4QE7A

Open mthk pore structure soaked in 10 mm ba2+/100 mm na+
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
PATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTCTLIVLGIGTFAVAVERLLEFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-gated potassium channel MthK
publication title Ionic interactions of Ba2+ blockades in the MthK K+ channel
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Transport protein
total genus 32
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4qe7A00
3ABLC 4MTOA 1R3KC 4EKWA 5J9PC 2WLIB 4MVQA 3LUTB 4MVOA 1XL6A 5EC1C 3SPHA 4X8AA 2K1EA 1OCRC 3ASOC 3K04A 4HYOA 3OGCC 5KUKA 4PDMA 3AG4C 4ZBMA 2A0LA 3SYPA 4J9ZB 2QTOA 4RUFA 1S5HC 4UUJC 4LBEC 3WG7C 2NLJC 4HZ3A 4R6ZA 3ABKC 4MVUA 3SYCA 2IH1C 2EIJC 5CBGA 1ZWIC 4JTDB 2DYSC 3FB6C 4QNHB 4H33A 4H37A 3FB5C 3RBZA 3K08A 3UM7A 2EIKC 1P7BA 1R3LC 2HVKC 2KB1A 2Y69C 3LNMB 3SYAA 2H8PC 4P9PA 3RVZA 1V55C 1KKDA 2WLNA 4R8CA 4WFHA 4I9WA 4PDLA 1R3JC 5E1AC 5KUMA 3AG2C 3SPGA 3TETA 2W0FC 4PDVA 3JYCA 4PA6A 1K4CC 4BW5A 4J9YB 1M57C 2HJFC 3LDCA 4QE7A 2DWDC 2Q67A 4XDLA 3UKMA 2X6AA 4WFEA 3T4DA 2AHYA 2EIMC 5B1BC 2BOBC 3LDEA 3SJQC 4CBCA 4MVMA 4JTCB 1J95A 5B1AC 5EBWC 3F5WC 2WLKA 2HG5C 5BZBA 3HPLC 3IGAC 2Q69A 4GX5A 2WLHA 3RVYA 1K4DC 3K06A 4RUEA 3SPCA 3OR6C 2WLLB 2HFEC 2WLMA 4KFMA 3VOUA 4PA3A 5CBFA 3ABMC 3E86A 1QLEC 3SYOA 4GX2A 2EINC 4MW3A 4P2ZA 4OXSA 5EK0A 1V54C 4WFFA 5B3SC 2ITCC 2ITDC 4G27B 2QKSA 4P30A 2DYRC 2EILC 4P9OA 2A9HA 4X89A 2Q6AA 5EBLC 3RW0A 5IY5C 3K0DA 2WLIA 3KG2A 3K0GA 3SYQA 4RO2A 3T1CA 2ATKC 3LDDA 4MVZA 4XDKA 3FB8C 4PDRA 3E89A 2AHZA 3F7VC 4MTFA 3BEHA 4MVSA 1JVMA 3AG1C 3R65A 4QE9A 4RAIA 4LCUC 3STLC 4GX1A 4PA9A 1OCCC 1OCZC 2P7TC 4MSWC 3EFFK 3SPJA 3T2MA 1M56C 3ZJZA 3ZRSA 3E83A 2HVJC 4GX0A 4JTAB 3ASNC 2IH3C 1R3IC 4LP8A 4PA7A 1BL8A 4MW8A 4MTGA 2JK5C 4X88A 2X6BA 2WLLA 3E8BA 3AG3C 3OR7C 4G28B 3TCUA 2A79B 3STZC 3T4ZA 4DXWA 2Q68A 1ORQC 2ZD9A 3E8HA 4TWKA 3IFXA 4F4LA 4MVRA 3OUSA 5CBHA 3GB7C 5EC2C 5EBMC 1OCOC 1LNQA 4WFGA 3E8GA 2X6CA 3K03A 1G4YB 3OUFA 2DWEC 3E8FA 3X2QC 4XDJA 4R50A 2WLJA 4PA4A 2OCCC 2ZXWC 2YEVA 2BOCC 3FB7C 3SPIA 2R9RB 3PJSK 4MS2A 1XL4A 4R7CA 3F7YC
chains in the Genus database with same CATH superfamily
1JFFA 3FYEB 5H9CA 5KX5B 3CC4V 3SPHA 2RDCA 1WP7A 5J2UB 4B08A 5BY1A 4HYOA 3OGCC 4WF9V 1H8HG 1E1QG 4LBEC 3SJBC 2W6JG 3ZX6A 4TQDA 4DV6O 2ADPA 1Y74B 3RVZA 1NJIW 3CJHA 1HR0O 1K4CC 1XMQO 1VF7A 4FLYA 2ZDIA 2PGGA 4EEQA 3LDEA 3ZCCA 3WB2A 5IYZB 2ZXWB 2GBOA 2KKWA 1PL0A 4MT8A 3K5LA 3E86A 4DR5O 2A3QA 4P2ZA 1YZBA 1VEWA 5B3SC 2ITCC 1OV9A 2HKOA 4FPPA 3CSXA 2JJ1G 4DUYB 1UFIA 3CCLV 2EJ7A 1H2KA 3RYCB 1Y76B 1NKDA 3ZHTA 2Y69B 4RAIA 2R72A 1OCZC 1M93A 2YXHA 1N32B 1BL8A 2Q8VA 2DN9A 1UPGA 4NXNO 4TQFA 1UJWB 1I7FA 3L75H 2FMLA 1LR1A 4WFGA 1FFTB 4X20A 1VQ5V 4K0KO 2LP7A 3H1KH 4DV6B 1PNLA 1SF9A 4UFZA 3SJCC 2VQFO 5FL7G 1H2LA 4J7ZA 3MHSC 1CPYA 2VS0A 1FFXA 1DTOA 1HR0B 2Y0IA 1WLEA 2ZT9B 3D36C 2JGDB 1XMQB 3CXCU 2WA4A 2IH1C 3HKEB 1US6A 2DYSC 1JPXA 4LF7B 3K08A 1RPOA 4RWUA 4NTWA 1KKDA 3OEHG 4F6RB 4IT5A 1KMIZ 5FPOA 4DR5B 5L3DA 3APOA 5HFMA 2EBOA 3E22A 3Q4HB 1VARA 3UKMA 3VQWA 1Q3EA 4MVMA 1J95A 2YXLA 4DRXB 3CMEV 1VQKV 4Z2WA 3K59A 1R6TA 3CXHF 1M5IA 1ROPA 1ZL8A 1WPBA 2DQ3A 2QKSA 4ZHQA 4P30A 4NXNB 4DR7O 5FNVA 2A9HA 3K3WA 2BCCH 3WB1A 2F93B 1ZX3A 3U11A 2ZM6O 2LFSA 4PDRA 5C93A 4QPKA 1BGYH 1JVMA 1YJWV 2WAMA 1SESA 2LW1A 1K3EA 2P7TC 4JTAB 1QVGU 4LP8A 3I5DA 4I7ZB 3TCUA 2VQFB 1KP3A 2JJ2G 2P4KA 3ZRWA 3UCSC 4LC1A 5CA1A 1M9NA 1Q82W 2P5OA 2PI5A 3F5TA 1IBKO 5F2VO 1OCCB 5L3EA 1EFRG 4W4LA 2ZIOA 5JVDB 4YHHO 3HKBB 1D2DA 4KHPO 1NTZH 3OTOO 2WLIB 2X7RB 4LNUA 3B40A 3OT7A 4LH7A 1DK1A 1XEQA 2B9ZA 4FLTA 2RCVA 5IJ0A 5EIBD 5JWPA 5IYBO 4QNHB 2EIKC 4UVCA 3A0RA 4R8CA 2UU9O 4PDLA 4NKGB 2JEXA 3ZN1A 5LOVA 1VQ9V 2CGOA 4IGGA 1TVKA 2LFRA 4LF6O 4AHCA 2XAQA 2R70A 1FXKC 1LUVA 2V4DA 4BIZA 1HNWO 4X1IB 2ZM6B 2EZOA 3WU2Z 4O4IB 5LXTB 3UO3A 4NYKA 2WLHA 4DR4O 3OEEG 3OR6C 2Q7HA 3H1LH 2ILMA 2EINC 2ZIMA 3DGEA 3G67A 4L8JA 4WFFA 1VQ7V 4JASA 1DGSA 4G27B 2DYRC 1X4TA 1VQ4V 1YCIA 3GVMA 2CUGA 1H38A 1G8MA 4H13B 1N4CA 1IBKB 3BEHA 4CZZA 1B06A 3TJTA 5EYPA 5B3SB 3QG5A 1W2BU 3ASNC 5LP6B 1XI1A 3PN1A 5B1OA 4YHHB 1XQ8A 5KHJA 3CP1A 1KUQA 2A79B 4KHPB 3ML0A 1CXZB 1PV0A 3T4ZA 3OTOB 1URFA 3OM3B 3H1IH 4MVRA 3N27A 2KSDA 3BA9A 1AR1B 1BHAA 2X6CA 1E1RG 4GCZA 3OUFA 3E8FA 3CRCA 4XDJA 2E5LO 3JD1A 3PJSK 1VQMV 4JI8O 5GTIZ 3C3TA 2UU9B 4LFCO 5GONB 4EFEA 1WNSA 2QTOA 2K9PA 4UB8Z 4LF6B 1F23A 2VWKA 3P30A 1HNWB 1OJHA 4JTDB 1M56B 4C7UA 1WPXA 3JARA 2P67A 3A8TA 4DR4B 1GO3F 5FLXN 3OFNG 4YY3O 4PDVA 1FXVA 3M7MX 4LF5O 2UXCO 2ZCEA 1FXKA 3OE7G 1N8RW 2ZE7A 5B1AC 4DV7O 3OMNB 2YSUB 4DV0O 1HDJA 1K4DC 1SQPH 5LYJA 3P3NA 3C3SA 3JD4A 1KP2A 5IYCO 2Q7GA 1BCCH 2ARHA 3K79A 5DECA 4JI2O 5LHHA 4MVZA 1N34O 3RYHA 1GN6A 3AG1C 2YC0A 2PI4A 3ZMUA 1P7GA 3ZHRA 5KMGB 3ABUA 4MSWC 1R6NA 1EN5A 1QLNA 2UUBB 1LUWA 2E5LB 1XOUA 3TK1A 2QDOA 4JI8B 2A06H 2JEUA 2EIMB 1YIJV 1N36O 2A7WA 2P90A 1TUBB 4LFCB 3MHHC 1XREA 2E75B 2OT5A 1FAFA 1NBMG 2DWEC 4I4TB 2CH7A 5CB4B 1G6UA 2WLJA 3FB7C 5LMNO 4LWSB 4X62O 4R7CA 2Z3YA 2FKXA 1JJ2U 1B3QA 4OX9B 3ABLC 5LA6A 2NR5A 4YY3B 1Q6IA 1PKXA 3BHPA 2Q0AA 3CMAV 3ASOC 1GMGA 4O2BB 4GKKO 2A0LA 1BQ0A 1DF5A 3L71H 4I0XA 1CP9A 2PZSA 4LF5B 2L6LA 2UXCB 4KP4A 2QM7A 4YXWG 3FB6C 4DV7B 4TV8A 4UCOA 1T5EA 3H9VA 1R3LC 1TUEB 3LNMB 2B1GA 4DV0B 1I5XA 3CRMA 3EHBB 4JYAB 4I55B 4FM0A 4FVMA 1AJNA 2PTMA 1BS3A 3OMIB 2XHBA 1I94B 2ZR3A 4UCVA 5IDJA 4JI2B 1MA1A 2EIKB 1N34B 5KA5A 2X0LA 3M99B 2UXBO 2ZR2A 2R9IA 3ABMC 1SA0B 4DK1A 2Y4TA 4J11A 1RFYA 1THZA 3UQ8A 1N36B 4RO2A 3RWRD 3E89A 2Q4PA 2EINB 1Z2GA 4FLXA 1SQBH 4FJCC 2DYRB 1K97A 4MW8A 5LMNB 4X62B 3BVOA 4FLUA 4B7KA 2FL4A 4HNAA 4L87A 5LBQA 2V7QG 5GW7A 2GV9A 4A5UB 3CE2A 1WA8A 2BSKB 1XHXA 4ZIBA 3ASNB 4UV8A 3RYCA 1Y76A 4DV3O 3W7TA 1V54B 5LMUO 2R9RB 1Q6HA 2E74B 2EILB 5CA3A 3K5MA 4LFAO 1RSOB 1OCRC 4ICGA 1NTMH 4JZGA 1S5HC 3CWBH 4TV9B 3O9OA 2ZINA 3DTUB 1VQOV 2UXBB 3CS5A 4QJFB 2RN9A 3SPGA 3RYIB 3IJ4A 3IAYA 4NTXA 5KHGA 3IC7A 3TXQA 1QBZA 2H3OA 5EZYA 4XDLA 3U10A 5B1BC 3THOA 1HNZO 3JD2A 5KA6A 4CC5A 1IURA 2ZQMA 2GUZA 4WBNA 5CBFA 5LHIA 1QLEC 3K9SA 1H2MA 4IHJA 2CAZC 2F4VO 1PNMA 1PPJH 1K9MW 3WG7B 2IU3A 5B1AB 4GZRB 2XUMA 3HB3B 2QWQB 3JAWA 2AZ2A 3QNEA 4JAUA 1EN4A 3MAQA 4MTFA 2XOKG 2QEXV 1DF4A 2D2CB 1MABG 1NZ6A 1XDCA 4J7JA 3CRAA 4ZI7B 4DXWA 4LFAB 2EJRA 3G80A 2KG7A 3AG1B 3QVNA 3ZHSA 2LW7A 3RYFA 5EBMC 4ZOLB 1CEZA 1N33O 4JGSA 3VQXA 1VF5B 4O4LA 1K5SA 4B3TO 1SC5B 4LF9O 1F4MA 3LUTB 4IYIA 2K1EA 4D7TA 4UCTA 4X1YA 1S0VA 4PDMA 3SYPA 1W0JG 5JJEB 4TOIA 3FD9A 3JASA 4IL6Z 1PP9H 1HNZB 5IJ9B 3RBZA 3JAKA 1QR8A 1FPOA 2CK3G 5BMVA 2WLNA 3ASOB 2LJ2A 1Y4MA 1NQTA 2IJJA 3JYCA 4PA6A 1G1XB 1NVPB 1RPRA 2ODMA 2MW2B 2AXTZ 5CN0A 2QR4A 4PI0A 3NXSA 2PYJA 1Z5WA 3UT5A 5JH7A 1VF6A 3CX5F 2CTRA 1H2NA 1JMKC 4KUMA 5KLVH 2RMKB 5JQGB 2HHHO 4OXSA 3APQA 4K3AA 3D8CA 2GTAA 5IY5C 3K0DA 1HP8A 2EIJB 3P32A 1SQQH 4F6EA 3MDSA 1A32A 2HJDA 3D3QA 3ABMB 3J80N 3G71V 1N33B 5L3GA 1OZ0A 3D3IA 2GDSA 3CJHB 4GX0A 1NVPD 2JK5C 4TUYA 3WB0A 4B3TB 3STZC 4LF9B 3SGIA 3T1YO 3GWOA 3H1JH 3E8GA 3ZHQA 4CC6A 1XMOO 2LGQA 2WSSG 3B8NA 4K0KB 2XNDG 1YDXA 4QIWF 2YIBA 2OCCC 5H2FZ 3JCUZ 1GK9A 1XL4A 3L74H 4ASUG 2RJZA 4MTOA 5JJNB 1VQNV 2L35A 1BQZA 1PL4A 4LFBO 4X66O 3RFRA 4O4JA 1YXBA 1FKAO 2KB1A 1Q8IA 1S72V 2H8PC 4FK5C 1V55C 1OCRB 2N04A 1VMGA 4U3JB 2LO1A 3AG2C 3C90A 2HHHB 1KECA 2IJIA 4X20B 4BW5A 1OCOB 3JSNA 2HJFC 1ZAUA 4QE7A 3QO7A 3EXAA 2X6AA 3JATA 2YI9A 4UB6Z 4JI5O 3ZMSA 4E2LA 1RM1B 2QWOB 3F5WC 2DW4A 2EULA 3EVKA 4N21A 3SPCA 2HFEC 3DC6A 4UCRA 1YF2A 4CH6A 4AI8A 3CPWU 3UO2A 1SQXH 4X89A 1QCEA 4YJ3B 1GN2A 4DR7B 2ATKC 3T1YB 5A9GA 1SZTA 4FFBA 1QLEB 4QE9A 1EZJA 2QWNB 3R66A 1XMOB 1YTFB 2QWPB 4H0LB 3AG3C 1FJGO 3U0ZA 4JI0O 3BABA 4QGPA 3E8HA 4TWKA 3CEIA 3N2KA 4BWAA 2UXXA 4LFBB 4X66B 2D3OW 1HWYA 4YIOA 1O9HA 3H01A 3FYIB 4LH6A 3X2QC 4YJ2A 1ZL8B 3DC5A 4OGQB 1F7YA 3TXSA 1FXHA 5CA0A 4ZHQB 5KMGA 5FNVB 4K8ZA 4DK0A 4JAVA 1XL6A 3VBBA 1KBHA 1VP7A 1ZSPA 4QPJA 4DUZO 1BT8A 5KUKA 3AK1A 1QHTA 1OCZB 1YTFD 4JI5B 1Y6XA 4O4HA 4IIJA 2HVKC 3ZRWB 4I4TA 4P9PA 3OW2U 2P22C 4X64O 5CA1B 4LWSA 1V9PA 1R1BA 2UUAO 1BHBA 1M57C 4PD4F 4UVAA 3CCUV 5GTHZ 2AGAA 2IU0A 5L3CA 4FIPC 4O2BA 1K73W 1H8EG 5FPRA 1K92A 5LGNA 1U97A 1AR4A 5KHIA 4BW9A 4AQYO 4RUEA 4LNUB 2WLLB 2WLMA 1S5LZ 3OD4A 2BE3A 1GH6A 2OIGA 5DN6G 2E76B 1AP6A 1SRYA 2ITDC 4JAAA 1FJGB 4P9OA 3OGIB 3K0GA 3SYQA 5K1XA 3KZIZ 3HKCA 3T1CA 2DYSB 3LDDA 1AJQA 4MVSA 1P84F 4EB6B 5LOVB 1SKVA 3ZRSA 1BSMA 1TVKB 5IY5B 1BE3H 4G28B 1Y67A 1SA0A 2QTSA 2PYLA 1K7DA 3CCJV 3J81N 1L0LH 4O2AA 4DUZB 3N2GA 5CBHA 1IVSA 2BTQA 2JS5A 3LNNA 2GTSA 1FD9A 5C8YA 3ETDA 2DQ0A 1GRJA 2ZXWC 2XAFA 4WFBV 1DLBA 4K35A 5LL6Y 1JQ0A 4X64B 3K04A 4RUFA 2UUCO 5EYPB 1YJNV 4R6ZA 1SQVH 1ZUQA 3ICXA 4H37A 3FB5C 2W6IG 2Y69C 4AQYB 4WFHA 2QKAA 1GKFA 1AI6A 1JOYA 3ZMZA 3DXRA 4D6TH 1VQ6V 2DWDC 4X9QA 2YI8A 4NTYA 2JRIA 3G4SV 3AG2B 1Q86W 3K57A 5KX5A 2DJVA 4DR3O 2ZE6A 1ENVA 5J2UA 3JARB 3FB8C 1N0NA 1YVWA 2UXDO 3CCRV 1P49A 4GX1A 1KB9F 4B7EA 5L3FA 4CS3A 2IH3C 1JX9A 3W7XA 1L0NH 3CCMV 2F95B 4GUNA 3VQYA 4FLZA 1Y74A 1FXKB 2Q68A 2HP8A 2VWJA 1ORQC 3ZIAG 4DR2O 1HW7A 4F4LA 5EC2C 2PF4E 1Q6UA 4OPHA 2UUCB 5LYJB 2WWWA 4YIPA 5KHHA 4JI3O 2NN4A 5HFLA 1JJOA 2Q5ZA 5IYZA 1IZ3A 1GM9A 3JD0A 5JCOA 1NU1H 2M7WA 1I0HA 4JI6O 3CCSV 4U7OA 3LSQA 5CMUA 1R3KC 5KHKA 1S3JA 1GM7A 4K8XA 2JIZG 2Y48A 4TT3G 4X8AA 3RYHB 3BRCA 3AG4C 1OHHG 1WB7A 4I9QA 3ZHUA 3LSUA 3X2QB 3RGBA 3B8MA 3A0BZ 3CD6V 3FAVB 4GKKB 2BTOA 3K9AA 3K5NA 1Q43A 3SYAA 1B6QA 5EIBC 3FFQA 5KUMA 4N23A 3ZRVA 4X1KB 1JCHA 4AILC 1PM9A 5ITZB 1HNXO 2CH7B 4DR3B 2BOBC 4CBCA 4B3MO 2IJHA 2WLKA 3M8AA 4NB5A 2Q69A 2UXDB 3RVYA 2V1DA 5H6QA 2P6JA 5LA6B 3SJAC 2JGUA 2ZNIA 1D5NA 4U7NA 4DUYO 4JI1O 4I0XB 2CE4A 3RW0A 1MNGA 1MSWD 4DR2B 1I08A 4TV8B 1VF6C 2YEVB 3R65A 1B04A 2JGDA 5IWAO 3HKEA 3T2MA 5LGTA 3ZJZA 4JI3B 4CS4A 4PI2A 3ETEA 2QA4V 2PY5A 3OAAG 3AEIA 3ZMTA 4JI6B 5JQGA 4F6RA 3W7WA 1F51A 2ZD9A 4UVBA 5J2TB 1GM8A 2VRZA 1BMFG 4WCEV 3HKDB 3Q4HA 3DSQA 2F66C 1IXMA 1R6KA 2WPDG 4DRXA 4DV3B 2OWOA 1U96A 5LMUB 5TISZ 5JJJB 2CTQA 2IBZH 1IXBA 2IJKA 5A2QN 1VQPV 4JV5O 1HNXB 4LF7O 3SYCA 5H5NA 1GTOA 3KKYA 2M6YA 4B3MB 3K5OA 3UM7A 4CS2A 4JZ2A 3S3XA 1SQGA 2QSAA 1K8AW 4B3SO 3KCYA 5B5EZ 4HNAB 2JDIG 5LP6C 3ETQA 2OCHA 1WB8A 4JI1B 1WA8B 2Q67A 4WFEA 3ZBHA 3HR0A 1MZEA 4J7KA 4JYYA 4DV1O 3J7AU 2KQXA 2EZPA 3SR2C 3JALB 2PUSA 3VQVA 3ABLB 2WA3A 3ZN0A 2QJ1A 5IWAB 3VOUA 4LF8O 1AP5A 4X65O 1WN7A 3QO8A 2B1IA 5JVDA 3I56V 4Z1VA 3HKBA 2E3CA 4U3JA 4OPAA 4CH4A 2P4VA 2F4VB 2WLIA 1KD1W 1M4UA 4I50B 2NNUA 1WJZA 4PA9A 1JFFB 1M56C 3MD0A 1H2SB 2HLDG 4PA7A 1WAZA 4FZ0A 2DMXA 5EZYB 5KAFZ 4UV9A 3RT3C 1MG1A 1Q90D 3E2EA 2FTKA 3B4SA 3P3PA 1IDSA 2CGNA 4JV5B 4YJ3A 1SZXA 2GUZB 4WBNB 4X1IA 5BR8O 4IHJB 1XILA 4JI4O 4O4IA 2ETNA 5LXTA 1S76D 1YJ9V 4B3SB 3JAWB 2Q9LA 5EC1C 1Q81W 2ADQB 3L72H 4FFKA 4UUJC 4NR1A 4HZ3A 3ABKC 4E4EA 1ZWIC 4DV1B 1NI8A 1MOFA 2ZE5A 1I5YA 4LF8B 1NR1A 1Z5VA 2P06A 2OTLV 3AG4B 4EFBA 2KG7B 3TGUH 3E35A 5LHGA 3RYFB 4X65B 5LP6A 1K34A 3CC7V 1KU9A 5IE9A 1TA8A 2EIMC 1KC8W 1Q5OA 1XUQA 2XTAA 4JTCB 2HG5C 2Q7EA 3HPLC 4O4LB 3IGAC 4GX5A 4LF4O 2QKCA 2O57A 1GN4A 4Q20A 2FB5A 2LQTA 4X1YB 2HEPA 3ABTA 5IT9N 1AROP 1VQ8V 1N0JA 1PNKA 4DR1O 5B66Z 5EBLC 3JASB 1YEWA 1FS0G 3RN4A 2FYUH 2Y0PA 4I5SA 1D5AA 2UXNA 5GONA 5LGUA 3JAKB 4PELA 5BMVB 3L9DA 4ZKIA 1K5QA 3QO5A 3EFFK 5BR8B 5KAIZ 1SQFA 4JI4B 2YS8A 2WLLA 3OR7C 1EM1A 1FFXB 2YXYA 4WFAV 3ZS8C 5B1BB 1SS3A 3UT5B 5JH7B 4LR3A 3D36A 2QE7G 5DEDA 3S3WA 4J80A 4NVPA 2XASA 1H2GA 3ZRXA 3NR7A 4TSFG 2F23A 3W7UA 3BAAA 4H44B 1QQCA 4EB6A 3F7YC 2DOSA 4EKWA 5J9PC 3BPZA 2Y4UA 3E22B 1SETA 1NS1A 1RP3B 1YI2V 4J10A 4MVUA 5CBGA 4RQEA 2AW9A 3G6BA 1IBLO 3ETGA 4TUYB 4LF4B 4GYCB 4I9WA 2GHYA 1EZVH 4DV2O 4CH3A 2R9AA 4FLVA 4J9YB 2QWRB 3W7SA 4DR1B 2YIAA 2AHYA 3SJQC 1TUBA 5B1NA 1NH2B 2CTWA 5BZBA 4GKJO 1KQSU 2VQEO 3K06A 2W0XA 1R73A 4GX2A 5CB4A 4MW3A 4RQFA 4Q6GA 1V54C 1AB3A 4O4JB 3CB2A 2EILC 1VQLV 2N74A 2Q6AA 4BR6A 2MK3A 3AK3A 2AHZA 3BA8A 2UUBO 3STLC 4Z1MG 3SDLA 3SPJA 5AG2A 1ZTEA 1EBOA 4PJ0Z 2QM8A 3CCQV 4B3RO 4JYBA 3QTCA 4MTGA 4X88A 2GSMB 3E8BA 5BXZA 3CHXA 3JATB 4JI7O 2ZE8A 1TGOA 5IJ0B 2YIBD 3IFXA 1NH2D 4I55A 5H6RA 4JI0B 3OUSA 3GB7C 1YSCA 5D5PA 3WFVA 1G4YB 4DW1A 4BIUA 4OX9O 1IX9A 2BOCC 4UCSA 4DW0A 1IBLB 1XNQO 3JD3A 4MS2A 1S5JA 1BZKA 4DV2B 4DYLA 1L1FA 3CRRA 4U3FH 4FMTA 4FFBB 1E79G 3WG7C 4UXNA 2QGNA 4GLXA 2Q73A 3AK2A 2AZ0A 1XNRO 4BIOA 1QR9A 1P7BA 4JYAO 2YDEA 4GKJB 5JCOC 2VQEB 1R3JC 4W4KA 3BFRA 3TETA 2W0FC 3N2KB 1P4RA 1I94O 4JPRA 3ABKB 1MMMA 3KCXA 3LDCA 3OTFA 3OMAB 1AVMA 3T4DA 2UUAB 1W0KG 4MTXA 4YJ2B 4KXRA 5EBWC 2OCCB 1QVFU 3BCCH 2LGWA 1MSDA 5CA0B 1KKCA 4ABMA 3FAVA 1AI4A 3G6EV 1COWG 1S77D 5DM6V 2JS3A 2BSKA 4DO2A 4HAMA 3ZMVA 4PHZA 3SYOA 5D5QA 5EK0A 2CTPA 2QM4A 1AI7A 4B3RB 3IC9A 1AJPA 1AI5A 1JR9A 1IBMO 4JI7B 2ZKOA 3CYOA 3KG2A 4PV1B 4X1KA 1RSOA 3I55V 4O4HB 4G2KA 5ITZA 4IIJB 3FKSG 3F7VC 1FYJA 1VIBA 4LCUC 1V55B 4DV5O 4TV9A 1K33A 2OYQA 2DE0X 3E83A 2HVJC 1M1KW 3A0HZ 3K58A 1JA8A 3AG7A 1XNQB 2X6BA 2RNBA 2YIDA 3FX7A 3RYIA 1Q7YW 3CC2V 3BY6A 2Z0AA 1PD3A 2YUAA 1MZFA 2ZNJA 1TAEA 5E79Z 3ZHVA 3K03A 3A2FA 3B2EE 3ZEDA 4R50A 2IW5A 2XAJA 1NTKH 1F4NA 1XNRB 2YEVA 3B09A 4DV4O 1NR7A 2HR3A 2RQ6A 4KL1A 4MVQA 3JCZA 3L70H 4MVOA 3HKCB 1J5EO 4NXMO 1QU7A 4IYHA 3QF7A 1W59A 4ZBMA 4J9ZB 4DR6O 2NLJC 2B5UA 5J2TA 2EIJC 3CRQA 2XAGA 3T1HO 4J41A 4H33A 2JVDA 3HKDA 3AG3B 1X59A 3JSLA 1AR5A 3JAMN 5E1AC 3CCVV 4BAYA 4O2AB 3N2GB 2BTQB 2ZDIC 1GAXA 5IYDO 4ZI7A 1IBMB 5C8YB 4FM1A 1YITV 2CDYA 2XAHA 4UCUA 4ZOLA 4KFMA 4DV5B 4PA3A 1L8DA 1NT2B 2IM9A 2YICA 1XBLA 4XBFA 1SERA 4CH5A 4J42A 1EN6A 4FLWA 1AILA 4D7SA 5L3BA 2OTJV 1M90W 3O65A 5K1PA 4FZ1A 2F43G 4FM2A 1GN3A 1O9GA 4XDKA 2Q0OC 3B77A 2C2AA 3GWKC 2N05A 2OIEA 3H1HH 3CCEV 1OCCC 1ZLZA 4JYCA 4HBNA 1R3IC 3DXRB 3JALA 4DV4B 5IJ9A 1M57B 1WP8A 4GT1A 4JF3A 1QNMA 1J5EB 4NXMB 3LSSA 1KYOF 2F1MA 1OCOC 1LNQA 2Z5UA 4DR6B 1YHQV 2H94A 2XT9A 1Y66A 4I50A 3T1HB 4PA4A 1N32O 3L73H 1RM1C 2G38A 3SPIA 2EX3A 1XHZA
chains in the Genus database with same CATH topology
3ABLC 3FYEB 5H9CA 3CC4V 4JAVA 1XL6A 5EC1C 3SPHA 3VBBA 1PKXA 4QPJA 3CMAV 3ASOC 1Q81W 1GMGA 4HYOA 3OGCC 5KUKA 4WF9V 2A0LA 1H8HG 1E1QG 4UUJC 4LBEC 1DF5A 4HZ3A 2W6JG 1CP9A 3ABKC 4KP4A 1YTFD 1OCZB 2QM7A 1ZWIC 4YXWG 3FB6C 1MOFA 1R3LC 1TUEB 2HVKC 2B1GA 3LNMB 1I5XA 3ZRWB 4P9PA 3RVZA 3OW2U 1I5YA 3EHBB 1NR1A 1NJIW 2OTLV 3AG4B 1AJNA 3E35A 5LHGA 1K34A 1K4CC 1BHBA 1M57C 4UVAA 3CCUV 3OMIB 3CC7V 2IU0A 2ZR3A 2ZDIA 2EIMC 5IDJA 5L3CA 1KC8W 4FIPC 1K73W 3LDEA 3ZCCA 2EIKB 4JTCB 1H8EG 2ZXWB 1K92A 5LGNA 2HG5C 3HPLC 5KA5A 2X0LA 3IGAC 3M99B 4GX5A 1PL0A 4RUEA 2ZR2A 4MT8A 2WLLB 2WLMA 4Q20A 2R9IA 3ABMC 3E86A 4P2ZA 3ABTA 1AROP 5B3SC 5DN6G 1VQ8V 2ITCC 2HKOA 4FPPA 1THZA 1SRYA 2ITDC 1PNKA 4P9OA 5EBLC 2JJ1G 3K0GA 1FS0G 3SYQA 3CCLV 4I5SA 4RO2A 2UXNA 2DYSB 3T1CA 3LDDA 1AJQA 1NKDA 5LGUA 3E89A 4MVSA 4PELA 2Y69B 4RAIA 4ZKIA 2EINB 1OCZC 1K5QA 3QO5A 3EFFK 3ZRSA 4FJCC 2DYRB 1K97A 1BL8A 4MW8A 5IY5B 2WLLA 4G28B 3OR7C 1UJWB 4WFAV 5B1BB 1K7DA 3CCJV 4L87A 5LBQA 3D36A 5CBHA 2QE7G 2V7QG 4WFGA 1FFTB 5GW7A 1VQ5V 2LP7A 3ASNB 3ETDA 4UV8A 1PNLA 1H2GA 2XASA 3ZRXA 2DQ0A 3W7TA 2ZXWC 4TSFG 1V54B 3W7UA 2R9RB 2XAFA 4WFBV 5FL7G 1DLBA 3F7YC 2EILB 4EKWA 5J9PC 5CA3A 3MHSC 1JQ0A 1OCRC 3K04A 1CPYA 1DTOA 1SETA 4RUFA 1S5HC 1WLEA 1YI2V 1YJNV 4R6ZA 3CXCU 4MVUA 2IH1C 5CBGA 4RQEA 2DYSC 1JPXA 3DTUB 4H37A 1VQOV 3ETGA 3FB5C 3K08A 1RPOA 2W6IG 2Y69C 1KKDA 3OEHG 4WFHA 4QJFB 4I9WA 2GHYA 1GKFA 1AI6A 3SPGA 1JOYA 5L3DA 3ZMZA 5HFMA 2EBOA 3IC7A 4J9YB 1VQ6V 1QBZA 2DWDC 4XDLA 3W7SA 3UKMA 2AHYA 5B1BC 3SJQC 4MVMA 1J95A 5B1NA 1NH2B 5BZBA 3CMEV 1VQKV 3G4SV 3JD2A 5KA6A 1KQSU 3AG2B 1Q86W 2ZQMA 3K06A 5CBFA 5LHIA 1QLEC 1R73A 4GX2A 4RQFA 4MW3A 1ROPA 1V54C 2DQ3A 1PNMA 1K9MW 2QKSA 4P30A 2EILC 3WG7B 2A9HA 2IU3A 2Q6AA 3K3WA 5B1AB 1VQLV 3HB3B 3QNEA 4JAUA 2MK3A 1ENVA 2LFSA 3FB8C 4PDRA 2AHZA 5C93A 4MTFA 4QPKA 2XOKG 1JVMA 3CCRV 1YJWV 2WAMA 3STLC 1SESA 4GX1A 4Z1MG 2QEXV 1DF4A 1K3EA 5L3FA 2P7TC 3SPJA 4JTAB 1QVGU 2IH3C 1EBOA 1MABG 1JX9A 2QM8A 4LP8A 3W7XA 4JYBA 3CCQV 4MTGA 4X88A 2GSMB 3CCMV 3E8BA 3TCUA 1KP3A 2JJ2G 3ZRWA 4DXWA 1FXKB 2Q68A 4LC1A 1ORQC 3ZIAG 2EJRA 3IFXA 1NH2D 4F4LA 1M9NA 1Q82W 3AG1B 2PI5A 5H6RA 3OUSA 3GB7C 5EC2C 5EBMC 1OCCB 1YSCA 1CEZA 5L3EA 1EFRG 4JGSA 2WWWA 3WFVA 1G4YB 4BIUA 5HFLA 1GM9A 2BOCC 3JD0A 2M7WA 3JD3A 4MS2A 3CCSV 1K5SA 4U7OA 3LSQA 5CMUA 1R3KC 2WLIB 2X7RB 1F4MA 1S3JA 3LUTB 1GM7A 2JIZG 2Y48A 4TT3G 4X8AA 2K1EA 1L1FA 1S0VA 4PDMA 3AG4C 1OHHG 3SYPA 4FMTA 1W0JG 3X2QB 1E79G 3B8MA 3WG7C 3CD6V 4UXNA 3K9AA 5IYBO 4QNHB 3RBZA 1QR9A 2EIKC 1P7BA 4UVCA 1QR8A 3A0RA 3SYAA 2CK3G 1B6QA 2WLNA 4R8CA 3ASOB 4PDLA 2JEXA 1R3JC 3ZN1A 5KUMA 3TETA 1Y4MA 2W0FC 1VQ9V 1NQTA 4N23A 1P4RA 3ZRVA 2IJJA 3JYCA 1JCHA 4PA6A 1NVPB 4JPRA 1RPRA 3ABKB 2LFRA 3LDCA 3OMAB 2XAQA 1FXKC 5CN0A 3T4DA 4BIZA 3NXSA 1W0KG 4MTXA 2BOBC 4CBCA 5EBWC 2EZOA 2IJHA 2OCCB 1QVFU 2WLKA 2Q69A 2WLHA 3RVYA 2V1DA 5H6QA 2P6JA 1AI4A 3OEEG 1COWG 4KUMA 5DM6V 3G6EV 1S77D 3OR6C 4DO2A 4HAMA 3ZMVA 3SYOA 2EINC 3DGEA 4OXSA 5EK0A 4WFFA 1VQ7V 1AI7A 4U7NA 4JASA 1AJPA 1AI5A 4G27B 2DYRC 3RW0A 5IY5C 1VQ4V 3K0DA 3CYOA 3KG2A 1H38A 1G8MA 2EIJB 1MSWD 3P32A 3I55V 4G2KA 3FKSG 3F7VC 3BEHA 2YEVB 3R65A 4CZZA 3ABMB 3G71V 4LCUC 1V55B 5L3GA 1OZ0A 1K33A 5B3SB 3T2MA 3D3IA 3ZJZA 5LGTA 1W2BU 3E83A 2HVJC 4GX0A 2QA4V 3ASNC 3ETEA 1M1KW 3OAAG 1NVPD 5B1OA 2JK5C 3AEIA 3ZMTA 2X6BA 3CP1A 2A79B 3STZC 3ML0A 3T4ZA 3W7WA 1F51A 2ZD9A 4UVBA 3OM3B 1AR1B 4MVRA 1Q7YW 3GWOA 3CC2V 3BY6A 1PD3A 3E8GA 1GM8A 1BMFG 4WCEV 1BHAA 2X6CA 1E1RG 3K03A 4GCZA 3OUFA 1IXMA 3E8FA 2WSSG 4XDJA 4R50A 3B8NA 1R6KA 2XNDG 2IW5A 2XAJA 4QIWF 1F4NA 2OCCC 2WPDG 2YEVA 1NR7A 3JD1A 2HR3A 3PJSK 1GK9A 1XL4A 1VQMV 4ASUG 4MTOA 1VQNV 4MVQA 3JCZA 4MVOA 4ZBMA 2IJKA 4J9ZB 2QTOA 1VQPV 1F23A 2NLJC 3P30A 3SYCA 1GTOA 2B5UA 2EIJC 2XAGA 4JTDB 1M56B 4H33A 1WPXA 3UM7A 2KB1A 2P67A 3AG3B 1S72V 2H8PC 4FK5C 1K8AW 1V55C 1GO3F 1OCRB 3OFNG 5E1AC 3CCVV 3AG2C 4BAYA 4PDVA 2JDIG 1KECA 2IJIA 4BW5A 1FXVA 1OCOB 2HJFC 4QE7A 3QO7A 2Q67A 2ZDIC 2X6AA 4WFEA 5IYDO 1FXKA 3OE7G 3ZMSA 4E2LA 5B1AC 1YITV 1N8RW 1RM1B 3F5WC 2EZPA 2XAHA 2DW4A 3OMNB 2YSUB 1K4DC 3ABLB 3ZN0A 4N21A 3SPCA 2HFEC 4KFMA 3VOUA 4PA3A 4XBFA 1SERA 3JD4A 1KP2A 5IYCO 3CPWU 3QO8A 2B1IA 3I56V 5L3BA 4X89A 2OTJV 3K79A 1M90W 2WLIA 1KD1W 1QCEA 5LHHA 2F43G 2ATKC 4MVZA 4XDKA 1SZTA 2NNUA 3B77A 2C2AA 3AG1C 2PI4A 3ZMUA 1QLEB 4QE9A 1EZJA 3CCEV 4PA9A 3ABUA 1OCCC 4MSWC 1R6NA 1YTFB 1M56C 1QLNA 4JYCA 3MD0A 4PA7A 2HLDG 1R3IC 3TK1A 1M57B 3AG3C 4UV9A 1MG1A 2JEUA 2EIMB 4GT1A 1YIJV 2P90A 4JF3A 3E8HA 4TWKA 3E2EA 3LSSA 2FTKA 2UXXA 3MHHC 1OCOC 1LNQA 2D3OW 1HWYA 2OT5A 2Z5UA 1YHQV 2H94A 1NBMG 3H01A 3FYIB 2DWEC 1Y66A 3X2QC 2WLJA 4PA4A 1RM1C 3FB7C 3SPIA 1JJ2U 1FXHA 2Z3YA 4R7CA 1S76D 1YJ9V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL C;  4MTO A;  1R3K C;  4EKW A;  5J9P C;  2WLI B;  4MVQ A;  3LUT B;  4MVO A;  1XL6 A;  5EC1 C;  3SPH A;  4X8A A;  2K1E A;  1OCR C;  3ASO C;  3K04 A;  4HYO A;  3OGC C;  5KUK A;  4PDM A;  3AG4 C;  4ZBM A;  2A0L A;  3SYP A;  4J9Z B;  2QTO A;  4RUF A;  1S5H C;  4UUJ C;  4LBE C;  3WG7 C;  2NLJ C;  4HZ3 A;  4R6Z A;  3ABK C;  4MVU A;  3SYC A;  2IH1 C;  2EIJ C;  5CBG A;  1ZWI C;  4JTD B;  2DYS C;  3FB6 C;  4QNH B;  4H33 A;  4H37 A;  3FB5 C;  3RBZ A;  3K08 A;  3UM7 A;  2EIK C;  1P7B A;  1R3L C;  2HVK C;  2KB1 A;  2Y69 C;  3LNM B;  3SYA A;  2H8P C;  4P9P A;  3RVZ A;  1V55 C;  1KKD A;  2WLN A;  4R8C A;  4WFH A;  4I9W A;  4PDL A;  1R3J C;  5E1A C;  5KUM A;  3AG2 C;  3SPG A;  3TET A;  2W0F C;  4PDV A;  3JYC A;  4PA6 A;  1K4C C;  4BW5 A;  4J9Y B;  1M57 C;  2HJF C;  3LDC A;  4QE7 A;  2DWD C;  2Q67 A;  4XDL A;  3UKM A;  2X6A A;  4WFE A;  3T4D A;  2AHY A;  2EIM C;  5B1B C;  2BOB C;  3LDE A;  3SJQ C;  4CBC A;  4MVM A;  4JTC B;  1J95 A;  5B1A C;  5EBW C;  3F5W C;  2WLK A;  2HG5 C;  5BZB A;  3HPL C;  3IGA C;  2Q69 A;  4GX5 A;  2WLH A;  3RVY A;  1K4D C;  3K06 A;  4RUE A;  3SPC A;  3OR6 C;  2WLL B;  2HFE C;  2WLM A;  4KFM A;  3VOU A;  4PA3 A;  5CBF A;  3ABM C;  3E86 A;  1QLE C;  3SYO A;  4GX2 A;  2EIN C;  4MW3 A;  4P2Z A;  4OXS A;  5EK0 A;  1V54 C;  4WFF A;  5B3S C;  2ITC C;  2ITD C;  4G27 B;  2QKS A;  4P30 A;  2DYR C;  2EIL C;  4P9O A;  2A9H A;  4X89 A;  2Q6A A;  5EBL C;  3RW0 A;  5IY5 C;  3K0D A;  2WLI A;  3KG2 A;  3K0G A;  3SYQ A;  4RO2 A;  3T1C A;  2ATK C;  3LDD A;  4MVZ A;  4XDK A;  3FB8 C;  4PDR A;  3E89 A;  2AHZ A;  3F7V C;  4MTF A;  3BEH A;  4MVS A;  1JVM A;  3AG1 C;  3R65 A;  4QE9 A;  4RAI A;  4LCU C;  3STL C;  4GX1 A;  4PA9 A;  1OCC C;  1OCZ C;  2P7T C;  4MSW C;  3EFF K;  3SPJ A;  3T2M A;  1M56 C;  3ZJZ A;  3ZRS A;  3E83 A;  2HVJ C;  4GX0 A;  4JTA B;  3ASN C;  2IH3 C;  1R3I C;  4LP8 A;  4PA7 A;  1BL8 A;  4MW8 A;  4MTG A;  2JK5 C;  4X88 A;  2X6B A;  2WLL A;  3E8B A;  3AG3 C;  3OR7 C;  4G28 B;  3TCU A;  2A79 B;  3STZ C;  3T4Z A;  4DXW A;  2Q68 A;  1ORQ C;  2ZD9 A;  3E8H A;  4TWK A;  3IFX A;  4F4L A;  4MVR A;  3OUS A;  5CBH A;  3GB7 C;  5EC2 C;  5EBM C;  1OCO C;  1LNQ A;  4WFG A;  3E8G A;  2X6C A;  3K03 A;  1G4Y B;  3OUF A;  2DWE C;  3E8F A;  3X2Q C;  4XDJ A;  4R50 A;  2WLJ A;  4PA4 A;  2OCC C;  2ZXW C;  2YEV A;  2BOC C;  3FB7 C;  3SPI A;  2R9R B;  3PJS K;  4MS2 A;  1XL4 A;  4R7C A;  3F7Y C; 
#chains in the Genus database with same CATH topology
 1JFF A;  3FYE B;  5H9C A;  5KX5 B;  3CC4 V;  3SPH A;  2RDC A;  1WP7 A;  5J2U B;  4B08 A;  5BY1 A;  4HYO A;  3OGC C;  4WF9 V;  1H8H G;  1E1Q G;  4LBE C;  3SJB C;  2W6J G;  3ZX6 A;  4TQD A;  4DV6 O;  2ADP A;  1Y74 B;  3RVZ A;  1NJI W;  3CJH A;  1HR0 O;  1K4C C;  1XMQ O;  1VF7 A;  4FLY A;  2ZDI A;  2PGG A;  4EEQ A;  3LDE A;  3ZCC A;  3WB2 A;  5IYZ B;  2ZXW B;  2GBO A;  2KKW A;  1PL0 A;  4MT8 A;  3K5L A;  3E86 A;  4DR5 O;  2A3Q A;  4P2Z A;  1YZB A;  1VEW A;  5B3S C;  2ITC C;  1OV9 A;  2HKO A;  4FPP A;  3CSX A;  2JJ1 G;  4DUY B;  1UFI A;  3CCL V;  2EJ7 A;  1H2K A;  3RYC B;  1Y76 B;  1NKD A;  3ZHT A;  2Y69 B;  4RAI A;  2R72 A;  1OCZ C;  1M93 A;  2YXH A;  1N32 B;  1BL8 A;  2Q8V A;  2DN9 A;  1UPG A;  4NXN O;  4TQF A;  1UJW B;  1I7F A;  3L75 H;  2FML A;  1LR1 A;  4WFG A;  1FFT B;  4X20 A;  1VQ5 V;  4K0K O;  2LP7 A;  3H1K H;  4DV6 B;  1PNL A;  1SF9 A;  4UFZ A;  3SJC C;  2VQF O;  5FL7 G;  1H2L A;  4J7Z A;  3MHS C;  1CPY A;  2VS0 A;  1FFX A;  1DTO A;  1HR0 B;  2Y0I A;  1WLE A;  2ZT9 B;  3D36 C;  2JGD B;  1XMQ B;  3CXC U;  2WA4 A;  2IH1 C;  3HKE B;  1US6 A;  2DYS C;  1JPX A;  4LF7 B;  3K08 A;  1RPO A;  4RWU A;  4NTW A;  1KKD A;  3OEH G;  4F6R B;  4IT5 A;  1KMI Z;  5FPO A;  4DR5 B;  5L3D A;  3APO A;  5HFM A;  2EBO A;  3E22 A;  3Q4H B;  1VAR A;  3UKM A;  3VQW A;  1Q3E A;  4MVM A;  1J95 A;  2YXL A;  4DRX B;  3CME V;  1VQK V;  4Z2W A;  3K59 A;  1R6T A;  3CXH F;  1M5I A;  1ROP A;  1ZL8 A;  1WPB A;  2DQ3 A;  2QKS A;  4ZHQ A;  4P30 A;  4NXN B;  4DR7 O;  5FNV A;  2A9H A;  3K3W A;  2BCC H;  3WB1 A;  2F93 B;  1ZX3 A;  3U11 A;  2ZM6 O;  2LFS A;  4PDR A;  5C93 A;  4QPK A;  1BGY H;  1JVM A;  1YJW V;  2WAM A;  1SES A;  2LW1 A;  1K3E A;  2P7T C;  4JTA B;  1QVG U;  4LP8 A;  3I5D A;  4I7Z B;  3TCU A;  2VQF B;  1KP3 A;  2JJ2 G;  2P4K A;  3ZRW A;  3UCS C;  4LC1 A;  5CA1 A;  1M9N A;  1Q82 W;  2P5O A;  2PI5 A;  3F5T A;  1IBK O;  5F2V O;  1OCC B;  5L3E A;  1EFR G;  4W4L A;  2ZIO A;  5JVD B;  4YHH O;  3HKB B;  1D2D A;  4KHP O;  1NTZ H;  3OTO O;  2WLI B;  2X7R B;  4LNU A;  3B40 A;  3OT7 A;  4LH7 A;  1DK1 A;  1XEQ A;  2B9Z A;  4FLT A;  2RCV A;  5IJ0 A;  5EIB D;  5JWP A;  5IYB O;  4QNH B;  2EIK C;  4UVC A;  3A0R A;  4R8C A;  2UU9 O;  4PDL A;  4NKG B;  2JEX A;  3ZN1 A;  5LOV A;  1VQ9 V;  2CGO A;  4IGG A;  1TVK A;  2LFR A;  4LF6 O;  4AHC A;  2XAQ A;  2R70 A;  1FXK C;  1LUV A;  2V4D A;  4BIZ A;  1HNW O;  4X1I B;  2ZM6 B;  2EZO A;  3WU2 Z;  4O4I B;  5LXT B;  3UO3 A;  4NYK A;  2WLH A;  4DR4 O;  3OEE G;  3OR6 C;  2Q7H A;  3H1L H;  2ILM A;  2EIN C;  2ZIM A;  3DGE A;  3G67 A;  4L8J A;  4WFF A;  1VQ7 V;  4JAS A;  1DGS A;  4G27 B;  2DYR C;  1X4T A;  1VQ4 V;  1YCI A;  3GVM A;  2CUG A;  1H38 A;  1G8M A;  4H13 B;  1N4C A;  1IBK B;  3BEH A;  4CZZ A;  1B06 A;  3TJT A;  5EYP A;  5B3S B;  3QG5 A;  1W2B U;  3ASN C;  5LP6 B;  1XI1 A;  3PN1 A;  5B1O A;  4YHH B;  1XQ8 A;  5KHJ A;  3CP1 A;  1KUQ A;  2A79 B;  4KHP B;  3ML0 A;  1CXZ B;  1PV0 A;  3T4Z A;  3OTO B;  1URF A;  3OM3 B;  3H1I H;  4MVR A;  3N27 A;  2KSD A;  3BA9 A;  1AR1 B;  1BHA A;  2X6C A;  1E1R G;  4GCZ A;  3OUF A;  3E8F A;  3CRC A;  4XDJ A;  2E5L O;  3JD1 A;  3PJS K;  1VQM V;  4JI8 O;  5GTI Z;  3C3T A;  2UU9 B;  4LFC O;  5GON B;  4EFE A;  1WNS A;  2QTO A;  2K9P A;  4UB8 Z;  4LF6 B;  1F23 A;  2VWK A;  3P30 A;  1HNW B;  1OJH A;  4JTD B;  1M56 B;  4C7U A;  1WPX A;  3JAR A;  2P67 A;  3A8T A;  4DR4 B;  1GO3 F;  5FLX N;  3OFN G;  4YY3 O;  4PDV A;  1FXV A;  3M7M X;  4LF5 O;  2UXC O;  2ZCE A;  1FXK A;  3OE7 G;  1N8R W;  2ZE7 A;  5B1A C;  4DV7 O;  3OMN B;  2YSU B;  4DV0 O;  1HDJ A;  1K4D C;  1SQP H;  5LYJ A;  3P3N A;  3C3S A;  3JD4 A;  1KP2 A;  5IYC O;  2Q7G A;  1BCC H;  2ARH A;  3K79 A;  5DEC A;  4JI2 O;  5LHH A;  4MVZ A;  1N34 O;  3RYH A;  1GN6 A;  3AG1 C;  2YC0 A;  2PI4 A;  3ZMU A;  1P7G A;  3ZHR A;  5KMG B;  3ABU A;  4MSW C;  1R6N A;  1EN5 A;  1QLN A;  2UUB B;  1LUW A;  2E5L B;  1XOU A;  3TK1 A;  2QDO A;  4JI8 B;  2A06 H;  2JEU A;  2EIM B;  1YIJ V;  1N36 O;  2A7W A;  2P90 A;  1TUB B;  4LFC B;  3MHH C;  1XRE A;  2E75 B;  2OT5 A;  1FAF A;  1NBM G;  2DWE C;  4I4T B;  2CH7 A;  5CB4 B;  1G6U A;  2WLJ A;  3FB7 C;  5LMN O;  4LWS B;  4X62 O;  4R7C A;  2Z3Y A;  2FKX A;  1JJ2 U;  1B3Q A;  4OX9 B;  3ABL C;  5LA6 A;  2NR5 A;  4YY3 B;  1Q6I A;  1PKX A;  3BHP A;  2Q0A A;  3CMA V;  3ASO C;  1GMG A;  4O2B B;  4GKK O;  2A0L A;  1BQ0 A;  1DF5 A;  3L71 H;  4I0X A;  1CP9 A;  2PZS A;  4LF5 B;  2L6L A;  2UXC B;  4KP4 A;  2QM7 A;  4YXW G;  3FB6 C;  4DV7 B;  4TV8 A;  4UCO A;  1T5E A;  3H9V A;  1R3L C;  1TUE B;  3LNM B;  2B1G A;  4DV0 B;  1I5X A;  3CRM A;  3EHB B;  4JYA B;  4I55 B;  4FM0 A;  4FVM A;  1AJN A;  2PTM A;  1BS3 A;  3OMI B;  2XHB A;  1I94 B;  2ZR3 A;  4UCV A;  5IDJ A;  4JI2 B;  1MA1 A;  2EIK B;  1N34 B;  5KA5 A;  2X0L A;  3M99 B;  2UXB O;  2ZR2 A;  2R9I A;  3ABM C;  1SA0 B;  4DK1 A;  2Y4T A;  4J11 A;  1RFY A;  1THZ A;  3UQ8 A;  1N36 B;  4RO2 A;  3RWR D;  3E89 A;  2Q4P A;  2EIN B;  1Z2G A;  4FLX A;  1SQB H;  4FJC C;  2DYR B;  1K97 A;  4MW8 A;  5LMN B;  4X62 B;  3BVO A;  4FLU A;  4B7K A;  2FL4 A;  4HNA A;  4L87 A;  5LBQ A;  2V7Q G;  5GW7 A;  2GV9 A;  4A5U B;  3CE2 A;  1WA8 A;  2BSK B;  1XHX A;  4ZIB A;  3ASN B;  4UV8 A;  3RYC A;  1Y76 A;  4DV3 O;  3W7T A;  1V54 B;  5LMU O;  2R9R B;  1Q6H A;  2E74 B;  2EIL B;  5CA3 A;  3K5M A;  4LFA O;  1RSO B;  1OCR C;  4ICG A;  1NTM H;  4JZG A;  1S5H C;  3CWB H;  4TV9 B;  3O9O A;  2ZIN A;  3DTU B;  1VQO V;  2UXB B;  3CS5 A;  4QJF B;  2RN9 A;  3SPG A;  3RYI B;  3IJ4 A;  3IAY A;  4NTX A;  5KHG A;  3IC7 A;  3TXQ A;  1QBZ A;  2H3O A;  5EZY A;  4XDL A;  3U10 A;  5B1B C;  3THO A;  1HNZ O;  3JD2 A;  5KA6 A;  4CC5 A;  1IUR A;  2ZQM A;  2GUZ A;  4WBN A;  5CBF A;  5LHI A;  1QLE C;  3K9S A;  1H2M A;  4IHJ A;  2CAZ C;  2F4V O;  1PNM A;  1PPJ H;  1K9M W;  3WG7 B;  2IU3 A;  5B1A B;  4GZR B;  2XUM A;  3HB3 B;  2QWQ B;  3JAW A;  2AZ2 A;  3QNE A;  4JAU A;  1EN4 A;  3MAQ A;  4MTF A;  2XOK G;  2QEX V;  1DF4 A;  2D2C B;  1MAB G;  1NZ6 A;  1XDC A;  4J7J A;  3CRA A;  4ZI7 B;  4DXW A;  4LFA B;  2EJR A;  3G80 A;  2KG7 A;  3AG1 B;  3QVN A;  3ZHS A;  2LW7 A;  3RYF A;  5EBM C;  4ZOL B;  1CEZ A;  1N33 O;  4JGS A;  3VQX A;  1VF5 B;  4O4L A;  1K5S A;  4B3T O;  1SC5 B;  4LF9 O;  1F4M A;  3LUT B;  4IYI A;  2K1E A;  4D7T A;  4UCT A;  4X1Y A;  1S0V A;  4PDM A;  3SYP A;  1W0J G;  5JJE B;  4TOI A;  3FD9 A;  3JAS A;  4IL6 Z;  1PP9 H;  1HNZ B;  5IJ9 B;  3RBZ A;  3JAK A;  1QR8 A;  1FPO A;  2CK3 G;  5BMV A;  2WLN A;  3ASO B;  2LJ2 A;  1Y4M A;  1NQT A;  2IJJ A;  3JYC A;  4PA6 A;  1G1X B;  1NVP B;  1RPR A;  2ODM A;  2MW2 B;  2AXT Z;  5CN0 A;  2QR4 A;  4PI0 A;  3NXS A;  2PYJ A;  1Z5W A;  3UT5 A;  5JH7 A;  1VF6 A;  3CX5 F;  2CTR A;  1H2N A;  1JMK C;  4KUM A;  5KLV H;  2RMK B;  5JQG B;  2HHH O;  4OXS A;  3APQ A;  4K3A A;  3D8C A;  2GTA A;  5IY5 C;  3K0D A;  1HP8 A;  2EIJ B;  3P32 A;  1SQQ H;  4F6E A;  3MDS A;  1A32 A;  2HJD A;  3D3Q A;  3ABM B;  3J80 N;  3G71 V;  1N33 B;  5L3G A;  1OZ0 A;  3D3I A;  2GDS A;  3CJH B;  4GX0 A;  1NVP D;  2JK5 C;  4TUY A;  3WB0 A;  4B3T B;  3STZ C;  4LF9 B;  3SGI A;  3T1Y O;  3GWO A;  3H1J H;  3E8G A;  3ZHQ A;  4CC6 A;  1XMO O;  2LGQ A;  2WSS G;  3B8N A;  4K0K B;  2XND G;  1YDX A;  4QIW F;  2YIB A;  2OCC C;  5H2F Z;  3JCU Z;  1GK9 A;  1XL4 A;  3L74 H;  4ASU G;  2RJZ A;  4MTO A;  5JJN B;  1VQN V;  2L35 A;  1BQZ A;  1PL4 A;  4LFB O;  4X66 O;  3RFR A;  4O4J A;  1YXB A;  1FKA O;  2KB1 A;  1Q8I A;  1S72 V;  2H8P C;  4FK5 C;  1V55 C;  1OCR B;  2N04 A;  1VMG A;  4U3J B;  2LO1 A;  3AG2 C;  3C90 A;  2HHH B;  1KEC A;  2IJI A;  4X20 B;  4BW5 A;  1OCO B;  3JSN A;  2HJF C;  1ZAU A;  4QE7 A;  3QO7 A;  3EXA A;  2X6A A;  3JAT A;  2YI9 A;  4UB6 Z;  4JI5 O;  3ZMS A;  4E2L A;  1RM1 B;  2QWO B;  3F5W C;  2DW4 A;  2EUL A;  3EVK A;  4N21 A;  3SPC A;  2HFE C;  3DC6 A;  4UCR A;  1YF2 A;  4CH6 A;  4AI8 A;  3CPW U;  3UO2 A;  1SQX H;  4X89 A;  1QCE A;  4YJ3 B;  1GN2 A;  4DR7 B;  2ATK C;  3T1Y B;  5A9G A;  1SZT A;  4FFB A;  1QLE B;  4QE9 A;  1EZJ A;  2QWN B;  3R66 A;  1XMO B;  1YTF B;  2QWP B;  4H0L B;  3AG3 C;  1FJG O;  3U0Z A;  4JI0 O;  3BAB A;  4QGP A;  3E8H A;  4TWK A;  3CEI A;  3N2K A;  4BWA A;  2UXX A;  4LFB B;  4X66 B;  2D3O W;  1HWY A;  4YIO A;  1O9H A;  3H01 A;  3FYI B;  4LH6 A;  3X2Q C;  4YJ2 A;  1ZL8 B;  3DC5 A;  4OGQ B;  1F7Y A;  3TXS A;  1FXH A;  5CA0 A;  4ZHQ B;  5KMG A;  5FNV B;  4K8Z A;  4DK0 A;  4JAV A;  1XL6 A;  3VBB A;  1KBH A;  1VP7 A;  1ZSP A;  4QPJ A;  4DUZ O;  1BT8 A;  5KUK A;  3AK1 A;  1QHT A;  1OCZ B;  1YTF D;  4JI5 B;  1Y6X A;  4O4H A;  4IIJ A;  2HVK C;  3ZRW B;  4I4T A;  4P9P A;  3OW2 U;  2P22 C;  4X64 O;  5CA1 B;  4LWS A;  1V9P A;  1R1B A;  2UUA O;  1BHB A;  1M57 C;  4PD4 F;  4UVA A;  3CCU V;  5GTH Z;  2AGA A;  2IU0 A;  5L3C A;  4FIP C;  4O2B A;  1K73 W;  1H8E G;  5FPR A;  1K92 A;  5LGN A;  1U97 A;  1AR4 A;  5KHI A;  4BW9 A;  4AQY O;  4RUE A;  4LNU B;  2WLL B;  2WLM A;  1S5L Z;  3OD4 A;  2BE3 A;  1GH6 A;  2OIG A;  5DN6 G;  2E76 B;  1AP6 A;  1SRY A;  2ITD C;  4JAA A;  1FJG B;  4P9O A;  3OGI B;  3K0G A;  3SYQ A;  5K1X A;  3KZI Z;  3HKC A;  3T1C A;  2DYS B;  3LDD A;  1AJQ A;  4MVS A;  1P84 F;  4EB6 B;  5LOV B;  1SKV A;  3ZRS A;  1BSM A;  1TVK B;  5IY5 B;  1BE3 H;  4G28 B;  1Y67 A;  1SA0 A;  2QTS A;  2PYL A;  1K7D A;  3CCJ V;  3J81 N;  1L0L H;  4O2A A;  4DUZ B;  3N2G A;  5CBH A;  1IVS A;  2BTQ A;  2JS5 A;  3LNN A;  2GTS A;  1FD9 A;  5C8Y A;  3ETD A;  2DQ0 A;  1GRJ A;  2ZXW C;  2XAF A;  4WFB V;  1DLB A;  4K35 A;  5LL6 Y;  1JQ0 A;  4X64 B;  3K04 A;  4RUF A;  2UUC O;  5EYP B;  1YJN V;  4R6Z A;  1SQV H;  1ZUQ A;  3ICX A;  4H37 A;  3FB5 C;  2W6I G;  2Y69 C;  4AQY B;  4WFH A;  2QKA A;  1GKF A;  1AI6 A;  1JOY A;  3ZMZ A;  3DXR A;  4D6T H;  1VQ6 V;  2DWD C;  4X9Q A;  2YI8 A;  4NTY A;  2JRI A;  3G4S V;  3AG2 B;  1Q86 W;  3K57 A;  5KX5 A;  2DJV A;  4DR3 O;  2ZE6 A;  1ENV A;  5J2U A;  3JAR B;  3FB8 C;  1N0N A;  1YVW A;  2UXD O;  3CCR V;  1P49 A;  4GX1 A;  1KB9 F;  4B7E A;  5L3F A;  4CS3 A;  2IH3 C;  1JX9 A;  3W7X A;  1L0N H;  3CCM V;  2F95 B;  4GUN A;  3VQY A;  4FLZ A;  1Y74 A;  1FXK B;  2Q68 A;  2HP8 A;  2VWJ A;  1ORQ C;  3ZIA G;  4DR2 O;  1HW7 A;  4F4L A;  5EC2 C;  2PF4 E;  1Q6U A;  4OPH A;  2UUC B;  5LYJ B;  2WWW A;  4YIP A;  5KHH A;  4JI3 O;  2NN4 A;  5HFL A;  1JJO A;  2Q5Z A;  5IYZ A;  1IZ3 A;  1GM9 A;  3JD0 A;  5JCO A;  1NU1 H;  2M7W A;  1I0H A;  4JI6 O;  3CCS V;  4U7O A;  3LSQ A;  5CMU A;  1R3K C;  5KHK A;  1S3J A;  1GM7 A;  4K8X A;  2JIZ G;  2Y48 A;  4TT3 G;  4X8A A;  3RYH B;  3BRC A;  3AG4 C;  1OHH G;  1WB7 A;  4I9Q A;  3ZHU A;  3LSU A;  3X2Q B;  3RGB A;  3B8M A;  3A0B Z;  3CD6 V;  3FAV B;  4GKK B;  2BTO A;  3K9A A;  3K5N A;  1Q43 A;  3SYA A;  1B6Q A;  5EIB C;  3FFQ A;  5KUM A;  4N23 A;  3ZRV A;  4X1K B;  1JCH A;  4AIL C;  1PM9 A;  5ITZ B;  1HNX O;  2CH7 B;  4DR3 B;  2BOB C;  4CBC A;  4B3M O;  2IJH A;  2WLK A;  3M8A A;  4NB5 A;  2Q69 A;  2UXD B;  3RVY A;  2V1D A;  5H6Q A;  2P6J A;  5LA6 B;  3SJA C;  2JGU A;  2ZNI A;  1D5N A;  4U7N A;  4DUY O;  4JI1 O;  4I0X B;  2CE4 A;  3RW0 A;  1MNG A;  1MSW D;  4DR2 B;  1I08 A;  4TV8 B;  1VF6 C;  2YEV B;  3R65 A;  1B04 A;  2JGD A;  5IWA O;  3HKE A;  3T2M A;  5LGT A;  3ZJZ A;  4JI3 B;  4CS4 A;  4PI2 A;  3ETE A;  2QA4 V;  2PY5 A;  3OAA G;  3AEI A;  3ZMT A;  4JI6 B;  5JQG A;  4F6R A;  3W7W A;  1F51 A;  2ZD9 A;  4UVB A;  5J2T B;  1GM8 A;  2VRZ A;  1BMF G;  4WCE V;  3HKD B;  3Q4H A;  3DSQ A;  2F66 C;  1IXM A;  1R6K A;  2WPD G;  4DRX A;  4DV3 B;  2OWO A;  1U96 A;  5LMU B;  5TIS Z;  5JJJ B;  2CTQ A;  2IBZ H;  1IXB A;  2IJK A;  5A2Q N;  1VQP V;  4JV5 O;  1HNX B;  4LF7 O;  3SYC A;  5H5N A;  1GTO A;  3KKY A;  2M6Y A;  4B3M B;  3K5O A;  3UM7 A;  4CS2 A;  4JZ2 A;  3S3X A;  1SQG A;  2QSA A;  1K8A W;  4B3S O;  3KCY A;  5B5E Z;  4HNA B;  2JDI G;  5LP6 C;  3ETQ A;  2OCH A;  1WB8 A;  4JI1 B;  1WA8 B;  2Q67 A;  4WFE A;  3ZBH A;  3HR0 A;  1MZE A;  4J7K A;  4JYY A;  4DV1 O;  3J7A U;  2KQX A;  2EZP A;  3SR2 C;  3JAL B;  2PUS A;  3VQV A;  3ABL B;  2WA3 A;  3ZN0 A;  2QJ1 A;  5IWA B;  3VOU A;  4LF8 O;  1AP5 A;  4X65 O;  1WN7 A;  3QO8 A;  2B1I A;  5JVD A;  3I56 V;  4Z1V A;  3HKB A;  2E3C A;  4U3J A;  4OPA A;  4CH4 A;  2P4V A;  2F4V B;  2WLI A;  1KD1 W;  1M4U A;  4I50 B;  2NNU A;  1WJZ A;  4PA9 A;  1JFF B;  1M56 C;  3MD0 A;  1H2S B;  2HLD G;  4PA7 A;  1WAZ A;  4FZ0 A;  2DMX A;  5EZY B;  5KAF Z;  4UV9 A;  3RT3 C;  1MG1 A;  1Q90 D;  3E2E A;  2FTK A;  3B4S A;  3P3P A;  1IDS A;  2CGN A;  4JV5 B;  4YJ3 A;  1SZX A;  2GUZ B;  4WBN B;  4X1I A;  5BR8 O;  4IHJ B;  1XIL A;  4JI4 O;  4O4I A;  2ETN A;  5LXT A;  1S76 D;  1YJ9 V;  4B3S B;  3JAW B;  2Q9L A;  5EC1 C;  1Q81 W;  2ADQ B;  3L72 H;  4FFK A;  4UUJ C;  4NR1 A;  4HZ3 A;  3ABK C;  4E4E A;  1ZWI C;  4DV1 B;  1NI8 A;  1MOF A;  2ZE5 A;  1I5Y A;  4LF8 B;  1NR1 A;  1Z5V A;  2P06 A;  2OTL V;  3AG4 B;  4EFB A;  2KG7 B;  3TGU H;  3E35 A;  5LHG A;  3RYF B;  4X65 B;  5LP6 A;  1K34 A;  3CC7 V;  1KU9 A;  5IE9 A;  1TA8 A;  2EIM C;  1KC8 W;  1Q5O A;  1XUQ A;  2XTA A;  4JTC B;  2HG5 C;  2Q7E A;  3HPL C;  4O4L B;  3IGA C;  4GX5 A;  4LF4 O;  2QKC A;  2O57 A;  1GN4 A;  4Q20 A;  2FB5 A;  2LQT A;  4X1Y B;  2HEP A;  3ABT A;  5IT9 N;  1ARO P;  1VQ8 V;  1N0J A;  1PNK A;  4DR1 O;  5B66 Z;  5EBL C;  3JAS B;  1YEW A;  1FS0 G;  3RN4 A;  2FYU H;  2Y0P A;  4I5S A;  1D5A A;  2UXN A;  5GON A;  5LGU A;  3JAK B;  4PEL A;  5BMV B;  3L9D A;  4ZKI A;  1K5Q A;  3QO5 A;  3EFF K;  5BR8 B;  5KAI Z;  1SQF A;  4JI4 B;  2YS8 A;  2WLL A;  3OR7 C;  1EM1 A;  1FFX B;  2YXY A;  4WFA V;  3ZS8 C;  5B1B B;  1SS3 A;  3UT5 B;  5JH7 B;  4LR3 A;  3D36 A;  2QE7 G;  5DED A;  3S3W A;  4J80 A;  4NVP A;  2XAS A;  1H2G A;  3ZRX A;  3NR7 A;  4TSF G;  2F23 A;  3W7U A;  3BAA A;  4H44 B;  1QQC A;  4EB6 A;  3F7Y C;  2DOS A;  4EKW A;  5J9P C;  3BPZ A;  2Y4U A;  3E22 B;  1SET A;  1NS1 A;  1RP3 B;  1YI2 V;  4J10 A;  4MVU A;  5CBG A;  4RQE A;  2AW9 A;  3G6B A;  1IBL O;  3ETG A;  4TUY B;  4LF4 B;  4GYC B;  4I9W A;  2GHY A;  1EZV H;  4DV2 O;  4CH3 A;  2R9A A;  4FLV A;  4J9Y B;  2QWR B;  3W7S A;  4DR1 B;  2YIA A;  2AHY A;  3SJQ C;  1TUB A;  5B1N A;  1NH2 B;  2CTW A;  5BZB A;  4GKJ O;  1KQS U;  2VQE O;  3K06 A;  2W0X A;  1R73 A;  4GX2 A;  5CB4 A;  4MW3 A;  4RQF A;  4Q6G A;  1V54 C;  1AB3 A;  4O4J B;  3CB2 A;  2EIL C;  1VQL V;  2N74 A;  2Q6A A;  4BR6 A;  2MK3 A;  3AK3 A;  2AHZ A;  3BA8 A;  2UUB O;  3STL C;  4Z1M G;  3SDL A;  3SPJ A;  5AG2 A;  1ZTE A;  1EBO A;  4PJ0 Z;  2QM8 A;  3CCQ V;  4B3R O;  4JYB A;  3QTC A;  4MTG A;  4X88 A;  2GSM B;  3E8B A;  5BXZ A;  3CHX A;  3JAT B;  4JI7 O;  2ZE8 A;  1TGO A;  5IJ0 B;  2YIB D;  3IFX A;  1NH2 D;  4I55 A;  5H6R A;  4JI0 B;  3OUS A;  3GB7 C;  1YSC A;  5D5P A;  3WFV A;  1G4Y B;  4DW1 A;  4BIU A;  4OX9 O;  1IX9 A;  2BOC C;  4UCS A;  4DW0 A;  1IBL B;  1XNQ O;  3JD3 A;  4MS2 A;  1S5J A;  1BZK A;  4DV2 B;  4DYL A;  1L1F A;  3CRR A;  4U3F H;  4FMT A;  4FFB B;  1E79 G;  3WG7 C;  4UXN A;  2QGN A;  4GLX A;  2Q73 A;  3AK2 A;  2AZ0 A;  1XNR O;  4BIO A;  1QR9 A;  1P7B A;  4JYA O;  2YDE A;  4GKJ B;  5JCO C;  2VQE B;  1R3J C;  4W4K A;  3BFR A;  3TET A;  2W0F C;  3N2K B;  1P4R A;  1I94 O;  4JPR A;  3ABK B;  1MMM A;  3KCX A;  3LDC A;  3OTF A;  3OMA B;  1AVM A;  3T4D A;  2UUA B;  1W0K G;  4MTX A;  4YJ2 B;  4KXR A;  5EBW C;  2OCC B;  1QVF U;  3BCC H;  2LGW A;  1MSD A;  5CA0 B;  1KKC A;  4ABM A;  3FAV A;  1AI4 A;  3G6E V;  1COW G;  1S77 D;  5DM6 V;  2JS3 A;  2BSK A;  4DO2 A;  4HAM A;  3ZMV A;  4PHZ A;  3SYO A;  5D5Q A;  5EK0 A;  2CTP A;  2QM4 A;  1AI7 A;  4B3R B;  3IC9 A;  1AJP A;  1AI5 A;  1JR9 A;  1IBM O;  4JI7 B;  2ZKO A;  3CYO A;  3KG2 A;  4PV1 B;  4X1K A;  1RSO A;  3I55 V;  4O4H B;  4G2K A;  5ITZ A;  4IIJ B;  3FKS G;  3F7V C;  1FYJ A;  1VIB A;  4LCU C;  1V55 B;  4DV5 O;  4TV9 A;  1K33 A;  2OYQ A;  2DE0 X;  3E83 A;  2HVJ C;  1M1K W;  3A0H Z;  3K58 A;  1JA8 A;  3AG7 A;  1XNQ B;  2X6B A;  2RNB A;  2YID A;  3FX7 A;  3RYI A;  1Q7Y W;  3CC2 V;  3BY6 A;  2Z0A A;  1PD3 A;  2YUA A;  1MZF A;  2ZNJ A;  1TAE A;  5E79 Z;  3ZHV A;  3K03 A;  3A2F A;  3B2E E;  3ZED A;  4R50 A;  2IW5 A;  2XAJ A;  1NTK H;  1F4N A;  1XNR B;  2YEV A;  3B09 A;  4DV4 O;  1NR7 A;  2HR3 A;  2RQ6 A;  4KL1 A;  4MVQ A;  3JCZ A;  3L70 H;  4MVO A;  3HKC B;  1J5E O;  4NXM O;  1QU7 A;  4IYH A;  3QF7 A;  1W59 A;  4ZBM A;  4J9Z B;  4DR6 O;  2NLJ C;  2B5U A;  5J2T A;  2EIJ C;  3CRQ A;  2XAG A;  3T1H O;  4J41 A;  4H33 A;  2JVD A;  3HKD A;  3AG3 B;  1X59 A;  3JSL A;  1AR5 A;  3JAM N;  5E1A C;  3CCV V;  4BAY A;  4O2A B;  3N2G B;  2BTQ B;  2ZDI C;  1GAX A;  5IYD O;  4ZI7 A;  1IBM B;  5C8Y B;  4FM1 A;  1YIT V;  2CDY A;  2XAH A;  4UCU A;  4ZOL A;  4KFM A;  4DV5 B;  4PA3 A;  1L8D A;  1NT2 B;  2IM9 A;  2YIC A;  1XBL A;  4XBF A;  1SER A;  4CH5 A;  4J42 A;  1EN6 A;  4FLW A;  1AIL A;  4D7S A;  5L3B A;  2OTJ V;  1M90 W;  3O65 A;  5K1P A;  4FZ1 A;  2F43 G;  4FM2 A;  1GN3 A;  1O9G A;  4XDK A;  2Q0O C;  3B77 A;  2C2A A;  3GWK C;  2N05 A;  2OIE A;  3H1H H;  3CCE V;  1OCC C;  1ZLZ A;  4JYC A;  4HBN A;  1R3I C;  3DXR B;  3JAL A;  4DV4 B;  5IJ9 A;  1M57 B;  1WP8 A;  4GT1 A;  4JF3 A;  1QNM A;  1J5E B;  4NXM B;  3LSS A;  1KYO F;  2F1M A;  1OCO C;  1LNQ A;  2Z5U A;  4DR6 B;  1YHQ V;  2H94 A;  2XT9 A;  1Y66 A;  4I50 A;  3T1H B;  4PA4 A;  1N32 O;  3L73 H;  1RM1 C;  2G38 A;  3SPI A;  2EX3 A;  1XHZ A; 
#chains in the Genus database with same CATH homology
 3ABL C;  3FYE B;  5H9C A;  3CC4 V;  4JAV A;  1XL6 A;  5EC1 C;  3SPH A;  3VBB A;  1PKX A;  4QPJ A;  3CMA V;  3ASO C;  1Q81 W;  1GMG A;  4HYO A;  3OGC C;  5KUK A;  4WF9 V;  2A0L A;  1H8H G;  1E1Q G;  4UUJ C;  4LBE C;  1DF5 A;  4HZ3 A;  2W6J G;  1CP9 A;  3ABK C;  4KP4 A;  1YTF D;  1OCZ B;  2QM7 A;  1ZWI C;  4YXW G;  3FB6 C;  1MOF A;  1R3L C;  1TUE B;  2HVK C;  2B1G A;  3LNM B;  1I5X A;  3ZRW B;  4P9P A;  3RVZ A;  3OW2 U;  1I5Y A;  3EHB B;  1NR1 A;  1NJI W;  2OTL V;  3AG4 B;  1AJN A;  3E35 A;  5LHG A;  1K34 A;  1K4C C;  1BHB A;  1M57 C;  4UVA A;  3CCU V;  3OMI B;  3CC7 V;  2IU0 A;  2ZR3 A;  2ZDI A;  2EIM C;  5IDJ A;  5L3C A;  1KC8 W;  4FIP C;  1K73 W;  3LDE A;  3ZCC A;  2EIK B;  4JTC B;  1H8E G;  2ZXW B;  1K92 A;  5LGN A;  2HG5 C;  3HPL C;  5KA5 A;  2X0L A;  3IGA C;  3M99 B;  4GX5 A;  1PL0 A;  4RUE A;  2ZR2 A;  4MT8 A;  2WLL B;  2WLM A;  4Q20 A;  2R9I A;  3ABM C;  3E86 A;  4P2Z A;  3ABT A;  1ARO P;  5B3S C;  5DN6 G;  1VQ8 V;  2ITC C;  2HKO A;  4FPP A;  1THZ A;  1SRY A;  2ITD C;  1PNK A;  4P9O A;  5EBL C;  2JJ1 G;  3K0G A;  1FS0 G;  3SYQ A;  3CCL V;  4I5S A;  4RO2 A;  2UXN A;  2DYS B;  3T1C A;  3LDD A;  1AJQ A;  1NKD A;  5LGU A;  3E89 A;  4MVS A;  4PEL A;  2Y69 B;  4RAI A;  4ZKI A;  2EIN B;  1OCZ C;  1K5Q A;  3QO5 A;  3EFF K;  3ZRS A;  4FJC C;  2DYR B;  1K97 A;  1BL8 A;  4MW8 A;  5IY5 B;  2WLL A;  4G28 B;  3OR7 C;  1UJW B;  4WFA V;  5B1B B;  1K7D A;  3CCJ V;  4L87 A;  5LBQ A;  3D36 A;  5CBH A;  2QE7 G;  2V7Q G;  4WFG A;  1FFT B;  5GW7 A;  1VQ5 V;  2LP7 A;  3ASN B;  3ETD A;  4UV8 A;  1PNL A;  1H2G A;  2XAS A;  3ZRX A;  2DQ0 A;  3W7T A;  2ZXW C;  4TSF G;  1V54 B;  3W7U A;  2R9R B;  2XAF A;  4WFB V;  5FL7 G;  1DLB A;  3F7Y C;  2EIL B;  4EKW A;  5J9P C;  5CA3 A;  3MHS C;  1JQ0 A;  1OCR C;  3K04 A;  1CPY A;  1DTO A;  1SET A;  4RUF A;  1S5H C;  1WLE A;  1YI2 V;  1YJN V;  4R6Z A;  3CXC U;  4MVU A;  2IH1 C;  5CBG A;  4RQE A;  2DYS C;  1JPX A;  3DTU B;  4H37 A;  1VQO V;  3ETG A;  3FB5 C;  3K08 A;  1RPO A;  2W6I G;  2Y69 C;  1KKD A;  3OEH G;  4WFH A;  4QJF B;  4I9W A;  2GHY A;  1GKF A;  1AI6 A;  3SPG A;  1JOY A;  5L3D A;  3ZMZ A;  5HFM A;  2EBO A;  3IC7 A;  4J9Y B;  1VQ6 V;  1QBZ A;  2DWD C;  4XDL A;  3W7S A;  3UKM A;  2AHY A;  5B1B C;  3SJQ C;  4MVM A;  1J95 A;  5B1N A;  1NH2 B;  5BZB A;  3CME V;  1VQK V;  3G4S V;  3JD2 A;  5KA6 A;  1KQS U;  3AG2 B;  1Q86 W;  2ZQM A;  3K06 A;  5CBF A;  5LHI A;  1QLE C;  1R73 A;  4GX2 A;  4RQF A;  4MW3 A;  1ROP A;  1V54 C;  2DQ3 A;  1PNM A;  1K9M W;  2QKS A;  4P30 A;  2EIL C;  3WG7 B;  2A9H A;  2IU3 A;  2Q6A A;  3K3W A;  5B1A B;  1VQL V;  3HB3 B;  3QNE A;  4JAU A;  2MK3 A;  1ENV A;  2LFS A;  3FB8 C;  4PDR A;  2AHZ A;  5C93 A;  4MTF A;  4QPK A;  2XOK G;  1JVM A;  3CCR V;  1YJW V;  2WAM A;  3STL C;  1SES A;  4GX1 A;  4Z1M G;  2QEX V;  1DF4 A;  1K3E A;  5L3F A;  2P7T C;  3SPJ A;  4JTA B;  1QVG U;  2IH3 C;  1EBO A;  1MAB G;  1JX9 A;  2QM8 A;  4LP8 A;  3W7X A;  4JYB A;  3CCQ V;  4MTG A;  4X88 A;  2GSM B;  3CCM V;  3E8B A;  3TCU A;  1KP3 A;  2JJ2 G;  3ZRW A;  4DXW A;  1FXK B;  2Q68 A;  4LC1 A;  1ORQ C;  3ZIA G;  2EJR A;  3IFX A;  1NH2 D;  4F4L A;  1M9N A;  1Q82 W;  3AG1 B;  2PI5 A;  5H6R A;  3OUS A;  3GB7 C;  5EC2 C;  5EBM C;  1OCC B;  1YSC A;  1CEZ A;  5L3E A;  1EFR G;  4JGS A;  2WWW A;  3WFV A;  1G4Y B;  4BIU A;  5HFL A;  1GM9 A;  2BOC C;  3JD0 A;  2M7W A;  3JD3 A;  4MS2 A;  3CCS V;  1K5S A;  4U7O A;  3LSQ A;  5CMU A;  1R3K C;  2WLI B;  2X7R B;  1F4M A;  1S3J A;  3LUT B;  1GM7 A;  2JIZ G;  2Y48 A;  4TT3 G;  4X8A A;  2K1E A;  1L1F A;  1S0V A;  4PDM A;  3AG4 C;  1OHH G;  3SYP A;  4FMT A;  1W0J G;  3X2Q B;  1E79 G;  3B8M A;  3WG7 C;  3CD6 V;  4UXN A;  3K9A A;  5IYB O;  4QNH B;  3RBZ A;  1QR9 A;  2EIK C;  1P7B A;  4UVC A;  1QR8 A;  3A0R A;  3SYA A;  2CK3 G;  1B6Q A;  2WLN A;  4R8C A;  3ASO B;  4PDL A;  2JEX A;  1R3J C;  3ZN1 A;  5KUM A;  3TET A;  1Y4M A;  2W0F C;  1VQ9 V;  1NQT A;  4N23 A;  1P4R A;  3ZRV A;  2IJJ A;  3JYC A;  1JCH A;  4PA6 A;  1NVP B;  4JPR A;  1RPR A;  3ABK B;  2LFR A;  3LDC A;  3OMA B;  2XAQ A;  1FXK C;  5CN0 A;  3T4D A;  4BIZ A;  3NXS A;  1W0K G;  4MTX A;  2BOB C;  4CBC A;  5EBW C;  2EZO A;  2IJH A;  2OCC B;  1QVF U;  2WLK A;  2Q69 A;  2WLH A;  3RVY A;  2V1D A;  5H6Q A;  2P6J A;  1AI4 A;  3OEE G;  1COW G;  4KUM A;  5DM6 V;  3G6E V;  1S77 D;  3OR6 C;  4DO2 A;  4HAM A;  3ZMV A;  3SYO A;  2EIN C;  3DGE A;  4OXS A;  5EK0 A;  4WFF A;  1VQ7 V;  1AI7 A;  4U7N A;  4JAS A;  1AJP A;  1AI5 A;  4G27 B;  2DYR C;  3RW0 A;  5IY5 C;  1VQ4 V;  3K0D A;  3CYO A;  3KG2 A;  1H38 A;  1G8M A;  2EIJ B;  1MSW D;  3P32 A;  3I55 V;  4G2K A;  3FKS G;  3F7V C;  3BEH A;  2YEV B;  3R65 A;  4CZZ A;  3ABM B;  3G71 V;  4LCU C;  1V55 B;  5L3G A;  1OZ0 A;  1K33 A;  5B3S B;  3T2M A;  3D3I A;  3ZJZ A;  5LGT A;  1W2B U;  3E83 A;  2HVJ C;  4GX0 A;  2QA4 V;  3ASN C;  3ETE A;  1M1K W;  3OAA G;  1NVP D;  5B1O A;  2JK5 C;  3AEI A;  3ZMT A;  2X6B A;  3CP1 A;  2A79 B;  3STZ C;  3ML0 A;  3T4Z A;  3W7W A;  1F51 A;  2ZD9 A;  4UVB A;  3OM3 B;  1AR1 B;  4MVR A;  1Q7Y W;  3GWO A;  3CC2 V;  3BY6 A;  1PD3 A;  3E8G A;  1GM8 A;  1BMF G;  4WCE V;  1BHA A;  2X6C A;  1E1R G;  3K03 A;  4GCZ A;  3OUF A;  1IXM A;  3E8F A;  2WSS G;  4XDJ A;  4R50 A;  3B8N A;  1R6K A;  2XND G;  2IW5 A;  2XAJ A;  4QIW F;  1F4N A;  2OCC C;  2WPD G;  2YEV A;  1NR7 A;  3JD1 A;  2HR3 A;  3PJS K;  1GK9 A;  1XL4 A;  1VQM V;  4ASU G;  4MTO A;  1VQN V;  4MVQ A;  3JCZ A;  4MVO A;  4ZBM A;  2IJK A;  4J9Z B;  2QTO A;  1VQP V;  1F23 A;  2NLJ C;  3P30 A;  3SYC A;  1GTO A;  2B5U A;  2EIJ C;  2XAG A;  4JTD B;  1M56 B;  4H33 A;  1WPX A;  3UM7 A;  2KB1 A;  2P67 A;  3AG3 B;  1S72 V;  2H8P C;  4FK5 C;  1K8A W;  1V55 C;  1GO3 F;  1OCR B;  3OFN G;  5E1A C;  3CCV V;  3AG2 C;  4BAY A;  4PDV A;  2JDI G;  1KEC A;  2IJI A;  4BW5 A;  1FXV A;  1OCO B;  2HJF C;  4QE7 A;  3QO7 A;  2Q67 A;  2ZDI C;  2X6A A;  4WFE A;  5IYD O;  1FXK A;  3OE7 G;  3ZMS A;  4E2L A;  5B1A C;  1YIT V;  1N8R W;  1RM1 B;  3F5W C;  2EZP A;  2XAH A;  2DW4 A;  3OMN B;  2YSU B;  1K4D C;  3ABL B;  3ZN0 A;  4N21 A;  3SPC A;  2HFE C;  4KFM A;  3VOU A;  4PA3 A;  4XBF A;  1SER A;  3JD4 A;  1KP2 A;  5IYC O;  3CPW U;  3QO8 A;  2B1I A;  3I56 V;  5L3B A;  4X89 A;  2OTJ V;  3K79 A;  1M90 W;  2WLI A;  1KD1 W;  1QCE A;  5LHH A;  2F43 G;  2ATK C;  4MVZ A;  4XDK A;  1SZT A;  2NNU A;  3B77 A;  2C2A A;  3AG1 C;  2PI4 A;  3ZMU A;  1QLE B;  4QE9 A;  1EZJ A;  3CCE V;  4PA9 A;  3ABU A;  1OCC C;  4MSW C;  1R6N A;  1YTF B;  1M56 C;  1QLN A;  4JYC A;  3MD0 A;  4PA7 A;  2HLD G;  1R3I C;  3TK1 A;  1M57 B;  3AG3 C;  4UV9 A;  1MG1 A;  2JEU A;  2EIM B;  4GT1 A;  1YIJ V;  2P90 A;  4JF3 A;  3E8H A;  4TWK A;  3E2E A;  3LSS A;  2FTK A;  2UXX A;  3MHH C;  1OCO C;  1LNQ A;  2D3O W;  1HWY A;  2OT5 A;  2Z5U A;  1YHQ V;  2H94 A;  1NBM G;  3H01 A;  3FYI B;  2DWE C;  1Y66 A;  3X2Q C;  2WLJ A;  4PA4 A;  1RM1 C;  3FB7 C;  3SPI A;  1JJ2 U;  1FXH A;  2Z3Y A;  4R7C A;  1S76 D;  1YJ9 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...