4QE7A

Open mthk pore structure soaked in 10 mm ba2+/100 mm na+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
PATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel MthK
publication title Ionic interactions of Ba2+ blockades in the MthK K+ channel
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
total genus 32
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qe7A00
4MVSA 3SPJA 3OR7C 3T1CA 1ORQC 3STZC 3OUSA 4KFMA 3FB7C 4QE7A 3SJQC 5J9PC 2WLLB 4P9PA 3SYOA 2ZD9A 3WG7C 4X8AA 2DWEC 2DWDC 1OCOC 4R50A 2X6CA 5KUMA 4QNHB 4G28B 4P2ZA 2EILC 4MW3A 4MVOA 2W0FC 4MVQA 4XDKA 3KG2A 4J9YB 4PDRA 4H37A 4GX1A 3TCUA 5IY5C 5E1AC 3E86A 3K0DA 1JVMA 4R7CA 2WLMA 3SPGA 3RVZA 4PDMA 2NLJC 2IH3C 2ZXWC 4WFEA 4P30A 4QE9A 3RVYA 1P7BA 3LDEA 2WLKA 3AG1C 4HZ3A 4PA6A 5BZBA 4I9WA 3OUFA 3AG3C 2HG5C 4MTGA 1J95A 3K08A 1OCCC 2EINC 1QLEC 3ASOC 3E83A 2EIMC 2HVKC 2QKSA 5KUKA 4J9ZB 4PA4A 3EFFK 2ITDC 3LUTB 4MW8A 3UM7A 2WLHA 4XDJA 2BOBC 3IGAC 2AHZA 1XL6A 4HYOA 4PA3A 4X88A 2WLIA 5CBFA 3T4ZA 4MTFA 3AG2C 4ZBMA 3F7VC 3LDCA 4TWKA 5EC1C 1K4DC 3SPCA 3SYQA 1M56C 5CBHA 3RW0A 3ABLC 4CBCA 2Q6AA 3E8BA 2HVJC 3BEHA 3SYAA 4P9OA 1OCRC 3ZJZA 3OGCC 1R3LC 1R3JC 4RO2A 3FB6C 1ZWIC 3F7YC 3SYPA 3PJSK 4LBEC 4MVMA 3RBZA 4XDLA 3K06A 2WLIB 2ITCC 4MVRA 4WFGA 5B1BC 4PDLA 5EBWC 3VOUA 4JTAB 2A79B 2HFEC 5EBLC 3F5WC 2AHYA 3ABKC 2P7TC 2Q68A 3R65A 4F4LA 3E8GA 5EK0A 1R3KC 3FB8C 4EKWA 2YEVA 3JYCA 2DYRC 4JTDB 4RUEA 3T4DA 3FB5C 2KB1A 3SYCA 4R6ZA 4MTOA 3E89A 4MVZA 1K4CC 3AG4C 4WFHA 4GX2A 5EBMC 2A9HA 2ATKC 3LNMB 4PDVA 1S5HC 2JK5C 4RAIA 3ZRSA 1BL8A 2A0LA 2DYSC 3IFXA 3ABMC 1R3IC 3GB7C 2K1EA 4G27B 5CBGA 4GX0A 3SPIA 5B1AC 2Q69A 3T2MA 3TETA 2EIKC 1M57C 2WLNA 1OCZC 4MSWC 3SPHA 2R9RB 2H8PC 4UUJC 1V54C 2IH1C 3E8HA 1G4YB 3LDDA 4OXSA 4PA7A 2HJFC 2Y69C 3UKMA 5B3SC 1KKDA 2WLJA 3OR6C 4LCUC 4DXWA 4R8CA 3E8FA 4JTCB 4X89A 2WLLA 3K04A 4WFFA 3STLC 4PA9A 3HPLC 4MS2A 2X6AA 1LNQA 4RUFA 1XL4A 5EC2C 2EIJC 4H33A 1V55C 2Q67A 2QTOA 3K0GA 4LP8A 2OCCC 2X6BA 3X2QC 4BW5A 3K03A 2BOCC 4GX5A 4MVUA 3ASNC
chains in the Genus database with same CATH superfamily
4MVSA 3A0RA 2RMKB 1Q86W 2ZE6A 3JSLA 4ZOLA 3JD4A 1DGSA 1NT2B 2ZXWC 5LGNA 2UU9O 3MDSA 1F7YA 4K0KO 3WB2A 2UUAB 4PA6A 4JAAA 3K08A 1YZBA 3K5MA 1NTKH 1WA8A 4PA4A 1PM9A 3MD0A 5LP6C 1I94O 2V1DA 3AG2B 4X88A 5L3BA 5EZYB 2P06A 1IBLB 1CP9A 4TWKA 4YY3B 4DV7B 1L0LH 2IJKA 3FFQA 4DW1A 1SESA 1Q5OA 1YXBA 2YXHA 4BWAA 4O2BB 5LGTA 3RBZA 1R6TA 2YS8A 4WFGA 3P3PA 4U3JB 4FJCC 3CYOA 3F5WC 2Y48A 3JALA 2O57A 4JAVA 4NVPA 1BHAA 5EIBC 3K3WA 1HWYA 1DTOA 4B7KA 5EBMC 5CA1B 2A9HA 2EZOA 1NTZH 1FS0G 2Q69A 4YXWG 4NTXA 2QJ1A 2Q7GA 4I55B 4PELA 2QR4A 4DV5O 2JJ2G 1H2NA 5JCOC 2QE7G 2UXDB 2ZE7A 1HNWB 2GSMB 2N74A 1SA0B 2LFRA 4MS2A 4LF9B 2F95B 1TUBB 2P4VA 4LWSB 3ZHQA 3N2GA 1JMKC 1N4CA 1WNSA 3OM3B 2ZCEA 1KMIZ 1H2KA 4KFMA 3FB7C 2P90A 4P9PA 4FLXA 4OPHA 4U7OA 4JI3O 2YDEA 4JF3A 4H37A 4GX1A 2VQEB 3G67A 3CE2A 1AP6A 3SPGA 5KA5A 5HFMA 3OTOB 2AZ2A 1ROPA 1WA8B 4IYHA 2QWPB 4JYCA 4PI2A 3B4SA 1OZ0A 4CZZA 1P7BA 1P84F 4YJ2A 1K92A 5JVDA 1RPOA 1H8HG 3ZBHA 1N34B 5LP6B 5LYJA 2P22C 3CRCA 5L3CA 4FIPC 1Q3EA 4IHJB 2FB5A 3O9OA 4CS2A 4N23A 4GZRB 1QR9A 4GUNA 2LJ2A 2UXCO 2CTWA 4NKGB 1OCRC 2JRIA 3VQVA 3NXSA 3ZJZA 3JALB 4NTYA 4X64O 1WPXA 3SGIA 1YI2V 1N36O 3N2KA 1L8DA 3I56V 1SS3A 1X4TA 3R65A 1OV9A 3C3TA 2YEVA 1I08A 3B40A 3FB5C 3J7AU 2PI4A 3D36A 3E89A 3C90A 5AG2A 1GH6A 1FKAO 1VEWA 1Q81W 1IBKB 4RWUA 1VF7A 2QKAA 2Q73A 3CCRV 1U96A 3CJHB 3ZMZA 2X0LA 2QA4V 4O4LA 2IH1C 4B3MO 4XBFA 3T1HB 4FFKA 4O4IB 3N2GB 2WLJA 2CTPA 2WLLA 2OWOA 5GONB 1Q6HA 1S5JA 2IW5A 3LNNA 2LW1A 2Q67A 4TT3G 3QF7A 2ADQB 5D5PA 2P6JA 4FMTA 3AG7A 5A2QN 3FYEB 1XBLA 4EB6B 2UU9B 3OMAB 2DWDC 5KUMA 4K0KB 2EILC 1FD9A 5JVDB 3CPWU 3RVZA 3ZMSA 3ICXA 5KX5B 5LYJB 1IXBA 1TUEB 4CC5A 3K5LA 4K3AA 1FXVA 1I94B 1BGYH 3AG3C 2FYUH 3E83A 5LMNB 2GUZB 3BAAA 2LGWA 2QGNA 4YHHO 1HP8A 4HNAA 2Q0OC 3W7TA 4DR1O 2Q7HA 5IYZB 2H94A 2ZIMA 2XAHA 1PV0A 5LL6Y 3GWOA 5BMVA 5K1XA 4ZHQB 3SYQA 2E5LO 1OCRB 4B3RB 2PGGA 4NXNB 3OMIB 3K58A 3HKDA 4RO2A 1M57B 1ZX3A 4JI8O 5GTHZ 2ZR2A 4X62O 1Q82W 4JTAB 5EBLC 5D5QA 1MOFA 1Z5VA 3FAVB 1SETA 1HNXO 2GBOA 5LHIA 2MW2B 2EBOA 3HKEA 1XEQA 3CSXA 2IBZH 1SQPH 2XAJA 4JI0O 4DRXA 1F4MA 3AG4C 2BCCH 4YJ3A 2YIAA 1NTMH 3H1JH 4ASUG 2IU3A 4TSFG 3JD1A 2F4VB 3LDDA 2QWOB 4I0XB 1JR9A 3BRCA 4I50B 3L73H 5JQGB 1F23A 4JI6B 3HPLC 2X6AA 2WPDG 3K0GA 3K03A 4DR4O 1MMMA 3SPJA 3STZC 3TK1A 3ZMUA 1JFFB 3CCSV 4R50A 1VQ9V 3B2EE 5JH7B 4FM2A 2ZDIC 2IJIA 1E1RG 4R7CA 1FFXA 4LH7A 2LGQA 3APOA 2JGUA 4HNAB 4QE9A 2ZDIA 1HDJA 3AG3B 3OGIB 1FYJA 1VF6C 4OX9O 2BTOA 1OCCC 5BMVB 4JGSA 1YCIA 1PL0A 3S3WA 4LF5O 1CXZB 1EFRG 3HKBA 1D2DA 1O9HA 2HP8A 2UXCB 5LA6A 2Q7EA 1FJGB 2W6JG 1RSOB 3HKDB 2RJZA 1KYOF 3CCUV 3A0BZ 3L72H 1PD3A 4DV4O 2Q6AA 4QPJA 1WB7A 2JVDA 4XDLA 5DECA 2AHYA 1SZXA 4K35A 3CEIA 1N8RW 2KG7B 1DF5A 4EKWA 1XI1A 1E79G 4CC6A 2Q5ZA 3U11A 1EZVH 1GMGA 1GTOA 3AG4B 4TV8B 1PPJH 1DK1A 4AI8A 2ETNA 2QDOA 3GB7C 2UUBB 2UXBO 5L3GA 4KUMA 2EIKC 3VBBA 1OCZC 4O2AA 2GTAA 2ZR3A 4EFEA 3UQ8A 1ZUQA 4X65O 3JARA 4JTCB 2PTMA 3APQA 1VQOV 3W7UA 4WFFA 2YXYA 3A2FA 2RDCA 1GK9A 2CGOA 1KKCA 3JCUZ 4BW5A 5JJJB 4LFBO 1I5XA 3L74H 4FLVA 3CRMA 4E4EA 4QE7A 2DWEC 2D2CB 1MZFA 4QIWF 1GM8A 3JAKA 3ZHSA 1S0VA 1GN4A 1DLBA 4DV3B 1JA8A 3HKBB 2PZSA 4YHHB 3QVNA 2BTQB 4DR1B 5LXTA 1TAEA 1XMOB 1QR8A 4CH3A 2BSKB 5KUKA 3DGEA 1QVFU 3JAMN 2F1MA 4XDJA 4BIUA 1BSMA 3DC6A 2CH7A 2WLIA 4JI7B 4Z2WA 3SPCA 5IWAB 4JI2B 3SYAA 5CA0A 3I55V 1M1KW 4LBEC 3E22B 1G1XB 1SQVH 1HNXB 3JD2A 3P32A 1Z2GA 1SQXH 3LSSA 4D7TA 2P7TC 3AK1A 4JI0B 1N33O 2UUCO 1VMGA 1YTFB 3H9VA 2Z5UA 3K9AA 4O4JA 3SDLA 1KU9A 4JASA 1NS1A 2HR3A 3RYIA 3E35A 4LF6O 1K4CC 5C93A 4RAIA 1RFYA 4TUYB 3ABMC 2EIKB 1OCZB 2CTQA 5EYPA 3ZMTA 4UV9A 4MSWC 4J7ZA 2IJJA 4U3FH 1Y74B 1AJQA 3TXQA 1OHHG 1G6UA 5KA6A 2XNDG 4GT1A 5EC2C 3FYIB 3X2QC 2BOCC 4BR6A 4K8ZA 4TV9A 1NVPD 3AK2A 3G6BA 4H13B 2Y0IA 1Q6IA 3OAAG 4JI5O 3ZMVA 2WA3A 3ZHVA 3CWBH 3CCJV 5LHGA 4K8XA 5E1AC 3E86A 4Q20A 2CUGA 4GYCB 3MHHC 2QTSA 5LXTB 3GWKC 4DR7O 5CB4A 1JJOA 1AI7A 3LDEA 3OEHG 1YJWV 3ZIAG 5IT9N 1I5YA 4JZGA 4IIJA 1YEWA 5CA3A 1PNMA 4FFBB 2AGAA 5CA0B 4I5SA 1W2BU 3VQWA 3SJBC 3F7VC 3G6EV 1K4DC 4FLTA 1XNRO 1MNGA 3CCVV 3L70H 1NBMG 3SYPA 3QTCA 3BHPA 3RYIB 3A0HZ 4LFCO 2W6IG 2AW9A 1YF2A 1R3KC 4Z1MG 3P3NA 3T4DA 4MTOA 1DF4A 4DK1A 4WFHA 3ABMB 1L1FA 3RT3C 2K1EA 4X65B 2Q0AA 4DV1O 3D3QA 3ETQA 2ZT9B 3JSNA 4WBNA 1S72V 5FL7G 3M99B 4AQYO 3UKMA 4DUZB 5B3SC 3BVOA 1P7GA 3E8FA 3JD0A 2F66C 4ZKIA 4TV9B 4DV2O 3BABA 1M4UA 4JV5O 3X2QB 2P4KA 4J80A 1XUQA 1TVKA 2OCCC 2VWKA 3SR2C 3BA8A 2XAQA 5IYDO 3OUSA 3T1YB 4X1KA 3UO2A 2ZM6B 5CB4B 4KHPO 1XMQB 5FPOA 4MW3A 1KP2A 3P30A 1SF9A 4A5UB 3K57A 4LF4O 1HR0O 4LNUA 2B5UA 2X7RB 3CXCU 1K5QA 3AG1C 5BZBA 1J95A 4ZOLB 2EINC 3ASOC 3CMAV 3JCZA 2CTRA 4J9ZB 3G80A 3OMNB 2KQXA 1K34A 4YIPA 1OJHA 1COWG 4MTFA 4DR5O 3O65A 5CBHA 1S5LZ 3RW0A 3ABLC 1QBZA 1JJ2U 2NNUA 4DV6O 1N33B 1ZSPA 1ZLZA 1ZWIC 4LF8B 1WP8A 1Y76A 5H2FZ 2QWNB 1B04A 4MT8A 4GKKO 2YIBD 4F4LA 1FXKC 4UCSA 5IDJA 1YDXA 4X9QA 2XAFA 2L6LA 3U10A 2JDIG 4MVZA 1AJNA 1FXKA 3ZRSA 3K79A 2A0LA 4ZI7A 5BY1A 2QEXV 4CH5A 3SPIA 1WN7A 1M57C 3RFRA 2XUMA 1NR7A 5B3SB 4LFAO 3D36C 4PA7A 2Y69C 1TVKB 3B77A 2VRZA 4OPAA 3RGBA 4LCUC 4X20A 2ZQMA 1LNQA 2OCCB 1V55C 3CC2V 2EJRA 1GAXA 2Q4PA 2IU0A 4GX5A 4MVUA 1AB3A 1EN4A 3CCQV 1ORQC 1IBMB 1M90W 4LNUB 3NR7A 4NYKA 4FLUA 1AVMA 2R70A 3ZHRA 1XHZA 4IL6Z 2W0XA 1K5SA 4F6RA 2HEPA 5LMUO 3KZIZ 4J7JA 1SC5B 3AG1B 3ZHUA 2WLKA 2EINB 3ASOB 1EZJA 2QSAA 1UJWB 2Q9LA 1NVPB 4B3SO 2QWQB 2YSUB 1XNRB 4YJ2B 2CE4A 3ABLB 4IT5A 1Y76B 2XASA 2N05A 3TGUH 4ABMA 4LFCB 1XNQO 1Y4MA 4WFAV 1J5EO 2PYJA 3S3XA 4CH4A 4H44B 3H01A 1AI4A 1Z5WA 3RYFA 5GTIZ 2PI5A 1WP7A 1Y66A 1FXKB 2B1GA 1YTFD 5DM6V 3E8GA 3SJCC 4FZ0A 1QLNA 3JYCA 1PNKA 1XDCA 2HHHO 3N2KB 2EULA 5ITZA 3U0ZA 2GV9A 1GO3F 1R3IC 4AQYB 1R1BA 2YEVB 3QNEA 1URFA 4FLWA 4JI1O 1Q8IA 1B6QA 1YHQV 1PKXA 5IY5B 4JYAO 2Y69B 2QM4A 3BCCH 4JV5B 5IJ0A 2HJFC 1HW7A 4LH6A 3ZRXA 5DN6G 3K04A 1HNZO 2FL4A 4DR3O 1W0JG 1V55B 3CRQA 3VQXA 3K5NA 1VQKV 4RUFA 2EIJC 3Q4HA 5KHKA 4O4LB 3UO3A 5IYCO 2YIBA 1TGOA 1PL4A 4BIOA 4DV5B 3CX5F 2WLLB 3F5TA 3WG7C 4X8AA 2X6CA 1X59A 1H2SB 1Y67A 3OD4A 1JPXA 4JAUA 4WFEA 4P30A 1IX9A 4WCEV 2DMXA 3IJ4A 4JYBA 4JI3B 3OT7A 4QGPA 4TQFA 2HVKC 3OTFA 1I7FA 4UB6Z 1R6NA 4DR6O 1GN3A 1ENVA 1XL6A 4CH6A 1A32A 3OEEG 5EC1C 4L87A 4HAMA 1SQQH 1GN6A 3HB3B 4GKKB 2PUSA 3VOUA 4QPKA 1VQ4V 3DSQA 2RN9A 1AILA 3DTUB 2HKOA 4G2KA 3CXHF 4JPRA 4NR1A 4X64B 1VQ8V 1CPYA 1D5AA 3M8AA 4TQDA 2FKXA 1N36B 2ZE8A 2XTAA 4LFAB 3CCLV 2LFSA 3CB2A 2ILMA 3HKEB 1M9NA 1N0JA 2R9RB 5HFLA 2KSDA 1QNMA 4DRXB 3CS5A 5FNVA 4DW0A 2D3OW 4UVAA 4YJ3B 3EVKA 1SKVA 3STLC 2EIJB 4UV8A 3W7WA 2VQFO 4KL1A 1VQLV 4UVBA 3JAWA 4B3MB 2CGNA 3WG7B 5LMUB 2F93B 2UUAO 4QNHB 2ADPA 2VS0A 4MTXA 1K33A 3K0DA 5KHJA 2XHBA 2NLJC 3ZEDA 2JGDA 4PJ0Z 1KBHA 1RP3B 4I9WA 4DK0A 1IBLO 1NU1H 2GHYA 4YY3O 1P49A 4IGGA 4DV7O 1QLEC 2EIMC 1FFXB 4Z1VA 5LOVA 5E79Z 5LBQA 4D7SA 4FM0A 1KP3A 3T4ZA 5KHHA 1J5EB 5C8YA 1M56C 2EZPA 3D8CA 1UPGA 2AZ0A 4PD4F 2HLDG 3BEHA 5KMGA 3UCSC 5JJNB 5LA6B 5LHHA 4D6TH 2E75B 1JOYA 2Y0PA 4KXRA 2HJDA 2R9AA 2E5LB 2JJ1G 2FMLA 1BT8A 2JS5A 2R9IA 1FFTB 1MSWD 1QU7A 2RNBA 4JI8B 4UCUA 4I4TA 4X62B 4B7EA 3JATA 2H3OA 3LNMB 5IE9A 2JK5C 5FNVB 2DYSC 4JI4O 3HKCA 1HNWO 5CBGA 1B06A 1S77D 1EM1A 1JQ0A 3H1IH 3CCMV 1ZL8A 2WLNA 1HNZB 2OTJV 1AJPA 2QKCA 2L35A 4I9QA 4J10A 1KUQA 1IXMA 2ZIOA 1AROP 3E2EA 4PA9A 3KKYA 2M7WA 2ZKOA 4J7KA 4O2AB 4H33A 3WB0A 1D5NA 2QTOA 4RQFA 3OTOO 1AI6A 3JARB 4NB5A 5J9PC 1PP9H 3CC4V 2ZD9A 4JYYA 1WAZA 1SERA 4EEQA 4PHZA 2E74B 4MVOA 4B08A 3TCUA 1N34O 1NH2D 3MHSC 3BPZA 4DR4B 2DQ0A 4RQEA 5LOVB 4HZ3A 5EZYA 1Q90D 1QLEB 2RQ6A 3JAKB 2EIMB 2QM8A 2BOBC 3IGAC 4O2BA 4HYOA 4PA3A 5CBFA 1JCHA 1M56B 4U3JA 4OX9B 2KKWA 1IVSA 4CBCA 2WSSG 4LF5B 1YVWA 4UCOA 4YIOA 3TJTA 1KQSU 1H38A 2R72A 2UXNA 1GN2A 1P4RA 2CH7B 3EHBB 2WLIB 5B1BC 4PDLA 5TISZ 3FD9A 5BR8O 4DV4B 2Z0AA 1IBKO 5KLVH 1WJZA 4RUEA 1NKDA 1I0HA 1XOUA 3T1HO 1L0NH 4E2LA 2DYSB 4GX2A 4UCVA 4PDVA 3QG5A 1BL8A 3RYHA 3THOA 4G27B 4I7ZB 4O4JB 1SA0A 4X66O 1TUBA 4LWSA 3SPHA 1V54C 5CMUA 3ZS8C 5KHIA 2VQFB 1UFIA 3ABTA 5F2VO 2Y4TA 2P5OA 5EYPB 1W59A 2UXBB 1XL4A 5KAFZ 1VIBA 4LP8A 3B8MA 1XILA 3ASNC 2K9PA 4IYIA 3BA9A 3SYOA 3LSUA 4AILC 1PNLA 5LMNO 1JVMA 1H8EG 4PDMA 5LP6A 4LFBB 4AHCA 4X1IA 4FZ1A 4IHJA 1KB9F 2G38A 1QHTA 4DUYO 2YI8A 1BMFG 4CS3A 5H6QA 4B3RO 2JS3A 4NXNO 2QKSA 5GW7A 3UM7A 3IC9A 3CC7V 2YUAA 3ZHTA 2AHZA 4IIJB 1B3QA 3OE7G 4BIZA 1RPRA 5B1BB 1VQMV 2IJHA 3K06A 1BZKA 3OW2U 4MVRA 2V4DA 1YIJV 1SQGA 5EK0A 3RYHB 3RWRD 2ZE5A 3ETGA 4JI4B 1VQ6V 2A7WA 2KB1A 3CJHA 2F4VO 2UXXA 1AP5A 3ZCCA 2CK3G 1S3JA 4O4IA 5JCOA 4Q6GA 2UUCB 4JI6O 2EX3A 2XT9A 5GONA 1V54B 2N04A 3ZX6A 4ZIBA 3B09A 2ZXWB 4LF6B 1NQTA 4WFBV 3IC7A 4NTWA 4R8CA 4X89A 2A3QA 2LW7A 1G8MA 4EB6A 2Q8VA 2F23A 1AR1B 3CRRA 4PV1B 4WBNB 3ASNB 3J81N 2WAMA 1R6KA 2PYLA 5KX5A 1Q6UA 1YJ9V 4B3TO 4X1IB 4P2ZA 1BS3A 1IZ3A 3FKSG 3H1HH 4MVQA 4XDKA 1BCCH 5IY5C 1XREA 5LGUA 2CAZC 2GUZA 2OCHA 3D3IA 2IH3C 2Z3YA 1YITV 1FJGO 1E1QG 1M5IA 4X1KB 5IYZA 2FTKA 4JI5B 4ZHQA 3OFNG 3ZRVA 4O4HA 1N32O 3LUTB 1AI5A 4MW8A 2M6YA 4DR7B 1U97A 1US6A 4LF7O 5CN0A 1BQZA 5IYBO 1H2MA 4F6EA 2DW4A 4ZBMA 3GVMA 2ZNIA 1NH2B 2ZNJA 2PF4E 1VQ5V 3FAVA 5BR8B 4UFZA 1EBOA 1SRYA 3FB6C 5EBWC 2A79B 1IDSA 2CDYA 4OGQB 2UUBO 4GLXA 3FB8C 2JEXA 5J2TA 1R73A 2DYRC 4H0LB 3W7SA 3KCYA 4R6ZA 1Y6XA 4X66B 2F43G 2NN4A 5KHGA 3SJAC 4I0XA 3HR0A 1S5HC 4I50A 3IAYA 5JQGA 1VF5B 1AR4A 2YIDA 1H2LA 1WPBA 5H9CA 3J80N 1GRJA 4UUJC 2H8PC 3G71V 4J41A 3ETEA 2C2AA 1G4YB 2QM7A 1VQPV 4TOIA 3OR6C 1JFFA 4ZI7B 1BHBA 3BY6A 4DR2O 5JH7A 4N21A 4DV1B 1BQ0A 1NJIW 2E76B 1FAFA 2E3CA 3AK3A 4DV3O 2NR5A 5IJ9A 5L3FA 3M7MX 4X20B 1WB8A 4DV2B 4G28B 4J9YB 4PDRA 1XMOO 4QJFB 4GKJO 4UVCA 2WLMA 4DUYB 4O4HB 3WU2Z 3CP1A 4C7UA 3B8NA 1RSOA 1EN5A 4KHPB 4JI7O 5DEDA 4U7NA 5IWAO 4JI2O 2VWJA 4F6RB 1V9PA 4UXNA 2ITDC 4LF4B 2PY5A 1HR0B 2WLHA 3RYCA 1SQFA 4FK5C 3ZRWA 3LDCA 5A9GA 1Q7YW 2HVJC 1MG1A 2LP7A 2KG7A 4FVMA 1VQNV 2OT5A 1R3JC 1VARA 5J2TB 4MVMA 2OTLV 3ETDA 4TV8A 1RM1C 4LR3A 2HFEC 4DR5B 3CRAA 4DV0O 2Q68A 1EN6A 3JD3A 1K97A 2DYRB 4DV6B 3ZN1A 3RYFB 3DXRA 3PN1A 5BXZA 1F51A 5B1AC 3TETA 1ZAUA 1GM7A 2EILB 2B9ZA 2WA4A 3E8HA 3CCEV 5B1OA 2YXLA 2YICA 1NR1A 5ITZB 3G4SV 3QO7A 1XHXA 5IJ9B 4WF9V 2GTSA 1MABG 4X1YA 2EJ7A 4PI0A 1MSDA 2XAGA 4B3TB 3I5DA 4BW9A 5IJ0B 4NXMO 1TA8A 4W4LA 1M93A 3OR7C 3T1CA 2Y4UA 3TXSA 3ABUA 2BTQA 1VF6A 1OCOC 2A06H 2W0FC 3Q4HB 2B1IA 2OIEA 1BE3H 2BSKA 1IURA 5FPRA 2YC0A 1N32B 3RYCB 1YJNV 1SZTA 1K3EA 4LF7B 2HG5C 3RN4A 2LO1A 2MK3A 3ZRWB 2DJVA 4J42A 2QWRB 3E22A 1QVGU 1LR1A 2YI9A 3L9DA 1K7DA 3OGCC 5B5EZ 4B3SB 2OIGA 3F7YC 1RM1B 5H5NA 3W7XA 2ITCC 4CS4A 4FLZA 1THZA 1O9GA 3MAQA 1FPOA 3ABKC 4TUYA 1K9MW 3DXRB 1Q43A 4EFBA 2ODMA 2LQTA 1NI8A 5L3EA 4BAYA 4W4KA 1XNQB 4L8JA 5H6RA 1SQBH 4DUZO 1Y74A 4FLYA 4DYLA 3IFXA 5B1AB 3K5OA 3ML0A 4JZ2A 3WB1A 1WLEA 4LC1A 3JASA 4DR2B 4X1YB 3UT5A 3KCXA 1GKFA 1T5EA 5JWPA 3QO8A 2HHHB 4UB8Z 2JEUA 3T1YO 1KKDA 2ZM6O 4UCTA 5J2UA 1VQ7V 1XMQO 1CEZA 3L75H 1MZEA 1JX9A 5B1NA 4ICGA 1QQCA 4JI1B 2DN9A 1OCCB 4JYAB 2X6BA 2XOKG 2UXDO 1XQ8A 2V7QG 5B66Z 2ZINA 4GKJB 1OCOB 2ARHA 4FPPA 3SJQC 4LF9O 1AR5A 1W0KG 2RCVA 5KAIZ 4DR3B 1GM9A 3KG2A 4UCRA 3VQYA 3ZN0A 3JAWB 4FFBA 5L3DA 1LUVA 3RVYA 2VQEO 1NZ6A 1YSCA 3OUFA 3K9SA 4MTGA 3N27A 3LSQA 3K59A 3EFFK 3QO5A 3CD6V 3H1LH 1VP7A 2JGDB 1MA1A 5EIBD 4LF8O 3EXAA 2DOSA 5FLXN 1KECA 4J11A 3WFVA 3AG2C 3E8BA 4P9OA 3AEIA 1R3LC 4HBNA 4DV0B 3R66A 5K1PA 4DR6B 2OYQA 3PJSK 2BE3A 3ABKB 3A8TA 2DE0X 5C8YB 2AXTZ 4KP4A 4DO2A 5KMGB 2JIZG 1KD1W 2IM9A 1FXHA 4JTDB 3FX7A 1QCEA 3SYCA 5JJEB 3DC5A 3JASB 3UT5B 3CMEV 4FM1A 2P67A 2ATKC 4GCZA 1K73W 2WWWA 1S76D 4GX0A 5J2UB 3T2MA 3CHXA 3C3SA 5CA1A 4I4TB 1KC8W 4OXSA 3JATB 1IBMO 1ZTEA 4DXWA 3HKCB 4NXMB 1N0NA 1H2GA 2GDSA 3L71H 3BFRA 4I55A 1ZL8B 3H1KH 1K8AW 2DQ3A 1LUWA 1F4NA
chains in the Genus database with same CATH topology
4MVSA 3A0RA 4QE7A 2WLLB 1YJ9V 3WG7C 1Q86W 4X8AA 2DWEC 2X6CA 4QIWF 4P2ZA 1GM8A 3FKSG 4MVQA 4XDKA 1S0VA 5IY5C 5LGUA 3JD4A 2ZXWC 2IH3C 3D3IA 1DLBA 1JPXA 2Z3YA 4JAUA 4P30A 4WFEA 5LGNA 1YITV 4WCEV 1E1QG 2FTKA 4PA6A 4JYBA 3K08A 3OFNG 3ZRVA 1QR8A 2HVKC 5KUKA 4PA4A 3MD0A 3DGEA 1AI5A 3LUTB 4MW8A 1QVFU 1R6NA 4XDJA 1ENVA 5CN0A 4BIUA 1XL6A 2V1DA 3AG2B 4X88A 5L3BA 2WLIA 5IYBO 3OEEG 2DW4A 4ZBMA 1CP9A 4TWKA 5EC1C 3SPCA 1NH2B 2IJKA 4L87A 4HAMA 1VQ5V 1SESA 3HB3B 3SYAA 3I55V 1EBOA 1M1KW 1SRYA 3FB6C 5LGTA 4LBEC 3RBZA 4WFGA 3VOUA 3JD2A 3P32A 5EBWC 2A79B 4FJCC 3CYOA 3LSSA 4QPKA 3F5WC 2Y48A 1VQ4V 2P7TC 1YTFB 2Z5UA 3DTUB 2HKOA 2JEXA 3FB8C 3K9AA 4G2KA 4JAVA 1R73A 2DYRC 4JASA 4JPRA 3W7SA 1BHAA 2HR3A 4R6ZA 1VQ8V 3K3WA 1CPYA 1HWYA 1DTOA 3E35A 2F43G 1K4CC 5C93A 5EBMC 2A9HA 4RAIA 2EZOA 1S5HC 3CCLV 3ABMC 2EIKB 1FS0G 1OCZB 2Q69A 2LFSA 4YXWG 3ZMTA 4UV9A 4MSWC 1M9NA 2IJJA 5H9CA 2R9RB 2H8PC 4PELA 4UUJC 5HFLA 3G71V 3ETEA 2C2AA 1G4YB 2QM7A 1VQPV 1AJQA 2JJ2G 2D3OW 3OR6C 4UVAA 1OHHG 1BHBA 3BY6A 2QE7G 5KA6A 2GSMB 3STLC 2EIJB 2XNDG 4UV8A 2LFRA 4MS2A 4N21A 4GT1A 3W7WA 1NJIW 5EC2C 1VQLV 3FYIB 3X2QC 4UVBA 3OM3B 2BOCC 3WG7B 4KFMA 1NVPD 3FB7C 5L3FA 2P90A 4P9PA 3OAAG 4U7OA 4QNHB 3ZMVA 4G28B 3CCJV 5LHGA 4JF3A 4J9YB 4MTXA 4PDRA 4H37A 4GX1A 5E1AC 3E86A 1K33A 4Q20A 4QJFB 3K0DA 4UVCA 3MHHC 2WLMA 3SPGA 2NLJC 5KA5A 5HFMA 3CP1A 1ROPA 4JYCA 1OZ0A 3B8NA 4CZZA 1AI7A 1P7BA 3LDEA 3OEHG 4I9WA 1K92A 4U7NA 3ZIAG 1YJWV 2GHYA 1QLEC 1RPOA 1H8HG 1I5YA 2EIMC 4UXNA 2ITDC 5CA3A 1PNMA 2WLHA 5L3CA 4FIPC 5LBQA 4I5SA 4FK5C 1KP3A 3T4ZA 1W2BU 4N23A 3F7VC 3LDCA 3ZRWA 3G6EV 1K4DC 1QR9A 1M56C 2EZPA 1Q7YW 2HLDG 1MG1A 2HVJC 3BEHA 2LP7A 1OCRC 3ZJZA 1VQNV 3NXSA 2OT5A 1R3JC 1WPXA 3CCVV 5LHHA 1NBMG 3SYPA 1YI2V 4MVMA 2OTLV 3ETDA 1JOYA 1RM1C 2HFEC 3I56V 2Q68A 3JD3A 1K97A 3R65A 2W6IG 2JJ1G 2DYRB 1R3KC 4Z1MG 2YEVA 1MSWD 2R9IA 1FFTB 3T4DA 3FB5C 2PI4A 4MTOA 1DF4A 3D36A 3E89A 3ZN1A 4WFHA 3ABMB 3LNMB 2JK5C 2DYSC 1L1FA 1S77D 5CBGA 1Q81W 2K1EA 1JQ0A 1F51A 5B1AC 3TETA 3CCMV 1GM7A 2WLNA 2EILB 3CCRV 2OTJV 3ZMZA 2X0LA 2QA4V 3E8HA 2IH1C 5FL7G 3CCEV 1S72V 1AJPA 3M99B 5B1OA 4XBFA 1NR1A 3UKMA 5B3SC 2WLJA 3G4SV 3QO7A 3E8FA 3JD0A 1IXMA 2WLLA 1AROP 4ZKIA 4WF9V 3E2EA 1MABG 4PA9A 2M7WA 2IW5A 4H33A 3X2QB 2Q67A 2QTOA 2XAGA 4TT3G 4RQFA 2OCCC 1AI6A 2P6JA 2XAQA 5IYDO 4FMTA 3OR7C 3T1CA 3OUSA 3FYEB 5J9PC 3CC4V 2ZD9A 3ABUA 3OMAB 2DWDC 1OCOC 1SERA 5KUMA 2EILC 4MW3A 4MVOA 2W0FC 1KP2A 2B1IA 3P30A 3TCUA 1NH2D 3MHSC 3CPWU 3RVZA 3ZMSA 2B5UA 2X7RB 2DQ0A 3CXCU 4RQEA 1TUEB 1K5QA 3AG1C 1SZTA 4HZ3A 1YJNV 5BZBA 1FXVA 1K3EA 1QLEB 3AG3C 2EIMB 2HG5C 1J95A 2MK3A 2EINC 3ASOC 3E83A 3CMAV 3ZRWB 2QM8A 3JCZA 4J9ZB 3OMNB 3W7TA 1K34A 2BOBC 3IGAC 4HYOA 4PA3A 2H94A 2XAHA 5CBFA 1QVGU 1COWG 3GWOA 4MTFA 1JCHA 1M56B 3SYQA 5CBHA 1OCRB 3ABLC 3RW0A 4CBCA 1QBZA 1K7DA 3OMIB 2WSSG 3OGCC 1JJ2U 1KQSU 1H38A 2NNUA 4RO2A 1M57B 2UXNA 1ZWIC 3F7YC 1P4RA 3EHBB 1RM1B 2WLIB 3W7XA 2ITCC 2ZR2A 5B1BC 1Q82W 4PDLA 1THZA 4JTAB 5EBLC 3ABKC 4MT8A 1K9MW 1MOFA 1SETA 4F4LA 1FXKC 5IDJA 5LHIA 4RUEA 5L3EA 4BAYA 1NKDA 2EBOA 2XAFA 5H6RA 2XAJA 2JDIG 4MVZA 1F4MA 1AJNA 1FXKA 3AG4C 2DYSB 4E2LA 4GX2A 4PDVA 3ZRSA 1BL8A 2A0LA 3IFXA 3K79A 5B1AB 4G27B 2QEXV 3ML0A 3SPIA 1WLEA 4LC1A 1M57C 4ASUG 2IU3A 3SPHA 4TSFG 1GKFA 3JD1A 1V54C 5CMUA 1NR7A 5B3SB 3QO8A 3LDDA 4PA7A 2Y69C 3ABTA 3B77A 2JEUA 1KKDA 4LCUC 1VQ7V 1CEZA 1JX9A 5B1NA 1F23A 2ZQMA 3HPLC 2X6AA 1LNQA 1XL4A 2OCCB 2WPDG 1V55C 3K0GA 3CC2V 1OCCB 4LP8A 3B8MA 2X6BA 2EJRA 3K03A 2IU0A 2XOKG 4GX5A 2V7QG 4MVUA 3ASNC 3SPJA 3CCQV 1ORQC 3STZC 3TK1A 3ZMUA 1OCOB 4FPPA 3SJQC 1M90W 3SYOA 3CCSV 4R50A 1VQ9V 1W0KG 1PNLA 1GM9A 1K5SA 3KG2A 2ZDIC 2IJIA 1E1RG 4R7CA 1JVMA 1H8EG 3ZN0A 4PDMA 5L3DA 3AG1B 4QE9A 2ZDIA 3RVYA 2WLKA 3AG3B 1YSCA 3OUFA 2EINB 3ASOB 1EZJA 4MTGA 1BMFG 1OCCC 5H6QA 4JGSA 1UJWB 1PL0A 2QKSA 3LSQA 1EFRG 3EFFK 3QO5A 5GW7A 3CD6V 1NVPB 3UM7A 3CC7V 2YSUB 2W6JG 2AHZA 3CCUV 1KECA 3WFVA 3AG2C 1PD3A 3ABLB 2Q6AA 2XASA 3E8BA 4P9OA 4QPJA 3AEIA 1R3LC 3OE7G 4BIZA 1Y4MA 1RPRA 4WFAV 5B1BB 1VQMV 2IJHA 3PJSK 4XDLA 3K06A 3OW2U 4MVRA 3ABKB 3H01A 1AI4A 2PI5A 2AHYA 1Y66A 4KP4A 4DO2A 1YIJV 1FXKB 2B1GA 1YTFD 1N8RW 2JIZG 5DM6V 3E8GA 1KD1W 5EK0A 1DF5A 4EKWA 1E79G 3JYCA 1QLNA 1FXHA 3ETGA 1PNKA 4JTDB 1VQ6V 1QCEA 2KB1A 3SYCA 2UXXA 1GMGA 1GTOA 3AG4B 3ZCCA 2CK3G 1S3JA 3CMEV 2P67A 2ATKC 4GCZA 1K73W 2WWWA 1S76D 1GO3F 1R3IC 3GB7C 2YEVB 4GX0A 5L3GA 3T2MA 3QNEA 4KUMA 2EIKC 3VBBA 1OCZC 1V54B 1B6QA 2ZR3A 1PKXA 5IY5B 1YHQV 1R6KA 2Y69B 1KC8W 4OXSA 2HJFC 2ZXWB 1NQTA 4WFBV 3IC7A 3ZRXA 5DN6G 4DXWA 4R8CA 4JTCB 4X89A 1VQOV 3K04A 3W7UA 1G8MA 4WFFA 1H2GA 1W0JG 1V55B 1VQKV 4RUFA 1GK9A 1AR1B 2EIJC 1K8AW 5IYCO 3ASNB 2DQ3A 4BW5A 2WAMA 1F4NA 1I5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVS A;  3SPJ A;  3OR7 C;  3T1C A;  1ORQ C;  3STZ C;  3OUS A;  4KFM A;  3FB7 C;  4QE7 A;  3SJQ C;  5J9P C;  2WLL B;  4P9P A;  3SYO A;  2ZD9 A;  3WG7 C;  4X8A A;  2DWE C;  2DWD C;  1OCO C;  4R50 A;  2X6C A;  5KUM A;  4QNH B;  4G28 B;  4P2Z A;  2EIL C;  4MW3 A;  4MVO A;  2W0F C;  4MVQ A;  4XDK A;  3KG2 A;  4J9Y B;  4PDR A;  4H37 A;  4GX1 A;  3TCU A;  5IY5 C;  5E1A C;  3E86 A;  3K0D A;  1JVM A;  4R7C A;  2WLM A;  3SPG A;  3RVZ A;  4PDM A;  2NLJ C;  2IH3 C;  2ZXW C;  4WFE A;  4P30 A;  4QE9 A;  3RVY A;  1P7B A;  3LDE A;  2WLK A;  3AG1 C;  4HZ3 A;  4PA6 A;  5BZB A;  4I9W A;  3OUF A;  3AG3 C;  2HG5 C;  4MTG A;  1J95 A;  3K08 A;  1OCC C;  2EIN C;  1QLE C;  3ASO C;  3E83 A;  2EIM C;  2HVK C;  2QKS A;  5KUK A;  4J9Z B;  4PA4 A;  3EFF K;  2ITD C;  3LUT B;  4MW8 A;  3UM7 A;  2WLH A;  4XDJ A;  2BOB C;  3IGA C;  2AHZ A;  1XL6 A;  4HYO A;  4PA3 A;  4X88 A;  2WLI A;  5CBF A;  3T4Z A;  4MTF A;  3AG2 C;  4ZBM A;  3F7V C;  3LDC A;  4TWK A;  5EC1 C;  1K4D C;  3SPC A;  3SYQ A;  1M56 C;  5CBH A;  3RW0 A;  3ABL C;  4CBC A;  2Q6A A;  3E8B A;  2HVJ C;  3BEH A;  3SYA A;  4P9O A;  1OCR C;  3ZJZ A;  3OGC C;  1R3L C;  1R3J C;  4RO2 A;  3FB6 C;  1ZWI C;  3F7Y C;  3SYP A;  3PJS K;  4LBE C;  4MVM A;  3RBZ A;  4XDL A;  3K06 A;  2WLI B;  2ITC C;  4MVR A;  4WFG A;  5B1B C;  4PDL A;  5EBW C;  3VOU A;  4JTA B;  2A79 B;  2HFE C;  5EBL C;  3F5W C;  2AHY A;  3ABK C;  2P7T C;  2Q68 A;  3R65 A;  4F4L A;  3E8G A;  5EK0 A;  1R3K C;  3FB8 C;  4EKW A;  2YEV A;  3JYC A;  2DYR C;  4JTD B;  4RUE A;  3T4D A;  3FB5 C;  2KB1 A;  3SYC A;  4R6Z A;  4MTO A;  3E89 A;  4MVZ A;  1K4C C;  3AG4 C;  4WFH A;  4GX2 A;  5EBM C;  2A9H A;  2ATK C;  3LNM B;  4PDV A;  1S5H C;  2JK5 C;  4RAI A;  3ZRS A;  1BL8 A;  2A0L A;  2DYS C;  3IFX A;  3ABM C;  1R3I C;  3GB7 C;  2K1E A;  4G27 B;  5CBG A;  4GX0 A;  3SPI A;  5B1A C;  2Q69 A;  3T2M A;  3TET A;  2EIK C;  1M57 C;  2WLN A;  1OCZ C;  4MSW C;  3SPH A;  2R9R B;  2H8P C;  4UUJ C;  1V54 C;  2IH1 C;  3E8H A;  1G4Y B;  3LDD A;  4OXS A;  4PA7 A;  2HJF C;  2Y69 C;  3UKM A;  5B3S C;  1KKD A;  2WLJ A;  3OR6 C;  4LCU C;  4DXW A;  4R8C A;  3E8F A;  4JTC B;  4X89 A;  2WLL A;  3K04 A;  4WFF A;  3STL C;  4PA9 A;  3HPL C;  4MS2 A;  2X6A A;  1LNQ A;  4RUF A;  1XL4 A;  5EC2 C;  2EIJ C;  4H33 A;  1V55 C;  2Q67 A;  2QTO A;  3K0G A;  4LP8 A;  2OCC C;  2X6B A;  3X2Q C;  4BW5 A;  3K03 A;  2BOC C;  4GX5 A;  4MVU A;  3ASN C; 
#chains in the Genus database with same CATH topology
 4MVS A;  3A0R A;  2RMK B;  1Q86 W;  2ZE6 A;  3JSL A;  4ZOL A;  3JD4 A;  1DGS A;  1NT2 B;  2ZXW C;  5LGN A;  2UU9 O;  3MDS A;  1F7Y A;  4K0K O;  3WB2 A;  2UUA B;  4PA6 A;  4JAA A;  3K08 A;  1YZB A;  3K5M A;  1NTK H;  1WA8 A;  4PA4 A;  1PM9 A;  3MD0 A;  5LP6 C;  1I94 O;  2V1D A;  3AG2 B;  4X88 A;  5L3B A;  5EZY B;  2P06 A;  1IBL B;  1CP9 A;  4TWK A;  4YY3 B;  4DV7 B;  1L0L H;  2IJK A;  3FFQ A;  4DW1 A;  1SES A;  1Q5O A;  1YXB A;  2YXH A;  4BWA A;  4O2B B;  5LGT A;  3RBZ A;  1R6T A;  2YS8 A;  4WFG A;  3P3P A;  4U3J B;  4FJC C;  3CYO A;  3F5W C;  2Y48 A;  3JAL A;  2O57 A;  4JAV A;  4NVP A;  1BHA A;  5EIB C;  3K3W A;  1HWY A;  1DTO A;  4B7K A;  5EBM C;  5CA1 B;  2A9H A;  2EZO A;  1NTZ H;  1FS0 G;  2Q69 A;  4YXW G;  4NTX A;  2QJ1 A;  2Q7G A;  4I55 B;  4PEL A;  2QR4 A;  4DV5 O;  2JJ2 G;  1H2N A;  5JCO C;  2QE7 G;  2UXD B;  2ZE7 A;  1HNW B;  2GSM B;  2N74 A;  1SA0 B;  2LFR A;  4MS2 A;  4LF9 B;  2F95 B;  1TUB B;  2P4V A;  4LWS B;  3ZHQ A;  3N2G A;  1JMK C;  1N4C A;  1WNS A;  3OM3 B;  2ZCE A;  1KMI Z;  1H2K A;  4KFM A;  3FB7 C;  2P90 A;  4P9P A;  4FLX A;  4OPH A;  4U7O A;  4JI3 O;  2YDE A;  4JF3 A;  4H37 A;  4GX1 A;  2VQE B;  3G67 A;  3CE2 A;  1AP6 A;  3SPG A;  5KA5 A;  5HFM A;  3OTO B;  2AZ2 A;  1ROP A;  1WA8 B;  4IYH A;  2QWP B;  4JYC A;  4PI2 A;  3B4S A;  1OZ0 A;  4CZZ A;  1P7B A;  1P84 F;  4YJ2 A;  1K92 A;  5JVD A;  1RPO A;  1H8H G;  3ZBH A;  1N34 B;  5LP6 B;  5LYJ A;  2P22 C;  3CRC A;  5L3C A;  4FIP C;  1Q3E A;  4IHJ B;  2FB5 A;  3O9O A;  4CS2 A;  4N23 A;  4GZR B;  1QR9 A;  4GUN A;  2LJ2 A;  2UXC O;  2CTW A;  4NKG B;  1OCR C;  2JRI A;  3VQV A;  3NXS A;  3ZJZ A;  3JAL B;  4NTY A;  4X64 O;  1WPX A;  3SGI A;  1YI2 V;  1N36 O;  3N2K A;  1L8D A;  3I56 V;  1SS3 A;  1X4T A;  3R65 A;  1OV9 A;  3C3T A;  2YEV A;  1I08 A;  3B40 A;  3FB5 C;  3J7A U;  2PI4 A;  3D36 A;  3E89 A;  3C90 A;  5AG2 A;  1GH6 A;  1FKA O;  1VEW A;  1Q81 W;  1IBK B;  4RWU A;  1VF7 A;  2QKA A;  2Q73 A;  3CCR V;  1U96 A;  3CJH B;  3ZMZ A;  2X0L A;  2QA4 V;  4O4L A;  2IH1 C;  4B3M O;  4XBF A;  3T1H B;  4FFK A;  4O4I B;  3N2G B;  2WLJ A;  2CTP A;  2WLL A;  2OWO A;  5GON B;  1Q6H A;  1S5J A;  2IW5 A;  3LNN A;  2LW1 A;  2Q67 A;  4TT3 G;  3QF7 A;  2ADQ B;  5D5P A;  2P6J A;  4FMT A;  3AG7 A;  5A2Q N;  3FYE B;  1XBL A;  4EB6 B;  2UU9 B;  3OMA B;  2DWD C;  5KUM A;  4K0K B;  2EIL C;  1FD9 A;  5JVD B;  3CPW U;  3RVZ A;  3ZMS A;  3ICX A;  5KX5 B;  5LYJ B;  1IXB A;  1TUE B;  4CC5 A;  3K5L A;  4K3A A;  1FXV A;  1I94 B;  1BGY H;  3AG3 C;  2FYU H;  3E83 A;  5LMN B;  2GUZ B;  3BAA A;  2LGW A;  2QGN A;  4YHH O;  1HP8 A;  4HNA A;  2Q0O C;  3W7T A;  4DR1 O;  2Q7H A;  5IYZ B;  2H94 A;  2ZIM A;  2XAH A;  1PV0 A;  5LL6 Y;  3GWO A;  5BMV A;  5K1X A;  4ZHQ B;  3SYQ A;  2E5L O;  1OCR B;  4B3R B;  2PGG A;  4NXN B;  3OMI B;  3K58 A;  3HKD A;  4RO2 A;  1M57 B;  1ZX3 A;  4JI8 O;  5GTH Z;  2ZR2 A;  4X62 O;  1Q82 W;  4JTA B;  5EBL C;  5D5Q A;  1MOF A;  1Z5V A;  3FAV B;  1SET A;  1HNX O;  2GBO A;  5LHI A;  2MW2 B;  2EBO A;  3HKE A;  1XEQ A;  3CSX A;  2IBZ H;  1SQP H;  2XAJ A;  4JI0 O;  4DRX A;  1F4M A;  3AG4 C;  2BCC H;  4YJ3 A;  2YIA A;  1NTM H;  3H1J H;  4ASU G;  2IU3 A;  4TSF G;  3JD1 A;  2F4V B;  3LDD A;  2QWO B;  4I0X B;  1JR9 A;  3BRC A;  4I50 B;  3L73 H;  5JQG B;  1F23 A;  4JI6 B;  3HPL C;  2X6A A;  2WPD G;  3K0G A;  3K03 A;  4DR4 O;  1MMM A;  3SPJ A;  3STZ C;  3TK1 A;  3ZMU A;  1JFF B;  3CCS V;  4R50 A;  1VQ9 V;  3B2E E;  5JH7 B;  4FM2 A;  2ZDI C;  2IJI A;  1E1R G;  4R7C A;  1FFX A;  4LH7 A;  2LGQ A;  3APO A;  2JGU A;  4HNA B;  4QE9 A;  2ZDI A;  1HDJ A;  3AG3 B;  3OGI B;  1FYJ A;  1VF6 C;  4OX9 O;  2BTO A;  1OCC C;  5BMV B;  4JGS A;  1YCI A;  1PL0 A;  3S3W A;  4LF5 O;  1CXZ B;  1EFR G;  3HKB A;  1D2D A;  1O9H A;  2HP8 A;  2UXC B;  5LA6 A;  2Q7E A;  1FJG B;  2W6J G;  1RSO B;  3HKD B;  2RJZ A;  1KYO F;  3CCU V;  3A0B Z;  3L72 H;  1PD3 A;  4DV4 O;  2Q6A A;  4QPJ A;  1WB7 A;  2JVD A;  4XDL A;  5DEC A;  2AHY A;  1SZX A;  4K35 A;  3CEI A;  1N8R W;  2KG7 B;  1DF5 A;  4EKW A;  1XI1 A;  1E79 G;  4CC6 A;  2Q5Z A;  3U11 A;  1EZV H;  1GMG A;  1GTO A;  3AG4 B;  4TV8 B;  1PPJ H;  1DK1 A;  4AI8 A;  2ETN A;  2QDO A;  3GB7 C;  2UUB B;  2UXB O;  5L3G A;  4KUM A;  2EIK C;  3VBB A;  1OCZ C;  4O2A A;  2GTA A;  2ZR3 A;  4EFE A;  3UQ8 A;  1ZUQ A;  4X65 O;  3JAR A;  4JTC B;  2PTM A;  3APQ A;  1VQO V;  3W7U A;  4WFF A;  2YXY A;  3A2F A;  2RDC A;  1GK9 A;  2CGO A;  1KKC A;  3JCU Z;  4BW5 A;  5JJJ B;  4LFB O;  1I5X A;  3L74 H;  4FLV A;  3CRM A;  4E4E A;  4QE7 A;  2DWE C;  2D2C B;  1MZF A;  4QIW F;  1GM8 A;  3JAK A;  3ZHS A;  1S0V A;  1GN4 A;  1DLB A;  4DV3 B;  1JA8 A;  3HKB B;  2PZS A;  4YHH B;  3QVN A;  2BTQ B;  4DR1 B;  5LXT A;  1TAE A;  1XMO B;  1QR8 A;  4CH3 A;  2BSK B;  5KUK A;  3DGE A;  1QVF U;  3JAM N;  2F1M A;  4XDJ A;  4BIU A;  1BSM A;  3DC6 A;  2CH7 A;  2WLI A;  4JI7 B;  4Z2W A;  3SPC A;  5IWA B;  4JI2 B;  3SYA A;  5CA0 A;  3I55 V;  1M1K W;  4LBE C;  3E22 B;  1G1X B;  1SQV H;  1HNX B;  3JD2 A;  3P32 A;  1Z2G A;  1SQX H;  3LSS A;  4D7T A;  2P7T C;  3AK1 A;  4JI0 B;  1N33 O;  2UUC O;  1VMG A;  1YTF B;  3H9V A;  2Z5U A;  3K9A A;  4O4J A;  3SDL A;  1KU9 A;  4JAS A;  1NS1 A;  2HR3 A;  3RYI A;  3E35 A;  4LF6 O;  1K4C C;  5C93 A;  4RAI A;  1RFY A;  4TUY B;  3ABM C;  2EIK B;  1OCZ B;  2CTQ A;  5EYP A;  3ZMT A;  4UV9 A;  4MSW C;  4J7Z A;  2IJJ A;  4U3F H;  1Y74 B;  1AJQ A;  3TXQ A;  1OHH G;  1G6U A;  5KA6 A;  2XND G;  4GT1 A;  5EC2 C;  3FYI B;  3X2Q C;  2BOC C;  4BR6 A;  4K8Z A;  4TV9 A;  1NVP D;  3AK2 A;  3G6B A;  4H13 B;  2Y0I A;  1Q6I A;  3OAA G;  4JI5 O;  3ZMV A;  2WA3 A;  3ZHV A;  3CWB H;  3CCJ V;  5LHG A;  4K8X A;  5E1A C;  3E86 A;  4Q20 A;  2CUG A;  4GYC B;  3MHH C;  2QTS A;  5LXT B;  3GWK C;  4DR7 O;  5CB4 A;  1JJO A;  1AI7 A;  3LDE A;  3OEH G;  1YJW V;  3ZIA G;  5IT9 N;  1I5Y A;  4JZG A;  4IIJ A;  1YEW A;  5CA3 A;  1PNM A;  4FFB B;  2AGA A;  5CA0 B;  4I5S A;  1W2B U;  3VQW A;  3SJB C;  3F7V C;  3G6E V;  1K4D C;  4FLT A;  1XNR O;  1MNG A;  3CCV V;  3L70 H;  1NBM G;  3SYP A;  3QTC A;  3BHP A;  3RYI B;  3A0H Z;  4LFC O;  2W6I G;  2AW9 A;  1YF2 A;  1R3K C;  4Z1M G;  3P3N A;  3T4D A;  4MTO A;  1DF4 A;  4DK1 A;  4WFH A;  3ABM B;  1L1F A;  3RT3 C;  2K1E A;  4X65 B;  2Q0A A;  4DV1 O;  3D3Q A;  3ETQ A;  2ZT9 B;  3JSN A;  4WBN A;  1S72 V;  5FL7 G;  3M99 B;  4AQY O;  3UKM A;  4DUZ B;  5B3S C;  3BVO A;  1P7G A;  3E8F A;  3JD0 A;  2F66 C;  4ZKI A;  4TV9 B;  4DV2 O;  3BAB A;  1M4U A;  4JV5 O;  3X2Q B;  2P4K A;  4J80 A;  1XUQ A;  1TVK A;  2OCC C;  2VWK A;  3SR2 C;  3BA8 A;  2XAQ A;  5IYD O;  3OUS A;  3T1Y B;  4X1K A;  3UO2 A;  2ZM6 B;  5CB4 B;  4KHP O;  1XMQ B;  5FPO A;  4MW3 A;  1KP2 A;  3P30 A;  1SF9 A;  4A5U B;  3K57 A;  4LF4 O;  1HR0 O;  4LNU A;  2B5U A;  2X7R B;  3CXC U;  1K5Q A;  3AG1 C;  5BZB A;  1J95 A;  4ZOL B;  2EIN C;  3ASO C;  3CMA V;  3JCZ A;  2CTR A;  4J9Z B;  3G80 A;  3OMN B;  2KQX A;  1K34 A;  4YIP A;  1OJH A;  1COW G;  4MTF A;  4DR5 O;  3O65 A;  5CBH A;  1S5L Z;  3RW0 A;  3ABL C;  1QBZ A;  1JJ2 U;  2NNU A;  4DV6 O;  1N33 B;  1ZSP A;  1ZLZ A;  1ZWI C;  4LF8 B;  1WP8 A;  1Y76 A;  5H2F Z;  2QWN B;  1B04 A;  4MT8 A;  4GKK O;  2YIB D;  4F4L A;  1FXK C;  4UCS A;  5IDJ A;  1YDX A;  4X9Q A;  2XAF A;  2L6L A;  3U10 A;  2JDI G;  4MVZ A;  1AJN A;  1FXK A;  3ZRS A;  3K79 A;  2A0L A;  4ZI7 A;  5BY1 A;  2QEX V;  4CH5 A;  3SPI A;  1WN7 A;  1M57 C;  3RFR A;  2XUM A;  1NR7 A;  5B3S B;  4LFA O;  3D36 C;  4PA7 A;  2Y69 C;  1TVK B;  3B77 A;  2VRZ A;  4OPA A;  3RGB A;  4LCU C;  4X20 A;  2ZQM A;  1LNQ A;  2OCC B;  1V55 C;  3CC2 V;  2EJR A;  1GAX A;  2Q4P A;  2IU0 A;  4GX5 A;  4MVU A;  1AB3 A;  1EN4 A;  3CCQ V;  1ORQ C;  1IBM B;  1M90 W;  4LNU B;  3NR7 A;  4NYK A;  4FLU A;  1AVM A;  2R70 A;  3ZHR A;  1XHZ A;  4IL6 Z;  2W0X A;  1K5S A;  4F6R A;  2HEP A;  5LMU O;  3KZI Z;  4J7J A;  1SC5 B;  3AG1 B;  3ZHU A;  2WLK A;  2EIN B;  3ASO B;  1EZJ A;  2QSA A;  1UJW B;  2Q9L A;  1NVP B;  4B3S O;  2QWQ B;  2YSU B;  1XNR B;  4YJ2 B;  2CE4 A;  3ABL B;  4IT5 A;  1Y76 B;  2XAS A;  2N05 A;  3TGU H;  4ABM A;  4LFC B;  1XNQ O;  1Y4M A;  4WFA V;  1J5E O;  2PYJ A;  3S3X A;  4CH4 A;  4H44 B;  3H01 A;  1AI4 A;  1Z5W A;  3RYF A;  5GTI Z;  2PI5 A;  1WP7 A;  1Y66 A;  1FXK B;  2B1G A;  1YTF D;  5DM6 V;  3E8G A;  3SJC C;  4FZ0 A;  1QLN A;  3JYC A;  1PNK A;  1XDC A;  2HHH O;  3N2K B;  2EUL A;  5ITZ A;  3U0Z A;  2GV9 A;  1GO3 F;  1R3I C;  4AQY B;  1R1B A;  2YEV B;  3QNE A;  1URF A;  4FLW A;  4JI1 O;  1Q8I A;  1B6Q A;  1YHQ V;  1PKX A;  5IY5 B;  4JYA O;  2Y69 B;  2QM4 A;  3BCC H;  4JV5 B;  5IJ0 A;  2HJF C;  1HW7 A;  4LH6 A;  3ZRX A;  5DN6 G;  3K04 A;  1HNZ O;  2FL4 A;  4DR3 O;  1W0J G;  1V55 B;  3CRQ A;  3VQX A;  3K5N A;  1VQK V;  4RUF A;  2EIJ C;  3Q4H A;  5KHK A;  4O4L B;  3UO3 A;  5IYC O;  2YIB A;  1TGO A;  1PL4 A;  4BIO A;  4DV5 B;  3CX5 F;  2WLL B;  3F5T A;  3WG7 C;  4X8A A;  2X6C A;  1X59 A;  1H2S B;  1Y67 A;  3OD4 A;  1JPX A;  4JAU A;  4WFE A;  4P30 A;  1IX9 A;  4WCE V;  2DMX A;  3IJ4 A;  4JYB A;  4JI3 B;  3OT7 A;  4QGP A;  4TQF A;  2HVK C;  3OTF A;  1I7F A;  4UB6 Z;  1R6N A;  4DR6 O;  1GN3 A;  1ENV A;  1XL6 A;  4CH6 A;  1A32 A;  3OEE G;  5EC1 C;  4L87 A;  4HAM A;  1SQQ H;  1GN6 A;  3HB3 B;  4GKK B;  2PUS A;  3VOU A;  4QPK A;  1VQ4 V;  3DSQ A;  2RN9 A;  1AIL A;  3DTU B;  2HKO A;  4G2K A;  3CXH F;  4JPR A;  4NR1 A;  4X64 B;  1VQ8 V;  1CPY A;  1D5A A;  3M8A A;  4TQD A;  2FKX A;  1N36 B;  2ZE8 A;  2XTA A;  4LFA B;  3CCL V;  2LFS A;  3CB2 A;  2ILM A;  3HKE B;  1M9N A;  1N0J A;  2R9R B;  5HFL A;  2KSD A;  1QNM A;  4DRX B;  3CS5 A;  5FNV A;  4DW0 A;  2D3O W;  4UVA A;  4YJ3 B;  3EVK A;  1SKV A;  3STL C;  2EIJ B;  4UV8 A;  3W7W A;  2VQF O;  4KL1 A;  1VQL V;  4UVB A;  3JAW A;  4B3M B;  2CGN A;  3WG7 B;  5LMU B;  2F93 B;  2UUA O;  4QNH B;  2ADP A;  2VS0 A;  4MTX A;  1K33 A;  3K0D A;  5KHJ A;  2XHB A;  2NLJ C;  3ZED A;  2JGD A;  4PJ0 Z;  1KBH A;  1RP3 B;  4I9W A;  4DK0 A;  1IBL O;  1NU1 H;  2GHY A;  4YY3 O;  1P49 A;  4IGG A;  4DV7 O;  1QLE C;  2EIM C;  1FFX B;  4Z1V A;  5LOV A;  5E79 Z;  5LBQ A;  4D7S A;  4FM0 A;  1KP3 A;  3T4Z A;  5KHH A;  1J5E B;  5C8Y A;  1M56 C;  2EZP A;  3D8C A;  1UPG A;  2AZ0 A;  4PD4 F;  2HLD G;  3BEH A;  5KMG A;  3UCS C;  5JJN B;  5LA6 B;  5LHH A;  4D6T H;  2E75 B;  1JOY A;  2Y0P A;  4KXR A;  2HJD A;  2R9A A;  2E5L B;  2JJ1 G;  2FML A;  1BT8 A;  2JS5 A;  2R9I A;  1FFT B;  1MSW D;  1QU7 A;  2RNB A;  4JI8 B;  4UCU A;  4I4T A;  4X62 B;  4B7E A;  3JAT A;  2H3O A;  3LNM B;  5IE9 A;  2JK5 C;  5FNV B;  2DYS C;  4JI4 O;  3HKC A;  1HNW O;  5CBG A;  1B06 A;  1S77 D;  1EM1 A;  1JQ0 A;  3H1I H;  3CCM V;  1ZL8 A;  2WLN A;  1HNZ B;  2OTJ V;  1AJP A;  2QKC A;  2L35 A;  4I9Q A;  4J10 A;  1KUQ A;  1IXM A;  2ZIO A;  1ARO P;  3E2E A;  4PA9 A;  3KKY A;  2M7W A;  2ZKO A;  4J7K A;  4O2A B;  4H33 A;  3WB0 A;  1D5N A;  2QTO A;  4RQF A;  3OTO O;  1AI6 A;  3JAR B;  4NB5 A;  5J9P C;  1PP9 H;  3CC4 V;  2ZD9 A;  4JYY A;  1WAZ A;  1SER A;  4EEQ A;  4PHZ A;  2E74 B;  4MVO A;  4B08 A;  3TCU A;  1N34 O;  1NH2 D;  3MHS C;  3BPZ A;  4DR4 B;  2DQ0 A;  4RQE A;  5LOV B;  4HZ3 A;  5EZY A;  1Q90 D;  1QLE B;  2RQ6 A;  3JAK B;  2EIM B;  2QM8 A;  2BOB C;  3IGA C;  4O2B A;  4HYO A;  4PA3 A;  5CBF A;  1JCH A;  1M56 B;  4U3J A;  4OX9 B;  2KKW A;  1IVS A;  4CBC A;  2WSS G;  4LF5 B;  1YVW A;  4UCO A;  4YIO A;  3TJT A;  1KQS U;  1H38 A;  2R72 A;  2UXN A;  1GN2 A;  1P4R A;  2CH7 B;  3EHB B;  2WLI B;  5B1B C;  4PDL A;  5TIS Z;  3FD9 A;  5BR8 O;  4DV4 B;  2Z0A A;  1IBK O;  5KLV H;  1WJZ A;  4RUE A;  1NKD A;  1I0H A;  1XOU A;  3T1H O;  1L0N H;  4E2L A;  2DYS B;  4GX2 A;  4UCV A;  4PDV A;  3QG5 A;  1BL8 A;  3RYH A;  3THO A;  4G27 B;  4I7Z B;  4O4J B;  1SA0 A;  4X66 O;  1TUB A;  4LWS A;  3SPH A;  1V54 C;  5CMU A;  3ZS8 C;  5KHI A;  2VQF B;  1UFI A;  3ABT A;  5F2V O;  2Y4T A;  2P5O A;  5EYP B;  1W59 A;  2UXB B;  1XL4 A;  5KAF Z;  1VIB A;  4LP8 A;  3B8M A;  1XIL A;  3ASN C;  2K9P A;  4IYI A;  3BA9 A;  3SYO A;  3LSU A;  4AIL C;  1PNL A;  5LMN O;  1JVM A;  1H8E G;  4PDM A;  5LP6 A;  4LFB B;  4AHC A;  4X1I A;  4FZ1 A;  4IHJ A;  1KB9 F;  2G38 A;  1QHT A;  4DUY O;  2YI8 A;  1BMF G;  4CS3 A;  5H6Q A;  4B3R O;  2JS3 A;  4NXN O;  2QKS A;  5GW7 A;  3UM7 A;  3IC9 A;  3CC7 V;  2YUA A;  3ZHT A;  2AHZ A;  4IIJ B;  1B3Q A;  3OE7 G;  4BIZ A;  1RPR A;  5B1B B;  1VQM V;  2IJH A;  3K06 A;  1BZK A;  3OW2 U;  4MVR A;  2V4D A;  1YIJ V;  1SQG A;  5EK0 A;  3RYH B;  3RWR D;  2ZE5 A;  3ETG A;  4JI4 B;  1VQ6 V;  2A7W A;  2KB1 A;  3CJH A;  2F4V O;  2UXX A;  1AP5 A;  3ZCC A;  2CK3 G;  1S3J A;  4O4I A;  5JCO A;  4Q6G A;  2UUC B;  4JI6 O;  2EX3 A;  2XT9 A;  5GON A;  1V54 B;  2N04 A;  3ZX6 A;  4ZIB A;  3B09 A;  2ZXW B;  4LF6 B;  1NQT A;  4WFB V;  3IC7 A;  4NTW A;  4R8C A;  4X89 A;  2A3Q A;  2LW7 A;  1G8M A;  4EB6 A;  2Q8V A;  2F23 A;  1AR1 B;  3CRR A;  4PV1 B;  4WBN B;  3ASN B;  3J81 N;  2WAM A;  1R6K A;  2PYL A;  5KX5 A;  1Q6U A;  1YJ9 V;  4B3T O;  4X1I B;  4P2Z A;  1BS3 A;  1IZ3 A;  3FKS G;  3H1H H;  4MVQ A;  4XDK A;  1BCC H;  5IY5 C;  1XRE A;  5LGU A;  2CAZ C;  2GUZ A;  2OCH A;  3D3I A;  2IH3 C;  2Z3Y A;  1YIT V;  1FJG O;  1E1Q G;  1M5I A;  4X1K B;  5IYZ A;  2FTK A;  4JI5 B;  4ZHQ A;  3OFN G;  3ZRV A;  4O4H A;  1N32 O;  3LUT B;  1AI5 A;  4MW8 A;  2M6Y A;  4DR7 B;  1U97 A;  1US6 A;  4LF7 O;  5CN0 A;  1BQZ A;  5IYB O;  1H2M A;  4F6E A;  2DW4 A;  4ZBM A;  3GVM A;  2ZNI A;  1NH2 B;  2ZNJ A;  2PF4 E;  1VQ5 V;  3FAV A;  5BR8 B;  4UFZ A;  1EBO A;  1SRY A;  3FB6 C;  5EBW C;  2A79 B;  1IDS A;  2CDY A;  4OGQ B;  2UUB O;  4GLX A;  3FB8 C;  2JEX A;  5J2T A;  1R73 A;  2DYR C;  4H0L B;  3W7S A;  3KCY A;  4R6Z A;  1Y6X A;  4X66 B;  2F43 G;  2NN4 A;  5KHG A;  3SJA C;  4I0X A;  3HR0 A;  1S5H C;  4I50 A;  3IAY A;  5JQG A;  1VF5 B;  1AR4 A;  2YID A;  1H2L A;  1WPB A;  5H9C A;  3J80 N;  1GRJ A;  4UUJ C;  2H8P C;  3G71 V;  4J41 A;  3ETE A;  2C2A A;  1G4Y B;  2QM7 A;  1VQP V;  4TOI A;  3OR6 C;  1JFF A;  4ZI7 B;  1BHB A;  3BY6 A;  4DR2 O;  5JH7 A;  4N21 A;  4DV1 B;  1BQ0 A;  1NJI W;  2E76 B;  1FAF A;  2E3C A;  3AK3 A;  4DV3 O;  2NR5 A;  5IJ9 A;  5L3F A;  3M7M X;  4X20 B;  1WB8 A;  4DV2 B;  4G28 B;  4J9Y B;  4PDR A;  1XMO O;  4QJF B;  4GKJ O;  4UVC A;  2WLM A;  4DUY B;  4O4H B;  3WU2 Z;  3CP1 A;  4C7U A;  3B8N A;  1RSO A;  1EN5 A;  4KHP B;  4JI7 O;  5DED A;  4U7N A;  5IWA O;  4JI2 O;  2VWJ A;  4F6R B;  1V9P A;  4UXN A;  2ITD C;  4LF4 B;  2PY5 A;  1HR0 B;  2WLH A;  3RYC A;  1SQF A;  4FK5 C;  3ZRW A;  3LDC A;  5A9G A;  1Q7Y W;  2HVJ C;  1MG1 A;  2LP7 A;  2KG7 A;  4FVM A;  1VQN V;  2OT5 A;  1R3J C;  1VAR A;  5J2T B;  4MVM A;  2OTL V;  3ETD A;  4TV8 A;  1RM1 C;  4LR3 A;  2HFE C;  4DR5 B;  3CRA A;  4DV0 O;  2Q68 A;  1EN6 A;  3JD3 A;  1K97 A;  2DYR B;  4DV6 B;  3ZN1 A;  3RYF B;  3DXR A;  3PN1 A;  5BXZ A;  1F51 A;  5B1A C;  3TET A;  1ZAU A;  1GM7 A;  2EIL B;  2B9Z A;  2WA4 A;  3E8H A;  3CCE V;  5B1O A;  2YXL A;  2YIC A;  1NR1 A;  5ITZ B;  3G4S V;  3QO7 A;  1XHX A;  5IJ9 B;  4WF9 V;  2GTS A;  1MAB G;  4X1Y A;  2EJ7 A;  4PI0 A;  1MSD A;  2XAG A;  4B3T B;  3I5D A;  4BW9 A;  5IJ0 B;  4NXM O;  1TA8 A;  4W4L A;  1M93 A;  3OR7 C;  3T1C A;  2Y4U A;  3TXS A;  3ABU A;  2BTQ A;  1VF6 A;  1OCO C;  2A06 H;  2W0F C;  3Q4H B;  2B1I A;  2OIE A;  1BE3 H;  2BSK A;  1IUR A;  5FPR A;  2YC0 A;  1N32 B;  3RYC B;  1YJN V;  1SZT A;  1K3E A;  4LF7 B;  2HG5 C;  3RN4 A;  2LO1 A;  2MK3 A;  3ZRW B;  2DJV A;  4J42 A;  2QWR B;  3E22 A;  1QVG U;  1LR1 A;  2YI9 A;  3L9D A;  1K7D A;  3OGC C;  5B5E Z;  4B3S B;  2OIG A;  3F7Y C;  1RM1 B;  5H5N A;  3W7X A;  2ITC C;  4CS4 A;  4FLZ A;  1THZ A;  1O9G A;  3MAQ A;  1FPO A;  3ABK C;  4TUY A;  1K9M W;  3DXR B;  1Q43 A;  4EFB A;  2ODM A;  2LQT A;  1NI8 A;  5L3E A;  4BAY A;  4W4K A;  1XNQ B;  4L8J A;  5H6R A;  1SQB H;  4DUZ O;  1Y74 A;  4FLY A;  4DYL A;  3IFX A;  5B1A B;  3K5O A;  3ML0 A;  4JZ2 A;  3WB1 A;  1WLE A;  4LC1 A;  3JAS A;  4DR2 B;  4X1Y B;  3UT5 A;  3KCX A;  1GKF A;  1T5E A;  5JWP A;  3QO8 A;  2HHH B;  4UB8 Z;  2JEU A;  3T1Y O;  1KKD A;  2ZM6 O;  4UCT A;  5J2U A;  1VQ7 V;  1XMQ O;  1CEZ A;  3L75 H;  1MZE A;  1JX9 A;  5B1N A;  4ICG A;  1QQC A;  4JI1 B;  2DN9 A;  1OCC B;  4JYA B;  2X6B A;  2XOK G;  2UXD O;  1XQ8 A;  2V7Q G;  5B66 Z;  2ZIN A;  4GKJ B;  1OCO B;  2ARH A;  4FPP A;  3SJQ C;  4LF9 O;  1AR5 A;  1W0K G;  2RCV A;  5KAI Z;  4DR3 B;  1GM9 A;  3KG2 A;  4UCR A;  3VQY A;  3ZN0 A;  3JAW B;  4FFB A;  5L3D A;  1LUV A;  3RVY A;  2VQE O;  1NZ6 A;  1YSC A;  3OUF A;  3K9S A;  4MTG A;  3N27 A;  3LSQ A;  3K59 A;  3EFF K;  3QO5 A;  3CD6 V;  3H1L H;  1VP7 A;  2JGD B;  1MA1 A;  5EIB D;  4LF8 O;  3EXA A;  2DOS A;  5FLX N;  1KEC A;  4J11 A;  3WFV A;  3AG2 C;  3E8B A;  4P9O A;  3AEI A;  1R3L C;  4HBN A;  4DV0 B;  3R66 A;  5K1P A;  4DR6 B;  2OYQ A;  3PJS K;  2BE3 A;  3ABK B;  3A8T A;  2DE0 X;  5C8Y B;  2AXT Z;  4KP4 A;  4DO2 A;  5KMG B;  2JIZ G;  1KD1 W;  2IM9 A;  1FXH A;  4JTD B;  3FX7 A;  1QCE A;  3SYC A;  5JJE B;  3DC5 A;  3JAS B;  3UT5 B;  3CME V;  4FM1 A;  2P67 A;  2ATK C;  4GCZ A;  1K73 W;  2WWW A;  1S76 D;  4GX0 A;  5J2U B;  3T2M A;  3CHX A;  3C3S A;  5CA1 A;  4I4T B;  1KC8 W;  4OXS A;  3JAT B;  1IBM O;  1ZTE A;  4DXW A;  3HKC B;  4NXM B;  1N0N A;  1H2G A;  2GDS A;  3L71 H;  3BFR A;  4I55 A;  1ZL8 B;  3H1K H;  1K8A W;  2DQ3 A;  1LUW A;  1F4N A; 
#chains in the Genus database with same CATH homology
 4MVS A;  3A0R A;  4QE7 A;  2WLL B;  1YJ9 V;  3WG7 C;  1Q86 W;  4X8A A;  2DWE C;  2X6C A;  4QIW F;  4P2Z A;  1GM8 A;  3FKS G;  4MVQ A;  4XDK A;  1S0V A;  5IY5 C;  5LGU A;  3JD4 A;  2ZXW C;  2IH3 C;  3D3I A;  1DLB A;  1JPX A;  2Z3Y A;  4JAU A;  4P30 A;  4WFE A;  5LGN A;  1YIT V;  4WCE V;  1E1Q G;  2FTK A;  4PA6 A;  4JYB A;  3K08 A;  3OFN G;  3ZRV A;  1QR8 A;  2HVK C;  5KUK A;  4PA4 A;  3MD0 A;  3DGE A;  1AI5 A;  3LUT B;  4MW8 A;  1QVF U;  1R6N A;  4XDJ A;  1ENV A;  5CN0 A;  4BIU A;  1XL6 A;  2V1D A;  3AG2 B;  4X88 A;  5L3B A;  2WLI A;  5IYB O;  3OEE G;  2DW4 A;  4ZBM A;  1CP9 A;  4TWK A;  5EC1 C;  3SPC A;  1NH2 B;  2IJK A;  4L87 A;  4HAM A;  1VQ5 V;  1SES A;  3HB3 B;  3SYA A;  3I55 V;  1EBO A;  1M1K W;  1SRY A;  3FB6 C;  5LGT A;  4LBE C;  3RBZ A;  4WFG A;  3VOU A;  3JD2 A;  3P32 A;  5EBW C;  2A79 B;  4FJC C;  3CYO A;  3LSS A;  4QPK A;  3F5W C;  2Y48 A;  1VQ4 V;  2P7T C;  1YTF B;  2Z5U A;  3DTU B;  2HKO A;  2JEX A;  3FB8 C;  3K9A A;  4G2K A;  4JAV A;  1R73 A;  2DYR C;  4JAS A;  4JPR A;  3W7S A;  1BHA A;  2HR3 A;  4R6Z A;  1VQ8 V;  3K3W A;  1CPY A;  1HWY A;  1DTO A;  3E35 A;  2F43 G;  1K4C C;  5C93 A;  5EBM C;  2A9H A;  4RAI A;  2EZO A;  1S5H C;  3CCL V;  3ABM C;  2EIK B;  1FS0 G;  1OCZ B;  2Q69 A;  2LFS A;  4YXW G;  3ZMT A;  4UV9 A;  4MSW C;  1M9N A;  2IJJ A;  5H9C A;  2R9R B;  2H8P C;  4PEL A;  4UUJ C;  5HFL A;  3G71 V;  3ETE A;  2C2A A;  1G4Y B;  2QM7 A;  1VQP V;  1AJQ A;  2JJ2 G;  2D3O W;  3OR6 C;  4UVA A;  1OHH G;  1BHB A;  3BY6 A;  2QE7 G;  5KA6 A;  2GSM B;  3STL C;  2EIJ B;  2XND G;  4UV8 A;  2LFR A;  4MS2 A;  4N21 A;  4GT1 A;  3W7W A;  1NJI W;  5EC2 C;  1VQL V;  3FYI B;  3X2Q C;  4UVB A;  3OM3 B;  2BOC C;  3WG7 B;  4KFM A;  1NVP D;  3FB7 C;  5L3F A;  2P90 A;  4P9P A;  3OAA G;  4U7O A;  4QNH B;  3ZMV A;  4G28 B;  3CCJ V;  5LHG A;  4JF3 A;  4J9Y B;  4MTX A;  4PDR A;  4H37 A;  4GX1 A;  5E1A C;  3E86 A;  1K33 A;  4Q20 A;  4QJF B;  3K0D A;  4UVC A;  3MHH C;  2WLM A;  3SPG A;  2NLJ C;  5KA5 A;  5HFM A;  3CP1 A;  1ROP A;  4JYC A;  1OZ0 A;  3B8N A;  4CZZ A;  1AI7 A;  1P7B A;  3LDE A;  3OEH G;  4I9W A;  1K92 A;  4U7N A;  3ZIA G;  1YJW V;  2GHY A;  1QLE C;  1RPO A;  1H8H G;  1I5Y A;  2EIM C;  4UXN A;  2ITD C;  5CA3 A;  1PNM A;  2WLH A;  5L3C A;  4FIP C;  5LBQ A;  4I5S A;  4FK5 C;  1KP3 A;  3T4Z A;  1W2B U;  4N23 A;  3F7V C;  3LDC A;  3ZRW A;  3G6E V;  1K4D C;  1QR9 A;  1M56 C;  2EZP A;  1Q7Y W;  2HLD G;  1MG1 A;  2HVJ C;  3BEH A;  2LP7 A;  1OCR C;  3ZJZ A;  1VQN V;  3NXS A;  2OT5 A;  1R3J C;  1WPX A;  3CCV V;  5LHH A;  1NBM G;  3SYP A;  1YI2 V;  4MVM A;  2OTL V;  3ETD A;  1JOY A;  1RM1 C;  2HFE C;  3I56 V;  2Q68 A;  3JD3 A;  1K97 A;  3R65 A;  2W6I G;  2JJ1 G;  2DYR B;  1R3K C;  4Z1M G;  2YEV A;  1MSW D;  2R9I A;  1FFT B;  3T4D A;  3FB5 C;  2PI4 A;  4MTO A;  1DF4 A;  3D36 A;  3E89 A;  3ZN1 A;  4WFH A;  3ABM B;  3LNM B;  2JK5 C;  2DYS C;  1L1F A;  1S77 D;  5CBG A;  1Q81 W;  2K1E A;  1JQ0 A;  1F51 A;  5B1A C;  3TET A;  3CCM V;  1GM7 A;  2WLN A;  2EIL B;  3CCR V;  2OTJ V;  3ZMZ A;  2X0L A;  2QA4 V;  3E8H A;  2IH1 C;  5FL7 G;  3CCE V;  1S72 V;  1AJP A;  3M99 B;  5B1O A;  4XBF A;  1NR1 A;  3UKM A;  5B3S C;  2WLJ A;  3G4S V;  3QO7 A;  3E8F A;  3JD0 A;  1IXM A;  2WLL A;  1ARO P;  4ZKI A;  4WF9 V;  3E2E A;  1MAB G;  4PA9 A;  2M7W A;  2IW5 A;  4H33 A;  3X2Q B;  2Q67 A;  2QTO A;  2XAG A;  4TT3 G;  4RQF A;  2OCC C;  1AI6 A;  2P6J A;  2XAQ A;  5IYD O;  4FMT A;  3OR7 C;  3T1C A;  3OUS A;  3FYE B;  5J9P C;  3CC4 V;  2ZD9 A;  3ABU A;  3OMA B;  2DWD C;  1OCO C;  1SER A;  5KUM A;  2EIL C;  4MW3 A;  4MVO A;  2W0F C;  1KP2 A;  2B1I A;  3P30 A;  3TCU A;  1NH2 D;  3MHS C;  3CPW U;  3RVZ A;  3ZMS A;  2B5U A;  2X7R B;  2DQ0 A;  3CXC U;  4RQE A;  1TUE B;  1K5Q A;  3AG1 C;  1SZT A;  4HZ3 A;  1YJN V;  5BZB A;  1FXV A;  1K3E A;  1QLE B;  3AG3 C;  2EIM B;  2HG5 C;  1J95 A;  2MK3 A;  2EIN C;  3ASO C;  3E83 A;  3CMA V;  3ZRW B;  2QM8 A;  3JCZ A;  4J9Z B;  3OMN B;  3W7T A;  1K34 A;  2BOB C;  3IGA C;  4HYO A;  4PA3 A;  2H94 A;  2XAH A;  5CBF A;  1QVG U;  1COW G;  3GWO A;  4MTF A;  1JCH A;  1M56 B;  3SYQ A;  5CBH A;  1OCR B;  3ABL C;  3RW0 A;  4CBC A;  1QBZ A;  1K7D A;  3OMI B;  2WSS G;  3OGC C;  1JJ2 U;  1KQS U;  1H38 A;  2NNU A;  4RO2 A;  1M57 B;  2UXN A;  1ZWI C;  3F7Y C;  1P4R A;  3EHB B;  1RM1 B;  2WLI B;  3W7X A;  2ITC C;  2ZR2 A;  5B1B C;  1Q82 W;  4PDL A;  1THZ A;  4JTA B;  5EBL C;  3ABK C;  4MT8 A;  1K9M W;  1MOF A;  1SET A;  4F4L A;  1FXK C;  5IDJ A;  5LHI A;  4RUE A;  5L3E A;  4BAY A;  1NKD A;  2EBO A;  2XAF A;  5H6R A;  2XAJ A;  2JDI G;  4MVZ A;  1F4M A;  1AJN A;  1FXK A;  3AG4 C;  2DYS B;  4E2L A;  4GX2 A;  4PDV A;  3ZRS A;  1BL8 A;  2A0L A;  3IFX A;  3K79 A;  5B1A B;  4G27 B;  2QEX V;  3ML0 A;  3SPI A;  1WLE A;  4LC1 A;  1M57 C;  4ASU G;  2IU3 A;  3SPH A;  4TSF G;  1GKF A;  3JD1 A;  1V54 C;  5CMU A;  1NR7 A;  5B3S B;  3QO8 A;  3LDD A;  4PA7 A;  2Y69 C;  3ABT A;  3B77 A;  2JEU A;  1KKD A;  4LCU C;  1VQ7 V;  1CEZ A;  1JX9 A;  5B1N A;  1F23 A;  2ZQM A;  3HPL C;  2X6A A;  1LNQ A;  1XL4 A;  2OCC B;  2WPD G;  1V55 C;  3K0G A;  3CC2 V;  1OCC B;  4LP8 A;  3B8M A;  2X6B A;  2EJR A;  3K03 A;  2IU0 A;  2XOK G;  4GX5 A;  2V7Q G;  4MVU A;  3ASN C;  3SPJ A;  3CCQ V;  1ORQ C;  3STZ C;  3TK1 A;  3ZMU A;  1OCO B;  4FPP A;  3SJQ C;  1M90 W;  3SYO A;  3CCS V;  4R50 A;  1VQ9 V;  1W0K G;  1PNL A;  1GM9 A;  1K5S A;  3KG2 A;  2ZDI C;  2IJI A;  1E1R G;  4R7C A;  1JVM A;  1H8E G;  3ZN0 A;  4PDM A;  5L3D A;  3AG1 B;  4QE9 A;  2ZDI A;  3RVY A;  2WLK A;  3AG3 B;  1YSC A;  3OUF A;  2EIN B;  3ASO B;  1EZJ A;  4MTG A;  1BMF G;  1OCC C;  5H6Q A;  4JGS A;  1UJW B;  1PL0 A;  2QKS A;  3LSQ A;  1EFR G;  3EFF K;  3QO5 A;  5GW7 A;  3CD6 V;  1NVP B;  3UM7 A;  3CC7 V;  2YSU B;  2W6J G;  2AHZ A;  3CCU V;  1KEC A;  3WFV A;  3AG2 C;  1PD3 A;  3ABL B;  2Q6A A;  2XAS A;  3E8B A;  4P9O A;  4QPJ A;  3AEI A;  1R3L C;  3OE7 G;  4BIZ A;  1Y4M A;  1RPR A;  4WFA V;  5B1B B;  1VQM V;  2IJH A;  3PJS K;  4XDL A;  3K06 A;  3OW2 U;  4MVR A;  3ABK B;  3H01 A;  1AI4 A;  2PI5 A;  2AHY A;  1Y66 A;  4KP4 A;  4DO2 A;  1YIJ V;  1FXK B;  2B1G A;  1YTF D;  1N8R W;  2JIZ G;  5DM6 V;  3E8G A;  1KD1 W;  5EK0 A;  1DF5 A;  4EKW A;  1E79 G;  3JYC A;  1QLN A;  1FXH A;  3ETG A;  1PNK A;  4JTD B;  1VQ6 V;  1QCE A;  2KB1 A;  3SYC A;  2UXX A;  1GMG A;  1GTO A;  3AG4 B;  3ZCC A;  2CK3 G;  1S3J A;  3CME V;  2P67 A;  2ATK C;  4GCZ A;  1K73 W;  2WWW A;  1S76 D;  1GO3 F;  1R3I C;  3GB7 C;  2YEV B;  4GX0 A;  5L3G A;  3T2M A;  3QNE A;  4KUM A;  2EIK C;  3VBB A;  1OCZ C;  1V54 B;  1B6Q A;  2ZR3 A;  1PKX A;  5IY5 B;  1YHQ V;  1R6K A;  2Y69 B;  1KC8 W;  4OXS A;  2HJF C;  2ZXW B;  1NQT A;  4WFB V;  3IC7 A;  3ZRX A;  5DN6 G;  4DXW A;  4R8C A;  4JTC B;  4X89 A;  1VQO V;  3K04 A;  3W7U A;  1G8M A;  4WFF A;  1H2G A;  1W0J G;  1V55 B;  1VQK V;  4RUF A;  1GK9 A;  1AR1 B;  2EIJ C;  1K8A W;  5IYC O;  3ASN B;  2DQ3 A;  4BW5 A;  2WAM A;  1F4N A;  1I5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...