4QDUA

Crystal structure of antigen 85c co-crystallized with ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
281
Chain Sequence
b'AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPWNEQLVAMKADIQHVLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 281
sequence length 283
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qduA00
1I6WA 2RHTA 2O2HA 5A71A 1CR6A 2WJ4A 5HFNA 4EA6A 3DYIA 1DWOA 4Q05A 2BKLA 4AX4A 5I7UA 1E3QA 1BROA 2GYUA 2OCLA 5ALVA 4N8SA 1G42A 1CQZA 4C88A 2XUGA 1FJ2A 1VOTA 1XZMA 1E8MA 3F96A 4J0GA 3W2TA 4AMYA 3EQ7A 3H0CA 4EY6A 2XUHA 5J3JA 2FUKA 3JWEA 3R3YA 2AJDA 4CCWA 1DT3A 4KRXA 3DD5A 1N5RA 1NX9A 2ZJ6A 2Z3ZA 4JEIA 4CFSA 4HXFB 2IX9A 2GBCA 5ALZA 4B82A 4P08A 2I03A 4UUQA 1CRLA 1B6GA 5C8VA 1GGVA 1EX9A 5ALHA 2XQJA 4EZIA 2OPHA 1MNQA 1QE3A 2OXEA 1USWA 3A70A 2VSQA 4H7HA 3WKEA 4BAUA 3OPMA 2RAUA 4UBMA 2V97A 1XZDA 3ESAA 1OCEA 1E5TA 2DHDA 4M0FA 1LZKA 3WL5A 4FKBA 4YX9A 4N5IX 1S8OA 3FBWA 3IIIA 4Y2SA 3C6BA 3HC7A 5DTJA 2ONCA 4J0IA 5AP9A 4YK7A 2FJPA 3D2AA 3HEAA 3B3QA 4DM7A 2O7VA 2VAXA 1GPKA 4H7IA 3I2FA 4EB0A 5AHXA 4HXEB 4CG3A 1LPPA 1W6RA 1CPYA 1VLQA 2HU5A 4Q34A 1CUIA 3I6ZA 1J2EA 4J0HA 3OURA 1PFQA 2XMGA 1XQVA 5FP0A 5D3ZA 4P92A 3R3VA 5BWBA 1ZIXA 4AQDA 1YS1X 3U0VA 1BEZA 5C8XA 2JGIA 5JADA 4B85A 3WK4A 4PNZA 2PL5A 4BVKA 5AKXA 3KSRA 4OU4A 3QBJA 1J07A 1H2XA 5JATA 2C5GA 1U8EA 2WU4A 4MQLA 5CURA 5DYTA 3PUIA 1YAJA 4KR0A 2ZJ7A 4ITVA 2CB9A 1UK9A 4J03A 1DINA 2E3JA 5CT8A 3O4HA 4DTCA 3RK4A 3OG9A 3UUFA 2QRUA 3GZJA 4GBGA 2WFZA 1VA4A 4MEBA 1CUAA 1CUXA 3LLCA 1T2NA 1R4ZA 2OCIA 2PX6A 3WIBA 1ZI6A 4GHWA 2WUEA 3R3ZA 1X2BA 4UBJA 2CBGA 3ESBA 4WDRA 4QDTA 1O6FA 3VVLA 3WL6A 3ZLUA 5CT9A 4BCDA 3H2HA 4ZGBA 2PM8A 4Y2PA 3VJKA 5AKJA 1TCAA 2HFJA 2OAGA 1QFMA 4U2DA 3E0XA 1XZAA 2XUDA 1G5FA 4LYDA 1U2EA 2JGFA 2WUGA 3B12A 4HVTA 1MO2A 3WK9A 2HA3A 3MUOA 5HCUA 3CXUA 1XRPA 3ICWA 1R88A 3QH4A 4K6GA 1ORVA 1WPXA 1MT3A 1JT2A 3H2IA 4DNFA 5YASA 4V2IA 5SYMA 5A62A 4MQMA 5C81A 5FLKA 4Q1VA 2W22A 2XMSA 1EXWA 4JYPA 3IURA 5FRDA 4UPDA 3BWXA 1JI3A 3C70A 2HA4A 3FWHA 5ALUA 2WIJA 1C7JA 3JW8A 5EHQA 2QM0A 3WWPA 3D2BA 4QWMA 5JD5A 4Y2VA 1XZIA 4U2GA 1A7UA 4GLBA 1XZFA 2XUQA 4ZRDA 2FJ0A 3H1BA 3H18A 1MTZA 3CN7A 4AXBA 4BZWA 2YASA 2JIDA 2PU5A 5CMLA 2AJ8A 4UFPA 2YH2A 2VJCA 1EDDA 3I6YA 4FWBA 3V1NA 2WHRA 4BTVA 1MPXA 4BYMA 4UHEA 3FYTA 2G4LA 1XFDA 5ALDA 1LGYA 3K9BA 5AKLA 1EDEA 3DKRA 1BEEA 1UK7A 1CUDA 1LBSA 2ES4A 3WKBA 3C45A 5T4BA 1Q0ZA 2PSFA 1UFOA 5AM3A 4X94A 4BCBA 1R1DA 2C58A 5HF9A 5CH8A 3KWJA 5F4ZA 1LPBB 3QPCA 1BCRA 3Q8WA 4X91A 4AB1A 2WSLA 4WJLA 2DFPA 1A8QA 5CT4A 4FFVA 2HM7A 5HF8A 2GBIA 4FTWA 3MUNA 4OPMA 2B9VA 1UKBA 1XROA 1GPLA 3ZLVA 3STUA 1EK1A 3ANTA 3CCBA 3PFCA 5JZSA 1CUGA 4ARBA 5AI5A 2PUJA 4IHAA 1WB4A 3LIIA 4K6KA 2X76A 2QMQA 2XUAA 1THGA 1FFEA 5ALQA 2Q0XA 4BRZA 3V1MA 1TAHA 3N0TA 3ZI7A 3R3XA 1P0PA 4IH4A 1ZI9A 1XKTA 4GI1A 3VJLA 5HFAA 1CQWA 5E4JA 3O9VA 4U2FA 3DEAA 3AIMA 1E8DA 3IUMA 1BRTA 1DX4A 4J0DA 3FLAA 2WJ6A 1H22A 1X70A 5LZ8A 3FYUB 1AGYA 5JYCA 1CUVA 4AN1A 1GKLA 2FX5A 3O95A 2VAVA 1LNSA 5A7HA 4Y2UA 1EH5A 4E14A 4X6UA 4Y2QA 3BF7A 3E1GA 3EF3A 1HBJA 2GBGA 5ALEA 3ZWQA 5IKXA 1ISPA 1K5PA 2PKYX 1CUHA 2C0PA 3BIWA 2HFKA 3ZLTA 1XZJA 1VXRA 4U2BA 1JMKC 1UK8A 2WM2A 2XUFA 2Z8XA 3G9UA 2UZ0A 1YSCA 5IVDA 2OGSA 3I2KA 5LKRA 4B6GA 1OILA 3L1JA 1FFDA 5FOQA 5AI9A 1FFCA 3L1HA 3CCCA 3G0IA 4J0KA 2C5FA 3A2NA 3WWCA 3ICVA 4GECA 1MAAA 5CW2A 4B9AA 5AKKA 1AX9A 3OTQA 4UHCA 3DL4A 3S2ZA 1QIIA 1Y7IA 4OB6A 4ZV7A 4Y2TA 1LLFA 1YAHA 4L0CA 4AZ3A 2ZYSA 5JARA 3FCXA 1Y7HA 4P9NA 5EIHA 3NGMA 1BU8A 5K3DA 2WHPB 3WKDA 3WWDA 4GDMA 3F98A 2HA2A 3JYHA 4G5XA 1XKLA 4M0EA 4J0JA 5E4YA 2GBFA 4QLAA 4X85A 4G4IA 1UZAA 4AO8A 3DOIA 1XRQA 1L7RA 2O2IA 5FDFA 2HU7A 1JJBA 2ZYIA 2XQGA 3IUJA 1ZI8A 4W1RA 2XLCA 1LPMA 1AQLA 3H2GA 3HACA 2WTMA 3I2GA 1XLUA 2DQZA 2J3QA 3TGLA 2RI6A 2QXUA 4AMZA 4FMPA 1CIJA 1UOQA 1BE0A 3STYA 1CUUA 4OUKX 4YPVA 5CRIA 2J4FA 4UFNA 5AI8A 4QZVA 4ETWA 2OQVA 1WHSA 4OYYA 1BS9A 1QLWA 3EQ8A 4BDTA 3D5EA 2ZSHA 3HXKA 3E3AA 2JGKA 5A6VA 1DQZA 4QDUA 3HJUA 5ALGA 5ESRA 3AIOA 1A8SA 1N5MA 3C5WP 1CVLA 3FSGA 1C4XA 2JF0A 5DLPA 1GPNA 3V9AA 1LPAB 3D3NA 3WIOA 5AO9A 4DIUA 2X8BA 1EA5A 5HKAA 1XZHA 1UOPA 4OU5A 4OCZA 3FAKA 3EQ9A 3DLTA 4QEKA 4G8CA 1C7IA 1JFRA 2JEYA 2DQYA 1CUZA 1J1IA 4FFWA 4LIPD 4G4JA 3FVRA 3H1AA 4PSDA 4A5SA 3WJ2A 4IQ4A 2PUHA 3G7NA 5AM4A 2G5PA 3ILSA 2VTVA 1HKHA 1LPNA 2YYSA 3SWWA 2AJLI 5IH7A 3ZV7A 3IUNA 3PFBA 1F8UA 4UFOA 2HADA 4KEAA 5CXUA 5LP1A 1LBTA 4I19A 4I4CA 2HIHA 3VISA 1UOOA 5K3AA 4H7FA 5AI6A 3AZQA 4PV7A 1UKAA 5DNVA 1CUCA 2RONA 4HTAA 2XB6A 4N8EA 1F6WA 4ARAA 3AFIA 2XUOA 3WK7A 1EINA 4W1QA 3G0BA 3RM3A 3QVMA 2IIVA 3WK8A 1IUNA 1SCQA 4KAJA 4EY8A 4B7ZA 1XZBA 2WUDA 3MVEA 3A2MA 4F21A 3WI7A 3F67A 4AZ0A 3SK0A 4E15A 2O7RA 5T4FA 4H77A 5AI0A 1EI9A 2BUBA 4EHBA 1AURA 1K63A 2Z3WA 4QA9A 4B84A 4RE5A 1M33A 3FVTA 2JGJA 1RP1A 3NUZA 1XRMA 3WWEA 5ALJA 2JBWA 4FDMA 5DTIA 3LIPA 5BWCA 2QT9A 3FSGD 2PSDA 1ODTC 3HYSA 1EVQA 2HA6A 3LCRA 2Y1KA 1JKMA 4Y7DA 4X71A 5DNUA 1P0MA 1WCYA 2XMZA 3O0DA 1R9NA 1SC9A 1ZD3A 4UHHA 1EVEA 2CJPA 3M81A 4DSAA 5IVHA 1ZD5A 1F0PA 1CLEA 5AI4A 1R3DA 1UWCA 4HRYA 3OOSA 1ZOIA 2J4CA 3Q0TA 4OD0A 4Q3OA 3TRDA 4X93A 4QDXA 2WG0A 3WMRA 5ALMA 1VKHA 1XQWA 5ALWA 1AUOA 4INZA 3C6ZA 5ALKA 4YASA 3I28A 1ODCA 3C6YA 2DCMA 4QE3A 4DGQA 5FV4A 5BOVA 1GQSA 3W9UA 5JASA 2H1IA 4U2CA 1Q83A 2QJRA 5CBKA 3ED1A 3GELA 2Y6VA 3ANSA 1CUFA 3FYUA 2R8BA 1MAHA 4P93A 1BN7A 2Y2VA 3W04A 1Y37A 3GBSA 1XQYA 4H7JA 2PSEA 3ESDA 1XRRA 5BV7A 1QFSA 4CIAA 3HRHA 4HS9A 5JAPA 4JUIA 1G4HA 1HPLA 4MWTA 3NOXA 2HRQA 4UHFA 2XMCA 2XQKA 4BVJA 5FXMA 4B9EA 1IZ8A 4UHDA 1ACLA 4B80A 4G1FA 3H17A 4Y2JA 4FLEA 2WQZA 4X00A 2X5XA 3R3WA 2VT6A 4CG1A 2DHEA 3AINA 4C89A 3C5VA 1QOZA 3BIXA 4K2AA 1WM1A 4ROTA 3PF9A 4MYDA 4L3WA 1K6EA 1THTA 2G5TA 1NU8A 4KJXA 3O4IA 4UBOA 3PE6A 4L9AA 3AILA 3A2LA 1GZ7A 2WJ3A 4MWSA 5AK4A 1QIGA 2WUFA 3STWA 3PUHA 3SC2A 4WCVA 1EB8A 1W76A 3DDUA 1CUJA 3F8SA 5FUMA 2HA5A 3WL7A 5C8ZA 2AJBA 2CKMA 2WHPA 2C7BA 1QJ4A 5AOCA 1P0IA 1CUEA 5AM2A 5H3HA 3S8YA 4K6HA 2XMBA 2I3DA 4BAZA 3BDVA 3GROA 3VKFA 1DQYA 4FLMA 4DSZA 4I3FA 1H2YA 4DMHA 2XQFA 2WG1A 1QIKA 4MYSA 4NZZA 1JJFA 2ZYRA 5D3KA 4DMFA 1EK2A 1N8SA 4E11A 4X92A 2IITA 4DMKA 5ALXA 2QR5A 4ZI5A 2WTNA 3DKKA 4W1PA 5CT6A 1IUOA 2XMQA 3GA7A 4L72A 1PJAA 1RWQA 1LPOA 1TIBA 3FCYA 3R3UA 1L7QA 2LIPA 2DHCA 1L7AA 2ZSIA 5K3BA 5LLSA 3PDCA 3G9TA 5JZBA 2WIDA 4W9RA 3OC0A 3D7RA 3BE8A 3I2IA 2ZYHA 1CUSA 1QIDA 4H7EA 5AKYA 4W63A 2ACKA 5JALA 4KE6A 1EDBA 1EHYA 4C4XA 1VE6A 3G02A 3HI4A 1A8UA 1ODSA 3K6KA 1VZ2A 1TCBA 3DL7A 4UBKA 1DT5A 1XZEA 5C7YA 2V96A 5AKHA 5ALTA 1XRLA 1TQHA 3QM1A 2XLBA 4EBBA 4H0CA 1CUWA 4DNQA 2ROQA 3CN9A 1QZ3A 5HKBA 2W6CX 1HQDA 1RYYA 2GYVA 1KU6A 4HZGA 4C6HA 2ZJFA 1MX9A 4PQEA 5EHXA 1BN6A 2WIFA 4TPKA 4G9EA 1WHTA 1KU0A 1MJ5A 2ACEA 3AZOA 2ECFA 4XWGA 5I8PA 2B61A 1A88A 1MX5A 1VZ3A 3BJRA 4BRSA 5HQ3A 3NWOA 1VXOA 4EUSA 4FNMA 5AICA 2Y2UA 5AOAA 2ZVDA 4LYEA 3VDXA 3SX4A 4FNGA 3WZMA 2QXTA 2XUPA 2HHAA 3C6XA 3IB3A 1E89A 5KWIA 5ALIA 1UT6A 1QIMA 2HL6A 3GFFA 1B41A 1SOMA 3WA6A 3I1YA 2AXEA 4JNCA 3WK5A 4X95A 2H9YA 4B83A 1QTRA 5EFZA 4Z49A 4NVRA 3M82A 3I6MA 3OM8A 5AK3A 4BC0A 1OXMA 5EHZA 3PI6A 2JGEA 3IULA 5CTAA 4J0CA 3A6ZA 5LKAA 1GT6A 2OAEA 2XDWA 4RNCA 5A7FA 1K4YA 4JH0A 4J7AA 3WKAA 4TVKA 1JU4A 2VF2A 1Z68A 4BE9A 4EY7A 5AKZA 2XI4A 1AMNA 1PV1A 4G9GA 1WOMA 3I2JA 5DJ5A 3D59A 3QPAA 2H7XA 1XZGA 2JGLA 3W06A 3F9CA 1ZGCA 1VE7A 3QMMA 1ORWA 4E46A 3KOOA 3EIOA 4BZZA 4WDQA 4XIIA 1X2EA 5CXXA 3DQZA 2JGMA 3C8DA 3QZUA 1U4NA 5ISMA 3V1LA 4QDOA 4C4ZA 2XMRA 5HK8A 4UBNA 5JD4A 3B5EA 2PSJA 1JJIA 1W52X 1AC5A 5T4EA 2OLEA 1HDEA 5ALPA 2I3ZA 1Q0RA 2JEZA 2V98A 5EI5A 2YXPX 4X6YA 2XE4A 1XLWA 4C01A 4GWLA 4Q82A 4X90A 5SYNA 4X97A 5EIAA 2OQIA 1JU3A 5K3FA 5EGNA 3T4UA 4BE4A 2VJAA 4KACA 5CH5A 4MXDA 4IH1A 3TEJA 4FHZA 3RLIA 4FLFA 2CMFA 5JANA 4Y9SA 3QPDA 2HDWA 3LP5A 2CEKA 3L1IA 1SFRA 4D9JA 1JMYA 3G0DA 4KRYA 4J3JA 3K2IA 3QITA 1MU0A 2O2GA 4IO0A 4B81A 3QYJA 3H2KA 3IDAA 1EB9A 4TGLA 2WIGA 1ZD2P 2B4KA 3V48A 2HA7A 5ALNA 2WILA 3BXPA 4DYHA 4N5HX 3X3HA 5HQ3B 2WFLA 5JIBA 4H35A 2XQIA 4XVCA 3WK6A 3DS8A 1DTEA 4RPCA 4OB8A 1E66A 1IMJA 1W1IA 5AJHA 3WYNA 1ZD4A 2BGNA 1YA4A 4WFKA 1H23A 2EDCA 3AZPA 4BP9A 4K5QA 5EIEA 2BCEA 5K3EA 3W9BA 3RKSA 1ACJA 2XUKA 1MN6A 2BUAA 3T52A 2RHWA 4Q3LA 4NMWA 1ZJ4A 3GUUA 1DWPA 4OB7A 4PO3X 4QDZA 2B20A 4HAIA 3G8YA 5IVIA 1P0QA 2GYWA 2BFNA 3C8HA 2PBLA 2HU8A 4O08A 5D7BA 1UKCA 5HK9A 4G8DA 4UBIA 1DWQA 2QOEA 1HL7A 2VATA 3P2MA 3PICA 3STVA 5ALRA 2QKYA 5KBYA 5K3CA 1IUPA 2WKWA 5K5EA 3FLEA 5LZ2A 3WZLA 4BATA 4FBLA 4OSEA 3VXKA 4WY5A 4HXGA 3DYVA 5HF6A 4Q3KA 3AJAA 5ALFA 2CZQA 5A2GA 4GW3A 4BCCA 2QUBA 4QNNA 3QMWA 2VT7A 3QMVA 1ZGBA 2K2QB 2VJDA 5E2IA 2VA9A 2WG2A 2WLSA 3IBTA 2EEPA 1R50A 2GZSA 5E4TA 3KWFA 2DSNA 2QUAA 5K3FB 3HZOA 1QIHA 3DOHA 4AN0A 3H04A 2OGTA 1WB5A 3AUKA 5AH0A 3BF8A 1GKKA 4UHBA 1XZKA 1F0NA 1QO9A 3E4DA 4W1SA 2J3DA 1E8NA 2PSHA 1QIFA 3G9ZA 7YASA 2WFMA 1XQXA 4OYLA 1CUBA 5AKEA 4XX1A 1VJ5A 4LXHA 4X6XA 4QWWA 2WFLB 2NW6A 5JAHA 2QS9A 1Q84A 2Y6UA 2XMDA 1LZLA 1NU6A 2XT0A 5DYYA 1XLVA 1K8QA 2DR0A 3WJ1A 4CIBA 1MX1A 1AZWA 2Z5GA 5EHNA 5LZ5A 4C4YA 3O4GA 5D6OA 4BB0A 4JYMA 4UBLA 2WHQA 5FPQA 2PPLA 2D0DA 1XZCA 3G0CA 1SCKA 3G0GA 1IVYA 1GXSA 3R0VA 5DYWA 1LPSA 4FOLA 2RIPA 3R41A 4KAAA 1MNAA 1WB6A 4KYVA 4CCYA 5AM5A 3STTA 2QTBA 5I9IA 4KE9A 5LZ4A 4S0XA 3KXPA 3UUEA 1H2ZA 4LXIA 4DNOA 2V9ZA 1FFAA 3VVMA 2WU3A 3WA7A 4QLOA 2G63A 5CT5A 4M0MA 2PU7A 3R40A 3STXA 3I1IA 2HRRA 1WPRA 3FLBA 5AM1A 2H7YA 5DNWA 4BTLA 2C0QA 3YASA 3BDIA 5LYYA 4IH9A 1YB6A 5CH3A 5ALLA 4Y2XA 4MJ3A 2Z8ZA 1DX6A 4NS4A 5AK5A 1YA8A 1H2WA 3ESCA 4B0PA 6YASA 1CV2A 2AJCA 4MEAA 1TKRA 1CUYA 1D07A 4ZREA 4Y2YA 3IUQA 4ZXFA 1HLGA 4WFJA 3IA2A 3WKCA 1YCDA 4F0JA 3U1TA 2OG1A 4GXNA 2ORYA 4ZWNA 1QIEA 5ALOA 2OGZA 3F97A 4A16A 1N1MA 4XJVA 4KAFA 1QIJA 2P8SA 5JAOA 2OCGA 1FFBA 5T4HA 4ZV9A 2QZPA 3UMJA 3C87A 4AO6A 5AOBA 1YASA 5LZ9A 1T4MA 1W4LA 2CUTA 1G66A 4G8BA 5FPPA 2QJWA 3O9MA 4H7DA 2BGRA 3BL8A 4BVLA 4BBZA 1UXOA 3G9XA 5AKIA 4F60A 2C4HA 1YB7A 4F5ZA 3WQHA 4KE8A 4H7KA 4DMCA 4PSCA 5HF5A 3TJMA 3V1KA 1YR2A 3H2JA 3WL8A 3PF8A 2GZRA 3EBLA 3MGAA 3H19A 2BJHA 2XUIA 3D2CA 4PW0A 2BUCA 3W05A 3WWOA 4RE6A 5JAUA 4CI9A 4H18A 4CG2A 2RGUA 1FSSA 1ETHA 3WYDA 1CFJA 4LKOA 5AK6A 2I78A 3AIKA 4LXGA 4N8DA 3N2ZB 2H7CA 1QTIA 4G4GA 3BJMA 3DJYA 4BC1A 4PF1A 4RGYA 5JZ9A 1O6GA 5ALSA 5HZGA 2HA0A 1GQRA 1TK3A 4EY5A 3LS2A 4FBMA 1SCIA 2QVBA 4A23A 4EY4A 4Y2RA 4CCYB 1ZICA 5AM0A 1BCSA 1AKNA 5AIBA 5KWJA 1QONA 1XZLA 1VA5A 3D4LA 3HLKA 3DNMA 2VJBA 1QO7A 3O4JA 1ZIYA 1J06A 3KD2A 2D5LA 4DLNA 1R9MA 3IVMA 3HABA 3FNBA 4GEGA 1IZ7A 2R11A 1DU4A 2PVSA 4PSUA 4HRXA 3M83A 4X3CA 4BDSA 5LZ7A 4AO7A 5FKJA 3RARA 5IVKA 3I2HA 5AKGA 4C87A 5JD6A 3FOBA 2WIKA 4U2EA 4X7BA 1YS2X 1QGED 3C43A 3WLAA 3HSSA 3D0KA 1CEXA 4BP8A 3ZPXA 5LIPA 2XUJA 4BAGA 1W75A 2OCKA 3FYUC 4WFIA 5A7GA 4LHEA 1ZJ5A 4DNPA 3KDAA 1KEZA 4B0OA 2VQ6A 5KREA 2BAGA 3VJMA 4KE7A 1TRHA 1UK6A 3M3DA 5AIAA 1U65A 5DWDA 2EDAA 2VEOA 4WY8A 1TCCA 3DCNA 5ALYA 1XRNA
chains in the Genus database with same CATH superfamily
2JHCA 5I4KA 2J7PD 1PTKA 2R1VA 2RMKA 5JNLA 2A5GA 3VMMA 3T4EA 1GARA 2VHWA 4CMKA 5K0SA 3LU1A 2O2HA 3G7SA 5B1IA 2WJ4A 5HOEA 3FUCA 3PHJA 3HRKA 4M1SA 4OA8A 2SCUA 2XEXA 3HCOA 2XJ9A 5HGJA 1JLRA 3DYIA 4X8MA 3SFVA 3P52A 3B82A 1DWOA 4UOZA 2WYIA 1AA6A 2WJYA 4QBKA 4R3UC 1QUEA 2FZ5A 3RHSA 1NVMB 1Z0SA 2J0SA 4QXQA 4Q05A 3AQIA 4BEWA 2D2EA 4MW0A 4AX4A 3KQSA 5CB4B 2NPFA 3W9SA 2HEIA 4WCFC 5AVKA 2OCLA 4A82A 1V11B 1US8B 3GRZA 1G42A 2XNDD 2HXSA 2ZDHA 3S27A 1ZUIA 1CQZA 3I76A 1BYIA 3UW3A 4DXHA 2HMSA 3IO5A 4WOBA 1FMTA 5BXYA 2GDJA 1NE7A 1C7ZA 1MW9X 4XYLA 4AMYA 3CLSC 1SBZA 1D5CA 1JDVA 2GKSA 3H0CA 3UKJA 1O89A 2GFHA 4B35A 2XWPA 5BPFA 4HB0A 1E6EA 4KL8S 2QRMA 2DEUA 4DLRA 3QA9A 4O29A 1JQAA 1C9NA 4P3NA 1G20A 1YZVA 4FSDA 1QK5A 3UJDA 1GP2A 1PZGA 2OV8A 3GLHA 3BCHA 3KB2A 1NJ8A 3NHPA 4KRXA 3DD5A 5IW8A 5HWSA 2XNHA 4JEIA 1MORA 2PT5A 2JIRA 5B53A 3TUZC 1SOAA 3FWPA 1ZM4A 1LV7A 1QHYA 1KEEB 1XXHE 2Y1OA 1NASA 1RHMA 4CFSA 1TA0A 5ICMA 1L5HB 3NFRA 4JJ8A 2RK4A 2NP7A 1RZUA 5E3JA 1M2VB 1S4MA 2B2NA 2QN9A 3BE6A 4PLYA 1S8AA 2GBCA 4ZQIA 3T5BA 4KPGA 1M0WA 1NT2A 2WJAA 1OBCA 1E4YA 1U11A 3EHEA 4RZQA 2XVZA 5JDCA 1NQXA 3OQJA 5IJAA 2Q21A 3K6SA 3QSYA 1U3CA 1CRLA 1KSJA 2BELA 2O2CA 5GADl 1EX9A 4R8KA 5BYJA 2FMKA 4CT0A 4HDMA 1S2NA 2R7NA 4LZLA 4HB4A 4OREX 2ABWA 1C80A 2XNSA 1QE3A 1X94A 3EISA 3WGOA 2OXEA 5LBUA 4RJLA 4ZOAA 1SIUA 4YAOA 3UFXB 3W4JA 3FPKA 1J6UA 1K7SN 3GOHA 3NTVA 5EUMA 3ZYCA 2VTBA 4MR8B 1BCSB 2WKPA 1NUSA 4FS3A 4HDQB 1NJFA 4BAUA 1W19A 3H2ZA 2FHPA 1T8TA 1U0HC 4H15A 3UJ7A 1CCWA 3EMVA 1VMIA 1UBCA 2A1TS 4BB5A 1NPDA 5G3YA 4ENWA 3P19A 3I8XA 4C4TA 4PAWA 4F6RA 2WPDA 1XZDA 1AZSC 3GH1A 3N2YA 1OCEA 1DG9A 1ST3A 1TQ8A 2W2KB 3D6FA 2FWPA 3A9UA 4QARA 3TI7A 4K9RA 5LM3A 1ULUA 2Q7XA 3K1ZA 4H27A 3GMTA 2ET6A 4FX2A 1W7AA 2PGDA 3HY6A 3WL5A 3AK4A 3OOYA 4LDAA 4YX9A 5G0UA 5BSGA 3KPYA 1ZU5A 2O8BB 1V9LA 3QVXA 2MOKA 4BKUA 5A6SA 3ADBA 3FBWA 4Y2SA 1EGAA 1IEWA 4MUYA 1VMEA 1YR7A 1JIIA 2E4ZA 3OUTA 3I58A 3WGZA 3ZYZA 3FFTA 3LWNA 4IBOA 2ZRCA 2DECA 5FV7A 5B58T 2FJPA 3WLFA 1ZXBA 1V5IA 3REOA 1C2TA 4XB1A 4WFQA 4EKDA 4ER6A 2ZZNA 2IS6A 2Q1TA 2O7VA 3C14C 3I9MA 2FNAA 4JCCA 4GC5A 1TTPB 4HDOB 4JKIA 4XD2A 2VAXA 1KE2A 4P5PA 2YRWA 3N8KA 4H7IA 2GM4A 4L2IA 4BUJA 1QU2A 3H3XA 3KIPA 3WO0A 1LTKA 4KPFC 4DLVA 4EB0A 4W6QA 4ZHQF 5DPMA 3FMGA 4DC0A 2P2DA 4BLPA 2GF0A 1I7DA 4HD8A 2VN8A 5J4YA 3TF5A 5EZYF 3WDMA 4DIMA 2DPXA 2EF0A 1VYHA 4W6ZA 4QTUB 2HU5A 3TFOA 2XQVA 1CUIA 4ZVUA 2EGGA 1PJBA 3I6ZA 4JR2A 4WTOA 5A3SA 3KP1A 1A4XA 9LDBA 3I3SR 4B3SB 4RPIA 2IPXA 3HG7A 1Z4MA 3T7TA 4RESA 4M1MA 1T3HA 1ZVQA 2B21A 3UJCA 1SZJG 3FKSA 1MA0A 1X3SA 1OI2A 4ZEOA 3C24A 3I04A 5D3ZA 2GASA 3KFXA 3GCDA 3R3VA 2WICA 3CF4A 3RB8A 1T6ZA 2QW8A 4PLVA 5CLFA 5BSUA 4Y6LA 5CXUA 4P4SB 3V4FA 1YS1X 3QFCA 4MWGA 3U0VA 2PEYA 5A9SA 2FN8A 1THZA 4P3KA 1BEZA 4BS9A 4ID3A 4YHBA 5TC4A 4AJJA 5JSQA 2OOSA 2R85A 4PX3A 3LPAA 1MVNA 2W71A 4U6SA 3WK4A 3Q3IA 3QNMA 5A0TA 4BFYA 1HORA 2PL5A 5AKXA 3KSRA 4OLAA 13PKA 1OA0A 3PD1A 4OU4A 4TTQA 2EZTA 3LCVB 1CIPA 1H8HD 1FDVA 3MJFA 1T5OA 1B74A 1WD7A 2CJXA 3KJEA 3QLUC 2D3WA 4TLMB 1G9SA 4EJ0A 5BNTA 2Z8YA 5BSFA 4YPOA 4OP1A 3E15A 2PFSA 3L7AA 4KODA 1QX4A 1EMDA 3A31A 1CJBA 4ZTBA 2QYSA 2JFZA 5CURA 5DYTA 1QQ5A 3ZWXA 4QYIA 4M9UA 4LVOA 3ZDFA 1NVTA 2JS7A 1KI7A 1PZXA 3VH2A 3NAQA 4FILA 2ERXA 4DR6B 3HDTA 2MTBA 4IG9A 4R84A 5JY6A 2BH9A 3P2JA 1M72A 3L4BA 5JR3A 3LWDA 3CSDA 4O4HF 2ZJ7A 1Y8RA 1ECCA 2P69A 3GFQA 4WZAA 5B7NA 3D8HA 2PEZA 3TQOA 4OMCA 2WRZA 1H4QA 2V6GA 5C5DA 4J03A 4EB3A 2XIQA 5FWYA 1XPUA 2FPLA 4NBNA 4UEOA 5FOSA 3SF8A 5LQMA 1HL3A 1BXGA 3CLKA 5F64A 2XB8A 2QD2A 2WT8A 4KDFA 1RFGE 4CMCA 3G0HA 4Q4DA 4WZBE 3MWYW 4Z0NA 4RJKA 1H3NA 5FH9A 2J3MA 2JGDB 4GBGA 1XZNA 2DULA 1SVMA 2EFCB 2M1XA 4ATNA 3L0CA 3KZKA 3CZQA 5KKAA 4MH0R 4RKYA 2I5PO 3DMRA 3BTUA 5EJ2A 2OFWA 3ZKWB 3BWDD 1XP8A 3I12A 4OAPA 2CKDA 2G9RA 4C5BA 3OJFA 1VCIA 1YXMA 2JJ2A 3DW1X 5LB2A 4MUBA 4BJ1A 1NE2A 1ORTA 4INPA 4OXIA 3RYHB 4JXXA 3CUYA 1FXSA 4FKZA 5JROA 3B8HA 4NF2A 4ETMA 3AVVA 3R3ZA 5TR9A 3MJSA 2IXGA 2HY7A 2CBGA 2YVUA 4EI7A 4PLTA 4O0MA 4EEXA 1XZQA 4DUPA 5BMOA 1NFQA 3OCCA 2GSWA 2P3QA 3L4SO 2R44A 2NM0A 1ECGA 1DRJA 2YCLA 5AW9A 4Q3NA 3HV2A 4GP9A 4ZICA 2W2MA 5BUCA 5BYBA 3KXLA 2NXJA 1O94D 4RDXA 3O3MB 4RQAA 3QFSA 1KK0A 1A2BA 1G59A 4AYTA 3L9WA 5B6IA 1NOIA 2CZGA 3E61A 3SOZA 4HH4A 3K70D 1JH9A 1YR6A 2CNDA 3GY0A 3KJGA 4RTLA 2Q2OA 1WQ1R 2ZRMA 4MS4B 3R23A 4DR3B 3VJKA 3JQDA 3TRKA 4V03A 1TCAA 1X8KA 2QL7A 1Z0JA 3ZD7A 2AF4C 1SHKA 3DTVA 2R8YA 4HZUA 3KQHA 3F6RA 1QFMA 2YNMC 2D0IA 2XZTA 1XKXA 1TZBA 3G6KA 4HATA 4LYDA 3ZVKA 3USZA 4EJSC 4D9FA 4FFBB 3LG2A 1DC4A 1A7JA 1LSUA 4YI5A 3ZNOA 5U4XA 4UEWA 3FHCB 3K70B 4IUCS 2IHTA 1SQGA 1MO2A 2R4QA 5BURA 3NYQA 3QXHA 5FUBA 5ELXA 4I1SA 1OJ7A 1SG0A 1TT7A 1V3VA 4LFCB 5KDDA 3TQSA 2H1VA 1BTOA 3CXUA 2OBXA 4D46A 1XRPA 3ICWA 1VPLA 5L51A 3DLAA 9GPBA 2RGAA 1MT3A 1CP3A 1OXTA 2ZAOA 4G1MB 1JA9A 5YASA 1I2DA 1MG5A 3RAPR 3NHJA 4FHGA 3SQLA 3RCBA 1E9FA 3GEIA 4HXYA 4UREA 3FMVA 3WLTA 1TVCA 3M4NA 1OA1A 1ZM2A 4DR7B 1KAHA 1TUEA 2W22A 3G59A 4REQB 1R10A 4GKVA 4JYPA 4RMJA 4UPDA 1V8ZA 4UD6A 4O4JB 4D41A 2C2WA 1PV4A 1Z88A 3DDCA 3QUTA 1ZCZA 3KKZA 3OWOA 3M5WA 3QBDA 3ZBQA 3HUTA 3PVCA 4ND5A 3ENWA 4YRDA 1T4CB 4KVZA 1DJOA 3TVTA 2JI9A 2HDNB 3TNLA 1XMSA 2BGJA 3JW8A 1Z0IA 3PNLA 3N53A 5AVRA 5EHQA 2NNWB 2AH5A 3DXYA 2GO7A 3DWGA 2ZDQA 1NKSA 1JEYB 5TRTA 1IBSA 2QM8A 1XZIA 4Y2VA 1K0UA 4U2GA 1LUAA 1NJ5A 1U28C 2TRSB 5BT8A 2XGJA 2OO3A 1KA9H 1XZFA 2XUQA 1LDNA 2H29A 3GQBA 3OJEA 4GLBA 4I4TA 2DE0X 4O5OA 4PRZA 3NH9A 2FJ0A 1M34E 1ADFA 4AZTA 1MTZA 4L7VA 4KR7A 2JAQA 3L07A 4UCQA 5KDOA 5LA6A 2PU5A 3HYLA 3EDMA 1R6XA 4CV0A 3SC6A 3HN6A 1DE0A 1VE1A 3EH1A 4LBVA 1H1DA 4E4YA 3LA6A 4FWBA 1Z83A 5BSRA 1HX7A 1GPUA 1EUDA 2WHRA 4OHMA 4OQMA 4IIYA 5HQJA 3M5DA 4BTVA 3D6MA 4JP2A 4CLOB 2W6PA 3PQ5A 2XE6A 3VZDA 4KBFA 4D43A 4YCDA 2Y99A 3RQSA 4BYMA 4D3SA 1HDZA 3M1IA 3BHJA 2MSEB 4EHDA 1XFDA 4XTRA 1YHYA 1UDCA 2VCYA 4H3VA 3I6IA 5FT9A 2V1UA 5IYZA 1U3WA 3GBPA 2YVKA 4M7OA 4WKGA 1XWWA 4O2AA 5DIFA 1FK8A 4N0EA 2O8FB 2BZGA 4HWRA 1Y8AA 1FRNA 3DKRA 1CUDA 4TN1A 2W6ID 2DJ5A 1Z6XA 2FQYA 5HA5A 1ZVKA 2E37A 3C45A 4PYLA 2P30A 3AESB 4MUGA 4PNPA 1EWQA 1F8XA 2PGLA 3QOXA 2PSFA 1GM5A 1P1BA 4CVNA 3HK2A 3ONVA 3PLAE 1SVUA 1XG5A 2OCAA 3Q4GA 4I8IA 5CGZA 2P6OA 2FH5B 3VSDA 2Q5JA 4HCJA 3U9LA 1KHHA 5JEEA 2ZM5A 1TYDE 2ADFA 2C9OA 5K05A 1IDN1 3ZV3A 4CL2A 2YWBA 4UUOA 3JD3A 3G1UA 3TL6A 3TSAA 2V6MA 2A9RA 1XP5A 2F64A 3NIFB 4KNVA 1ZNWA 5KCZA 1ST2A 2VTKA 3IFSA 3P0EA 3QPCA 4ZCQA 4TSKA 3Q6IA 2F8SA 3W5VA 3ADOA 2ZDGA 3H05A 4ARZA 2YOHA 3PA6A 1ZRMA 4PYQA 2A59A 3V8BA 2GLUA 1M6YA 2JK0A 4LVCA 2GJAA 4Z6KA 4YCBA 2H06A 3F4LA 1DIRA 5TT0A 4RLHA 1SA0B 5KVQA 5EUBA 1QDUA 1XQ9A 2Z9CA 3MRVA 3JD2A 3N5KA 2HM7A 4FFVA 4WL0A 1Z4JA 2W6JD 4QODA 6CHYA 5AW0A 4IJUA 3UMVA 4XARA 4D79A 3FH0A 2YJ3A 2Z1DA 3DOEA 4ALJA 2GBIA 1BS2A 4G5YA 2ZR0A 4MROA 4W8OA 3LDUA 2HRDA 1O96A 4FTWA 2NO0A 4QOGA 3TR5A 4U8GA 4R9RA 4BEVA 1WXDA 3QKUA 2EP8A 4OPMA 3KOXA 3VUFA 3WDSA 1B8NA 3ZY3A 3L5OA 2V0GA 3GGPA 4NLLA 4U7TB 1B8UA 3UWKA 1ZJYA 3P9IA 2FUNB 4WECA 3DT6A 4P5EA 1VJRA 5LOVA 1E1KA 1E1CA 2IW1A 3PFCA 1XJQA 1I33A 2EFDB 2OK7A 4IEEA 1P3Y1 4K6OA 4ARSA 1X86B 2PLRA 2QD5A 1G60A 2MSNA 2XAAA 3SCZA 3O8NA 3CRW1 3GZNA 4IJVA 3EFOA 4F9FA 3MQ2A 4GWKA 1JR4A 4JI8B 1Y6GA 2H17A 3OKFA 1L5RA 1KXZA 2X76A 2QMQA 1QFYA 1KZ7B 2R751 4MQFA 1LEHA 3FNRA 5A5EA 1J0BA 2V7TA 3T5MA 4JHXA 2JIOA 1UZNA 3U40A 4JB3A 1WETA 1P33A 2OUKA 1AS3A 2GESA 3B3FA 1QBKC 2X42A 3COYA 5K6AC 3U4AA 2BWJA 1U8YA 1DELA 4ZAZA 3GZ4A 4QUEA 2WZQA 1B43A 3CLRD 3PHHA 1SXJB 2J07A 4O3FA 4PLGA 3SHOA 1JVNA 2ENUA 3OZWA 4XLTA 4CMGA 1MOQA 4JQCA 2HQBA 1VIAA 2GPAA 4L9SA 4RZHA 2DUUA 2XODA 3ZDBA 2GPJA 2PH1A 3Q88A 4O5AA 1ZXXA 2QAGA 3LZ6A 2J7PA 1Q6YA 1UBEA 2UZAA 3EWSA 3GA0A 1HF3A 3DEAA 2JFBA 2H1CA 2ZSJA 3MHTA 5CVVA 4PM4A 5HBGA 1W48A 5KTKA 3RI3A 1WDKA 1N77A 4CEHA 1QVRA 3IIJA 1E8DA 2F1OA 2PUEA 3ABIA 3N2NA 1A2QA 2N75A 2VBCA 3ETNA 4BWVA 2NMVA 2N1BA 1J5PA 1XV5A 2I2AA 2F9LA 4HNSA 4M1QA 3IAAA 3P5SA 1ZQ1A 3FLAA 4B6RA 4YCAA 2GCPA 3VYRB 4Q01A 4WNAB 5EWJA 4Q9NA 3FYUB 2YHAA 4F7DA 3GUYA 4NYMR 5LBIA 3OX2A 3WLLA 2HBQA 5JFOA 5JYCA 3OFSA 2VQDA 1P31A 4RSHA 2MIIA 4U3JB 1A5SB 1H93A 3COJA 1R0ZA 2BDEA 5TQ0A 1LNSA 1T9HA 4MUEA 2HV8A 2PUTA 3CM0A 4MGZR 4Y2UA 1KDPA 1KC1A 1JDUA 3DEHA 2VK4A 3OFNA 5ICSA 1KOGA 2W90A 1ZUNA 5C1OA 3LHKA 3QEMB 1I01A 2BP7A 2AFIE 2W2LD 1X1QA 3DHWC 2PJZA 3M6VA 4UARA 3T0GA 1T0JB 2ZRIA 4EW6A 4HNVA 2OSVA 4RABA 1PAUA 1D1TA 3BHMA 2H4FA 4GKBA 3H9GA 1Z3CA 3AEXA 2W83A 3G2QA 3CEAA 1W94A 3IPLA 3DH0A 1LJLA 4EABA 1AZTA 2B0JA 2DBRA 2P5UA 1Q44A 1YE3A 4MW4A 4AAYA 1B3BA 1CUHA 5LP6A 4C07A 1SM4A 3ME5A 4CCAA 5IJ0B 1XZJA 3GBVA 1UPUA 1I10A 4ES6A 4IWXA 1TGYA 1V4BA 5DN9A 1JMKC 2HKIA 1EPUA 3MA0A 3HI6A 3HH8A 5KYWA 2I3BA 1VTKA 2AFVA 2WE7A 1Q14A 3EYWA 1HQKA 3G9UA 2NXNA 4BMPB 3FYSA 4FFMA 1N0UA 4JBYA 4OK3A 5IVDA 1FFYA 3LQQA 5BNWA 1HK7A 3FNEA 1W1UA 2OGSA 3NBXX 4IJWA 4KLZA 4KQKA 1QVZA 1N2JA 2BBOA 2BLNA 4ZO4A 3V6LA 4B6GA 4DRYA 4DR4B 3L1JA 4PN7A 5DHQA 4B4KA 1NFRA 5AI9A 5A5FA 5I6DA 2I6QA 2ISSD 2VPTA 2WOOA 3G0IA 4OGLA 4AKEA 4XLLA 2JAPA 1ZN7A 1JHVA 3CUVA 2J32A 3HKBA 3EVGA 3O3CA 4J0FA 2ZS7A 3ECCA 2ANBA 3I0NA 2V8OA 5FI5A 4EARA 1LC0A 4MULA 4KMOA 2PS0A 2PMCA 4PPGA 2O8BA 4MZXA 1Q1ZA 3SJ7A 3WWCA 2ZRDA 5DBGA 1C1DA 2V7BA 3MD9A 4U7GA 5CW2A 2PGNA 2WJJA 2Y27A 4Q9KA 5AKKA 4E94A 2G7MC 2G28A 6REQA 5C1IA 5FIUA 5BXQC 3A25A 2J46A 3OZRA 1HSOA 1NULA 4YIKA 5FOTA 3B8EA 1J2TA 1Y1LA 4UHCA 1Z5NA 4JWKA 5EVJA 3S2ZA 4GM4A 1QIIA 2CDRA 2WNSA 3IO3A 4M1ZA 5IKOA 4C7XA 1ZK0A 3RIGA 2FGKA 3ABQB 2DBZA 4RIFA 5JXWA 3N8GA 4I4TF 4C2TA 1N57A 1RPAA 1R8SA 1YAHA 5CBPA 5IULC 3C3DA 3ODPA 1ZCAA 2B1RA 4AG5A 3GRVA 3TLJA 4BLTA 4WD3A 1XVLA 4BV2A 2HZ7A 2VSOA 4G36A 3UIEA 1M1XB 3IYLW 1PIWA 1Y5RA 1V39A 5EIHA 5LA6F 2ODBA 3RE1A 4IVPA 3UYKA 3IXQA 3FTNA 4MV6A 4WQMA 5K3DA 2PV0A 5D51S 3WKDA 5A2QA 2WAAA 4DR1B 3Q8LA 1VG1A 2IHBA 3I32A 3RF6A 4GDMA 4P98A 1DQSA 4G5XA 4PGMA 1NKTA 4M0EA 3FMOB 4EIWA 4OQPA 4AN4A 1RYBA 5D01A 3S2YA 4A8JB 3B1WA 4MCHA 1MJHA 1KYIA 3LKBA 2BHLA 5IYZF 4DPMA 4CEIA 1W93A 2ARKA 2X58A 2YMPA 2GBFA 1SWVA 1Z82A 3G5AA 4O2AF 4A6PA 2DHRA 3K1AA 3DZDA 1L5SA 1R4MB 2ZGVA 4OBXA 5JD3A 3AL3A 5EIOA 4RV5A 1HKUA 1AK2A 1SHZA 2EBWA 3I09A 3P20A 4RL4A 4A26A 3CFYA 1V5FA 5FDFA 3EW9A 5ER9A 3SZRA 2XQGA 3CZMA 4PIMA 1DB3A 3PNOA 5I9LA 3DDNA 1XTRA 2V59A 2XVXA 4W1RA 5IPFA 4X65B 1CZNA 3IUPA 4GLFA 4M8NE 4REOA 2QTRA 4LFBB 5C5CA 1WUKS 1LPMA 1AQLA 3P2IA 3NEYA 4GD3Q 4A91A 3L7OA 3PUYA 4WY5A 4G0ZA 1V1MB 1FYFA 2VDOB 1POWA 1YI8A 1QYXA 1W46A 5B3KA 2J3QA 5K8IA 1NHGA 3C4VA 3IS3A 2O3UA 4A6EA 4OHRA 4DSUA 3DM9B 4IZ6A 1VE9A 4IMJB 4QC2A 3QKTA 3AY3A 1T2DA 1JAZA 1SBNE 1CIJA 4JZYA 1BE0A 2Q07A 5TS3A 1H8HA 1RYNA 4I4LA 4LOAA 3U13A 3VU0A 3BWYA 4CJXA 4ND8B 2GZ3A 4HNGA 4RIEA 5LXTA 4BNDB 4NPHA 5BQ5A 4FT4A 5LLDA 1DC6A 1E0DA 2PT6A 3I5YA 2Z6UA 2IPNA 5CLHA 3HGMA 3UHFA 5BQOA 2CXOA 1WHSA 1Z7YA 3KL4A 1M83A 3OEWA 1AT1A 3AF3A 1QLWA 5E6SA 4BDTA 1K2WA 2KW5A 3V2HA 5AESA 5DH9A 2H18A 1JBKA 4WGGA 3B70A 4ZJYA 1KR2A 5JNTA 1W1WA 1RJEA 1TDJA 3E3AA 2JGKA 3H7IA 3RNOA 2G40A 2WWXA 3S2UA 4G89A 3DLBA 5BN5B 2J9ZB 3Q6MA 1E62A 2QM7A 3VPGA 3HJUA 4TV9A 1NP3A 1GNPA 3AIOA 3HSKA 1N5MA 5LOVF 2WIBA 4ISBA 2O5VA 4OJTA 1W88A 4GOMD 4HNTA 4BNLA 4LTNA 2PX5A 4J4BA 1I1NA 2O6HA 2CXRA 4ML3A 1C4XA 1NHWA 4UULA 4CKCA 5DLPA 1CZUA 4JJZA 4DPLA 2HR1A 1WNTA 5AHKA 1F2TA 1GPNA 2IVZA 1X3LA 2ZT8A 5DI9A 3RIYA 1LVHA 2P9HA 1YV9A 1HTBA 4IIVA 3SJZA 4K9LA 4DMGA 4YCNA 1YMVA 1SXGA 2IZ5A 3LBNA 1UMDB 1ZIDA 1ZH4A 3MTIA 1VPEA 4FZVA 4PYNA 5K0JA 1DBPA 2NZ8A 2PPVA 1YOBA 3NPAA 2BEWB 2X8BA 2Z5LA 1MQ8B 2SICE 2JZCA 3V1UA 1RD4A 2EU8A 3DCIA 3E48A 3CPHA 2V58A 4JGGA 1UOPA 1T8WA 5GPBA 5IN5A 3UVEA 3W5IA 3ZGVA 2BFBB 4E22A 3DA8A 5JCXA 3JQGA 5KYXB 3DE4X 4OCZA 3AHJA 4YECA 4ALNA 3VGPA 2BPOA 4B09A 1RWBA 2L82A 2R1UA 3EQ9A 4R7ZA 1YOVB 1GTL1 1U8ZA 4MLCA 4MNTA 4G8CA 4ZZ2A 1UBTS 1E2EA 1T1EA 1PX2A 2JH9A 1JFRA 3U4MA 2JFGA 1NWHA 3PR1A 3IVAA 4MGIR 1I1OA 2AMJA 2MINB 2AWOA 2RHBA 3DV0A 5EJMA 3ER9A 1CUZA 5G1PA 4AMVA 3LT0A 4XCVA 4LV6A 2ZSUA 3MGKA 1IZ0A 4D4KA 4IGFA 1P2TA 1Z39A 2GZDA 2HQRA 2N46A 3DMPA 4FFBA 5BQ3A 3DBLA 1JHZA 1IVNA 2E4YA 5H8WA 1ZL0A 2DERA 3NHSA 4BWGA 4ER7A 1NMXA 4KWTA 1OZ0A 3PD7A 5FOWA 3UJ8A 5KOYA 2IUEA 2XEDA 1Y63A 4F5WA 4LWZA 4QFBA 3TLGB 4URUR 1FB5A 1YMQA 2KLBA 4BX0A 1R12A 4LYFA 1DAPA 2W42A 1T8YA 4HGPA 1DEAA 2VUSA 2P9GA 3OZVA 2ATEA 3PC6A 1K3TA 2BF7A 4J90A 1UEJA 3P9XA 2ASEA 3WB9A 3N87A 4V0LA 2GERA 5IH7A 1PF7E 3IUNA 5I7EA 2HSDA 3K09A 4FNOA 1HM5A 3GJ6A 5DCWA 4K9QA 1CEEA 2JRLA 1F8UA 4JMLA 4RTNA 3TWOA 3EC1A 2HADA 3RS0A 3GJZA 4LWQA 1SB9A 2CT8A 5IK2A 3NDJA 1X77A 5C18A 4L1KA 5DXAA 3T0IA 4AZ3B 1BJRE 4FDTA 4I4CA 3ZHQA 5LP6F 3BKXA 1E2LA 2BHSA 2JIMA 4B76A 4NJOA 2C94A 2ORVA 1DWUA 5SZKB 2BEVB 3FIJA 1JEOA 2AHRA 3DPUA 1T9CA 4Q3CA 5DNVA 3LW7A 5DWQA 2OBMA 1U7WA 4FE3A 1CNEA 4BVEA 1JAIA 4AKHA 1NI4B 4CW7A 4RMGA 4CUKA 4DQLA 4TMZA 5FA5A 1A5TA 1E6MA 2FVXA 4LJ6A 1YKFA 2OQRA 3B6JA 3AU8A 4RSMA 3OE4A 1IWOA 1IYZA 4ARAA 2ZYWX 1IHXA 3AQ4A 2GZ1A 2I54A 1YNOA 1PZHA 2VUHB 3FCEA 3OTHA 3PFWO 2XUOA 2OLJA 4LE1A 3RVQA 3UTDA 5C4IA 2HMTA 1KAGA 3KXDA 1JHRA 1J24A 4URZR 4RS3A 4DLYA 4JT4A 2GNAA 5DX0A 4TL9A 3UCXA 3ZX5A 2IBTA 2IYNA 1Y89A 4YTEA 1RQRA 3GCXA 3L49A 5TMEA 2GCNA 3AYZB 3A2MA 4YP1A 2R2AA 2BH2A 4XOUA 4M1WA 2PYDA 4BKPA 4DRZA 3HVUA 4E15A 4QRDA 1NKVA 4H77A 2WZDA 1RYDA 2H1RA 2NNLD 4WNCA 4C20A 4II3A 5I7WA 5AI0A 4EHBA 2F8TA 1ENPA 3GFGA 1K63A 4MS3A 2PUVA 4MLZA 3HPQA 1NXSA 3HVRA 3LSYA 2P2CA 1XCMA 3GG2A 3DEFA 3RSHA 3TNDA 3KAKA 3D43A 1SIWA 3VKVA 4WKNA 3M9XA 1HDOA 4LYYA 3ZDDA 1ZHFA 3FHLA 2D1FA 3HMQA 2IJGX 3AESA 3EFEA 2GXSA 1RHRA 5IWAB 1YKSA 4I5DA 1X7ZA 1T8PA 2G88A 3GDFA 3V7WA 5B37A 4ZMBA 3A32A 3OPYI 1P6UA 1XRMA 4QATA 4ZU3A 3KVOA 4E13A 5A0FA 3X1YA 3PC3A 1V7ZA 2RJOA 1F4PA 1RPTA 2QT9A 2WSYB 3QU2A 2JJ1D 4RD6A 1GR1A 3FSGD 1UJ4A 2EV9A 4P4UA 1RP7A 3DQPA 2LCFA 5AVJA 2ZCVA 5JHHB 1OKKA 3CY6A 3PDHA 2WHEA 1RZVA 4MKIA 3LQ4A 1EVQA 4OQEA 3TX2A 2Y1KA 3LT1A 3JSXA 1RXSA 1T5IA 1EJBA 1KFBB 3E9QA 1UJ6A 1UKZA 1KI9A 1WCYA 2GVZC 3BZUA 4IIDA 5F9FA 4D9CA 1FP4B 2VRWA 1I2CA 4KO3S 3GRKA 5IFLA 1V9SA 1NUAA 2I2XB 4RACA 2Q9AA 1SC9A 5LD2B 4D9KA 4L27A 1ZD3A 4UCWA 4QTYA 5DK6A 2VP5A 2XYHA 2DKNA 1HC7A 3B53X 2CLEB 1OFGA 3HYTA 4QJBA 3F7OA 4KQIA 2EF1A 2V3VA 5IVHA 1W5SA 5BNFA 3QJ5A 3W3AA 4KLNA 2J3IA 2OVBA 1D4ZA 3QPBA 3E7DA 4CKXA 1BQ4A 4LMBA 1P5JA 2K87A 4KGVA 1A9PA 3U80A 1IY9A 1S1MA 1XMJA 1K3FA 1R3DA 1UWCA 1YQWA 2W6JA 1VLHA 1XNRB 4XD7D 3RKRA 2H54A 1FRFS 2AN3A 4DUGA 4HRYA 5A5GA 1KYWA 3LLSA 3HB5X 3KB6A 3EEQA 3OOSA 3RRMA 3RUIA 3TOXA 5CGQB 1JG3A 4MOWA 3PL1A 3EE6A 4V0MA 1WL8A 3EN0A 3PR2B 4PTYA 2D2IA 4IKPA 1XSEA 5DCLA 5B36A 1JR3E 2H8KA 4P54A 2QL9A 5LXTF 3KQTA 2Q5LA 1OTHA 3I9KA 3H9EO 5K3SA 2NSHA 1EVZA 1HZJA 2R62A 4MRRA 2HHJA 3I3OA 4MW2A 3VFDA 3WMRA 5DRYA 2RC6A 4OLFA 5LVAA 2RC5A 1LI7A 1ZM7A 1OTXA 3UG6A 5FWXA 2P0YA 1D09A 4YASA 1V95A 1JUDA 1XNGA 2QX4A 2ZKLA 2NVOA 4JOCA 3EF0A 3Q8XB 2L19A 3PYXA 4M76B 4NCJA 3GFOA 1IXSB 4JEHA 5DHFA 5ICFA 4TV9F 3TN7A 3DWIA 4B71A 5B6JA 3O8CA 1J8QA 1C4OA 2HJSA 3PE3A 4IDFA 4ZVKA 1NI5A 1H4TA 3RR2A 4JC4A 1K4KA 2V3CC 1EVKA 1EFVB 1TEVA 2BKAA 4KB5A 5AVTA 5LMZA 1WP9A 1OPXA 5D3MB 3KJIA 5FO1A 3ZQKA 4U2CA 5EN4A 5BN4A 4M2LA 3D2LA 3KR0A 3ZBPA 2P79A 2Q0QA 5E6UB 4IJ5A 2AC7A 3ANSA 4FGKA 1VHWA 3DVLA 3MLAA 3TXXA 4C0JA 3U4QB 3FYUA 3ZU2A 1MKYA 2PAAA 4P93A 3G5UA 2ZWVA 1T3GA 5H68A 1N8KA 4WGFA 2ZRAA 4BO8A 2FPGA 2PRKA 4LY3A 4IJMA 1HSZA 2DU8A 4HYQA 4H7JA 1XDBA 3KSAC 3T9AA 2C8LA 3LY5A 4XVRA 3RRYA 2IHZA 1L7DA 2BBWA 3OZCA 2AMYA 1GDDA 3F5MA 1MDFA 4FOOA 4HDSB 4NECA 3V46A 1VRWA 3ONEA 4LPSA 3NV9A 4YDHB 3K4QA 4A0SA 5H7XA 2XYGA 4NZPA 3HRHA 1LU9A 1BKYA 1CZRA 1TO6A 4UPVA 3UMFA 3QIAA 2ECKA 1YKGA 3WX0A 1YDWA 1Z6YA 3ZK8A 5JAPA 4BX8A 2DM6A 2I1WA 2H4HA 2WY2D 3U26A 3FYHA 4YYEA 4ZRNA 4BIIA 1Q1EA 1O1YA 2CDBA 3I5UA 4I1VA 4F04A 5J47A 4KN6A 4IXNA 1HPLA 3QBTA 1I14A 3EXEA 4G63A 1G5PA 5I3ZA 3N2EA 4RVOA 2C29D 2W2LA 3R7BA 3RS4A 3LOQA 1UXIA 3NVMB 4AF7A 5CCEA 1Q91A 1JZSA 1Y9DA 3A4YA 3H97A 3KBBA 3Q3CA 4HH1A 4UHDA 4MQEB 1J09A 5FNVA 1K27A 5FOVA 4DCGA 1X7XB 3S7ZA 1U99A 1D2MA 3CX3A 3H2BA 3HFRA 4AECA 4BMNA 4AZ0B 1B0UA 1IOLA 4CR7A 1G8PA 1QRDA 2WYUA 2OHOA 1BE1A 1PWHA 4XIGS 5C53B 1TNDA 3WHKA 5B3JC 4UDYX 5SY9A 4FM9A 3C5VA 4U00A 4NBSA 1H85A 1JYSA 1P1JA 3NAGA 3O5AA 4G5HA 4PINA 3T7KA 1EXDA 1VG8A 1C9YA 1H94A 4EVIA 1F38A 3PF9A 3R20A 3TTXA 3M6LA 2JAHA 1PLKA 4L3WA 4MYDA 4Q4LA 5E38A 1SOVA 4TMYA 2VHUA 3NWPA 4ZIRB 2QDXA 1HR0B 3MWEB 3L06A 3ZHXA 1E1MA 4HDRB 1PS8A 2ETXA 2ZWIA 1ISHA 4HUQB 3S6JA 3O4IA 2PJUA 2PXHA 4WXYB 4E5MA 1JFFA 5JISA 4ZVNA 2QZ4A 5KVVA 1GZ7A 1TTHA 1JB9A 5CD9A 2OHGA 4S24A 5AK4A 5I48A 5KINB 4LK3A 3CX7A 3M7IA 2PY6A 3KE8A 1ZMRA 3UW1A 1M75A 1YJBA 5EIWA 4ZVVA 3ZTWA 2WUFA 4P5DA 5F77A 5FPHA 4U39A 3ZVLA 2HWWA 4E1VA 4EKIA 1T24A 1ZDMA 4MW7A 1KC3A 3RRJA 4WCVA 4ITRC 4DNXA 5MGNA 1E7MA 3FOWA 4PAQA 3O82A 4DB4A 2Q3EA 4L78A 1N7HA 2GXAA 1W76A 2CVOA 1VYUA 3DDUA 4JJKA 1T5BA 2FZVA 4UNNA 1O4VA 2HA5A 2UYYA 1V6AA 3LV8A 3WL7A 1NUTA 2D5BA 4X0EA 3DXFA 2CKMA 4G1BA 4KNYA 5KOIA 3HNPA 3LLUA 3VHXA 1J9GA 3T99A 1OFUX 2RB5A 2BFEA 1U2PA 2HLPA 4MWCA 4JD5A 4NC9A 1RNLA 3QXJA 3T06B 1MO5A 1V2HE 3FOZA 5H3HA 4GEKA 1ZVVA 1LK5A 3AOGA 3QUQA 5E7QA 2XMBA 3BD8A 4BAZA 5L40A 3BDVA 3NBMA 2Q9BA 3Q7RA 4II7A 3GNLA 3LQFA 1M6VB 4TVSA 2QYTA 3ANYB 3VKFA 5K8VA 4FLMA 5C31A 4S04A 1I0ZA 1GN8A 3K8OE 3GLKA 3GYBA 3QBVA 3SKYA 5C2JB 3D7MA 4YQZA 4C0BA 4DSZA 3I6BA 2IYPA 4DMHA 4YCCA 4BPBA 1OU0A 5BVGB 2C7RA 4DRXA 5F51A 1ZUHA 1C1XA 4G5RA 2I67A 1H8ED 1XEXA 2QQFA 4MYSA 1DJMA 1B8OA 3AM1A 4DV5B 2GBLA 1VHJA 2BM0A 4DARA 2F9FA 3Q41A 4DMFA 4YT8A 2WUVA 3CX6A 4ZCTA 2DYKA 2VJOA 2ADMA 5FTMA 1ZO8A 1EK2A 1N8SA 1RAFA 1FW6A 4YRLA 4X92A 4XVUA 3OZUA 4JP8A 4YRZA 4I1YA 5ALXA 3ABOB 4TM7A 1HZZA 1V1MA 2CWDA 2QR5A 2BI8A 3ASZA 3TKLA 4HVLA 3DKKA 5L4LA 1XN1A 1J0EA 1Q57A 1SCBA 3AEQA 1TF7A 1ECFA 2PD4A 1KRHA 2P90A 4U6NA 1Y8QA 3NALA 4W1PA 4JVLA 4D57A 3A8TA 1IUOA 1Z6GA 3FNQA 4M0PA 4ARUA 2X14A 3BFVA 3LK7A 3RBVA 2V4UA 3FRIA 5IEBA 3NBAA 4J0EA 4EENA 1XWIA 3HP4A 3LCCA 4RTOA 3GNTA 2IU0A 1OYWA 3JTMA 1WLYA 3K0AB 3ESQA 2Z9BA 1CE8A 3C7CB 5TB5A 4WEOA 1O5OA 1GAQA 1M2WA 3Q3GE 4BJ5A 4TL7A 5MF6A 1J8MF 4G0NA 2W4IA 1HA3A 2RH9B 2WHYA 3KOWA 3L0OA 4NCXA 5LLSA 1APBA 3PDCA 2DPLA 2Z2YA 3ESRA 3AL2A 4JQOA 3UV6A 1VKOA 3MTQA 5JZBA 2ZJYA 1MB2A 2PX2A 4JT8A 4NI5A 1QWSA 1E9RA 1NA5A 2XT9A 5AKYA 3TRJA 1CUSA 1N1DA 3DMTA 4W63A 3H8VA 2NYVA 1YVDA 2ACKA 5JALA 4D26A 2XOKD 1Z3IX 3CRVA 3IOBA 3NRBA 4S1VA 1VSVA 1FQJA 1MB0A 3OJCA 2KB0A 3UZUA 5THKA 4J0QA 1WMBA 4E5NA 2QBYB 4ZOBA 4BE7B 2C9BA 4C4XA 4Y6QA 2EATA 1QK4A 1T0PA 2A1IA 1P6QA 2B7BA 3HI4A 3PXBA 4JJAA 1KNXA 1A8UA 1ODSA 2ZRHA 4M1KA 4US0R 2LRHA 1QX3A 5EE1A 4JZKA 1LSOA 1P5FA 1TCBA 2QQ5A 3JPYA 3UT5A 2C07A 4B8YA 1E94E 2P2YA 4F85A 4DS3A 1DGQA 3ELBA 2I4MA 1DT5A 1SG9A 2IXBA 4FU0A 3MC1A 5FTWA 2GHQA 2XE8A 1ZRHA 1RQPA 1QO0A 4PHCA 4YP9A 1BXZA 1E9DA 3DZIA 2C95A 4XFJA 1IBKB 5TSDA 2V96A 4B1FA 5BOSB 3CUKA 4GDFA 1CQIB 5ALTA 3MXTA 1L1EA 5BYAA 3LGXA 4DILA 2ZI3A 2HPAA 1Z17A 2DG2A 2R8PA 3AFGA 2R7KA 1S8NA 4DEYA 1DARA 2B35A 3RS8A 1AXEA 4CEJB 4RD1A 4N41A 2ZBUA 2XLBA 1YMUA 3BJZA 5K45A 1SG6A 1QPGA 4O2BA 5FNZA 1CUWA 2DC1A 2EFEB 1LBIA 1Z4PX 3ZS9A 3CN9A 1KJ9A 1ISFA 1E77A 3H5NA 3HHPA 4IUDS 4L5AA 2CJWB 2PH3A 4TRNA 5TY0A 4JNKA 3VRHA 4Z9XA 3M5PA 2D2VA 3WLMA 1Z38A 5JQWA 1IQUA 4BNYA 1EP3B 2JBAB 2VYQA 5FJIA 4BB9A 3I30X 3AJDA 4J1SA 3T5TA 4DADA 2V0NA 4Y6PA 1SC4A 1XOIA 3CGGA 3ETCA 3HBMA 5EEGA 4C6HA 2HGSA 1C5KA 2J9RA 3KJZA 4CDRA 1Z5VA 1FDUA 1BN6A 4QRHA 4CRWB 1PZFA 1PR2A 3L0PA 4H0FA 1FF9A 1YZGA 1M1YB 1OBFO 1K88A 1PJSA 4TPKA 3WNZA 4ER0A 4Z1MD 3O38A 1MMFB 3D7SA 3AR6A 2W8BA 4YR9A 3FGZA 4FMDB 2VYFA 3MINB 5KNDD 3MHPA 4S2UA 3RTBA 3AOEC 1PBTA 2ECFA 3UA3A 4CTKA 2B61A 2HN9A 3DDZX 4KBYA 5CPFA 4G2TA 3EPKA 1WMAA 1PR0A 1MX5A 2WV7A 2BFDA 1R0BA 3D6AA 5IXJA 4BRSA 3UMMA 2BZ0A 4X41A 3UC5A 1VMDA 4D0GA 1U8CB 4MR7A 5HIJA 4L15A 1R6DA 4QVKA 3SC2B 2ZCUA 3NWOA 5KTPA 1GYPA 1QHEA 3EC7A 1H42A 3EMDA 3SLGA 3VOTA 4AUEA 5CLLA 3JS5A 2XADA 1DCKA 7ABPA 3R0XA 3EVTA 2BEVA 3R9XA 3Q2KA 3ZE8A 4FNMA 4ZRMA 4C22A 3CRMA 5ABPA 2I6TA 3AV0B 4CT5A 1PFYA 5AOAA 5LQAA 3ND7A 2Z2IA 4ZHSA 1OXKB 2O8DB 4W8GA 2Y71A 4L5IA 1JPNA 1SUBA 4N5LA 4POOA 10MHA 5FNVF 1QQTA 4FNGA 4IFEA 4BKQA 5JU6A 2AKYA 5HZHA 3GVXA 1SUPA 4KR9A 4REMA 1T1RA 3KX2A 3ZZ1A 4TYMA 3ZJ4A 1DAIA 4ACAA 2C84A 3CUTA 3C6XA 4HUTA 3RABA 1E89A 2INGX 2Q1YA 2QX7A 4TMFA 4JEUA 3W2HA 2Q28A 1OB2A 2IUYA 3OD1A 2HL6A 3T3HA 1TUIA 4EPTA 4DF3A 1ODJA 2CHFA 2W58A 2BHTA 1CY7A 3FLMA 4AY5A 4ZOQI 1Z8HA 2G07A 2JD1A 4QIHA 1RW4A 1C41A 5AMXA 4BMDA 3N8NA 4DCMA 3MJVA 4KFTA 4A0FA 5GV8A 3QGMA 3V7FA 4WEQA 3U7GA 2VSXA 2OMKA 4Z0PA 2PYZA 1F1BA 3THYB 5JUWA 2VDNB 5EERA 4PS0A 1K86A 1DC8A 2VWPA 4PCAA 4A0QA 4GE3A 1GPDG 4KMSA 2A0FA 4Q9LA 3FKQA 4OX9B 3NASA 3OIVA 1OV4A 1SRRA 2OSBA 3E1KA 3F71A 2BYTA 3P9NA 5EYPB 4QJ5A 4RL6A 1OXMA 3I64A 2JGEA 3IQDB 3EVCA 1Q0QA 2AQHA 4D8UA 4FYIA 4F9EA 3A6ZA 5K51A 5B12A 5DMHA 1VI2A 2XDWA 1JLSA 3HL4A 4MUFA 2K7FA 2WEKA 1UFKA 2AG8A 2OLKA 1N25A 3MTGA 1PO7A 3FBGA 3BSYA 4NJMA 3HUFA 1DV1A 4LAFA 2C2ZA 3WKAA 2QJOA 1VL8A 2VF2A 4DA0A 5J43A 4HMPA 5EJFA 4BNGA 2J6IA 1Z68A 5DEIA 4BMSA 3D5QA 3THWA 1M2HA 1UMBA 3CW9A 2P9BA 1FFXB 4BNZA 2XI4A 5KIAA 4ZQFA 3VYUB 2P2LA 1U90A 2GEDA 2OESA 1PV1A 4JVSB 1WOMA 1XCGB 3MM4A 3T7SA 2FLKA 2H9AA 2F43A 3E58A 4M7PA 4OP2A 4TXLA 1OIXA 4YV0A 4BLUA 5ETJA 1RMYA 1M10A 4CUJA 3U60B 1AB6A 1XCPA 2P4SA 3DO8A 4WBNB 1EX6A 3HBJA 4QHTA 2Z9DA 3GA5A 2JJ1A 1V96A 1H6BA 2A88A 4OBBA 1Z08A 3L8ZA 1XRSB 1Z28A 2PKRA 3PQ6A 1XMIA 1M76A 1CHNA 2IOFA 3N3AC 1G8FA 3NHYA 1EJ6A 1UZLA 4RS4A 3DWEX 5CXXA 4DA9A 3C8DA 3NOQA 3TDMA 3ORRA 4PBSA 5ISMA 3GRUA 5F21A 3F3MA 2QG9A 4W7HA 3BULA 2G9NA 5T3UA 5HK8A 4UBNA 3TW4A 5BUQA 2HJVA 2VNKA 3OPNA 4Z7OB 4TTTS 1FOEB 4TLEA 1XNHA 4C43A 2DETA 1TD1A 3RSLA 3QYPA 3HY3A 3ZVNA 3IMFA 1TO1E 2I3ZA 3OX1A 2JEZA 3HQ4O 2QTMA 2TMYA 3K16A 2YMQA 3U48A 1ADBA 3CLTC 5HJ2A 1ULSA 5AUPB 4FONA 4C01A 1FX0B 1RXUA 1SU7A 4L8WB 1DG1G 4LMRA 4WLVA 3VX3A 4L4RA 1IH8A 3GGCA 2V7VA 4TOIA 3RKUA 2XRYA 2C1XA 2OM2A 3KB1A 2D7JA 2V7QD 3BTSA 4YJFB 4FK8A 4XD7A 2RAPA 1CQPA 2AT1A 3CVUA 3GJ8A 2GDZA 2OQIA 2OO5C 1YE5A 1LLUA 4P0TA 1NF3A 1UINA 4PX2A 4X7PA 1IN1A 1D2RA 3KNZA 1K6XA 3T4UA 1HUQA 3VTZA 4BE4A 5CB6A 2CFIA 1ZW1A 3EJ6A 3H3JA 4KACA 3OQVA 1P4RA 1RADA 1S7CA 2GMWA 4MXDA 5B30A 1EWTA 2ZP1A 4Q7MB 3TEJA 3NDBB 3BD9A 1A1VA 1FL9A 2HYDA 4FHZA 4I99A 3RLIA 3V2UA 4IXMA 4V0OA 2JLSA 3HDJA 2EKQA 1ISGA 2C2YA 2TMDA 3ODGA 1RM5A 1NMEA 3L1IA 3LUFA 2NSDA 3RRZA 3SYNA 4CQMD 1CRWG 3G0DA 3DHYA 3O6VA 3HB7A 4JJIA 4KRYA 5DM2A 5DISB 1KGDA 4FYHA 3EXHB 2IV3A 4B6FA 3K2IA 5I4IA 3QITA 2J1LA 2QNRA 3WMGA 4BO1A 4O63O 4B81A 4Q4CA 4X20A 4U7PB 4ERXA 3L7JA 4YRSA 1H2BA 4OBWA 1RJ9B 3UHPA 5B2FA 3V48A 2B4KA 2HA7A 3P4UA 4LV8B 2WILA 4MAMA 1D4AA 3KQKA 1DKPA 2J9YB 2CMDA 1XVIA 3Q72A 1YVRA 3PGA1 4GPD1 3O21A 5A4JA 1NP7A 1VBMA 4U8HA 4XVCA 2GUWA 1V1RB 4TX1A 3DS8A 4RK4A 3H3FA 1KS9A 4K0KB 3JQAA 2IV2X 1H2RS 4MWBA 1DTEA 2MYPA 2XTJA 1YBHA 3WFJA 3CQ9A 5CAEB 2HJGA 3S0JA 5INTA 3DL0A 1UDRA 3MGCA 4YA6A 3ZKAA 1X1BA 1E66A 4I36A 1U0LA 3NT2A 3U62A 3VVBA 4O2BF 1GL3A 1W1IA 5AJHA 5T8KA 4BQNA 1MF7A 3WKBA 1I6LA 1HGXA 2G5GX 3KFLA 2QX9A 3GFVA 1TVKA 1ZD4A 2AYYA 1E2FA 1UMKA 1UANA 4CMJA 2KMLA 1K7FB 1Y80A 1H23A 1RXEA 2IE0A 1YCFA 3BB4A 3OFVA 4PC1A 4D74A 4P36A 1KJQA 4YI3A 2P9TA 5JMWA 1IRXA 2QTAA 5ER6A 3A27A 2IYUA 3BXGA 1Y4DE 3SQMA 2JFYA 3GZTB 2IXFA 4HN2A 1UP4A 4G0VA 5G0VA 2XUKA 1MN6A 5FLEX 4FCCA 2R3SA 1J7JA 1GQFA 3INRA 2R6AA 4NY1A 4YP0A 2B3TA 1BXRA 2JFQA 5ELLA 4EKYA 5JSZB 1DC3A 1EZ4A 3BJIC 3NEAA 4RHTA 2YWJA 5AJVB 1ZJ4A 3FCSB 5TQJA 2ONZA 3L8MA 1BFKA 4X7RA 1PTJA 3NORA 3R0JA 1NM5C 4MYRA 1PEDA 4MTCA 4Q48A 5DEOA 4HGYA 5GP1A 3W6NA 4YJ3A 1FYXA 1RLUA 2WIAA 4EZBA 4KR6A 4UE2A 4UDOA 3DP7A 1B6SA 1P0QA 4JLMA 4P2BA 3MWEA 1XHLA 3R7AA 5IAGA 1XA3A 1L4UA 2BFNA 4UXJA 5AQ1A 3DEJA 2F55A 1DJQA 1TXGA 1N2CE 2GN6A 2UUPA 3H5WA 4CU2A 2HF2A 2PBLA 4O08A 4WLEA 1A98A 3VU1A 3ZWYA 5IVPA 1KRWA 2XIJA 2ZREA 3SDZA 4P2GA 1Y3FE 3OIUA 4G8DA 1KQOA 2HWKA 2QV7A 3BWCA 4ZP1A 1Q1AA 2HBRA 2QOEA 1FW8A 2QTZA 3UT6A 3TE6A 2X0DA 3AI7A 2OB1A 4GPEA 3WMXA 1GWNA 2VATA 1YT5A 3KYDB 3KJNA 4HNUA 1Y5IA 1QGZA 2C9CA 1TM4E 3CF6R 3M33A 4XUGB 4IICA 5ALRA 1IOVA 5DX8A 5DW0A 4YAUA 1E1DA 2NLOA 2ZRLA 3CR7A 3JYNA 5FQOA 1JFVA 1P4SA 1U02A 3ETGA 2OA0A 3VU9A 3SFTA 2WKWA 1KKUA 1N75A 1O87A 3MJEA 4OA5A 1RJGA 5LZ2A 3MBIA 3TPZA 3ZGNA 1X7GA 2LGJA 3WZLA 3C16C 4BATA 4XRGA 5KNLA 4W9MC 1DC7A 5EPOA 3F6EX 3QF4B 2WD7A 4JA0A 4YS6A 3FFXA 3DYVA 3OO0A 4EYQA 4DBZA 3E9YA 4KXVA 3S5UA 3N58A 5DSZA 1XVVA 2O2XA 1AE1A 1ZHHA 3E82A 2R7AA 2AOWA 5ALFA 1F2UB 1K9VF 2CZQA 2J6CA 3KSMA 2IOQA 5DLYA 3VO8A 4QBTA 3VPDA 5J2UB 1DXQA 3QKSA 1WV0A 2QUBA 2HXYA 3EY4A 2F2TA 2A0WA 1EWKA 3LQYA 3NJ4A 5JRZA 3P45A 1OBVA 4M89A 4XZ3A 1UXGA 1NJ6A 3P9CA 2W6OA 4WAUA 3U4DA 5JYDA 4IF6A 5HQTA 2IELA 5BV2P 2VT7A 3DZHA 3TS1A 1TKAA 4B3GA 4MZDA 2K2QB 2OAQ1 2COEA 1OFUA 2VJDA 1DMSA 3NHWA 1PQWA 3OZGA 4ZOCA 5E0KB 2VJNA 3RFFA 4AY6A 4LZZA 2YZMA 5G1OA 1R50A 2UVPA 1U5CA 1F0YA 4IF4A 3OEED 2PRJA 3C8UA 1JLMA 3JQPA 1IMOA 5FYDA 3CRQA 1ZCFA 4TWAA 1E58A 5G02A 4AP9A 3TFWA 2ORWA 3J7TA 3WP1B 2LV8A 3CX8A 1W25A 4DAEA 1CR1A 1H8EA 2A0YA 4AN0A 4BP1A 4CG3A 2OGTA 4OHZA 1KZ6A 1WB5A 3AUKA 4LY6A 4EVQA 1T3LA 1U6IA 3W2EA 1A04A 3K7EA 2HF7A 2ZBFA 2B7CA 3EDYA 3M6WA 4UHBA 5KNBH 4WOJA 1GNRA 1QO9A 2CLOB 2QT0A 3EQ2A 3I4LA 4R2MA 5KJEA 3ZJ5A 3M4JA 3BILA 3BZWA 3FETA 3L41A 4WKBA 3R9KA 4QYMA 4EYGA 2VPPA 1ZN2A 2I6GA 2QRHA 4IP0A 4TS1A 3VNRA 4AIIA 2C20A 2CCGA 2FEPA 4M0DA 4MYUA 1M7HA 1XQXA 2M6LA 3NU1A 2Y1GA 4R3NA 1BGVA 3BRSA 1FRZA 2P9JA 1P45A 2XZOA 2M6RA 1KDVA 1VJ5A 3JRNA 1VJ0A 5EE9A 3E9CA 1XPOA 1KJIA 4NX2A 5FI0B 3AHGA 1KKLA 2NT3A 1JZTA 2X77A 1GU7A 4A2QA 3UHOA 3AR8A 3RVPA 2G8LA 1B0AA 3FTPA 2QTVB 2DUNA 5AR1A 4EVRA 4OGFA 1RZRA 1TAGA 4CKEB 1T3SA 4LSGA 3OQIB 4YXWA 3HM9A 1GPAA 4WLOA 1Z9BA 1IY2A 1VI5A 3WJAA 3DNFA 5AW7A 1MJGA 2ZTHA 4US2R 3TM4A 5DYYA 4C0XA 4FGSA 4IHJA 1PG5A 3FRHA 2XDQB 3AUYA 2EWVA 3FPBA 3Q3VA 2DR0A 4PZLA 1JEDA 3WJ1A 2ZUWA 3W8DA 2WSBA 4UMFA 3COVA 1MX1A 3ZLBA 4V24A 5HKOA 3H0EA 5E6RA 2CYAA 5LZ5A 1CZKA 3O4GA 2CE7A 1DUSA 3L8YA 2WJGA 4IIHA 4GKJB 2R68A 2G9VA 2II6A 4MPRA 3VC2A 4BU0A 2ZE8A 1KJ8A 3EZNA 3F5SA 5KSOA 1SPXA 2OCBA 3QTLA 2JASA 5M29A 1J5XA 1DLJA 1QR2A 2WHQA 3TRIA 3O83A 5FPQA 5GAJA 1T9AA 3G8AA 2ZTSA 1SBQA 4B7XA 2VK2A 4UTNA 4D0RA 2GD6A 3L4EA 1A2KC 1RXYA 1RI3A 3F9RA 1G6Q1 4ACBA 4H08A 4ARIA 3AR4A 1GXSA 4J29A 4N4AA 4QGSA 3TLKA 5AVUA 2JBAA 1CU1A 1QWOA 2PA0A 4JC0A 3AF2A 3BXXA 4FOLA 4AP5A 3FFWA 3FZEA 4RPGA 4IKOA 3R41A 3G5TA 4NXMB 3VKUA 4TYWA 2GCIA 3BM5A 4WERA 1Q17A 1WB6A 4B32A 3UK1A 1HE2A 1SKUA 1SN7A 1M1YA 1Q92A 3DC2A 2ZYVX 3GR6A 2AZTA 4CCYA 1VGRA 4F9GA 2ZPAA 4JLBA 3STTA 2G04A 2Y3IA 3OA0A 1YRLA 4DCJA 1JXMA 4M60A 3LUCA 5JNSA 3ZDAA 4BGIA 3K53A 4FUTA 1BFDA 5FF9A 4LF6B 1EKXA 4S0XA 1HXHA 3KXPA 4H0NA 1H2ZA 2RGWA 3UK2A 4ZTZB 4LXIA 5JYBA 5JDCC 1GZDA 2ZBGA 1ATIA 4ALMA 3GRYA 4GGOA 2AG0A 2WU3A 4QYWA 4DMLA 3WA7A 2WWYA 2PO5A 3T1TA 5JDIC 4GVPA 5G0SA 4Z1MA 1M2NA 2EX4A 4I2VA 4QGAA 1L7PA 1RHQA 2VR1A 4QSMA 5EQTA 2ONKA 3S1AA 2OAP1 2NQ8A 3VC3A 4OK6A 3TQRA 2ERYA 5KNDA 3PJDA 4XLZA 2C7PA 2C2BA 3R40A 3C3MA 2WV9A 2PCLA 3EGDA 2Z2JA 3O8LA 5KKCA 2DAPA 3LMKA 3A6DA 4LBWA 3I1IA 5CX4A 1EGVB 1NJ1A 1PGNA 2D00A 2R8EA 4O6VA 4IV5A 3FLBA 2YS6A 4GOJA 5JS2A 2KM1A 2JRCA 4BFLA 4FFDA 2GLTA 3WGQA 4FZ5A 1M5UA 2CUKA 2REXB 3BDIA 4RGBA 2XCTB 3ECSA 3BIJA 2FEKA 5LUBA 3S2IA 1MUUA 3TE7A 1YB6A 3EPPA 5ALLA 1ISSA 3NDRA 4PYIA 4ODIA 4K8RB 1G3IA 4LSZA 3BFXA 5EXEA 1HLFA 3AF1A 1E7QA 3FHOA 4BNIA 3W34A 3DOCA 2WTBA 3K92A 4GM0A 5JG7A 3WNVA 4MQUA 2L18A 3RG8A 2GAOA 4NG4A 1QHHA 4ZAXA 1VDZA 4DVJA 2NZJA 1SUSA 1QP0A 4YGYA 4L8LA 4YJ3F 2A0XA 3U49A 2WTXA 3BRWD 4ALKA 3BAFA 4MEAA 1D07A 2GCEA 4Y2YA 3IUQA 3AF5A 4HOYA 4TKUB 4EGCB 5C80A 3C3WA 4P86A 5LFAA 2ZIZA 2R4TA 2JCBA 3FYCA 3DZBA 3KYIB 2VLBA 3IDZA 3ZIAD 1NVVQ 5KKNB 1OH6A 1I36A 1NW3A 1QP4A 2YN4A 3THYA 1G3MA 1U5BA 4F0JA 3SIPA 3U1TA 3A04A 4DC1A 4JXZA 4UC0A 5LMUB 2W2NA 4XPIA 4MVJE 4MRNA 5BUSA 3KQLA 1OREA 3GJ7A 3M2PA 3RYCB 1M3SA 1MRNA 3K5HA 3EY9A 1YIAA 3L6UA 4KI7A 3W79A 3LYLA 3BQMB 5EYPA 3F97A 3PX7A 2PYIA 4AJIA 4TWBA 2IBSA 1JJAA 3ONWA 3P0FA 4I5GA 4K6FA 2EHJA 3ROQA 4EG0A 1Z5PA 2P8SA 4LJ7A 2A14A 5K0LA 1FFBA 2AVDA 3Q40A 2VDWB 5T4HA 4RAQA 3R6GA 2C92A 1V16B 3C87A 5TGDA 4X62B 1VFPA 2FW8A 4JGBA 4TZKA 4BLVA 2VHVA 3E22B 3KKPA 2VI5A 5K8UA 3R5JA 5LZ9A 1CJCA 1BVRA 2H6EA 3C1TA 3PWTA 4Q7JB 1N2BA 3HBAA 2CUTA 1NF2A 3VZBA 4A73A 5IKEA 2VHXA 4B74A 1N33B 2QJWA 2B37A 2QTHA 3BL8A 4GQIA 3ICEA 1MHTA 3FHTA 4G6ZA 2QRZA 3L6OO 3MCAA 2QNIA 1TLLA 5BWMA 3UJNA 5IT9A 1ZINA 1YJ5A 5F7JA 1MW8X 4FXPA 2H1FA 1IM2A 4UEJA 3G9XA 4RANA 5HOQA 4RTRA 4F60A 2C4HA 3I73A 1EGQA 1J1ZA 4PHFA 3RG2A 3PFKA 4WBNA 2CLKB 4N01A 1H69A 2YIVX 4H7KA 1DJLA 4E5DA 4YCSA 4LJKA 1TK9A 2PKCA 1NQOA 1XMOB 5MFZA 3IDFA 3TXYA 5HF5A 2RHMA 4PYMA 4C0HA 2BMFA 4EELA 4TYQA 3NPMA 4AKSA 5L3QB 1A9YA 5BORA 1QF9A 2GZRA 2QTTA 2ZSDA 4WASA 1VSTA 2YWXA 3VKGA 2N3ZA 3X1ZA 5C1BA 3ROEA 1TT5B 3HWX1 4QPNA 1L7NA 1Y5LA 4JITA 1TECE 3B9RA 1T0UA 1GKYA 1XXHB 2FP4B 2C8JA 1I1QB 2QA5A 2MDTA 2VO1A 3QF7A 4PPYA 3TQFA 4AG3A 1IU9A 4PW0A 3I1JA 1QTQA 5B7PA 3RVNA 4N3BA 4XUDA 3L4BC 1QH9A 5G0WA 3O75A 3OLQA 2R87A 4PQFA 1FX0A 1FSSA 1J23A 3EDCA 4K05A 3PJFA 4JROA 1NP6A 4P4NA 4N1AA 1ETHA 3WYDA 1IB6A 1Y4AE 2GARA 2VYCA 1PWYE 4MIEA 1AY0A 3B9PA 5AK6A 1JA1A 4G0WA 3OOHA 2XX3A 4B4UA 1YC2A 1WY5A 2HSWA 2KSQA 4N8DA 3UJ6A 3N2ZB 2H7CA 4L73A 3DOFA 3KAPA 2QUZA 1ZOLA 3M9WA 4Q4AB 4XYMA 9ATCA 1JQLB 3DJYA 3TSYA 4PF1A 4DLAA 1Z29A 5A4IS 5F7ZA 3HYRA 4GWGA 3E53A 5CDGA 5JZ9A 1JQEA 5ALSA 2ZAIA 5HZGA 1H0SA 3ZLJA 1AGNA 1EUCA 5CLIA 4YEDA 1JQBA 2GO1A 1MEJA 4EY5A 2AEJA 2HREA 3MS4A 4FBMA 4GX2A 1YFZA 4LYAA 2UKDA 4URHA 5DYGA 5H82A 4X1IA 2O8CB 5E1BA 3UYLA 3IBFA 2V7QA 4WV3A 3GH3A 3JAKA 2C8KA 4Y2RA 1NF8A 3OJWA 3ITNA 1NR7A 4QYXA 3FFBA 3GT4A 5EY5B 1YVEI 2AS0A 3DUFB 3O3OB 1SVLA 1S01A