4QE7A

Open mthk pore structure soaked in 10 mm ba2+/100 mm na+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
PATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ionic interactions of Ba2+ blockades in the MthK K+ channel
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
molecule keywords Calcium-gated potassium channel MthK
total genus 32
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qe7A00
5EC2C 5EBMC 3E8GA 1P7BA 2WLLB 4PA6A 5EC1C 3SYCA 1QLEC 3OR7C 1R3JC 3ABLC 4X8AA 4LP8A 3SJQC 4MVZA 4MW3A 2DYSC 4H33A 2HFEC 3AG4C 3TETA 2DWDC 2ZXWC 2K1EA 4GX2A 3UKMA 3HPLC 4RAIA 4X89A 3UM7A 4F4LA 4R8CA 4DXWA 1S5HC 2Q69A 5KUMA 3K0DA 3AG1C 4G27B 3OGCC 3LDEA 3F7YC 3RVZA 4GX0A 3SYPA 2YEVA 3R65A 4H37A 3T2MA 5CBFA 4HYOA 1R3LC 1JVMA 3E8HA 3K04A 3SYOA 2Q67A 3AG3C 4G28B 3T4DA 1G4YB 2KB1A 2QTOA 4PA4A 4MW8A 1BL8A 5B3SC 2BOBC 4I9WA 3SYQA 4WFHA 3X2QC 3TCUA 2EIJC 3LDDA 4OXSA 2DYRC 2AHYA 2HJFC 5E1AC 3VOUA 2A0LA 3OR6C 3OUFA 4MTGA 1ZWIC 2OCCC 4P2ZA 2HVJC 4R6ZA 4X88A 3RVYA 1LNQA 1KKDA 5KUKA 4PDRA 4R50A 2EIMC 3E89A 4P9OA 2NLJC 3FB7C 3LUTB 4MVOA 5EK0A 1ORQC 3RBZA 3PJSK 1OCCC 4P30A 2IH1C 5EBWC 3T1CA 3E83A 3ABKC 3SPGA 4PDLA 3SPJA 2Q68A 1M57C 2WLIB 2ITDC 2R9RB 4LCUC 3LDCA 2ATKC 4GX5A 4MTFA 4R7CA 3JYCA 3F7VC 1K4DC 3LNMB 3E8BA 1OCRC 1K4CC 3GB7C 4MVMA 3ZRSA 5CBGA 3E8FA 4JTAB 2X6CA 1J95A 4MVRA 2DWEC 2HVKC 3ABMC 2EIKC 2WLJA 3ASOC 3SPHA 4J9YB 3EFFK 4PDVA 2WLKA 3ASNC 5CBHA 1V54C 3STLC 4PDMA 1XL6A 1V55C 5J9PC 5B1AC 5B1BC 5EBLC 4MVSA 2HG5C 2EINC 1XL4A 2Y69C 3OUSA 4WFEA 4XDJA 4XDKA 2X6BA 4LBEC 3K08A 4GX1A 1OCOC 3SYAA 5BZBA 3FB6C 2H8PC 2ITCC 3IFXA 3RW0A 3FB8C 3STZC 1R3KC 2W0FC 2A79B 2ZD9A 3F5WC 2WLNA 2WLMA 4MVQA 3SPCA 1M56C 2EILC 3AG2C 4PA9A 4RUEA 4ZBMA 3FB5C 3IGAC 4QE7A 2JK5C 4QNHB 4JTCB 3K03A 4UUJC 3T4ZA 4CBCA 2P7TC 4JTDB 4TWKA 4J9ZB 3K06A 4MTOA 3ZJZA 4BW5A 4WFFA 2IH3C 1OCZC 4MSWC 4MVUA 1R3IC 2A9HA 3K0GA 4P9PA 4QE9A 2Q6AA 4RUFA 3KG2A 4RO2A 3SPIA 4KFMA 5IY5C 4EKWA 2QKSA 4PA3A 2WLHA 3BEHA 2WLLA 4HZ3A 2AHZA 3WG7C 2WLIA 4PA7A 4WFGA 4MS2A 2BOCC 2X6AA 4XDLA 3E86A
chains in the Genus database with same CATH superfamily
4FZ1A 3VQVA 2XTAA 3RYFB 5DM6V 1SC5B 4JI1O 3UO2A 5KX5B 3TETA 1EN5A 2MK3A 3I5DA 3ZHSA 4WBNA 1Y76A 4LF5B 3AG1C 3H1HH 3E8HA 5EIBC 3FAVB 3HKEA 3MD0A 2HEPA 2Q67A 3BY6A 4JI0O 1HP8A 2F95B 2BOBC 4I9WA 3SYQA 1WB7A 1MABG 3C3TA 2A0LA 3OR6C 1ZWIC 3VQWA 4LF7B 2ZDIA 3D3IA 1ZLZA 3FB7C 1EZVH 3T1CA 5IY5B 3ZHQA 5LOVB 1RM1B 2X7RB 2Y4UA 1YF2A 4PDLA 3SPJA 4YY3O 3RYCA 2JVDA 2XAJA 4GT1A 4I55B 2BE3A 1Q82W 4LH7A 4FVMA 3M99B 1K73W 1KP2A 4L87A 2IBZH 4I5SA 1QU7A 4JI1B 1K97A 1XMQB 2LW7A 1PL4A 5JJEB 3OD4A 2R72A 4U7NA 1HNXB 3QVNA 4X64O 1R73A 3P3NA 1F23A 1I5YA 5B1BC 1FXVA 4MVSA 3K9AA 5KHIA 1JCHA 3B40A 2QWOB 3FB6C 4L8JA 4J10A 5K1XA 3O65A 1OCOB 3A0HZ 1SQGA 2QA4V 4YIOA 4RUEA 3ASOB 4C7UA 2BSKB 4W4LA 1BHAA 4AHCA 2DYSB 3GVMA 1FFTB 3CRMA 3OTOO 1SS3A 2UUBB 2VQEB 5L3CA 3U0ZA 4WFGA 1YTFD 4CH6A 1V55B 1F4MA 3E35A 3JAMN 3BAAA 3LSQA 1EBOA 4QPKA 3K5LA 1YJNV 3JSLA 4F6EA 3K5MA 4X89A 3J81N 3K0DA 4DV3O 4G27B 3PN1A 3JARA 2HHHO 1NR7A 3HKDA 3QO5A 2IM9A 3JAKA 5KHHA 1MA1A 2DYRB 3AG3C 1XI1A 3IAYA 4DYLA 3X2QC 1BE3H 5CA1A 4UB6Z 2FKXA 3CYOA 4JAAA 1MSWD 4U3JA 1THZA 4J7KA 4FM1A 2PUSA 4WBNB 1SESA 2RN9A 1B06A 2Y69B 4K8ZA 4LR3A 4LNUB 2B9ZA 2ZE6A 1N34O 3K58A 1PNKA 3J7AU 1Q5OA 2KQXA 1GK9A 4KL1A 1SA0A 4KXRA 4JYAO 1GM8A 2X6CA 4CH5A 4I50A 4UFZA 3H1KH 2WA3A 4DV0B 1DLBA 2Y0PA 3L71H 1Z5VA 2ITCC 3WG7B 1L0LH 2PGGA 4YJ3A 4LFBO 4CC5A 4JTCB 4O2AA 5BMVA 1TUBB 4DV2O 4QE9A 5LXTB 5H5NA 2PTMA 4DUZO 3THOA 2PI4A 4UXNA 5LHHA 5AG2A 4TOIA 5L3GA 2JEUA 2WLLB 4JF3A 3K5NA 3K9SA 3ZN1A 3APOA 4H0LB 2QEXV 1AVMA 2CTQA 1VARA 1OCRB 2ZE8A 2WAMA 1S5HC 4O4HA 4A5UB 3SYPA 3LDEA 2GBOA 2XASA 2NNUA 1CXZB 3R65A 5J2TB 2UXDO 3A8TA 1JFFA 3B77A 1SERA 2KG7A 3CXCU 2ZE7A 4DR5B 3AK2A 4X20B 4X1KA 4GYCB 2F4VO 5CA1B 4X88A 1VQMV 1NR1A 1W59A 4FM0A 3A0BZ 5L3BA 4LF4O 3HKCB 3ABKC 4FZ0A 2Q68A 4J41A 2ITDC 1GN6A 3LDCA 4MTFA 5LP6B 1DK1A 1FXHA 2JJ1G 2KSDA 1Q86W 5FLXN 5LMUB 1H8EG 4UCVA 1Q6IA 3D36C 5B66Z 1Q81W 1R6NA 3QF7A 3STLC 4PELA 4JZ2A 1DF4A 1YVWA 1YI2V 4JI4O 2EINC 3OUSA 4LFAB 5KA5A 3K08A 2XUMA 1VIBA 1BT8A 2F66C 4JV5O 5LMNO 1B3QA 1WA8B 1K7DA 4X1KB 4K0KB 2F1MA 4H44B 4IT5A 1GM7A 3MDSA 2LW1A 1XMOO 2OT5A 2QWPB 4FK5C 4DR3B 4ZIBA 1SQXH 4P9PA 1D2DA 2BTOA 3FKSG 3OE7G 2HR3A 5LXTA 3WG7C 1QLEB 4GLXA 1SQVH 1YCIA 1MG1A 2XT9A 5IYZB 4YHHB 4LWSB 1A32A 5L3EA 2QM8A 1OJHA 1XDCA 3SGIA 1SETA 2RMKB 1FFXA 1N36B 1VQ7V 2QM7A 3E22A 4GUNA 5CBFA 3CMEV 1US6A 2KG7B 2E76B 2RNBA 4J11A 1G4YB 4MW8A 3KCYA 2QR4A 1SF9A 1AJQA 1MMMA 1L0NH 3BHPA 3NXSA 1IZ3A 1PPJH 2YC0A 4DRXA 5A2QN 2YICA 4B3TO 1AR4A 2EIMB 3E83A 1DF5A 5GTHZ 4JI8B 1JR9A 3P30A 1VQLV 2LFRA 1YIJV 1P7GA 1HNZB 5JQGB 4I9QA 1H2MA 2DMXA 1VQKV 2EZPA 1GAXA 3LSUA 1Q6UA 2NN4A 4YJ2B 5JCOA 5L3DA 1HW7A 1DTOA 2ZR2A 4FLTA 3CS5A 1KQSU 1IURA 3GWOA 1NI8A 2UXNA 3DC6A 1IBLO 1EN6A 3M8AA 5B1OA 5IDJA 2Q7EA 2FMLA 1FXKC 2UU9B 1SQFA 1QCEA 3W7SA 5GONB 3SPCA 1K92A 3CCUV 1YDXA 4NTYA 2VS0A 3T4ZA 5J2UB 4TWKA 3K06A 4MTOA 3CC7V 2R70A 4MVUA 1BGYH 3ICXA 1XUQA 2QE7G 4LNUA 3HKDB 3DC5A 4HZ3A 3N2GA 4MTXA 1WA8A 2QWRB 1VF5B 4UCOA 3B2EE 3WU2Z 1MNGA 4MW3A 1QLNA 1D5NA 1KECA 3HKBA 4LC1A 5EZYB 2Q73A 3RFRA 4RAIA 4HNAB 3G4SV 2Q69A 1K33A 3I56V 4BIUA 1IBKB 4DUYO 4GX0A 3OMIB 2YIBD 3ZRWB 3JCUZ 3K04A 3ML0A 2P22C 5CN0A 1NVPD 1N32B 4WCEV 1M90W 3JAKB 2EIJC 2DYRC 4U3FH 3CRRA 4JI5O 1JA8A 5KUKA 2ZIOA 1Q8IA 2ZM6O 4E2LA 4BIZA 1ORQC 3RBZA 1H2KA 2PI5A 2EX3A 4DV0O 1SRYA 5C93A 3MAQA 5IWAB 2ATKC 3MHHC 3G80A 3JYCA 2D2CB 4LF5O 3E2EA 2XNDG 1R6TA 1J95A 2DQ0A 2F23A 3ABMC 4O4IB 1XMOB 5BMVB 4XBFA 2UXCB 2AW9A 1PNLA 4NXNO 4UCRA 2GTSA 2Q7HA 4XDJA 3P3PA 1NH2B 4JI2B 4EFEA 5IJ9B 2JGDB 1AJNA 1M57B 5HFLA 1YXBA 1M56C 2V4DA 3AG2C 3IGAC 2KKWA 1X59A 3KKYA 5BR8O 2H94A 5CA0B 3CCRV 4IIJB 3W7TA 4O2AB 2BTQB 1L8DA 2YIBA 2Z3YA 2P4KA 2WLLA 1V54B 4O2BB 4CZZA 2GSMB 1Z5WA 2HHHB 5EYPA 5EC1C 2YUAA 5KX5A 3L73H 1QLEC 2GHYA 1ZSPA 4FLUA 4NYKA 2HFEC 3UKMA 3R66A 3U10A 4X9QA 1WN7A 3OGCC 5BY1A 2YEVA 3L75H 1IXBA 1PV0A 3K59A 1K9MW 2ODMA 1AI4A 4UCSA 1JQ0A 3A2FA 3H9VA 4DR1B 1IBLB 1AILA 3JALB 2H3OA 2ZDIC 3CEIA 1KP3A 4CH3A 2N05A 4DW1A 4E4EA 4TQDA 3JASA 2LFSA 4IIJA 1NJIW 1EN4A 2ADPA 3AG3B 2JIZG 4DR4B 4J7JA 4DR4O 2YXLA 2LO1A 3FD9A 4O4JB 4QIWF 5H6QA 3NR7A 4BWAA 1TA8A 1BSMA 2B5UA 3TK1A 1KU9A 3ABKB 4FLWA 4JGSA 1K4DC 3E8BA 3IJ4A 3E8FA 2HJDA 3CCSV 2IJJA 1YJWV 1IBMO 3EFFK 5BR8B 3TXQA 2VWKA 1QHTA 1V9PA 3EHBB 4FFKA 5B1AC 1GO3F 1XL4A 1Y74B 3RYIB 1YITV 2WLMA 3GWKC 2CE4A 3AG1B 3H01A 2QGNA 2UXCO 2P7TC 4JTDB 3T1YO 4DV4B 1R3IC 3K0GA 3L74H 5KHGA 5F2VO 2RDCA 4CS3A 5EYPB 1B6QA 1TVKA 4LF6B 1N34B 3K5OA 3DXRA 4DV6B 2HP8A 3ABLC 3SJQC 2LP7A 4MVZA 3AG4C 1W0KG 4DR7B 2P4VA 5CA0A 1K8AW 2O57A 4DV1O 5KAIZ 3ABMB 3RVZA 1YHQV 4B3RO 2E5LB 1H2LA 1FPOA 3B8MA 1KBHA 1BL8A 3U11A 4Q6GA 5DECA 5IJ9A 4DV3B 4JYCA 2AZ2A 4J80A 4P2ZA 3QO8A 3RYFA 1Q43A 5IWAO 1M56B 1Q6HA 2MW2B 4LF6O 3MHSC 1XNRB 3PJSK 2V7QG 2IH1C 1OHHG 4CS4A 2WA4A 1BS3A 3K57A 4W4KA 3BFRA 3D3QA 1I5XA 3VBBA 1JFFB 3ZRSA 5CBGA 3ZRXA 3O9OA 1KC8W 1KKCA 3CE2A 1QR9A 5LHGA 3J80N 2EILB 4J9YB 4O4HB 1ZTEA 2X0LA 3HR0A 4LFCB 5IYCO 5D5QA 3EXAA 4Z1VA 2PYLA 5B3SC 5LA6A 1FKAO 2VWJA 4CH4A 4GZRB 1HNWB 1Y6XA 1NKDA 1F7YA 3STZC 1R3KC 2UUAO 2Q5ZA 4D6TH 1Y74A 3H1IH 3RYIA 2YIDA 1UJWB 1N33B 3CJHB 1NQTA 3AG2B 4DRXB 1TUEB 1WPBA 1TVKB 2QWQB 1SZTA 4NTWA 3B09A 2XHBA 1GN4A 4RQFA 2EIJB 1H38A 3ZX6A 3TXSA 1N0JA 4PA6A 4H33A 4I0XB 2QTSA 4LF8B 5KHJA 4GX2A 5J2UA 1P49A 4DXWA 3D8CA 2QKCA 5FPOA 1HNWO 3HKBB 3ZBHA 2R9AA 1DGSA 4HYOA 3FFQA 3CC2V 2R9IA 4I4TA 2PY5A 4BW9A 2ZKOA 1IDSA 4IHJB 5B3SB 2EULA 4OXSA 4D7TA 1W2BU 1NTMH 5C8YA 4N21A 1VQNV 3CHXA 2XAFA 1B04A 4P9OA 1N4CA 5D5PA 5KAFZ 1AI7A 1CEZA 3FYEB 1N0NA 2OCHA 4P30A 5EBWC 3ZHTA 1FYJA 1PKXA 5JH7A 1M57C 4KHPB 3HB3B 4UCUA 1WB8A 3SR2C 1S77D 4QGPA 4I4TB 1RP3B 3F7VC 3G6BA 3SJCC 1JOYA 3ZMUA 1FS0G 1Y67A 3EVKA 5CBHA 1V54C 5LA6B 2BTQA 4TQFA 2V1DA 3BA8A 3B8NA 4TV8A 1M9NA 4GX1A 1LR1A 1FJGB 1VQOV 2EILC 4WFAV 5JJNB 4JI6B 4YHHO 4CBCA 1U97A 3JASB 1PM9A 3QTCA 4WFFA 1ZL8A 3BPZA 2OTLV 2CGOA 1QQCA 3HKEB 4MSWC 2UXBO 4JYBA 4UVCA 3UO3A 2YI8A 3BEHA 1GTOA 1VQ9V 4PA7A 4XDLA 2RJZA 1VMGA 4HAMA 3SYCA 4AQYO 4DR6B 3OR7C 4K0KO 5H9CA 2GUZB 4LWSA 3OTOB 5KHKA 1Y4MA 3ASNB 1VQ5V 5GONA 4LF9B 4B08A 4ZI7B 1J5EO 2ETNA 1OZ0A 4GKKB 1SKVA 3L70H 2F4VB 3JAWB 2AGAA 5JWPA 1JVMA 4NVPA 4JAVA 1FD9A 5CB4B 5IYZA 2YS8A 4OPAA 2Z5UA 5CMUA 1BQ0A 4UVAA 4O4LB 2JGDA 3OUFA 2HVJC 1T5EA 4R6ZA 1WLEA 3ZS8C 5IT9N 2UUAB 3TGUH 4ZOLB 1SQQH 3OEHG 5LHIA 2LGQA 3APQA 4UV8A 1ROPA 1BHBA 2GDSA 1IXMA 3SPGA 1PNMA 1LUWA 2ZINA 3G6EV 3CPWU 3ETGA 5EIBD 1X4TA 3OT7A 3Q4HA 5C8YB 4JTAB 2DWEC 4FLVA 1PD3A 1MSDA 3SPHA 1RM1C 3ASNC 3OFNG 4BIOA 2W6JG 1XHXA 4XDKA 3ABLB 3C90A 3S3WA 1H2SB 2W0FC 4PJ0Z 1JPXA 3L9DA 2ZD9A 2CTPA 4MVQA 1R1BA 3WB0A 2QKAA 3FB5C 4Q20A 3K03A 3CP1A 1UFIA 5E79Z 2IH3C 2ZIMA 2DN9A 1GN3A 3HKCA 4DUZB 2JDIG 2AHZA 1ENVA 2F93B 3KZIZ 4GKJB 4B3MO 4U3JB 3RYHB 2DYSC 2ZXWC 1J5EB 4JI7O 1KD1W 3SYOA 5DEDA 5ITZB 2ILMA 3FAVA 2ARHA 5K1PA 5IJ0A 2B1IA 3Q4HB 5LGTA 1OCZB 3SDLA 3ETDA 2DJVA 2NLJC 1WP8A 4MVOA 4PI2A 3ZMZA 1IX9A 3LSSA 4I55A 1P4RA 2VRZA 4DR3O 4NXMO 5CB4A 4DO2A 2EZOA 3AK1A 4FLYA 2P90A 2DOSA 2UUBO 2QJ1A 2NR5A 2QSAA 2LGWA 4NB5A 1H2NA 5LGNA 4DR2B 4JV5B 4OGQB 1UPGA 3ZIAG 3JATB 4B3SB 2CGNA 3H1JH 1QVFU 3OGIB 1GH6A 1YJ9V 4ABMA 1XEQA 4RQEA 5JJJB 3F5WC 5LMUO 3CD6V 4DV7B 4PA9A 4X1IB 5B1NA 3JD0A 2CUGA 2Y4TA 5IE9A 3ZRWA 3T1YB 1OCZC 5JVDB 1I94B 5JCOC 4O2BA 3JARB 3KG2A 2FYUH 4LF4B 4F6RA 3JATA 3ZEDA 3IC9A 5ITZA 3E86A 2UUCB 4JI3O 3ABTA 3OEEG 4DR5O 2CTRA 1FXKB 2VQFB 2DWDC 2K1EA 4YIPA 1LUVA 1M1KW 2A06H 4AILC 3F7YC 5LYJA 2B1GA 1R3LC 1HNXO 4TV9B 3K79A 1U96A 4IHJA 3ABUA 2KB1A 4PA4A 4JYYA 4FPPA 4K35A 2OWOA 1HDJA 5BXZA 2N04A 1JJOA 4BAYA 1VQ4V 1LNQA 4PDRA 1VQ8V 4WFBV 3CCEV 2JS3A 2EIKB 2YEVB 4B3SO 3BRCA 5IYBO 5FNVB 2IW5A 4LCUC 4R7CA 4DV1B 1JX9A 1XNQO 3CSXA 1QNMA 1G1XB 1M93A 2ZT9B 3F5TA 1PP9H 5EZYA 1K5QA 4JI3B 3FX7A 4DV6O 1GMGA 2IU3A 1V55C 5J9PC 2JJ2G 3G71V 4DV5B 2M7WA 2ZR3A 3AG7A 2Y69C 4UV9A 5BZBA 1OCOC 2PYJA 2H8PC 1SZXA 1I94O 1WNSA 2Z0AA 4AI8A 3BA9A 4JAUA 1P84F 4QPJA 3CCMV 3TJTA 3W7XA 1XNRO 4J9ZB 1S5LZ 4F6RB 3N2GB 3QNEA 3ZMSA 1EFRG 3BCCH 3ZHUA 1RPRA 3WB2A 3DTUB 4J42A 3LNNA 3G67A 3ZN0A 1URFA 1P7BA 4DUYB 4H13B 3WB1A 4X8AA 1AP5A 4B3MB 2YDEA 4GCZA 5TISZ 3OAAG 4ZHQB 4NXNB 1Z2GA 1Q7YW 3UM7A 4Z2WA 1N8RW 3CB2A 5LMNB 4EFBA 1AB3A 3OM3B 3M7MX 4LFAO 1QR8A 2IU0A 4TSFG 2AXTZ 4CS2A 3W7UA 2CK3G 1XHZA 2GUZA 4X1IA 3BABA 1KKDA 4IGGA 2FTKA 4O4LA 1GM9A 4DV4O 5B1AB 4ZHQA 1BCCH 1KYOF 3RYCB 2VQEO 4DR1O 3CC4V 3E22B 4ZOLA 1R6KA 2WLIB 2R9RB 1S0VA 3BVOA 4GX5A 1NH2D 1NS1A 5KMGB 2Q4PA 5HFMA 3LNMB 2Q8VA 2YXHA 4D7SA 1RSOB 3B4SA 3I55V 1SQPH 2HVKC 1QBZA 2RCVA 1YEWA 1JJ2U 1PL0A 1NT2B 2UU9O 1KMIZ 4GKJO 4PHZA 4PDMA 1XL6A 3JAWA 4X64B 1AI6A 1NTZH 4DK0A 3OTFA 3SYAA 1YTFB 3CRAA 4FIPC 3RW0A 2OCCB 3RT3C 4EEQA 1VQ6V 4DV7O 2XAQA 3SJBC 3UCSC 4QNHB 4UUJC 1K5SA 2VQFO 3CWBH 4MT8A 4JI2O 3SPIA 1GRJA 1ZUQA 1FAFA 4JI8O 1K34A 4PA3A 1XQ8A 1MOFA 3L72H 2PF4E 1HR0B 4MS2A 3ETEA 3K3WA 2X6AA 5EC2C 2JGUA 5EBMC 3UT5B 1E79G 1O9GA 3ZMVA 3N27A 3OMAB 4LP8A 3VQXA 4LFBB 3X2QB 1N36O 2A7WA 2WSSG 3ETQA 3RYHA 1BZKA 2P5OA 4I0XA 5LOVA 1IVSA 3CCLV 4ASUG 4PV1B 4H37A 2IJHA 4PD4F 5LP6C 1VF6A 1CP9A 2GTAA 2Q0OC 2QDOA 3LDDA 1VQPV 2AHYA 3VOUA 4TT3G 3JSNA 4JI5B 2EBOA 5B5EZ 2OTJV 1FXKA 4JI7B 2Q9LA 5EK0A 4X66B 1YZBA 2JEXA 2ZCEA 2CH7A 4JI4B 2JS5A 3JD2A 1CPYA 5B1BB 2Y0IA 4GKKO 2UXXA 1IBKO 2C2AA 2Q0AA 4YJ3B 4X62B 4LF9O 5LL6Y 2G38A 4MVRA 1BQZA 5KMGA 1HWYA 3RGBA 4DR6O 4YJ2A 4HBNA 1AI5A 1I0HA 1RPOA 4N23A 5J2TA 4NXMB 2Q7GA 4LBEC 2CAZC 3CCJV 1NBMG 1S3JA 2L35A 3UT5A 1L1FA 1AR5A 2WLNA 4QJFB 4U7OA 1M5IA 3CCVV 4QE7A 2QM4A 3RWRD 5JVDA 4JPRA 4UB8Z 2EJ7A 2W0XA 3W7WA 4FJCC 1AR1B 2ZM6B 2D3OW 4TUYB 4RUFA 2K9PA 3QG5A 4KFMA 2QKSA 2WLHA 4K3AA 2UXDB 2Y48A 4DK1A 1HR0O 2YXYA 3E8GA 1EZJA 3N2KA 4Z1MG 2FL4A 1SA0B 3D36A 4UVBA 3CRCA 1NZ6A 5LYJB 4F4LA 1TUBA 4R8CA 5KUMA 3T1HB 2FB5A 1S5JA 2HKOA 3OW2U 1VP7A 3DSQA 3JD3A 2YIAA 3AEIA 4CC6A 3T4DA 2QTOA 4BR6A 4WFHA 3TCUA 2XAHA 3H1LH 4OX9O 2HJFC 1VF6C 4NR1A 5FL7G 2OCCC 2P06A 3JD1A 2W6IG 4KP4A 3RVYA 4I50B 2EIMC 4ZI7A 4K8XA 1WP7A 4FLZA 1VEWA 2XAGA 3DGEA 1FFXB 4TV8B 1YSCA 4LFCO 1I08A 3VQYA 5LP6A 2RQ6A 5IYDO 1BMFG 4RWUA 2ZNIA 1XBLA 2EJRA 4FM2A 1NVPB 3ZMTA 4B7KA 5CA3A 2CH7B 3KCXA 3AK3A 4G2KA 2F43G 5GW7A 4O4IA 1Q90D 1OCRC 3GB7C 4MVMA 4LF7O 2YSUB 1ZL8B 2E75B 4IYHA 4LH6A 1VF7A 4PDVA 4JI0B 2UXBB 1K3EA 3CRQA 5KA6A 3T1HO 2HLDG 1HNZO 4DW0A 2BSKA 2P6JA 4ZBMA 1N33O 2ADQB 4B3TB 4I7ZB 2Q6AA 4EKWA 3N2KB 1WAZA 2WLIA 2XOKG 5IY5C 4IYIA 1NU1H 3CXHF 3QO7A 1R3JC 3OMNB 1W0JG 3HPLC 1E1QG 1TAEA 1FJGO 4FLXA 4O4JA 3JALA 1SQBH 1AROP 2WWWA 5H6RA 4DV5O 1H8HG 4MTGA 4JI6O 4FMTA 4R50A 2YI9A 3E89A 5LBQA 4NKGB 2BCCH 1WJZA 5FPRA 4KUMA 3UQ8A 1QVGU 4KHPO 4LF8O 2OIEA 3ZHRA 2QWNB 3CCQV 2EINB 4B7EA 2DE0X 5L3FA 1K4CC 3JCZA 1COWG 1GN2A 1ZAUA 4ICGA 1ZX3A 1Y76B 2WLKA 4EB6B 2OYQA 2GV9A 2X6BA 3IFXA 3FB8C 1XREA 4WF9V 2A79B 1E1RG 1GKFA 3ZCCA 1RSOA 4J7ZA 3ZRVA 1G8MA 1H2GA 1TGOA 1OCCB 2ZE5A 4HNAA 2AZ0A 4X65B 2CTWA 2E74B 4X1YB 3RN4A 1KUQA 2PZSA 4ZKIA 1S76D 2IJKA 2ZQMA 5IJ0B 3ZJZA 2UUCO 2BOCC 4OPHA 4X65O 2JRIA 2CDYA 3CX5F 4OX9B 3DXRB 5KLVH 1XMQO 4JASA 2N74A 4YXWG 3T2MA 5JH7B 1D5AA 4JZGA 2DQ3A 3FYIB 4G28B 1MZEA 3A0RA 1S72V 1WPXA 1OV9A 5FNVA 4TV9A 3WFVA 1KB9F 4FFBB 5E1AC 1G6UA 3SJAC 3ZHVA 4YY3B 4IL6Z 1XILA 1RFYA 1O9HA 1Q3EA 1JMKC 2OIGA 4DV2B 2ZNJA 4DR2O 3LUTB 1F51A 2E3CA 3CMAV 3P32A 1OCCC 4AQYB 1XOUA 2WPDG 1NTKH 3S3XA 4NTXA 1AP6A 2A3QA 1F4NA 3C3SA 1MZFA 2IJIA 2LJ2A 3JD4A 3IC7A 4X20A 4UCTA 4PI0A 1I7FA 4FFBA 5H2FZ 2EIKC 2DW4A 2WLJA 3ASOC 5LGUA 5GTIZ 1Y66A 1EM1A 2M6YA 4TUYA 5DN6G 5A9GA 5EBLC 2HG5C 4JYAB 4WFEA 4EB6A 2P67A 3AG4B 1AJPA 2ZXWB 4X62O 3CJHA 2LQTA 5JQGA 2JK5C 1N32O 4X1YA 1M4UA 4DR7O 4BW5A 2A9HA 4X66O 4RO2A 1XNQB 2L6LA 2E5LO 4B3RB 1IBMB
chains in the Genus database with same CATH topology
5EC2C 5EBMC 1E79G 3ZMVA 4HAMA 3SYCA 3OR7C 3OMAB 4LP8A 5H9CA 4MW3A 5DM6V 1QLNA 3X2QB 1Y4MA 3ASNB 3TETA 1VQ5V 1KECA 2WSSG 4LC1A 3G4SV 2MK3A 4RAIA 2Q69A 1K33A 1OZ0A 4BIUA 3I56V 3AG1C 3CCLV 4ASUG 4GX0A 4H37A 2IJHA 3OMIB 3ZRWB 1JVMA 3E8HA 3K04A 3MD0A 2Q67A 4JAVA 3BY6A 3ML0A 1CP9A 5CN0A 1NVPD 4WCEV 1M90W 2BOBC 4I9WA 3SYQA 2EIJC 3LDDA 1MABG 2DYRC 2Z5UA 2AHYA 1VQPV 5CMUA 4UVAA 3VOUA 2A0LA 4TT3G 3OR6C 3OUFA 1ZWIC 2HVJC 4R6ZA 1WLEA 5KUKA 2EBOA 2ZDIA 2OTJV 3D3IA 3FB7C 4E2LA 1FXKA 4BIZA 5EK0A 1ORQC 3RBZA 3OEHG 5LHIA 3T1CA 4UV8A 5IY5B 1ROPA 1RM1B 2X7RB 1BHBA 1IXMA 2JEXA 3SPGA 4PDLA 3SPJA 2PI5A 1PNMA 1SRYA 3G6EV 5C93A 3CPWU 2XAJA 4GT1A 3JD2A 1CPYA 3ETGA 5B1BB 2ATKC 3MHHC 3JYCA 2UXXA 3E2EA 2C2AA 2XNDG 1Q82W 4JTAB 1J95A 2DQ0A 4MVRA 2DWEC 3M99B 1K73W 1KP2A 3ABMC 4L87A 4I5SA 1PD3A 1HWYA 1K97A 3SPHA 1RM1C 4XBFA 3ASNC 3OFNG 1PNLA 1AI5A 1RPOA 4U7NA 1R73A 1F23A 1I5YA 4N23A 2W6JG 5B1BC 1FXVA 4MVSA 3K9AA 4XDJA 4XDKA 4LBEC 1JCHA 3ABLB 3FB6C 3CCJV 1NBMG 1S3JA 1NH2B 1L1FA 2W0FC 1JPXA 2ZD9A 2WLNA 4QJFB 1AJNA 1M57B 1OCOB 4MVQA 5HFLA 2QA4V 4U7OA 1M56C 3ASOB 3AG2C 4RUEA 3FB5C 3IGAC 3CCVV 4QE7A 4Q20A 3K03A 3CP1A 4JPRA 2H94A 3CCRV 1BHAA 2DYSB 1FFTB 3W7TA 2IH3C 3W7WA 4FJCC 1AR1B 2D3OW 4RUFA 4KFMA 2QKSA 2Z3YA 2WLHA 2JDIG 5L3CA 2WLLA 2AHZA 1V54B 4WFGA 1ENVA 1YTFD 4CZZA 2GSMB 2Y48A 1V55B 1F4MA 3E8GA 1EZJA 4Z1MG 3E35A 5EC1C 3LSQA 1QLEC 2GHYA 1EBOA 3D36A 4QPKA 4UVBA 2DYSC 1YJNV 2HFEC 2ZXWC 3UKMA 4X89A 4F4LA 4R8CA 5KUMA 2HKOA 3OW2U 3K0DA 4G27B 3OGCC 3JD3A 3AEIA 2YEVA 1NR7A 1KD1W 3QO5A 3SYOA 3AG3C 2DYRB 3T4DA 2QTOA 1K9MW 1AI4A 1JQ0A 3X2QC 4WFHA 3TCUA 2XAHA 2B1IA 3CYOA 2HJFC 5FL7G 2ZDIC 5LGTA 2OCCC 1KP3A 3JD1A 1OCZB 2W6IG 4KP4A 3RVYA 1MSWD 1THZA 2EIMC 3ETDA 1SESA 2NLJC 2LFSA 1NJIW 2XAGA 3DGEA 2Y69B 4MVOA 3AG3B 3ZMZA 2JIZG 1YSCA 4QIWF 5H6QA 3LSSA 1P4RA 5IYDO 1BMFG 1PNKA 2B5UA 3TK1A 2EJRA 1NVPB 4DO2A 3ZMTA 3ABKB 5CA3A 2EZOA 4G2KA 1GK9A 2F43G 1K4DC 2P90A 4JGSA 3E8BA 5GW7A 1OCRC 3GB7C 4MVMA 1GM8A 3E8FA 2X6CA 3CCSV 2IJJA 1YJWV 2YSUB 5LGNA 3EFFK 3ZIAG 4PDVA 3EHBB 1K3EA 5B1AC 5KA6A 1DLBA 1GO3F 1XL4A 1QVFU 2HLDG 2ITCC 1YJ9V 4RQEA 3WG7B 3F5WC 2WLMA 1YITV 3CD6V 2P6JA 4PA9A 4ZBMA 5B1NA 3AG1B 3JD0A 3H01A 4JTCB 2P7TC 4JTDB 3ZRWA 1OCZC 4QE9A 1R3IC 3K0GA 2Q6AA 3KG2A 4EKWA 2PI4A 1B6QA 4UXNA 5LHHA 2WLIA 2XOKG 3E86A 5IY5C 5L3GA 2JEUA 2WLLB 4JF3A 3QO7A 1R3JC 3ABTA 3ABLC 3OEEG 3SJQC 3ZN1A 2LP7A 4MVZA 3OMNB 1FXKB 3AG4C 1W0KG 2QEXV 2DWDC 2K1EA 1W0JG 1M1KW 1K8AW 1OCRB 3HPLC 2WAMA 1S5HC 1E1QG 3SYPA 3LDEA 2XASA 3ABMB 3F7YC 3RVZA 2NNUA 2B1GA 3R65A 1YHQV 1R3LC 3K79A 3ABUA 2KB1A 4PA4A 3B8MA 3B77A 4FPPA 1AROP 1BL8A 1SERA 2WWWA 3CXCU 5H6RA 1H8HG 4JYCA 4MTGA 4MS2A 4P2ZA 3QO8A 4BAYA 4FMTA 4X88A 1VQMV 1VQ4V 1LNQA 3K3WA 4PDRA 4R50A 1NR1A 4WFBV 3CCEV 3E89A 1VQ8V 5LBQA 1M56B 3MHSC 5L3BA 2EIKB 2YEVB 3PJSK 2V7QG 2IH1C 1OHHG 3ABKC 4KUMA 1QVGU 2Q68A 5IYBO 2ITDC 2IW5A 4LCUC 3LDCA 1I5XA 4MTFA 3CCQV 4R7CA 2EINB 5L3FA 3VBBA 1JX9A 1FXHA 1K4CC 3ZRSA 2JJ1G 5CBGA 3ZRXA 3JCZA 1Q86W 1KC8W 1COWG 1H8EG 1QR9A 5LHGA 1K5QA 2EILB 1Q81W 1R6NA 4J9YB 2WLKA 1GMGA 2X0LA 3STLC 5IYCO 2IU3A 4PELA 1DF4A 1V55C 5J9PC 2JJ2G 3G71V 1YI2V 2M7WA 2ZR3A 5B3SC 2EINC 2Y69C 3OUSA 4UV9A 5KA5A 2X6BA 3K08A 5BZBA 1OCOC 3IFXA 2H8PC 3FB8C 1NKDA 4WF9V 3STZC 1R3KC 2A79B 1K7DA 1E1RG 1GKFA 3ZCCA 4JAUA 4QPJA 3CCMV 1GM7A 3ZRVA 1UJWB 1G8MA 1H2GA 1OCCB 2OT5A 1NQTA 4FK5C 3W7XA 4J9ZB 3AG2B 1TUEB 4P9PA 3QNEA 1EFRG 3FKSG 3OE7G 3ZMSA 1SZTA 4ZKIA 1RPRA 2HR3A 1S76D 4RQFA 3DTUB 2EIJB 1H38A 2IJKA 3WG7C 1QLEB 2ZQMA 3ZJZA 2BOCC 3ZN0A 1MG1A 1P7BA 4PA6A 5L3EA 2QM8A 4X8AA 4GCZA 3OAAG 4H33A 1SETA 4GX2A 1Q7YW 1VQ7V 3UM7A 1N8RW 4DXWA 2QM7A 4JASA 4YXWG 3T2MA 3OM3B 5CBFA 4HYOA 1QR8A 2IU0A 3CC2V 4TSFG 2R9IA 2DQ3A 3CMEV 3FYIB 4G28B 1G4YB 3W7UA 3A0RA 4MW8A 1S72V 1WPXA 2CK3G 3WFVA 5B3SB 4OXSA 1W2BU 1AJQA 5E1AC 4N21A 1VQNV 1KKDA 3NXSA 2FTKA 2XAFA 1GM9A 4P9OA 1AI7A 5B1AB 3LUTB 1F51A 3CMAV 3FYEB 1CEZA 3P32A 1OCCC 3CC4V 2EIMB 4P30A 5EBWC 3E83A 1DF5A 2WPDG 1R6KA 3P30A 1PKXA 1VQLV 1M57C 2WLIB 1F4NA 2R9RB 3HB3B 1S0VA 2LFRA 1YIJV 1S77D 4GX5A 1NH2D 2IJIA 3F7VC 5HFMA 3JD4A 3LNMB 1VQKV 3IC7A 2EZPA 3I55V 2HVKC 1JOYA 1QBZA 2EIKC 1JJ2U 1PL0A 2DW4A 2WLJA 3ASOC 5L3DA 3ZMUA 5LGUA 1FS0G 1Y66A 1DTOA 5CBHA 2ZR2A 1V54C 4PDMA 1XL6A 2V1DA 1KQSU 3GWOA 5DN6G 1AI6A 5EBLC 2HG5C 3B8NA 4WFEA 1M9NA 2UXNA 4GX1A 3SYAA 1YTFB 4FIPC 3RW0A 5B1OA 5IDJA 2OCCB 2P67A 1FXKC 1AJPA 3AG4B 1VQOV 1VQ6V 1QCEA 3W7SA 2XAQA 2ZXWB 3SPCA 2EILC 1K92A 4WFAV 3CCUV 2JK5C 4QNHB 4UUJC 3T4ZA 4CBCA 1K5SA 4TWKA 3K06A 4MTOA 4BW5A 3CC7V 4WFFA 2OTLV 4MSWC 4MVUA 2A9HA 4MT8A 4JYBA 4RO2A 3SPIA 2QE7G 4UVCA 1K34A 4PA3A 3BEHA 1MOFA 4HZ3A 1GTOA 4MTXA 1VQ9V 4PA7A 3ETEA 2X6AA 4XDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC2 C;  5EBM C;  3E8G A;  1P7B A;  2WLL B;  4PA6 A;  5EC1 C;  3SYC A;  1QLE C;  3OR7 C;  1R3J C;  3ABL C;  4X8A A;  4LP8 A;  3SJQ C;  4MVZ A;  4MW3 A;  2DYS C;  4H33 A;  2HFE C;  3AG4 C;  3TET A;  2DWD C;  2ZXW C;  2K1E A;  4GX2 A;  3UKM A;  3HPL C;  4RAI A;  4X89 A;  3UM7 A;  4F4L A;  4R8C A;  4DXW A;  1S5H C;  2Q69 A;  5KUM A;  3K0D A;  3AG1 C;  4G27 B;  3OGC C;  3LDE A;  3F7Y C;  3RVZ A;  4GX0 A;  3SYP A;  2YEV A;  3R65 A;  4H37 A;  3T2M A;  5CBF A;  4HYO A;  1R3L C;  1JVM A;  3E8H A;  3K04 A;  3SYO A;  2Q67 A;  3AG3 C;  4G28 B;  3T4D A;  1G4Y B;  2KB1 A;  2QTO A;  4PA4 A;  4MW8 A;  1BL8 A;  5B3S C;  2BOB C;  4I9W A;  3SYQ A;  4WFH A;  3X2Q C;  3TCU A;  2EIJ C;  3LDD A;  4OXS A;  2DYR C;  2AHY A;  2HJF C;  5E1A C;  3VOU A;  2A0L A;  3OR6 C;  3OUF A;  4MTG A;  1ZWI C;  2OCC C;  4P2Z A;  2HVJ C;  4R6Z A;  4X88 A;  3RVY A;  1LNQ A;  1KKD A;  5KUK A;  4PDR A;  4R50 A;  2EIM C;  3E89 A;  4P9O A;  2NLJ C;  3FB7 C;  3LUT B;  4MVO A;  5EK0 A;  1ORQ C;  3RBZ A;  3PJS K;  1OCC C;  4P30 A;  2IH1 C;  5EBW C;  3T1C A;  3E83 A;  3ABK C;  3SPG A;  4PDL A;  3SPJ A;  2Q68 A;  1M57 C;  2WLI B;  2ITD C;  2R9R B;  4LCU C;  3LDC A;  2ATK C;  4GX5 A;  4MTF A;  4R7C A;  3JYC A;  3F7V C;  1K4D C;  3LNM B;  3E8B A;  1OCR C;  1K4C C;  3GB7 C;  4MVM A;  3ZRS A;  5CBG A;  3E8F A;  4JTA B;  2X6C A;  1J95 A;  4MVR A;  2DWE C;  2HVK C;  3ABM C;  2EIK C;  2WLJ A;  3ASO C;  3SPH A;  4J9Y B;  3EFF K;  4PDV A;  2WLK A;  3ASN C;  5CBH A;  1V54 C;  3STL C;  4PDM A;  1XL6 A;  1V55 C;  5J9P C;  5B1A C;  5B1B C;  5EBL C;  4MVS A;  2HG5 C;  2EIN C;  1XL4 A;  2Y69 C;  3OUS A;  4WFE A;  4XDJ A;  4XDK A;  2X6B A;  4LBE C;  3K08 A;  4GX1 A;  1OCO C;  3SYA A;  5BZB A;  3FB6 C;  2H8P C;  2ITC C;  3IFX A;  3RW0 A;  3FB8 C;  3STZ C;  1R3K C;  2W0F C;  2A79 B;  2ZD9 A;  3F5W C;  2WLN A;  2WLM A;  4MVQ A;  3SPC A;  1M56 C;  2EIL C;  3AG2 C;  4PA9 A;  4RUE A;  4ZBM A;  3FB5 C;  3IGA C;  4QE7 A;  2JK5 C;  4QNH B;  4JTC B;  3K03 A;  4UUJ C;  3T4Z A;  4CBC A;  2P7T C;  4JTD B;  4TWK A;  4J9Z B;  3K06 A;  4MTO A;  3ZJZ A;  4BW5 A;  4WFF A;  2IH3 C;  1OCZ C;  4MSW C;  4MVU A;  1R3I C;  2A9H A;  3K0G A;  4P9P A;  4QE9 A;  2Q6A A;  4RUF A;  3KG2 A;  4RO2 A;  3SPI A;  4KFM A;  5IY5 C;  4EKW A;  2QKS A;  4PA3 A;  2WLH A;  3BEH A;  2WLL A;  4HZ3 A;  2AHZ A;  3WG7 C;  2WLI A;  4PA7 A;  4WFG A;  4MS2 A;  2BOC C;  2X6A A;  4XDL A;  3E86 A; 
#chains in the Genus database with same CATH topology
 4FZ1 A;  3VQV A;  2XTA A;  3RYF B;  5DM6 V;  1SC5 B;  4JI1 O;  3UO2 A;  5KX5 B;  3TET A;  1EN5 A;  2MK3 A;  3I5D A;  3ZHS A;  4WBN A;  1Y76 A;  4LF5 B;  3AG1 C;  3H1H H;  3E8H A;  5EIB C;  3FAV B;  3HKE A;  3MD0 A;  2HEP A;  2Q67 A;  3BY6 A;  4JI0 O;  1HP8 A;  2F95 B;  2BOB C;  4I9W A;  3SYQ A;  1WB7 A;  1MAB G;  3C3T A;  2A0L A;  3OR6 C;  1ZWI C;  3VQW A;  4LF7 B;  2ZDI A;  3D3I A;  1ZLZ A;  3FB7 C;  1EZV H;  3T1C A;  5IY5 B;  3ZHQ A;  5LOV B;  1RM1 B;  2X7R B;  2Y4U A;  1YF2 A;  4PDL A;  3SPJ A;  4YY3 O;  3RYC A;  2JVD A;  2XAJ A;  4GT1 A;  4I55 B;  2BE3 A;  1Q82 W;  4LH7 A;  4FVM A;  3M99 B;  1K73 W;  1KP2 A;  4L87 A;  2IBZ H;  4I5S A;  1QU7 A;  4JI1 B;  1K97 A;  1XMQ B;  2LW7 A;  1PL4 A;  5JJE B;  3OD4 A;  2R72 A;  4U7N A;  1HNX B;  3QVN A;  4X64 O;  1R73 A;  3P3N A;  1F23 A;  1I5Y A;  5B1B C;  1FXV A;  4MVS A;  3K9A A;  5KHI A;  1JCH A;  3B40 A;  2QWO B;  3FB6 C;  4L8J A;  4J10 A;  5K1X A;  3O65 A;  1OCO B;  3A0H Z;  1SQG A;  2QA4 V;  4YIO A;  4RUE A;  3ASO B;  4C7U A;  2BSK B;  4W4L A;  1BHA A;  4AHC A;  2DYS B;  3GVM A;  1FFT B;  3CRM A;  3OTO O;  1SS3 A;  2UUB B;  2VQE B;  5L3C A;  3U0Z A;  4WFG A;  1YTF D;  4CH6 A;  1V55 B;  1F4M A;  3E35 A;  3JAM N;  3BAA A;  3LSQ A;  1EBO A;  4QPK A;  3K5L A;  1YJN V;  3JSL A;  4F6E A;  3K5M A;  4X89 A;  3J81 N;  3K0D A;  4DV3 O;  4G27 B;  3PN1 A;  3JAR A;  2HHH O;  1NR7 A;  3HKD A;  3QO5 A;  2IM9 A;  3JAK A;  5KHH A;  1MA1 A;  2DYR B;  3AG3 C;  1XI1 A;  3IAY A;  4DYL A;  3X2Q C;  1BE3 H;  5CA1 A;  4UB6 Z;  2FKX A;  3CYO A;  4JAA A;  1MSW D;  4U3J A;  1THZ A;  4J7K A;  4FM1 A;  2PUS A;  4WBN B;  1SES A;  2RN9 A;  1B06 A;  2Y69 B;  4K8Z A;  4LR3 A;  4LNU B;  2B9Z A;  2ZE6 A;  1N34 O;  3K58 A;  1PNK A;  3J7A U;  1Q5O A;  2KQX A;  1GK9 A;  4KL1 A;  1SA0 A;  4KXR A;  4JYA O;  1GM8 A;  2X6C A;  4CH5 A;  4I50 A;  4UFZ A;  3H1K H;  2WA3 A;  4DV0 B;  1DLB A;  2Y0P A;  3L71 H;  1Z5V A;  2ITC C;  3WG7 B;  1L0L H;  2PGG A;  4YJ3 A;  4LFB O;  4CC5 A;  4JTC B;  4O2A A;  5BMV A;  1TUB B;  4DV2 O;  4QE9 A;  5LXT B;  5H5N A;  2PTM A;  4DUZ O;  3THO A;  2PI4 A;  4UXN A;  5LHH A;  5AG2 A;  4TOI A;  5L3G A;  2JEU A;  2WLL B;  4JF3 A;  3K5N A;  3K9S A;  3ZN1 A;  3APO A;  4H0L B;  2QEX V;  1AVM A;  2CTQ A;  1VAR A;  1OCR B;  2ZE8 A;  2WAM A;  1S5H C;  4O4H A;  4A5U B;  3SYP A;  3LDE A;  2GBO A;  2XAS A;  2NNU A;  1CXZ B;  3R65 A;  5J2T B;  2UXD O;  3A8T A;  1JFF A;  3B77 A;  1SER A;  2KG7 A;  3CXC U;  2ZE7 A;  4DR5 B;  3AK2 A;  4X20 B;  4X1K A;  4GYC B;  2F4V O;  5CA1 B;  4X88 A;  1VQM V;  1NR1 A;  1W59 A;  4FM0 A;  3A0B Z;  5L3B A;  4LF4 O;  3HKC B;  3ABK C;  4FZ0 A;  2Q68 A;  4J41 A;  2ITD C;  1GN6 A;  3LDC A;  4MTF A;  5LP6 B;  1DK1 A;  1FXH A;  2JJ1 G;  2KSD A;  1Q86 W;  5FLX N;  5LMU B;  1H8E G;  4UCV A;  1Q6I A;  3D36 C;  5B66 Z;  1Q81 W;  1R6N A;  3QF7 A;  3STL C;  4PEL A;  4JZ2 A;  1DF4 A;  1YVW A;  1YI2 V;  4JI4 O;  2EIN C;  3OUS A;  4LFA B;  5KA5 A;  3K08 A;  2XUM A;  1VIB A;  1BT8 A;  2F66 C;  4JV5 O;  5LMN O;  1B3Q A;  1WA8 B;  1K7D A;  4X1K B;  4K0K B;  2F1M A;  4H44 B;  4IT5 A;  1GM7 A;  3MDS A;  2LW1 A;  1XMO O;  2OT5 A;  2QWP B;  4FK5 C;  4DR3 B;  4ZIB A;  1SQX H;  4P9P A;  1D2D A;  2BTO A;  3FKS G;  3OE7 G;  2HR3 A;  5LXT A;  3WG7 C;  1QLE B;  4GLX A;  1SQV H;  1YCI A;  1MG1 A;  2XT9 A;  5IYZ B;  4YHH B;  4LWS B;  1A32 A;  5L3E A;  2QM8 A;  1OJH A;  1XDC A;  3SGI A;  1SET A;  2RMK B;  1FFX A;  1N36 B;  1VQ7 V;  2QM7 A;  3E22 A;  4GUN A;  5CBF A;  3CME V;  1US6 A;  2KG7 B;  2E76 B;  2RNB A;  4J11 A;  1G4Y B;  4MW8 A;  3KCY A;  2QR4 A;  1SF9 A;  1AJQ A;  1MMM A;  1L0N H;  3BHP A;  3NXS A;  1IZ3 A;  1PPJ H;  2YC0 A;  4DRX A;  5A2Q N;  2YIC A;  4B3T O;  1AR4 A;  2EIM B;  3E83 A;  1DF5 A;  5GTH Z;  4JI8 B;  1JR9 A;  3P30 A;  1VQL V;  2LFR A;  1YIJ V;  1P7G A;  1HNZ B;  5JQG B;  4I9Q A;  1H2M A;  2DMX A;  1VQK V;  2EZP A;  1GAX A;  3LSU A;  1Q6U A;  2NN4 A;  4YJ2 B;  5JCO A;  5L3D A;  1HW7 A;  1DTO A;  2ZR2 A;  4FLT A;  3CS5 A;  1KQS U;  1IUR A;  3GWO A;  1NI8 A;  2UXN A;  3DC6 A;  1IBL O;  1EN6 A;  3M8A A;  5B1O A;  5IDJ A;  2Q7E A;  2FML A;  1FXK C;  2UU9 B;  1SQF A;  1QCE A;  3W7S A;  5GON B;  3SPC A;  1K92 A;  3CCU V;  1YDX A;  4NTY A;  2VS0 A;  3T4Z A;  5J2U B;  4TWK A;  3K06 A;  4MTO A;  3CC7 V;  2R70 A;  4MVU A;  1BGY H;  3ICX A;  1XUQ A;  2QE7 G;  4LNU A;  3HKD B;  3DC5 A;  4HZ3 A;  3N2G A;  4MTX A;  1WA8 A;  2QWR B;  1VF5 B;  4UCO A;  3B2E E;  3WU2 Z;  1MNG A;  4MW3 A;  1QLN A;  1D5N A;  1KEC A;  3HKB A;  4LC1 A;  5EZY B;  2Q73 A;  3RFR A;  4RAI A;  4HNA B;  3G4S V;  2Q69 A;  1K33 A;  3I56 V;  4BIU A;  1IBK B;  4DUY O;  4GX0 A;  3OMI B;  2YIB D;  3ZRW B;  3JCU Z;  3K04 A;  3ML0 A;  2P22 C;  5CN0 A;  1NVP D;  1N32 B;  4WCE V;  1M90 W;  3JAK B;  2EIJ C;  2DYR C;  4U3F H;  3CRR A;  4JI5 O;  1JA8 A;  5KUK A;  2ZIO A;  1Q8I A;  2ZM6 O;  4E2L A;  4BIZ A;  1ORQ C;  3RBZ A;  1H2K A;  2PI5 A;  2EX3 A;  4DV0 O;  1SRY A;  5C93 A;  3MAQ A;  5IWA B;  2ATK C;  3MHH C;  3G80 A;  3JYC A;  2D2C B;  4LF5 O;  3E2E A;  2XND G;  1R6T A;  1J95 A;  2DQ0 A;  2F23 A;  3ABM C;  4O4I B;  1XMO B;  5BMV B;  4XBF A;  2UXC B;  2AW9 A;  1PNL A;  4NXN O;  4UCR A;  2GTS A;  2Q7H A;  4XDJ A;  3P3P A;  1NH2 B;  4JI2 B;  4EFE A;  5IJ9 B;  2JGD B;  1AJN A;  1M57 B;  5HFL A;  1YXB A;  1M56 C;  2V4D A;  3AG2 C;  3IGA C;  2KKW A;  1X59 A;  3KKY A;  5BR8 O;  2H94 A;  5CA0 B;  3CCR V;  4IIJ B;  3W7T A;  4O2A B;  2BTQ B;  1L8D A;  2YIB A;  2Z3Y A;  2P4K A;  2WLL A;  1V54 B;  4O2B B;  4CZZ A;  2GSM B;  1Z5W A;  2HHH B;  5EYP A;  5EC1 C;  2YUA A;  5KX5 A;  3L73 H;  1QLE C;  2GHY A;  1ZSP A;  4FLU A;  4NYK A;  2HFE C;  3UKM A;  3R66 A;  3U10 A;  4X9Q A;  1WN7 A;  3OGC C;  5BY1 A;  2YEV A;  3L75 H;  1IXB A;  1PV0 A;  3K59 A;  1K9M W;  2ODM A;  1AI4 A;  4UCS A;  1JQ0 A;  3A2F A;  3H9V A;  4DR1 B;  1IBL B;  1AIL A;  3JAL B;  2H3O A;  2ZDI C;  3CEI A;  1KP3 A;  4CH3 A;  2N05 A;  4DW1 A;  4E4E A;  4TQD A;  3JAS A;  2LFS A;  4IIJ A;  1NJI W;  1EN4 A;  2ADP A;  3AG3 B;  2JIZ G;  4DR4 B;  4J7J A;  4DR4 O;  2YXL A;  2LO1 A;  3FD9 A;  4O4J B;  4QIW F;  5H6Q A;  3NR7 A;  4BWA A;  1TA8 A;  1BSM A;  2B5U A;  3TK1 A;  1KU9 A;  3ABK B;  4FLW A;  4JGS A;  1K4D C;  3E8B A;  3IJ4 A;  3E8F A;  2HJD A;  3CCS V;  2IJJ A;  1YJW V;  1IBM O;  3EFF K;  5BR8 B;  3TXQ A;  2VWK A;  1QHT A;  1V9P A;  3EHB B;  4FFK A;  5B1A C;  1GO3 F;  1XL4 A;  1Y74 B;  3RYI B;  1YIT V;  2WLM A;  3GWK C;  2CE4 A;  3AG1 B;  3H01 A;  2QGN A;  2UXC O;  2P7T C;  4JTD B;  3T1Y O;  4DV4 B;  1R3I C;  3K0G A;  3L74 H;  5KHG A;  5F2V O;  2RDC A;  4CS3 A;  5EYP B;  1B6Q A;  1TVK A;  4LF6 B;  1N34 B;  3K5O A;  3DXR A;  4DV6 B;  2HP8 A;  3ABL C;  3SJQ C;  2LP7 A;  4MVZ A;  3AG4 C;  1W0K G;  4DR7 B;  2P4V A;  5CA0 A;  1K8A W;  2O57 A;  4DV1 O;  5KAI Z;  3ABM B;  3RVZ A;  1YHQ V;  4B3R O;  2E5L B;  1H2L A;  1FPO A;  3B8M A;  1KBH A;  1BL8 A;  3U11 A;  4Q6G A;  5DEC A;  5IJ9 A;  4DV3 B;  4JYC A;  2AZ2 A;  4J80 A;  4P2Z A;  3QO8 A;  3RYF A;  1Q43 A;  5IWA O;  1M56 B;  1Q6H A;  2MW2 B;  4LF6 O;  3MHS C;  1XNR B;  3PJS K;  2V7Q G;  2IH1 C;  1OHH G;  4CS4 A;  2WA4 A;  1BS3 A;  3K57 A;  4W4K A;  3BFR A;  3D3Q A;  1I5X A;  3VBB A;  1JFF B;  3ZRS A;  5CBG A;  3ZRX A;  3O9O A;  1KC8 W;  1KKC A;  3CE2 A;  1QR9 A;  5LHG A;  3J80 N;  2EIL B;  4J9Y B;  4O4H B;  1ZTE A;  2X0L A;  3HR0 A;  4LFC B;  5IYC O;  5D5Q A;  3EXA A;  4Z1V A;  2PYL A;  5B3S C;  5LA6 A;  1FKA O;  2VWJ A;  4CH4 A;  4GZR B;  1HNW B;  1Y6X A;  1NKD A;  1F7Y A;  3STZ C;  1R3K C;  2UUA O;  2Q5Z A;  4D6T H;  1Y74 A;  3H1I H;  3RYI A;  2YID A;  1UJW B;  1N33 B;  3CJH B;  1NQT A;  3AG2 B;  4DRX B;  1TUE B;  1WPB A;  1TVK B;  2QWQ B;  1SZT A;  4NTW A;  3B09 A;  2XHB A;  1GN4 A;  4RQF A;  2EIJ B;  1H38 A;  3ZX6 A;  3TXS A;  1N0J A;  4PA6 A;  4H33 A;  4I0X B;  2QTS A;  4LF8 B;  5KHJ A;  4GX2 A;  5J2U A;  1P49 A;  4DXW A;  3D8C A;  2QKC A;  5FPO A;  1HNW O;  3HKB B;  3ZBH A;  2R9A A;  1DGS A;  4HYO A;  3FFQ A;  3CC2 V;  2R9I A;  4I4T A;  2PY5 A;  4BW9 A;  2ZKO A;  1IDS A;  4IHJ B;  5B3S B;  2EUL A;  4OXS A;  4D7T A;  1W2B U;  1NTM H;  5C8Y A;  4N21 A;  1VQN V;  3CHX A;  2XAF A;  1B04 A;  4P9O A;  1N4C A;  5D5P A;  5KAF Z;  1AI7 A;  1CEZ A;  3FYE B;  1N0N A;  2OCH A;  4P30 A;  5EBW C;  3ZHT A;  1FYJ A;  1PKX A;  5JH7 A;  1M57 C;  4KHP B;  3HB3 B;  4UCU A;  1WB8 A;  3SR2 C;  1S77 D;  4QGP A;  4I4T B;  1RP3 B;  3F7V C;  3G6B A;  3SJC C;  1JOY A;  3ZMU A;  1FS0 G;  1Y67 A;  3EVK A;  5CBH A;  1V54 C;  5LA6 B;  2BTQ A;  4TQF A;  2V1D A;  3BA8 A;  3B8N A;  4TV8 A;  1M9N A;  4GX1 A;  1LR1 A;  1FJG B;  1VQO V;  2EIL C;  4WFA V;  5JJN B;  4JI6 B;  4YHH O;  4CBC A;  1U97 A;  3JAS B;  1PM9 A;  3QTC A;  4WFF A;  1ZL8 A;  3BPZ A;  2OTL V;  2CGO A;  1QQC A;  3HKE B;  4MSW C;  2UXB O;  4JYB A;  4UVC A;  3UO3 A;  2YI8 A;  3BEH A;  1GTO A;  1VQ9 V;  4PA7 A;  4XDL A;  2RJZ A;  1VMG A;  4HAM A;  3SYC A;  4AQY O;  4DR6 B;  3OR7 C;  4K0K O;  5H9C A;  2GUZ B;  4LWS A;  3OTO B;  5KHK A;  1Y4M A;  3ASN B;  1VQ5 V;  5GON A;  4LF9 B;  4B08 A;  4ZI7 B;  1J5E O;  2ETN A;  1OZ0 A;  4GKK B;  1SKV A;  3L70 H;  2F4V B;  3JAW B;  2AGA A;  5JWP A;  1JVM A;  4NVP A;  4JAV A;  1FD9 A;  5CB4 B;  5IYZ A;  2YS8 A;  4OPA A;  2Z5U A;  5CMU A;  1BQ0 A;  4UVA A;  4O4L B;  2JGD A;  3OUF A;  2HVJ C;  1T5E A;  4R6Z A;  1WLE A;  3ZS8 C;  5IT9 N;  2UUA B;  3TGU H;  4ZOL B;  1SQQ H;  3OEH G;  5LHI A;  2LGQ A;  3APQ A;  4UV8 A;  1ROP A;  1BHB A;  2GDS A;  1IXM A;  3SPG A;  1PNM A;  1LUW A;  2ZIN A;  3G6E V;  3CPW U;  3ETG A;  5EIB D;  1X4T A;  3OT7 A;  3Q4H A;  5C8Y B;  4JTA B;  2DWE C;  4FLV A;  1PD3 A;  1MSD A;  3SPH A;  1RM1 C;  3ASN C;  3OFN G;  4BIO A;  2W6J G;  1XHX A;  4XDK A;  3ABL B;  3C90 A;  3S3W A;  1H2S B;  2W0F C;  4PJ0 Z;  1JPX A;  3L9D A;  2ZD9 A;  2CTP A;  4MVQ A;  1R1B A;  3WB0 A;  2QKA A;  3FB5 C;  4Q20 A;  3K03 A;  3CP1 A;  1UFI A;  5E79 Z;  2IH3 C;  2ZIM A;  2DN9 A;  1GN3 A;  3HKC A;  4DUZ B;  2JDI G;  2AHZ A;  1ENV A;  2F93 B;  3KZI Z;  4GKJ B;  4B3M O;  4U3J B;  3RYH B;  2DYS C;  2ZXW C;  1J5E B;  4JI7 O;  1KD1 W;  3SYO A;  5DED A;  5ITZ B;  2ILM A;  3FAV A;  2ARH A;  5K1P A;  5IJ0 A;  2B1I A;  3Q4H B;  5LGT A;  1OCZ B;  3SDL A;  3ETD A;  2DJV A;  2NLJ C;  1WP8 A;  4MVO A;  4PI2 A;  3ZMZ A;  1IX9 A;  3LSS A;  4I55 A;  1P4R A;  2VRZ A;  4DR3 O;  4NXM O;  5CB4 A;  4DO2 A;  2EZO A;  3AK1 A;  4FLY A;  2P90 A;  2DOS A;  2UUB O;  2QJ1 A;  2NR5 A;  2QSA A;  2LGW A;  4NB5 A;  1H2N A;  5LGN A;  4DR2 B;  4JV5 B;  4OGQ B;  1UPG A;  3ZIA G;  3JAT B;  4B3S B;  2CGN A;  3H1J H;  1QVF U;  3OGI B;  1GH6 A;  1YJ9 V;  4ABM A;  1XEQ A;  4RQE A;  5JJJ B;  3F5W C;  5LMU O;  3CD6 V;  4DV7 B;  4PA9 A;  4X1I B;  5B1N A;  3JD0 A;  2CUG A;  2Y4T A;  5IE9 A;  3ZRW A;  3T1Y B;  1OCZ C;  5JVD B;  1I94 B;  5JCO C;  4O2B A;  3JAR B;  3KG2 A;  2FYU H;  4LF4 B;  4F6R A;  3JAT A;  3ZED A;  3IC9 A;  5ITZ A;  3E86 A;  2UUC B;  4JI3 O;  3ABT A;  3OEE G;  4DR5 O;  2CTR A;  1FXK B;  2VQF B;  2DWD C;  2K1E A;  4YIP A;  1LUV A;  1M1K W;  2A06 H;  4AIL C;  3F7Y C;  5LYJ A;  2B1G A;  1R3L C;  1HNX O;  4TV9 B;  3K79 A;  1U96 A;  4IHJ A;  3ABU A;  2KB1 A;  4PA4 A;  4JYY A;  4FPP A;  4K35 A;  2OWO A;  1HDJ A;  5BXZ A;  2N04 A;  1JJO A;  4BAY A;  1VQ4 V;  1LNQ A;  4PDR A;  1VQ8 V;  4WFB V;  3CCE V;  2JS3 A;  2EIK B;  2YEV B;  4B3S O;  3BRC A;  5IYB O;  5FNV B;  2IW5 A;  4LCU C;  4R7C A;  4DV1 B;  1JX9 A;  1XNQ O;  3CSX A;  1QNM A;  1G1X B;  1M93 A;  2ZT9 B;  3F5T A;  1PP9 H;  5EZY A;  1K5Q A;  4JI3 B;  3FX7 A;  4DV6 O;  1GMG A;  2IU3 A;  1V55 C;  5J9P C;  2JJ2 G;  3G71 V;  4DV5 B;  2M7W A;  2ZR3 A;  3AG7 A;  2Y69 C;  4UV9 A;  5BZB A;  1OCO C;  2PYJ A;  2H8P C;  1SZX A;  1I94 O;  1WNS A;  2Z0A A;  4AI8 A;  3BA9 A;  4JAU A;  1P84 F;  4QPJ A;  3CCM V;  3TJT A;  3W7X A;  1XNR O;  4J9Z B;  1S5L Z;  4F6R B;  3N2G B;  3QNE A;  3ZMS A;  1EFR G;  3BCC H;  3ZHU A;  1RPR A;  3WB2 A;  3DTU B;  4J42 A;  3LNN A;  3G67 A;  3ZN0 A;  1URF A;  1P7B A;  4DUY B;  4H13 B;  3WB1 A;  4X8A A;  1AP5 A;  4B3M B;  2YDE A;  4GCZ A;  5TIS Z;  3OAA G;  4ZHQ B;  4NXN B;  1Z2G A;  1Q7Y W;  3UM7 A;  4Z2W A;  1N8R W;  3CB2 A;  5LMN B;  4EFB A;  1AB3 A;  3OM3 B;  3M7M X;  4LFA O;  1QR8 A;  2IU0 A;  4TSF G;  2AXT Z;  4CS2 A;  3W7U A;  2CK3 G;  1XHZ A;  2GUZ A;  4X1I A;  3BAB A;  1KKD A;  4IGG A;  2FTK A;  4O4L A;  1GM9 A;  4DV4 O;  5B1A B;  4ZHQ A;  1BCC H;  1KYO F;  3RYC B;  2VQE O;  4DR1 O;  3CC4 V;  3E22 B;  4ZOL A;  1R6K A;  2WLI B;  2R9R B;  1S0V A;  3BVO A;  4GX5 A;  1NH2 D;  1NS1 A;  5KMG B;  2Q4P A;  5HFM A;  3LNM B;  2Q8V A;  2YXH A;  4D7S A;  1RSO B;  3B4S A;  3I55 V;  1SQP H;  2HVK C;  1QBZ A;  2RCV A;  1YEW A;  1JJ2 U;  1PL0 A;  1NT2 B;  2UU9 O;  1KMI Z;  4GKJ O;  4PHZ A;  4PDM A;  1XL6 A;  3JAW A;  4X64 B;  1AI6 A;  1NTZ H;  4DK0 A;  3OTF A;  3SYA A;  1YTF B;  3CRA A;  4FIP C;  3RW0 A;  2OCC B;  3RT3 C;  4EEQ A;  1VQ6 V;  4DV7 O;  2XAQ A;  3SJB C;  3UCS C;  4QNH B;  4UUJ C;  1K5S A;  2VQF O;  3CWB H;  4MT8 A;  4JI2 O;  3SPI A;  1GRJ A;  1ZUQ A;  1FAF A;  4JI8 O;  1K34 A;  4PA3 A;  1XQ8 A;  1MOF A;  3L72 H;  2PF4 E;  1HR0 B;  4MS2 A;  3ETE A;  3K3W A;  2X6A A;  5EC2 C;  2JGU A;  5EBM C;  3UT5 B;  1E79 G;  1O9G A;  3ZMV A;  3N27 A;  3OMA B;  4LP8 A;  3VQX A;  4LFB B;  3X2Q B;  1N36 O;  2A7W A;  2WSS G;  3ETQ A;  3RYH A;  1BZK A;  2P5O A;  4I0X A;  5LOV A;  1IVS A;  3CCL V;  4ASU G;  4PV1 B;  4H37 A;  2IJH A;  4PD4 F;  5LP6 C;  1VF6 A;  1CP9 A;  2GTA A;  2Q0O C;  2QDO A;  3LDD A;  1VQP V;  2AHY A;  3VOU A;  4TT3 G;  3JSN A;  4JI5 B;  2EBO A;  5B5E Z;  2OTJ V;  1FXK A;  4JI7 B;  2Q9L A;  5EK0 A;  4X66 B;  1YZB A;  2JEX A;  2ZCE A;  2CH7 A;  4JI4 B;  2JS5 A;  3JD2 A;  1CPY A;  5B1B B;  2Y0I A;  4GKK O;  2UXX A;  1IBK O;  2C2A A;  2Q0A A;  4YJ3 B;  4X62 B;  4LF9 O;  5LL6 Y;  2G38 A;  4MVR A;  1BQZ A;  5KMG A;  1HWY A;  3RGB A;  4DR6 O;  4YJ2 A;  4HBN A;  1AI5 A;  1I0H A;  1RPO A;  4N23 A;  5J2T A;  4NXM B;  2Q7G A;  4LBE C;  2CAZ C;  3CCJ V;  1NBM G;  1S3J A;  2L35 A;  3UT5 A;  1L1F A;  1AR5 A;  2WLN A;  4QJF B;  4U7O A;  1M5I A;  3CCV V;  4QE7 A;  2QM4 A;  3RWR D;  5JVD A;  4JPR A;  4UB8 Z;  2EJ7 A;  2W0X A;  3W7W A;  4FJC C;  1AR1 B;  2ZM6 B;  2D3O W;  4TUY B;  4RUF A;  2K9P A;  3QG5 A;  4KFM A;  2QKS A;  2WLH A;  4K3A A;  2UXD B;  2Y48 A;  4DK1 A;  1HR0 O;  2YXY A;  3E8G A;  1EZJ A;  3N2K A;  4Z1M G;  2FL4 A;  1SA0 B;  3D36 A;  4UVB A;  3CRC A;  1NZ6 A;  5LYJ B;  4F4L A;  1TUB A;  4R8C A;  5KUM A;  3T1H B;  2FB5 A;  1S5J A;  2HKO A;  3OW2 U;  1VP7 A;  3DSQ A;  3JD3 A;  2YIA A;  3AEI A;  4CC6 A;  3T4D A;  2QTO A;  4BR6 A;  4WFH A;  3TCU A;  2XAH A;  3H1L H;  4OX9 O;  2HJF C;  1VF6 C;  4NR1 A;  5FL7 G;  2OCC C;  2P06 A;  3JD1 A;  2W6I G;  4KP4 A;  3RVY A;  4I50 B;  2EIM C;  4ZI7 A;  4K8X A;  1WP7 A;  4FLZ A;  1VEW A;  2XAG A;  3DGE A;  1FFX B;  4TV8 B;  1YSC A;  4LFC O;  1I08 A;  3VQY A;  5LP6 A;  2RQ6 A;  5IYD O;  1BMF G;  4RWU A;  2ZNI A;  1XBL A;  2EJR A;  4FM2 A;  1NVP B;  3ZMT A;  4B7K A;  5CA3 A;  2CH7 B;  3KCX A;  3AK3 A;  4G2K A;  2F43 G;  5GW7 A;  4O4I A;  1Q90 D;  1OCR C;  3GB7 C;  4MVM A;  4LF7 O;  2YSU B;  1ZL8 B;  2E75 B;  4IYH A;  4LH6 A;  1VF7 A;  4PDV A;  4JI0 B;  2UXB B;  1K3E A;  3CRQ A;  5KA6 A;  3T1H O;  2HLD G;  1HNZ O;  4DW0 A;  2BSK A;  2P6J A;  4ZBM A;  1N33 O;  2ADQ B;  4B3T B;  4I7Z B;  2Q6A A;  4EKW A;  3N2K B;  1WAZ A;  2WLI A;  2XOK G;  5IY5 C;  4IYI A;  1NU1 H;  3CXH F;  3QO7 A;  1R3J C;  3OMN B;  1W0J G;  3HPL C;  1E1Q G;  1TAE A;  1FJG O;  4FLX A;  4O4J A;  3JAL A;  1SQB H;  1ARO P;  2WWW A;  5H6R A;  4DV5 O;  1H8H G;  4MTG A;  4JI6 O;  4FMT A;  4R50 A;  2YI9 A;  3E89 A;  5LBQ A;  4NKG B;  2BCC H;  1WJZ A;  5FPR A;  4KUM A;  3UQ8 A;  1QVG U;  4KHP O;  4LF8 O;  2OIE A;  3ZHR A;  2QWN B;  3CCQ V;  2EIN B;  4B7E A;  2DE0 X;  5L3F A;  1K4C C;  3JCZ A;  1COW G;  1GN2 A;  1ZAU A;  4ICG A;  1ZX3 A;  1Y76 B;  2WLK A;  4EB6 B;  2OYQ A;  2GV9 A;  2X6B A;  3IFX A;  3FB8 C;  1XRE A;  4WF9 V;  2A79 B;  1E1R G;  1GKF A;  3ZCC A;  1RSO A;  4J7Z A;  3ZRV A;  1G8M A;  1H2G A;  1TGO A;  1OCC B;  2ZE5 A;  4HNA A;  2AZ0 A;  4X65 B;  2CTW A;  2E74 B;  4X1Y B;  3RN4 A;  1KUQ A;  2PZS A;  4ZKI A;  1S76 D;  2IJK A;  2ZQM A;  5IJ0 B;  3ZJZ A;  2UUC O;  2BOC C;  4OPH A;  4X65 O;  2JRI A;  2CDY A;  3CX5 F;  4OX9 B;  3DXR B;  5KLV H;  1XMQ O;  4JAS A;  2N74 A;  4YXW G;  3T2M A;  5JH7 B;  1D5A A;  4JZG A;  2DQ3 A;  3FYI B;  4G28 B;  1MZE A;  3A0R A;  1S72 V;  1WPX A;  1OV9 A;  5FNV A;  4TV9 A;  3WFV A;  1KB9 F;  4FFB B;  5E1A C;  1G6U A;  3SJA C;  3ZHV A;  4YY3 B;  4IL6 Z;  1XIL A;  1RFY A;  1O9H A;  1Q3E A;  1JMK C;  2OIG A;  4DV2 B;  2ZNJ A;  4DR2 O;  3LUT B;  1F51 A;  2E3C A;  3CMA V;  3P32 A;  1OCC C;  4AQY B;  1XOU A;  2WPD G;  1NTK H;  3S3X A;  4NTX A;  1AP6 A;  2A3Q A;  1F4N A;  3C3S A;  1MZF A;  2IJI A;  2LJ2 A;  3JD4 A;  3IC7 A;  4X20 A;  4UCT A;  4PI0 A;  1I7F A;  4FFB A;  5H2F Z;  2EIK C;  2DW4 A;  2WLJ A;  3ASO C;  5LGU A;  5GTI Z;  1Y66 A;  1EM1 A;  2M6Y A;  4TUY A;  5DN6 G;  5A9G A;  5EBL C;  2HG5 C;  4JYA B;  4WFE A;  4EB6 A;  2P67 A;  3AG4 B;  1AJP A;  2ZXW B;  4X62 O;  3CJH A;  2LQT A;  5JQG A;  2JK5 C;  1N32 O;  4X1Y A;  1M4U A;  4DR7 O;  4BW5 A;  2A9H A;  4X66 O;  4RO2 A;  1XNQ B;  2L6L A;  2E5L O;  4B3R B;  1IBM B; 
#chains in the Genus database with same CATH homology
 5EC2 C;  5EBM C;  1E79 G;  3ZMV A;  4HAM A;  3SYC A;  3OR7 C;  3OMA B;  4LP8 A;  5H9C A;  4MW3 A;  5DM6 V;  1QLN A;  3X2Q B;  1Y4M A;  3ASN B;  3TET A;  1VQ5 V;  1KEC A;  2WSS G;  4LC1 A;  3G4S V;  2MK3 A;  4RAI A;  2Q69 A;  1K33 A;  1OZ0 A;  4BIU A;  3I56 V;  3AG1 C;  3CCL V;  4ASU G;  4GX0 A;  4H37 A;  2IJH A;  3OMI B;  3ZRW B;  1JVM A;  3E8H A;  3K04 A;  3MD0 A;  2Q67 A;  4JAV A;  3BY6 A;  3ML0 A;  1CP9 A;  5CN0 A;  1NVP D;  4WCE V;  1M90 W;  2BOB C;  4I9W A;  3SYQ A;  2EIJ C;  3LDD A;  1MAB G;  2DYR C;  2Z5U A;  2AHY A;  1VQP V;  5CMU A;  4UVA A;  3VOU A;  2A0L A;  4TT3 G;  3OR6 C;  3OUF A;  1ZWI C;  2HVJ C;  4R6Z A;  1WLE A;  5KUK A;  2EBO A;  2ZDI A;  2OTJ V;  3D3I A;  3FB7 C;  4E2L A;  1FXK A;  4BIZ A;  5EK0 A;  1ORQ C;  3RBZ A;  3OEH G;  5LHI A;  3T1C A;  4UV8 A;  5IY5 B;  1ROP A;  1RM1 B;  2X7R B;  1BHB A;  1IXM A;  2JEX A;  3SPG A;  4PDL A;  3SPJ A;  2PI5 A;  1PNM A;  1SRY A;  3G6E V;  5C93 A;  3CPW U;  2XAJ A;  4GT1 A;  3JD2 A;  1CPY A;  3ETG A;  5B1B B;  2ATK C;  3MHH C;  3JYC A;  2UXX A;  3E2E A;  2C2A A;  2XND G;  1Q82 W;  4JTA B;  1J95 A;  2DQ0 A;  4MVR A;  2DWE C;  3M99 B;  1K73 W;  1KP2 A;  3ABM C;  4L87 A;  4I5S A;  1PD3 A;  1HWY A;  1K97 A;  3SPH A;  1RM1 C;  4XBF A;  3ASN C;  3OFN G;  1PNL A;  1AI5 A;  1RPO A;  4U7N A;  1R73 A;  1F23 A;  1I5Y A;  4N23 A;  2W6J G;  5B1B C;  1FXV A;  4MVS A;  3K9A A;  4XDJ A;  4XDK A;  4LBE C;  1JCH A;  3ABL B;  3FB6 C;  3CCJ V;  1NBM G;  1S3J A;  1NH2 B;  1L1F A;  2W0F C;  1JPX A;  2ZD9 A;  2WLN A;  4QJF B;  1AJN A;  1M57 B;  1OCO B;  4MVQ A;  5HFL A;  2QA4 V;  4U7O A;  1M56 C;  3ASO B;  3AG2 C;  4RUE A;  3FB5 C;  3IGA C;  3CCV V;  4QE7 A;  4Q20 A;  3K03 A;  3CP1 A;  4JPR A;  2H94 A;  3CCR V;  1BHA A;  2DYS B;  1FFT B;  3W7T A;  2IH3 C;  3W7W A;  4FJC C;  1AR1 B;  2D3O W;  4RUF A;  4KFM A;  2QKS A;  2Z3Y A;  2WLH A;  2JDI G;  5L3C A;  2WLL A;  2AHZ A;  1V54 B;  4WFG A;  1ENV A;  1YTF D;  4CZZ A;  2GSM B;  2Y48 A;  1V55 B;  1F4M A;  3E8G A;  1EZJ A;  4Z1M G;  3E35 A;  5EC1 C;  3LSQ A;  1QLE C;  2GHY A;  1EBO A;  3D36 A;  4QPK A;  4UVB A;  2DYS C;  1YJN V;  2HFE C;  2ZXW C;  3UKM A;  4X89 A;  4F4L A;  4R8C A;  5KUM A;  2HKO A;  3OW2 U;  3K0D A;  4G27 B;  3OGC C;  3JD3 A;  3AEI A;  2YEV A;  1NR7 A;  1KD1 W;  3QO5 A;  3SYO A;  3AG3 C;  2DYR B;  3T4D A;  2QTO A;  1K9M W;  1AI4 A;  1JQ0 A;  3X2Q C;  4WFH A;  3TCU A;  2XAH A;  2B1I A;  3CYO A;  2HJF C;  5FL7 G;  2ZDI C;  5LGT A;  2OCC C;  1KP3 A;  3JD1 A;  1OCZ B;  2W6I G;  4KP4 A;  3RVY A;  1MSW D;  1THZ A;  2EIM C;  3ETD A;  1SES A;  2NLJ C;  2LFS A;  1NJI W;  2XAG A;  3DGE A;  2Y69 B;  4MVO A;  3AG3 B;  3ZMZ A;  2JIZ G;  1YSC A;  4QIW F;  5H6Q A;  3LSS A;  1P4R A;  5IYD O;  1BMF G;  1PNK A;  2B5U A;  3TK1 A;  2EJR A;  1NVP B;  4DO2 A;  3ZMT A;  3ABK B;  5CA3 A;  2EZO A;  4G2K A;  1GK9 A;  2F43 G;  1K4D C;  2P90 A;  4JGS A;  3E8B A;  5GW7 A;  1OCR C;  3GB7 C;  4MVM A;  1GM8 A;  3E8F A;  2X6C A;  3CCS V;  2IJJ A;  1YJW V;  2YSU B;  5LGN A;  3EFF K;  3ZIA G;  4PDV A;  3EHB B;  1K3E A;  5B1A C;  5KA6 A;  1DLB A;  1GO3 F;  1XL4 A;  1QVF U;  2HLD G;  2ITC C;  1YJ9 V;  4RQE A;  3WG7 B;  3F5W C;  2WLM A;  1YIT V;  3CD6 V;  2P6J A;  4PA9 A;  4ZBM A;  5B1N A;  3AG1 B;  3JD0 A;  3H01 A;  4JTC B;  2P7T C;  4JTD B;  3ZRW A;  1OCZ C;  4QE9 A;  1R3I C;  3K0G A;  2Q6A A;  3KG2 A;  4EKW A;  2PI4 A;  1B6Q A;  4UXN A;  5LHH A;  2WLI A;  2XOK G;  3E86 A;  5IY5 C;  5L3G A;  2JEU A;  2WLL B;  4JF3 A;  3QO7 A;  1R3J C;  3ABT A;  3ABL C;  3OEE G;  3SJQ C;  3ZN1 A;  2LP7 A;  4MVZ A;  3OMN B;  1FXK B;  3AG4 C;  1W0K G;  2QEX V;  2DWD C;  2K1E A;  1W0J G;  1M1K W;  1K8A W;  1OCR B;  3HPL C;  2WAM A;  1S5H C;  1E1Q G;  3SYP A;  3LDE A;  2XAS A;  3ABM B;  3F7Y C;  3RVZ A;  2NNU A;  2B1G A;  3R65 A;  1YHQ V;  1R3L C;  3K79 A;  3ABU A;  2KB1 A;  4PA4 A;  3B8M A;  3B77 A;  4FPP A;  1ARO P;  1BL8 A;  1SER A;  2WWW A;  3CXC U;  5H6R A;  1H8H G;  4JYC A;  4MTG A;  4MS2 A;  4P2Z A;  3QO8 A;  4BAY A;  4FMT A;  4X88 A;  1VQM V;  1VQ4 V;  1LNQ A;  3K3W A;  4PDR A;  4R50 A;  1NR1 A;  4WFB V;  3CCE V;  3E89 A;  1VQ8 V;  5LBQ A;  1M56 B;  3MHS C;  5L3B A;  2EIK B;  2YEV B;  3PJS K;  2V7Q G;  2IH1 C;  1OHH G;  3ABK C;  4KUM A;  1QVG U;  2Q68 A;  5IYB O;  2ITD C;  2IW5 A;  4LCU C;  3LDC A;  1I5X A;  4MTF A;  3CCQ V;  4R7C A;  2EIN B;  5L3F A;  3VBB A;  1JX9 A;  1FXH A;  1K4C C;  3ZRS A;  2JJ1 G;  5CBG A;  3ZRX A;  3JCZ A;  1Q86 W;  1KC8 W;  1COW G;  1H8E G;  1QR9 A;  5LHG A;  1K5Q A;  2EIL B;  1Q81 W;  1R6N A;  4J9Y B;  2WLK A;  1GMG A;  2X0L A;  3STL C;  5IYC O;  2IU3 A;  4PEL A;  1DF4 A;  1V55 C;  5J9P C;  2JJ2 G;  3G71 V;  1YI2 V;  2M7W A;  2ZR3 A;  5B3S C;  2EIN C;  2Y69 C;  3OUS A;  4UV9 A;  5KA5 A;  2X6B A;  3K08 A;  5BZB A;  1OCO C;  3IFX A;  2H8P C;  3FB8 C;  1NKD A;  4WF9 V;  3STZ C;  1R3K C;  2A79 B;  1K7D A;  1E1R G;  1GKF A;  3ZCC A;  4JAU A;  4QPJ A;  3CCM V;  1GM7 A;  3ZRV A;  1UJW B;  1G8M A;  1H2G A;  1OCC B;  2OT5 A;  1NQT A;  4FK5 C;  3W7X A;  4J9Z B;  3AG2 B;  1TUE B;  4P9P A;  3QNE A;  1EFR G;  3FKS G;  3OE7 G;  3ZMS A;  1SZT A;  4ZKI A;  1RPR A;  2HR3 A;  1S76 D;  4RQF A;  3DTU B;  2EIJ B;  1H38 A;  2IJK A;  3WG7 C;  1QLE B;  2ZQM A;  3ZJZ A;  2BOC C;  3ZN0 A;  1MG1 A;  1P7B A;  4PA6 A;  5L3E A;  2QM8 A;  4X8A A;  4GCZ A;  3OAA G;  4H33 A;  1SET A;  4GX2 A;  1Q7Y W;  1VQ7 V;  3UM7 A;  1N8R W;  4DXW A;  2QM7 A;  4JAS A;  4YXW G;  3T2M A;  3OM3 B;  5CBF A;  4HYO A;  1QR8 A;  2IU0 A;  3CC2 V;  4TSF G;  2R9I A;  2DQ3 A;  3CME V;  3FYI B;  4G28 B;  1G4Y B;  3W7U A;  3A0R A;  4MW8 A;  1S72 V;  1WPX A;  2CK3 G;  3WFV A;  5B3S B;  4OXS A;  1W2B U;  1AJQ A;  5E1A C;  4N21 A;  1VQN V;  1KKD A;  3NXS A;  2FTK A;  2XAF A;  1GM9 A;  4P9O A;  1AI7 A;  5B1A B;  3LUT B;  1F51 A;  3CMA V;  3FYE B;  1CEZ A;  3P32 A;  1OCC C;  3CC4 V;  2EIM B;  4P30 A;  5EBW C;  3E83 A;  1DF5 A;  2WPD G;  1R6K A;  3P30 A;  1PKX A;  1VQL V;  1M57 C;  2WLI B;  1F4N A;  2R9R B;  3HB3 B;  1S0V A;  2LFR A;  1YIJ V;  1S77 D;  4GX5 A;  1NH2 D;  2IJI A;  3F7V C;  5HFM A;  3JD4 A;  3LNM B;  1VQK V;  3IC7 A;  2EZP A;  3I55 V;  2HVK C;  1JOY A;  1QBZ A;  2EIK C;  1JJ2 U;  1PL0 A;  2DW4 A;  2WLJ A;  3ASO C;  5L3D A;  3ZMU A;  5LGU A;  1FS0 G;  1Y66 A;  1DTO A;  5CBH A;  2ZR2 A;  1V54 C;  4PDM A;  1XL6 A;  2V1D A;  1KQS U;  3GWO A;  5DN6 G;  1AI6 A;  5EBL C;  2HG5 C;  3B8N A;  4WFE A;  1M9N A;  2UXN A;  4GX1 A;  3SYA A;  1YTF B;  4FIP C;  3RW0 A;  5B1O A;  5IDJ A;  2OCC B;  2P67 A;  1FXK C;  1AJP A;  3AG4 B;  1VQO V;  1VQ6 V;  1QCE A;  3W7S A;  2XAQ A;  2ZXW B;  3SPC A;  2EIL C;  1K92 A;  4WFA V;  3CCU V;  2JK5 C;  4QNH B;  4UUJ C;  3T4Z A;  4CBC A;  1K5S A;  4TWK A;  3K06 A;  4MTO A;  4BW5 A;  3CC7 V;  4WFF A;  2OTL V;  4MSW C;  4MVU A;  2A9H A;  4MT8 A;  4JYB A;  4RO2 A;  3SPI A;  2QE7 G;  4UVC A;  1K34 A;  4PA3 A;  3BEH A;  1MOF A;  4HZ3 A;  1GTO A;  4MTX A;  1VQ9 V;  4PA7 A;  3ETE A;  2X6A A;  4XDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...