7PA 4YFYA 4FOLA 1QPZA 2IXFA 4KRYA 4M8SA 2ZZKA 2A92A 2R6CA 4EA6A 3SR0A 4OQNA 5CCBA 5M2QA 1PN3A 2BHNA 2QTHA 1WP4A 1DB3A 4G24A 4MYHA 3ZQ6A 1DJMA 1C5KA 1SAYA 1E3LA 1ZNQO 1C7RA 1P7PA 4FR2A 2P67A 5HX7A 3OQBA 5JXIA 4P32A 4ZV9A 5IKOA 4CTNA 3EC1A 1CUUA 4J76A 3LPMA 4YMWA 3WJ7A 3ZJVA 4HAYA 3EVFA 5FTWA 3D54D 4LXUA 2OK8A 4QPZA 3NM6B 5LQCA 1G5FA 3JQGB 1D1SA 1ZIYA 5TB5A 3LPAA 4GR4A 5ALPA 3DBLB 3IUJA 2FSGA 4ISBA 1ZIDA 2CLEB 2ODWA 4QPCA 4WKGA 1MOSA 3WYFA 4AZWA 4ITUA 3SHOA 1GNRA 1YAHA 4Q6BA 5KTRA 3VSAA 4J0EA 3L84A 1Y33E 4J4HA 2XEXA 1BVRA 2VH2A 3Q7SA 2OPHA 1BGVA 4F2WA 4CIDA 2GZ2A 1H0SA 1R12A 2X4IA 4NFHA 1BYUA 3D8TA 4N49A 3VO2A 1JPVA 1VPEA 4CUZA 1BU5A 1XAIA 2QDKA 4CCSA 2D1RA 5L3QA 2PGIA 3GJZA 3GVXA 3J7AC 4HUQB 1Z73A 3VDMA 4MICA 3E3AA 3QYFA 2XGJA 1FFXB 1IIRA 1XHFA 3JQFC 1F9AA 1IXRC 1ADGA 2IP4A 4LGMA 4UASA 4KR6A 4MV3A 3UGKA 2AFVA 3E8MA 3D6JA 5CEJA 4QRDA 2OB2A 2ADOA 2I4MA 3LIIA 4CKZA 1WP9A 4CCAA 5KOHB 1A1SA 1T2NA 2VHUA 2IUEA 4ZD6A 4AS2A 2DTEA 3AUJB 2G07A 1ZUNB 4H4CA 4HLUA 3HBLA 3EISA 4KP7A 3O9MA 2WE7A 4PBTA 3WO1A 4KIUA 2OM2A 1POWA 4OGFA 4NQRA 4AQDA 4AS1A 3CT4A 4KWIA 3WG9A 3AHIA 5EXXA 4CDRA 2A59A 3QXJA 4J4BA 3PF9A 3B1JA 4WADA 2VXCA 3MWYW 3R5XA 5FTLA 2I66A 4JEMA 2GAAA 1NOJA 1TIBA 3QX8A 3FPAA 4OH7A 2Q9UA 1TT5B 1XEXB 2BKAA 2O0HA 3K9HA 3ZZMA 1VLJA 2FTKE 2UUOA 5FLEX 1RM3A 2ZB8A 1JIXA 3RRMA 2HNAA 4OI4A 4OL0A 3U3MA 2XUFA 4RCVA 2XB2A 3D64A 4BGUA 1XTZA 3FFAA 1QYRA 4MVJA 4ZQGA 5IANA 1B42A 1IMOA 2C2GA 2IYLD 2JFWA 3SJCA 2EZUA 2WJHA 1RBMA 1HOXA 3QLJA 2JFPA 2BFEA 2Q07A 3ETJA 3V5NA 4CLHA 4NNPA 1TCAA 2OO5C 1G17A 1F2VA 1AKUA 2IEIA 5T4BA 2K4MA 4ZIRB 1KJIA 1EUZA 1TA4A 1XKLA 4MVJD 5KX5F 5LBIA 2CMGA 1I7PA 4N65A 1PR3A 5TVKA 4XGQA 4D5GA 3MGBA 5FPSA 3AF3A 1VI5A 4F97A 4MQUA 2H1RA 4D4JA 9LDBA 5JDCA 4PWYA 3CNQS 4UUAA 3SQNA 3ZR4B 2Q5QA 1Y7HA 2Q28A 3DAHA 4NESA 4XX1A 4CQLA 2WWGA 4DIKA 2ZAOA 1B0ZA 3PFKA 2C0CA 3LGXA 4K3VA 4ZV7A 3RVJA 3VYVA 4AM8A 2MYNA 1R74A 4MH0R 1ODTC 4MVCA 1QR6A 3SZGA 5KMGB 4C0XA 1RXEA 1NQVA 1ORVA 1VE1A 3GMIA 3OF2A 4HZGA 2ET6A 2WKWA 3WGYA 5LFAA 3DHEA 1HORA 2YIMA 4XJSA 3K2BA 5FNVA 4EMTA 2P9QA 3B6EA 4NDAA 4H6PA 4B32A 2JVKA 4LJRA 2J0EA 5AOAA 2SHKA 1Z06A 2H8KA 3VNAA 2XTZA 3LCJA 3AUAA 3O8NA 4L27A 4AXXA 5BSGA 5ICGA 3G0HA 4WTOA 3O03A 2NZ8A 3MSXA 1M54A 2NTEA 3IBTA 3KTOA 4IH4A 3GARA 3H5TA 4A16A 2P77A 2EQAA 2YJ3A 4MR7A 1NW7A 1OBHA 4OMFG 2CC2A 3GIWA 2XMQA 1E0KA 4TYNA 1NBHA 1I4WA 2JRCA 5C53B 2TMKA 2V58A 5EIEA 3WLJA 3EIUA 1BU8A 3PXEA 1AGNA 1AUXA 2ZBRA 3BWYA 3P4XA 2ZRKA 4HNAA 4TKUA 3V8VA 5E38A 4BFYA 2HEIA 1PJLA 4FNOA 2Q5IA 1JQAA 2XZDA 3DZJA 5FXMA 4YMVA 5ARDA 2PFGA 4F5ZA 1OFUX 3IMKA 3TCKA 5IXJA 3UKDA 4K03A 1GRQA 3KVNA 3CNLA 3CRVA 1DFGA 121PA 2O57A 3FGPA 4NOJA 4KO2S 5HOQA 5AJUA 3TB6A 2XYHA 3L40A 4XYGA 3RR2A 1QB7A 2WP0A 4MVJP 4LGVA 3UW3A 2CSXA 4MPPA 1J9GA 4PRLA 1GUZA 4DWJA 2JC3A 2WR8A 4R3UC 1CUVA 4P33A 2JK0A 4A03A 3DH0A 3PUHA 2A1UB 1BWPA 1A27A 1NMEA 3OTGA 5B4TA 1L3CA 2CXQA 3AO0B 1NF3A 2D1FA 3L1HA 4AB1A 1B6RA 3T3OA 4Z4QA 3IQDB 1W0CA 1PUIA 4JCOA 3L7CA 4K9QA 4YCJA 2CXRA 3TQCA 2O8VA 3EBOA 1MEOA 6NULA 2G17A 4AKGA 1JFTA 2CVOA 1T6BY 2NZWA 4YWHA 3RKRA 4J0KA 4B5KA 3EZYA 4E13A 3T9EA 3WIOA 2WLSA 3YASA 4L8YA 4ASUA 3SBOA 1OTXA 4UVEA 3QJGA 2RKOA 1XJWA 2R6R1 4ESEA 3U62A 1SCUA 1U0GA 3QUCA 4OP2A 3ROXA 3RC9A 1UZAA 3MZ0A 3RT9A 2DM6A 4FFBB 1J9ZA 1W8DA 2OV6A 1V6SA 1T8UA 3T1HB 3FTPA 3B3GA 4QXRA 2OXFA 3IDQA 4PZPA 1ZR2A 3T7TA 2FK8A 1NN0A 1ZDMA 1YD7A 4GMXA 3HJFA 4M53A 1H9CA 3BEOA 1XLTA 1Q1QA 5JPIA 4ZV4A 3UPUA 1TJ4A 1W0JA 1VGQA 1UPBA 1X7HA 3KKQA 3MQ2A 4YFVA 4EVQA 5FV4A 2CLHB 10MHA 2PX6A 2OZKA 2IY9A 3PPIA 1EFRD 5B1HA 4U2EA 4AY6A 1K27A 4JLPA 3GAAA 2HXSA 4CF3A 3BKXA 3FWYA 1J23A 1DX4A 3CNOA 3UAWA 3NLLA 2J41A 3HJTA 1ZK4A 5KCMA 4PVCA 1ZJZA 3DEKA 3FLAA 1R4AA 4FR5A 1W0JD 3PHCA 3VU9A 3FTCA 3S70A 2NZVG 4UVIA 4BNNA 4EUSA 4P31A 4D3FA 4A6EA 1DP4A 1XFAA 4Q7EA 4XYMA 5FP0A 3RC2A 1E2UA 3UMMA 4FN5A 1W581 5AT1A 1JZTA 2PU5A 1DKRA 5M5BA 2DUNA 2MMGA 2JIPA 1O5TA 3BICA 2FOIA 1CJKC 1VYVA 4RD2A 2YDXA 5B3JA 1C9NA 1BROA 2PRIA 3CW2A 3CTMA 4B81A 5CG1A 2WPNA 4YCAA 4ZGBA 1CUWA 1PWZA 4UTOA 4IIDA 1CG6A 4AG6A 3DVAB 2OV4A 2RGNA 1O2DA 3IFSA 4HEA6 3U4DA 3ZW9A 4K46A 3IQZA 3PEUA 2JZCA 1SM4A 5B1EA 1CETA 3R3VA 2B5OA 1X94A 4LOLA 1OHHA 3VTZA 4HPJB 1U0JA 1UMBA 3O8LA 3Q5EA 1V7QA 4RD6A 4RESA 2R1VA 3I32A 1RJWA 1SK8A 3L04A 2GK6A 2EHJA 3PUIA 4L22A 5DNWA 2GBLA 1CUEA 4J0IA 5BV7A 1F8UA 1SUSA 1YTLA 5ED4A 4LJYA 3T5AA 1IVNA 2OGSA 1K0UA 3RU2A 3A6DA 5HS6A 1DINA 3ZGYA 4RF2A 4GKJB 5FAXA 1P75A 1OHHD 2FZCA 1FOEB 4P22A 3C1AA 3R2JA 5CDUA 4IEEA 4JT8A 5DGIA 1F3OA 3OFJA 1TUIA 3I8SA 4RLQA 1DBIA 4N01A 5KJEA 3TG8A 3IERA 2DBRA 2Q46A 1EGHA 5GAJA 2FJUA 5THKA 3RSFA 3TN7A 1GRCA 1Z13A 4TV8A 3UHAA 1YFJA 4OB6A 1VBNA 1D09A 3WYGA 1K97A 3P9RA 4RPKA 1AQIA 3AJDA 2YINC 4JAVC 1IN6A 2R6AA 3DNFA 4A0FA 1LX6A 3P5BA 1KBZA 3QF7A 4J2HA 1VJRA 3BRQA 1C7IA 3R9KA 5JSZA 2FMFA 4D9MA 5A06A 4KRGA 1ZSNA 1ES9A 2R8ZA 2H16A 1SUBA 2W6PA 1D4FA 2L2QA 3DTVB 4WVLA 4G4SO 1MZPA 1KNQA 2OHOA 3KZ1E 4JLVA 2IVZA 4QDZA 2C31A 3D1JA 3ESBA 1W94A 2PEZA 3PXXA 1X38A 2R5WA 1S6YA 1Z2NX 2FWJA 2ABWA 3O1HB 3QENA 2CV1A 2FLVA 4BKRA 2P2GA 2EP7A 3QU4A 3TNYA 3F3YA 3KYDB 1ST2A 4J1QA 3N87A 4O1IA 4X20A 1L5LA 1X2BA 2AK2A 2YYYA 4BNDA 3KLMX 2QSJA 1O1YA 1T9AA 2JKYA 1I01A 1XUOA 4DIOA 2P91A 3PSAA 4KBGA 2FH5B 1RTTA 3MGAA 3KOUA 4JBXA 4R7ZA 1YQQA 1NRWA 2RAUA 4BFSA 4NXMB 4DV2B 2HO4A 2NPOA 4W5HA 1AS3A 4L07A 3ROQA 4ERXA 2C2MA 1LU9A 2FX2A 5FIUA 4B7XA 2QQ5A 2QB5A 1I2ZA 1PP4A 3NW9A 4RGYA 2CHEA 3BOSA 2A86A 3PPYA 3L7AA 1NXQA 5AI4A 4AJ1A 1V43A 4RMGA 4XVCA 4YT2A 4B3MB 3KOZA 1DG9A 1MAHA 2GCPA 3OJLA 3OOEA 1JLLB 4YMUA 5HVNA 3IILA 2Q29A 5KNBA 1GJRA 4UDOA 1T43A 4G0QA 3ROFA 3O93A 4WOPA 4WNYA 3VZSA 3CEPB 2R97A 4N0PA 4IYRA 3LVFO 3GDWA 3WGHA 2HUPA 3MILA 4LNHA 3FY4A 4X3PA 4Q4AB 5JR3A 2FPWA 1EM8B 4W5NA 3GLHB 1BKDR 4A0RA 3U0VA 3FNEA 1GSOA 4BRSA 4BE9A 1NI4B 4IH1A 3VC2A 5JEEA 3N05A 3F3KA 4F6LA 1IXSB 4Z3OA 1D8TA 3LO5A 1Z15A 5JHGB 4ITVA 5G40A 4D4MA 4BNJA 1Y5IA 3ELUA 5DCWA 5JWRA 1ZK0A 3SYTA 3DVQX 4QYSA 1YS1X 1JN0A 1OH8A 4RWEA 5CRIA 3M0EA 1PZXA 5CIWA 5KYUA 3HCFA 5TT1A 3IB3A 5JMOA 2WE8A 1II8A 4HFJA 2YJ5A 2CXHA 1AG9A 3B2EA 4HHEA 4I9FA 4FLMA 4AJLA 3HTXA 3C6QA 2QX6A 4YAJA 2B4TO 3QA3E 1Z82A 2J3LA 1NQ5A 2QYTA 2A4MA 4S0ZA 3THXB 3I45A 4EZBA 1SZCA 1BHSA 2AC7A 4LXIA 4KLAA 4XDHA 4GWKA 3BYZA 2FOLA 4UW9A 3WB2A 4XPZA 4RVGA 4TOIA 2G7MC 4YCDA 4M88A 2GGSA 5CNMA 1QF6A 4F12A 2OPBA 1S9HA 4G01B 4WLEA 1XTPA 4E6EA 5F52A 1U04A 1ZBDA 4EKIA 1FUKA 3L3BA 5EEHA 1CUBA 1PQ4A 4KWHA 4XI9A 2DEUA 3HYNA 1KQNA 4CR7A 3C6XA 3FTFA 2AFRA 2JATA 1C7JA 3EH2A 5AKKA 5AQ1A 1DBRA 3L8MA 1R18A 2AXEA 3QPDA 1K06A 4LXXA 2ZVJA 2R00A 4DSOA 3CZRA 3LY9A 4YREA 4DS3A 1IN1A 4V0LA 1K8XB 2JCBA 4QVGA 3MUNA 5TMBA 1NTOA 5ILOA 1AURA 2VXYA 1I4DD 4PHGA 4EY4A 3VR6H 3DLIA 1P2BA 5DEIA 2VYNA 3S2IA 1U9YA 3AFNA 2XI4A 4LC0A 3O4VA 3V2GA 5JNTA 4LZPA 1YQWA 3BFPA 3L07A 4LXYA 4XGNA 4EG4A 1TOAA 1POXA 2VP2A 2Y1WA 4FJ1A 4XOUA 4EVRA 3TFOA 3G0IA 1G7TA 2CK3D 1W85A 3LT0A 3OC6A 1XT6A 4DIMA 1T24A 2C82A 2VYND 1X80A 2JAXA 3A3OA 1HT2E 1ZK2A 4UVHA 4DVGA 2GPAA 3BXFA 4DCUA 3HC7A 2Q4OA 3QEAZ 1PBNA 1KSJA 1HDCA 3NOXA 4MCJA 2WM8A 4QA9A 4HRVA 2YIJA 5EGSA 5CEFA 3AL0C 4PN7A 1MZVA 1GPDG 5JWOA 2Q6KA 2ZFUA 1T6XA 3DM9B 2Q4TA 3ME5A 3F90A 2DFKB 1CULC 1N32B 4I99A 1PLJA 5CB8A 2WYVA 1B3RA 2OGWA 5A5DA 4KQJA 3KALA 5FBWB 1CUFA 3PQ6A 4R68A 2H08A 2R8BA 4RFLA 3ZXIA 3LXUX 4EO4A 1J9EA 3IPXA 1OXVA 1JHQA 3KT3A 3A58B 3IPAA 3ST7A 3ZZ0A 2J4DA 4B6QA 4DCPA 4RTNA 1QTNA 4H9GA 2FWIA 2GF2A 2CLFB 2OLJA 2JDID 2JJ8A 2QTRA 4XDYA 4QPNA 1PTJC 2E87A 5I7OA 4G0VA 3AR3A 3CUUA 2QQFA 4YV7A 4M2LA 4GPD1 3TVDA 1BQEA 4GIBA 3RLIA 2BCEA 2YS7A 1KDZA 4FGWA 2F3UA 1OUMA 4XYLA 3GFRA 5I7EA 2P4HX 3NTUA 3Q10A 2WIFA 2B69A 2G6BA 3D02A 3RJTA 1MAWA 4DUGA 2F1KA 3CZAA 3KTAB 1UFOA 1L5NA 2UUAB 3WY9A 1ADCA 1QKIA 2WFLA 2IP2A 4ZVPA 4CIWA 2VJLA 2VWHA 5THQA 3GJSA 1M2OB 3K0KA 1ZZGA 4P86A 4BOYA 1SXJA 1NNSA 3PC7A 1RW4A 1QONA 1AKTA 4MCHA 4QUHA 2AHRA 5IH7A 3ZX5A 1GUYA 2P75A 2R5NA 3HLKA 1E3MA 2DWQA 3E2MA 2FRDA 3NH9A 4UQOA 5LA6B 2O0LA 5DRYA 4W7HA 3I83A 1ZW6A 3IEXA 4Y0AA 3QPWA 4HLNA 3A9VA 5LQKA 1SXJD 5ENVA 1NBMA 3MIZA 2E4AA 3R7SA 1EXVA 1LNSA 1GFIA 1NLFA 3TSCA 2ZQYA 1H5QA 1RQPA 1XB2A 4M55A 4EB6B 3DOEA 1TCCA 1T8RA 1G2QA 4ZALA 1EX6A 1ZR4A 2NG1A 3MINB 4FGLA 4K6CA 2MSDB 4LZJA 5F2NA 3FN4A 5AVYA 1PYOA 4MUNA 2IYRA 1CVIA 1OI7A 3TZBA 4HDCA 4A2QA 1JU9A 1WPRA 3H2BA 3VOAA 1GV1A 1VSQA 3R0QA 2GUGA 2JAHA 2QDXA 1LD3A 1XNJA 1UBHS 1ZRSA 2ZIXB 3H6KA 3HWRA 4TWRA 5B6JA 2XDQB 4DB2A 5GV8A 1EP3B 3C3JA 4MULA 3C5VA 1UXIA 1YMVA 4AULA 1N2HA 1CY1A 1C9KA 3K2EA 4NU6A 3ZPXA 1E5TA 2RHWA 5BWMA 1GPLA 1RWXA 1YDGA 2EYQA 3BM5A 4HDNA 3L01A 2J1LA 3ACDA 4JMLA 5CK5A 1DCMA 5HA5A 4CQNA 4LUCA 5JSYA 4KO4S 3G8DA 3P2MA 5IJWA 3QMVA 4C87A 2BHSA 4RIEA 3I3SR 1HKUA 2DQYA 2PCJA 3IB6A 1O6FA 3P19A 4R4JA 5CA0A 4NXNB 2NYUA 1GUAA 1LTKA 1KFJB 3BD8A 4GPTA 1J2JA 2DX7A 3B82A 1ZGZA 3LCRA 3T61A 4DR2B 1CIPA 1LBHA 1E8NA 2A8YA 4LOIA 2VBGA 5AUNB 3WMFA 4CKWB 1IBRA 1MO5A 2D5AA 3FZGA 1I6WA 4BVGA 1NVAA 4Q9JA 1WZNA 1QOZA 2UUCB 3LG2A 1V47A 3NOOA 1FYDA 1UFKA 5EI5A 5D3ZA 1JQEA 4LI3X 3LSTA 4DLLA 1F60A 1Z0KA 1HG0A 4CYMA 1DAPA 4EO7A 1CUCA 2I4RA 1Q44A 1B0AA 2VF4X 1QHHA 3CB4A 2OSVA 2OVFA 4K28A 4NCXA 3T95A 3M1YA 3EA4A 4MITA 3ZUGA 2COEA 3JQDA 4RPIA 5KWSA 1E8MA 2H7XA 3N7UA 2CNWD 4N3NA 1PYGA 4F3YA 3H9UA 2IV7A 1V5WA 4WCFA 3ZWPA 1P4RA 3D7NA 3RS7A 2Q3EA 3K05A 1V8ZA 3T52A 1D5CA 4V39A 1IUNA 1DRUA 4R8LA 5BVHB 4JEIA 2A78A 1XZQA 2HSDA 4OBBA 1H6DA 1EG7A 2VN8A 2QRUA 3QVSA 2YHAA 2R6FA 4JJAA 4FS3A 4E4RA 4URXR 3C24A 5AW7A 2ZJ3A 4LW8A 4KQ1A 2XDYA 5IZCC 4XJXA 3I1FA 1JDBC 1BXRA 2JCVA 5ILGA 3EVGA 1T6ZA 3UFBA 4CQJA 1V1RA 1XZLA 5BURA 4URYR 1Z6PA 4NG4A 1D7OA 1A9PA 4FJ0A 3CX8A 3CUTA 2PXCA 1HQKA 1OFGA 2IFTA 2PY6A 2ZTSA 3MTJA 1WUJS 2EU8A 1Z62A 2PH5A 3LUHA 3PC3A 1U3DA 3SZRA 4ZYVA 1NPYA 4AZ0A 5HYVA 2B0JA 2DWCA 3FW1A 2J4CA 3IO5A 5KIAA 3FETA 3VR3D 1J33A 2WP8J 3KBBA 3EGDA 2MYTA 4M1OA 3BG5A 4W1QA 3QQ5A 3OPYI 5CITA 3OPYB 4ZAFA 1SUCA 3TR6A 3MJEA 2I1LA 5LA6F 5H3CA 4XH9B 1ZA1A 2VBFA 1Y3HA 1NNI1 3T4EA 2FPRA 1T9GS 3E6AA 3LA8A 1F2DA 3F8SA 3HNPA 3GGPA 1FP4A 1M1XB 1NF9A 1LZLA 3AL3A 4RK5A 2OKCA 4G8BA 5ULLA 3ZQKA 5IUJC 2MINA 1C3OA 3I9MA 4CV3A 2HPAA 1D6MA 3H2HA 3PNYA 2OFPA 4DN6A 1U3TA 2VI5A 5FBLB 1EUQA 4Y9UA 3PJEA 3ER9A 1OLXB 2ODBA 1B0PA 1YCDA 4QXQA 3CPEA 4P4NA 1WKBA 3V2UA 1YIDA 5EERA 2ZBFA 3OQOA 3MQFA 4MTLA 1ZICA 1R1DA 3WNDA 1PLLA 2DAPA 4RYLA 3OBBA 3G02A 2WWIA 1MR3F 4QDXA 3GPCA 3KOYA 1EMDA 1U0TA 3I58A 1AGXA 1IN5A 2EZTA 5A7GA 1NXTA 3AJEA 3IPCA 4K1XA 2AF3C 4F1JA 2VQEB 5DNEA 1R9JA 1OE0A 3VNUA 1QO0D 4QVKA 4DCGA 4XUGB 1IY8A 4Q1EA 1YKSA 5FRDA 4ISCA 4ES6A 1F9EA 3EXIA 3L1KA 4JQZA 4OREX 3WSTA 2ADFA 1AVTA 3BMCB 5K0CA 4D4GA 1BX3A 4GQAA 2CWWA 2QZZA 1IJBA 1D0SA 2WU8A 5K4HA 2WBLC 5LOVB 2G9UA 2ZIUB 1A71A 4YWJA 3KR1A 1X8LA 2V7PA 5L3ZA 2VSQA 2H5EA 3AKEA 3EFOA 3SE0A 3BA6A 4F84A 5GOTA 2Z5GA 4K2HA 2J9ZB 1B8NA 3B1XA 1LI5A 4A9AA 1J42A 2P1ZA 2E48A 1ZAYA 1YVPA 2J0UB 1NBME 3G6KA 1E1QD 2QMEA 3H1FA 3HCBA 3LA6A 1K9VF 2P9JA 1XEAA 3QV2A 4HEJA 4NVRA 4AROA 1X3SA 1KRHA 1X92A 3QELA 3HKBA 1W4RA 4RZUA 1JJ7A 1DXOA 1RYMA 2XUJA 3HGMA 1L4HA 1EA5A 3EIHA 4JKIA 4F5YA 4LECA 5CDFE 2FSVC 1XZJA 3R8CA 3UJ9A 4RETA 4DRXA 3JQAA 4GBED 4WINA 2PHZA 4F4IA 5F7XA 2CHQA 3N2ZB 2WDZA 1M2FA 1O94A 2NZ2A 3IE0A 4HDRB 1G59A 2ZCUA 3JQQA 2R8PA 3K3PA 3LCVB 3NDIA 2D8AA 3QFHA 5EUMA 2XVXA 1ISGA 3SJ7A 3F7MA 3FDZA 4BCDA 3M2PA 4UOZA 5ABPA 3BRWA 3G1WA 2FZEA 2R6HA 2CVHA 3AVQA 2OCIA 3H16A 2RHMA 5LP6C 3V1LA 1TQDA 4C6TA 1WVGA 1O6CA 3R3YA 4F8JA 2PRZA 5BP7A 4JJ6A 1XHEA 5JCOA 3N2KA 4Z7OB 1BDIA 5E6UA 1XL1A 4I1VA 2FUG6 1SRQA 4MRNA 3UG7A 5KNDH 1NXSA 1Z9BA 2YASA 3BRWD 3LC2O 2O6HA 3WGVA 2AGVA 1YU6A 1PJBA 4QYIA 4IX1A 3HZRA 3SHVA 5B5SA 2KBEA 1LPSA 2WNHA 5JRZA 3WMXA 1XA3A 3LC1O 3O3NB 5HFAA 1GQRA 5AXCA 3GCWA 3BGOS 1Z45A 3U0BA 5A5VA 3WZMA 3NWEA 1X7XA 1ZC3A 3FLEA 2BLLA 3TXAA 1AF4A 3PDWA 3ESYA 4RLFA 4LFCB 3T41A 4B8YA 3OJCA 1ZGCA 1KWGA 1E1MA 1JILA 4BLOA 1Z34A 1RS0A 2XYVA 1EUCA 1T29A 4B6OA 5G1NA 2Z0MA 3MT7A 2YYAA 1FYWA 4C7BA 2ZI3A 2VUTA 4FNMA 4EJSC 2KPOA 4WEQA 1DS6A 2ECQA 4JQYA 4B4WA 3I5YA 5JXWA 2ZYTX 1QYWA 4DIFA 1IDN1 4MWTA 4ZN6A 4RLHA 3AOEA 2A3RA 4TLBA 3ZDDA 2JI9A 3T7AA 4NJMB 4A92A 3JYHA 5FADA 3WWYA 2YQZA 3O3MB 1QTIA 2JHFA 1GAWA 3VPDA 5KX5A 5JY6A 2FKNA 1EK5A 5LMNB 2BFBB 3HA2A 2XRFA 1RMYA 4J3JA 2PPLA 2PUHA 1HEIA 3DE3X 5KC9A 1BCSB 3B5JA 4JQOA 4R1TA 1T8YA 3L0OA 5EPOA 1O7JA 4XM1A 2I3AA 2AI2A 2RGCA 1XA4A 4HLCA 5HTKA 3CLSC 5LOVF 1JJIA 1E5LA 2GHRA 3OCJA 4S0XA 4R16A 1YZUA 2AG6A 1GG8A 4UAGA 3AQ4A 3GRFA 2F43A 3WKEA 1NG1A 4KVGA 4QWWA 5CW1A 2A88A 3U6BA 2K7FA 2ZAIA 1M5TA 3F2IA 1WQ4A 4MP6A 3R74A 1DBPA 1P4GA 4B9AA 5LL6P 1HG1A 4WBNB 1EDBA 4Z7NB 2F3QA 1LKZA 1E5DA 3S1AB 4BWVA 4QODA 4EGQA 2XUZA 4TM8A 1L1RA 1KYXA 4PZAA 3NUGA 4NFYA 1KBQA 5FUYA 4NCAA 1XAJA 4NZYA 2QU8A 2XUAA 3OWXA 4K6OA 4DA8A 2NGRA 4II2A 4X1KA 3ZWBA 4ZOQI 3T38A 3NGXA 4E15A 1Y8AA 2C04A 4C4RA 4F46A 3IRVA 5HZHA 1PEDA 5FI1B 1WLSA 4W82A 2C2OA 1FTGA 2VYQA 1VRWA 3PGLA 1JJBA 4L74A 4ZRNA 4EKNB 1N9ZA 1QHNA 1ZP6A 5C1IA 3DZDA 1ESEA 3AM1A 4OQYA 1UOPA 4TS1A 3KT6A 4G1BA 4LHZA 1AUVA 3ISTA 2FEXA 4ZVOA 3UBMA 1IUKA 1OZHA 1X9HA 3BE8A 1U2PA 5GVSA 3C7CB 1Z5WA 2JIMA 3KWLA 3HI6A 1M6YA 1MVLA 2WF7A 3S7ZA 2BI4A 1GGJA 1HDIA 3DAGA 1BFKA 2V7TA 2G36A 1GCIA 3QF4B 1SRRA 4YMHA 2OGZA 3T7RA 1WZEA 4RH3A 1S2IA 3A1WA 1XMPA 1N3BA 4M9XA 2QVBA 2BFCA 3G79A 3STYA 4NU8X 3KR0A 4BO8A 1UK9A 1SBCA 4Z2AA 4G6ZA 3CCBA 5JADA 1A82A 2PKQP 1DDIA 4L75A 1BJRE 1WXDA 3IP8A 1MB9A 1XCOA 4IH9A 5EJ4A 2VNIA 3FPCA 4RFSA 3JY6A 5IJZA 4KQIA 4EJ2A 1FUYB 3KXIA 1YDMA 4WZBB 4IMJB 2COUA 4FP9A 3BCRA 1DKOA 3K1TA 4NJEA 2BMJA 1TT5A 4M9SA 1ODCA 1JXMA 4EP1A 4BLUA 3O91A 1FPMA 4KKXB 4Z9XA 1XRJA 2VQDA 4NF2A 1T4CA 4G2NA 5I6DA 3QX3A 5KYXB 3AB8A 4JP1A 1IM5A 1PQWA 1D2HA 1G0NA 2HNKA 2PWBA 2WIGA 3F1KA 4NI5A 3RK0A 5A4IS 5EKUA 4YLEA 4M0UA 1MX1A 1VLZA 4OHZA 1P0IA 2I80A 4O1HA 1BEEA 3KQUA 1QQ7A 2HBZA 1DPFA 4CM9A 5LU8A 3WISA 1NVWQ 4KXVA 4ZIRA 4IHQA 2SKEA 2D7CA 5KQLA 2RIRA 1DBVO 2YHBA 3C7KA 1TK3A 1EPUA 4HWRA 3CA8A 1SCNE 4RVCA 4R7TA 4ZI5A 2YWDA 3ENVA 2ZDGA 2IYUA 3DZIA 3UW1A 2UVDA 4JEHA 2YH2A 3GLFE 2FN9A 4ZANA 2JCGA 3FOBA 1U2SA 1AH2A 1B6SA 5C7LO 3BGVA 3ZDBA 1N3IA 3CJRA 4NDZA 3A1FA 2RH9B 3W8RA 1AQ6A 2B9VA 2LDXA 2QR2A 4JC4A 4CFSA 5KMGA 4OLJA 1NFRA 1N8TA 3I04A 3LHSA 4HGQA 1K5HA 2CYCA 2ZBEA 3GBSA 4HUJA 4JXXA 5ECDA 5B30A 3NKVA 4WACA 1GT91 2IJGX 1OYOA 2JEYA 3HHEA 3IP9A 2V5AA 4FC7A 4V0NA 4WBNF 2ZG6A 5C8XA 3ZD8A 4LHSA 1KJYA 2G6TA 5AR1A 1NW6A 1N57A 1XDDA 4RZ2A 1K4YA 1V11A 1EBUA 4C5BA 1Y80A 3F73A 1SKMA 2H00A 2GS9A 1B1CA 1QS0B 2VKQA 4JMPA 5DCUA 3I9FA 1ISMA 4HDKB 2B8JA 3O7MA 5HW0A 3T94A 3L93A 1PNRA 5JU6A 4BB0A 1NE2A 2LIPA 4L8GA 4F38A 2VUUA 4W7IA 2EL7A 1V7PC 5K8JB 2XMSA 1RWMA 5I7SA 1Z4OA 4IJMA 4QLBA 1L3BA 3BRSA 4MV1A 4CG0A 1A0OA 5HK8A 4RM3A 3W9BA 1E1RA 1PT7A 3EA0A 1KR5A 1DV2A 1GZ3A 1GQQA 3OIVA 3AXTA 1F38A 4X94A 16PKA 3PGVA 1WR8A 4JP8A 3X44A 1U8CB 4DPLA 2Z6AA 2FJ0A 1Z7YA 2OHXA 1VMAA 3ANXA 3IOCA 3TI7A 2HJGA 2QG4A 1MB3A 4WSOA 4HWTA 1WMBA 5D7NA 3H4IA 1TNDA 5H3LA 3NRJA 2C9OA 1KP9A 4HWOA 3RVNA 3WTBA 2YZGA 4PYIA 1T91A 4BMPB 3JVEA 1A76A 4M99A 4ZFNA 4WH0A 3UFXA 5CDYA 2WIAA 2DWPA 4Y6PA 1H66A 5K4GA 1SC3A 3PFBA 2PL5A 4AC9A 3OFVA 2Z6QA 5KB3A 2UXBB 4X6UA 1E2FA 3QVJA 3U7QA 4MGZR 1KZGB 4RPGA 3WAJA 1FPQA 4RTRA 1XRPA 1Y42X 1H3EA 4B35A 1H8HA 1Q50A 3G9ZA 1JXQA 5A6SB 2P90A 4AAYA 2QXTA 1J8VA 2DBZA 2HO5A 3BE5A 4NCJA 4RA9A 3T5BA 1NULA 2HA4A 2VDNB 3LPCA 2PX0A 2BF7A 2Q0XA 3I4LA 3TXXA 2DUUA 1WMFA 2FZKA 2IP1A 2Q45A 3DPUA 4CMIA 1OBCA 2GN4A 4GI5A 3WZLA 3O8RA 1XP5A 3G2QA 1VSTA 4RGBA 4CKYA 2C9ZA 3CNEA 1AKMA 5FB3A 1XF9A 2ZIVB 3VTFA 5IHXA 1CUXA 4Q6WA 4ND1A 4Q34A 1TKAA 5HQJA 2JBAB 3SS7X 2BTQB 2JFNA 4L51A