4QECA

Elxo with nadp bound
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
248
structure length
248
Chain Sequence
MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Oxidoreductase
molecule keywords ElxO
total genus 86
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qecA00
3U09A 4LW8A 2DBQA 2WEKA 5K6AC 1MB4A 3I3OA 3AJRA 3HDQA 1K3TA 3B1JA 2DTEA 1ENOA 5TT0A 4ND1A 1WP4A 3C1AA 4XGIA 2OP1A 4DLAA 1OFGA 2ZJ1A 3TFOA 4AJEA 2Q2QA 3C7AA 3C3XA 3CINA 3LU1A 3WWYA 4CLOA 4FFPA 4MJLA 4Q9NA 4BGEA 1N1GA 3D0OA 4A7PA 1KBZA 1LSSA 3AM4A 3V8BA 4AG3A 4HNGA 1GD1O 1OOEA 3U4HA 4DWVA 4TKMA 4QEDA 3SJ7A 1SCUA 2NADA 2HU2A 1U7HA 4J3FA 1SPXA 1LRJA 1R15A 3VHRA 4B4WA 1B8VA 2VRCA 4R9RA 5JO9A 4BKUA 5HS4A 2JHFA 3OP4A 3U4CA 4P22A 2BFAA 4BNHA 3NYWA 2NUAA 3AFNA 2NTNA 3BA1A 1O5IA 3FPCA 1TT5A 4Z9YA 2HMWA 4ZHSA 5IDXA 4UUPA 2AG8A 1A7AA 2ZB3A 3EMKA 4J91A 2P9GA 2BFMA 1CEQA 3QV1A 3CXRA 4HBGA 2Q45A 1BG6A 1E7RA 4BO0A 5EJ2A 1UUFA 3FD8A 1OBFO 4TSKA 3I52A 4ZQGA 3K2BA 4JLWA 4K28A 3GG2A 4Q3BA 1XG5A 2I65A 3H9QA 3WOHA 3WYCA 3GAZA 1K0UA 4D79A 5C7IO 1MXFA 4TZKA 3IQDB 4MVJP 1RYDA 2R00C 3KYBA 2GO1A 3PYXA 3F6YA 2CZCA 3UN1A 1GPDG 3W4IA 5K0ZA 3WICA 2WE8A 5JFOA 1YGYA 3QVSA 1RM4A 2O7QA 2VYNA 1QLJA 3OH8A 4WEOA 3UFXA 4EW6A 2V6GA 3HDYA 5CDTA 3FSRA 1VL0A 1JWAB 1T2CA 1VI2A 2YUTA 4CM4A 5AYVA 3PRJA 3ZWAA 4BMSA 1ZSNA 2CD9A 3G17A 3HZZA 3TOZA 1P0FA 1I8TA 1DBVO 1NR7A 2FR8A 3EVNA 2LDXA 3PTZA 4PZDA 3ASVA 3L6EA 4XR4A 4ZA2A 1AXGA 3PGXA 4RPKA 4XYMA 2TMGA 2HK9A 2PV7A 3UCXA 4TQGA 4F46A 1LDEA 4MVJI 4U0KA 1SEVA 4A5OA 2Q2WA 1DOHA 4UEJA 1GZ3A 4O1MA 3W1VA 4J1QA 4WOJA 1PGJA 1A9YA 4J2HA 2VRCD 2E82A 1MP0A 2OFPA 4L9RA 3W4KA 1ZFNA 1NQOA 2EKPA 2BGMA 2OHXA 4Y98A 4WK6A 2D8AA 4U7WA 1GQQA 4B3JA 4ND3A 2LDBA 2I6TA 2ZYGA 1BMDA 4TMFA 2XF8A 2O4CA 1IUKA 4ROSA 3QVTA 4IIVA 5ENVA 1LQTA 4LN1A 1EQ2A 1R66A 5HTOA 3AI2A 1UZNA 3C7CB 3L4BA 2NLOA 4N18A 5ICMA 4G81A 2VWPA 3CEAA 1WMBA 4M55A 4WUVA 1XYGA 4KP7A 5JW6A 2E37A 5TF4A 4J49A 4II3A 4KDEA 4QFCA 5H83A 1PZGA 1K6JA 3G0OA 2Q1WA 3CKYA 4ZQBA 4Z0PA 1YS4A 4BNZA 3BIOA 1TT7A 1R4MA 4TZTA 2FPPA 1R16A 1F8GA 3DZFA 4PG6A 3RFTA 2Z5LA 3HDJA 5JAZA 1Q2XA 1XQ1A 3AM5A 1G0OA 3AUTA 4Q3DA 5AXAA 2BD0A 2C5AA 2G5CA 4J1TA 1LTHR 1B7GO 1EVIA 1UAYA 2I66A 4YT2A 3WNVA 1RM5A 1D8AA 7MDHA 1CRWG 2VWQA 4DQVA 3T4XA 4I08A 2FY8A 1GQ2A 1ULSA 4L4RA 5BNFA 2Z1MA 2O23A 5ILGA 3FHLA 3AK4A 4HKTA 3NAQA 4XR9A 1N5DA 1E7MA 1X0VA 4IMRA 4BQRA 3GGGA 3D3EA 2PKRA 2XPCA 3AUAA 4ND5A 4QTZA 4XYGA 4O0LA 2CFCA 1PJCA 3L9WA 5A1TA 1BW9B 1WPQA 3LC2O 1B3BA 1FK8A 1ONPA 2W8ZA 4IQGA 4II2A 4LMPA 3VDRA 3ITKA 1HYEA 4M1QA 5HWSA 2WWRA 1BSVA 4CM6A 4YDRA 2FSVA 1K6IA 3FPLA 4H16A 4WLOA 3WLFA 4W99A 3AI1A 2FR0A 4ZICA 5KJ6A 3ROPA 2NACA 4WGGA 1I0ZA 3NRCA 5CDSA 4IUYA 3GEGA 3Q1LA 3V2UA 4U8GA 3EAGA 3GZNB 4IS3A 4B4OA 4BNTA 1I36A 1BXZA 1SOVA 1U8FO 1UP7A 1Y6JA 2HJSA 2J3IA 2ZIZA 4FC7A 4OMUA 4DBVO 5CEEA 1ONNA 5JSFA 1ZXBA 3FI9A 1CF2O 2ZK7A 1DC3A 2GLXA 4CLXA 4D0RA 3NT2A 5EQDA 4RVSA 4YAIA 4K26A 2I99A 4ZN6A 5A9SB 4WEQA 3HE3A 2GGSA 2O50A 4M86A 2Y1DA 1A27A 3CSDA 4LCEA 1WAMA 2PH3A 3A28A 1EDOA 3ZWNA 3WGHA 1JKIA 4GMFA 1N9GA 4J9VA 4XGKA 1YB4A 4YJHA 4BMVA 1NASA 1EQUA 1C3VA 2AW5A 4S1VA 1NX6A 3UICA 2ZB7A 4DYVA 1JA9A 2HLPA 1WZIA 2NTVA 4P4GA 3PWSA 4ZD6A 2YFQA 1DEHA 1GFSA 3PZBA 1EK5A 3ZV6A 5JYDA 2A94A 3JV7A 2FWMX 1HYGA 3D3WB 2VHWA 5AVOA 2ET6A 3LZ6A 3VPHA 2R2GA 3OQ6A 5LCXA 4ALLA 1E7YA 3CPSA 2ZB8A 1B0AA 3JD2A 4B8ZA 2WE7A 3VVCA 3N74A 4FR5A 3W6UA 4NDNE 1E3EA 1GUYA 3GOHA 5ER6A 1CDOA 3SX2A 4FIZA 4D43A 1PSDA 3NT4A 3PWKA 4E5NA 3NJ4A 3I9JA 4P4LA 2C54A 3ZWBA 2EP5A 4R3NA 5ER9A 5CAEA 2BF7A 4XCVA 3COSA 4Y6SA 4GX2A 4E2XA 3DOJA 1PZHA 3KXDA 1Y8RB 3OETA 3UOGA 4YRAA 1X15A 1DIGA 4J0EA 4RVUA 1X14A 4CPDA 3F5QA 5DCWA 4NMHA 1VSVA 3JQBA 3PLRA 3AWDA 1QLHA 4CMHA 5A5FA 4YA6A 2ZJ0A 4FFMA 5BR7A 1GYRA 3E5RA 4Y67A 3IUSA 2YV1A 3OJEA 3AY6A 1NXQA 3WQQA 1J6UA 3AI3A 3FRJA 3AM3A 2QRKA 5BNTA 1UDAA 3DBRB 4WKGA 3WXBA 2QW8A 3ZDFA 1WXDA 2GD1O 3HFGA 2P4QA 1J49A 4RPJA 2PD4A 2VTDA 4CJXA 4BB6A 5L7TA 4PLHA 3GA0A 1Y8QA 3WDSA 2TMDA 4HY3A 2Y1CA 1QG6A 1UJMA 3JQAB 1UDBA 2QIOA 3LQFA 4R1SA 5IXSA 4DGSA 4CM4B 5EQFA 4BO8A 1LSJA 3V5NA 3RC1A 1ARZA 2GZ3A 3RBXA 4W6ZA 4B79A 3ANNA 3ZWOA 4BO6A 4J1SA 3A4VA 1T24A 2I3GA 2E49A 2G1UA 2H6EA 1I32A 5CG2A 2G82A 5CP8A 3QSGA 1RWBA 3GMSA 1BDBA 3FNFA 3O03A 4XKJA 2AQIA 5IAAA 5JO0A 4N5MA 1IE3A 1UZLA 4BGUA 1ADGA 1I3LA 2VYND 4AJNA 4CM9D 4IDGA 1PL8A 4FD3A 4BHTA 3WGOA 1EK6A 2J6IA 3I4CA 3HDHA 1GUZA 4K9DA 5KJEA 5BSGA 4YQZA 5THQA 3LYLA 3JQ7A 5CG1A 1KVRA 4EEXA 1D1SA 1XSEA 2ZTLA 3IP3A 3LT4A 3D7LA 1DHRA 5C7LO 4PLPA 1Q0QA 3GPDG 3MTGA 3T7EA 4O6VA 3GRPA 1H6AA 3OEYA 1XLTA 1DXYA 1MFZA 1GQYA 2FZEA 4FN4A 4D42A 1QSGA 5CPBA 5F3RA 1KC1A 2X5JO 5T6BA 3WIEA 3I9LA 1C0IA 4Q3NA 1FDTA 1RKXA 2C59A 4XIJA 4CR7A 3DB2A 5G2OA 3S1LA 5IZCA 1EVJA 4BMNA 5KVVA 1ZKMA 3ZWXA 3KTDA 4CLOB 4FJ2A 2DUWA 4C7JA 1JQBA 3E82A 2NVWA 3GZNA 2HMSA 3U0BA 4OAQA 5A5EA 2OBYA 4IZHA 2Q1TA 3GY0A 1E3LA 4YAJA 4GVXA 1Y1PA 4HNHA 3H6KA 1LDGA 5CDUA 3HFSA 3ONDA 2ZCUA 4Q3CA 4RVFA 4OOEA 3PHJA 3GVPA 3DZBA 4ILKA 4RF2A 3G3EA 4QECA 2WSBA 1BWSA 3DMYA 2XXBA 3OM9A 4E3ZA 3DBLB 5EERA 2J5QA 4NFSA 1ENPA 1C0KA 1I33A 2G0TA 3KRTA 4M89A 4OO3A 1JVSA 1UXJA 4UEKA 1P1FA 5T67A 4DMMA 3L0DA 4WOKA 3VH4A 1P9LA 3LT0A 4IDCA 2YYYA 2RHCA 3DAFA 4FBGA 2B4QA 2C2XA 2IODA 5HM8A 3TZKA 4H15A 2X1HA 3NTRA 4GGOA 4JBHA 3B20A 3Q0EA 3VPSA 1C1DB 4PZCA 5BT9A 3OF2A 4CM8B 1NM5A 2DKNA 5I8ZA 2CVZA 2GSDA 1R0KA 5DDIP 5CDYA 3FCOA 4BV9A 4BNXA 3KUXA 3ZI0A 3NKLA 2RAFA 1BTOA 3K9QO 3JQFC 3JYOA 5I7FA 3NEPX 4YRDA 4CLRA 3FWZA 1RM3A 4J16A 4WLVA 3VOSA 1DIAA 1YWGO 4QFDA 1P0CA 3KYCA 2CY0A 2AG5A 3I9NA 1VRWA 2Y0CA 3ZWYA 3ASUA 4OKNA 1S6YA 2OZPA 3JQFA 2DFDA 4IM7A 4PG4A 3EDMA 3PI7A 3UW3A 1W8DA 3QWHA 2CDBA 3HN7A 3IKVA 1CETA 1GYPA 1R37A 4CM7A 2FOIA 4C7KA 4HFNA 2DTDA 3UKOA 1DJNA 1O0SA 3MJSA 1ZEJA 2D0IA 4PVCA 3EZYA 1NNUA 2PNFA 1ADFA 4NHEA 4L76A 3GN2A 3JD3A 1NQ5A 3PIDA 3F47A 1U2GA 1U28A 3VVBA 1ZH8A 3PHLA 4DC0A 5JC8A 1UXHA 1A71A 1YE3A 2A9FA 4JIGA 2Y68A 4NG5A 1Z82A 4ONEA 4YJFB 5DCUA 3SC4A 2NU9A 1N7GA 1PZEA 2VOJA 1VJ0A 1BGVA 2AA3A 2E6UX 3ZN2A 1ZK3A 1XA0A 1W6UA 3QIVA 3E1KA 5G4KA 1D1TA 2JAHA 1I3NA 5F21A 1MXHA 2PZLA 3OHSX 2ZQZA 3AU9A 5BQFA 4E2YA 3O26A 1BXGB 3I1JA 4ESOA 4WCFA 4Y8VA 3RC2A 2O2YA 2PGLA 3DL2A 3X2EA 5B37A 5JY1A 1C1XB 4FQ8A 2IXBA 4MP8A 5LC1A 4WE3A 3DOOA 4XDZA 3DMTA 5ILOA 4QT0A 1AHIA 1FJHA 3R0IA 2BRUA 5JAQA 4I5FA 3FBGA 4MIEA 1TT5B 3BHJA 3DBVO 4FOOA 4J1NA 4D3SA 1TLTA 1F8FA 3GNQA 3RUHA 3OBBA 4FCCA 4BGIA 2IE0A 2X5KO 2ZTUA 3TSCA 4W4TA 3BAZA 4D3DA 5FYDA 4R5HA 4R69A 3QW2A 3H5NA 1K5HA 1I5RA 1P1IA 2C20A 4PGFA 3ZU5A 4D0SA 1VKNA 3PFFA 2JHGA 1YVEI 5TRTA 5LDHA 1EBUA 1U1IA 1VLLA 2C7VA 3GDFA 1JKFA 1Q7CA 1DDOA 1PGPA 5KVCA 1U5AA 4PLFA 1V3TA 1V0JA 4MINA 4BNFA 2HDHA 2CUKA 3WG9A 3RJ9A 2BHLA 1YQXA 3L07A 5JCXA 4GGPA 4JBGA 3TL3A 1L7DA 2BI7A 3OJ0A 4EDFA 1Z74A 1UH5A 2W2LD 3DTTA 4XZ3A 1IZ0A 1EFLA 4JBIA 3DO5A 1DFIA 1U2DA 2JCYA 4IJUA 4Y6PA 3ZU3A 4UVIA 1PU2A 1E0DA 3UGKA 4AL4A 1AN9A 2P9EA 5A3JA 4KOAA 4J4HA 3FTNA 1SMKA 4NPCA 3B1KA 3IKTA 1HE4A 3EW7A 1GUFA 4RPLA 3MJVA 3TFQA 3GRKA 4KUHA 2C0CA 1YL5A 3ICPA 1HEUA 1TI7A 1O6ZA 5IDQA 2HMVA 1PQPA 2P9CA 4NU5A 5L95A 5F5NA 2HMUA 5F5LA 1LQUA 1NBOA 4FGWA 4XDYA 3MJCA 4RVGA 3JYPA 1YDWA 2UUPA 5IZCC 2X86A 2Q99A 1DSSG 4MKZA 3GFBA 3GG9A 2P5UA 4MVJA 3I9KA 3VAZA 3ZU2A 3R6DA 3T4EA 4O59O 2FN7A 1IY8A 5JPIA 2VT3A 2ZATA 1DRWA 2FSSA 4FPXA 4RF4A 3W8FA 3U3XA 3ZWMA 5KJ1A 4NFYA 1NHWA 5TLSA 3BMCA 9LDBA 1I01A 4RV9A 1JTVA 3PJGA 3OIFA 1ISFA 4I5DA 3ZHXA 1EMDA 5B12A 1I3KA 2JFHA 4J7CA 2W2KA 5A9TA 1JVBA 2YY7A 1HRDA 3I4FA 4E33A 4L4SA 4NBRA 2VRBA 1E3WA 1R4NA 2HQ1A 1X7HA 3ENNA 3W8EA 5I7VA 2V6MA 1V8BA 3F5SA 2A35A 4BKOA 4ALNA 1KERA 1LLCA 4R68A 1PIWA 3U9LA 4OQYA 5JXWA 3BTOA 3STHA 1XU9A 4E5YA 4HFJA 2ZB4A 4CL3A 1MLDA 2ZTVA 1DB3A 1PJ4A 1KYQA 4N5NA 2UVDA 1JLLA 3MJTA 2VCYA 1T26A 4HFMA 3GGPA 1SNYA 1JDJA 3RASA 2WMDA 2PKQP 1OC2A 1UAGA 4ZRMA 3ZNQA 1RJWA 2AQKA 2QHXA 4RZHA 5I7SA 5DBIA 2B37A 1DIHA 4FB5A 4BNJA 5TIIA 1ZUD1 5IJZA 5J23A 1GCUA 1NQAO 5LDGA 2C07A 1G0NA 3A9WA 3KVOA 4YBZA 1B26A 4RJTA 5ADHA 2V6FA 3H8VA 1ZSYA 4BNVA 1GDHA 2ZTMA 2Q4EA 2RH8A 1J4AA 4NR0A 2AQ8A 3M2PA 4ZQEA 3A14A 3GQVA 3HJAA 3IIEA 3IJRA 4GX0A 3JQEA 1JWBB 4DLLA 1EUZA 3FNGA 4EI2A 1K89A 1BVUA 3AFMA 1XCBA 4OJNA 2X8LA 1P74A 3R3SA 1R6DA 4YT8A 2Y1GA 4NBUA 2HRBA 5EMHA 5HS6A 4R9SA 5JMWA 4WCFB 3HG7A 4YEDA 4J90A 1JW9B 4YAEA 2IEDA 3JQ6A 5G0TA 2VZ0A 2EGHA 4JCOA 4XB1A 2GN6A 4K6FA 3RWBA 3GDGA 4NBVA 5IDYA 2O48X 4NIMA 3AUUA 2NNLD 4MKXA 2B83A 1GL3A 1R0LA 3ROKA 3ADOA 4MVJH 3T7CA 3WTCA 4BNYA 1EZ4A 5AQ1A 5L51A 3A1NA 5JNLA 4Y6RA 3SEFA 4E5MA 1I2ZA 1E7QA 4I1IA 4Z3DA 3GLQA 4RDIA 4MVJF 1Q0LA 2DVMA 2AEJA 4Q39A 4DPKA 5L7WA 1LRLA 3DHYA 1E3IA 1P33A 4XYEA 4B4VA 3H2ZA 3QRWA 3EC7A 5AXDA 4R16A 1B8PA 4WLUA 4CODB 4BIIA 2VUUA 4MVJG 3JQ8B 4AJOA 2J3HA 4FDAA 3Q2KA 2ZCVA 1B14A 1YB5A 3CTMA 2GRAA 4CV0A 1ZMOA 4F45A 2NVUB 3C1TA 3F9IA 4HFRA 4YT5A 4L74A 1AUPA 2VYVD 3PPIA 1SBYA 2D5CA 1HSOA 4TWRA 2EKQA 2Y0EA 4GWGA 5KCZA 1U3VA 2QYTA 1Q7BA 4B7CA 3NUGA 5I9LA 2JAPA 4GLLA 3GR6A 3WYEA 4DIFA 4IPTA 2VNSA 4TROA 4CMAA 1XU7A 4W7HA 3UHAA 1O95A 1ZIDA 5C37A 3I5MA 4IDDA 1U7TA 1A4UA 2X23A 2GN8A 4NK4A 4OXYA 1OAAA 3WFIA 4BO4A 5C5IA 3GT0A 5KJCA 3BHIA 5AXCA 3ZWVA 4NZ9A 2VHZA 2B36A 1PJ3A 4G2NA 2FPIA 3PZRA 4UAGA 4PLVA 1C14A 1IHXA 1E3WB 2X4GA 3EHEA 4HX5A 3RKRA 3ON5A 2X22A 3ZCXA 2VWGA 3L4BC 1E5QA 1WDKA 4RCVA 2GCGA 1ZW1A 5A03A 4PLWA 1LC0A 3AUSA 1E1MA 1FDVA 1NVGA 4E0BA 1KVUA 1R0SA 4RPGA 4XQCA 5CPFA 1H94A 2PWZA 1LLDA 3JYNA 1FDSA 4Z6KA 1TB4A 5ICSA 1A5ZA 5TJHA 3IJPA 1H6BA 4EJ6A 4CLEA 2RCYA 4OGWA 3I6IA 1C1XA 2IRWA 4ALIA 1VSUA 1PS0A 3VC7A 1OZAA 1ZK1A 3MWEB 1TEHA 5DNAA 1ISMA 2WD7B 2D2IA 4BS9A 1Y9EA 2GPTA 4PFJA 1E6WA 4CM1A 4YQYA 4B7UA 1AGNA 3PQFA 2QG4A 1ZBQA 2DUUA 1V3VA 5L53A 1E7SA 3AOEC 3WWZA 5L4LA 1PX0A 1DRVA 1H6CA 3C8MA 1MA0A 3JD4A 2UYYA 4GLOA 1R12A 4BUCA 2QZ9A 3SXPA 1M6WA 2VYVA 3CMMA 4KZPA 4J0FA 1DC6A 3D4OA 4CMIB 3O8QA 1HDXA 4WPGA 2FHSA 5T8KA 3HB5X 1U4OA 3HHPA 3BMOA 1ULUA 3AOEA 3ICCA 4BGVA 1ID1A 1MUUA 4ALMA 4H7PA 4CM5A 1SOWA 2JCXA 5C3MA 1C0PA 4D46A 4WJZA 2PGJA 4RDHA 2JD2A 2C29D 1P45A 3PWZA 3UF0A 3OEWA 3Q6IA 2CVOA 4D7AA 3ADPA 3JQGB 5T5QA 3VPXA 1CIVA 1ISJA 3GHHA 3JTMA 1IPFA 4J9UE 4PZEA 1FDUA 3GPIA 1A9ZA 1VL8A 4PLTA 3I9OA 1E3JA 1JKJA 4EGFA 2B5VA 2Y66A 1IZ9A 2H5LA 2FPGA 1NQTA 4XQGA 1FDWA 3WSWA 4CM9A 4N5LA 4TVBA 3IDSA 4F6LA 3KOUA 4FJ1A 1ZSVA 3WSVA 3DEYX 1NFFA 5U1PA 3DAGA 5TT1A 1M2WA 5G0UA 3K2EA 3PHHA 3S2EA 1Z45A 3OFSA 1ADBA 1FF9A 4I9HA 2DBVO 2YW9A 2VUSA 2QX7A 1VPDA 4AICA 4DIOA 2RH4A 3WLEA 3RU9A 2UAGA 3FNEA 2O3RA 1JAYA 5DOZA 2X9NA 3BMNA 2OMEA 1QYVA 3H9JA 2GYYA 5JY6A 1UR5A 3D1LA 4R41A 4OYRA 1KS9A 1U3WA 3DFZA 4MDHA 1EDZA 2Z1NA 1PQWA 1EEHA 3INRA 4FGSA 4YYZA 5CDGA 3WGGA 2B5WA 3ZHYA 3GFGA 4EEZA 1DLJA 2I5PO 4IGEA 2PH5A 3EYWA 4DQUA 1IYZA 2GN4A 4OSPA 1WLYA 1P31A 5U9CA 4N54A 2EP7A 1ISHA 3JQ9C 3PDUA 3Q2IA 5GY7A 1LEHA 4NFHA 1KEUA 2OUIA 4I8XA 5EINA 2IXAA 3OA0A 1G1AA 1T4DA 3DR3A 2EEZA 3NDIA 1DHTA 3MJ4A 3DWFA 1UZMA 3RU7A 2OL4A 4YAKA 1WZEA 4QX6A 4OSOA 1KOLA 3JQ7B 1HZJA 2WYVA 5A4DA 4RLSA 4LVCA 4KTVE 2W2KB 1B8UA 1WDMA 2RBEA 3H3JA 2PD3A 3P2OA 5GZ6A 3PYLA 3QQPA 2YHIA 5G0VA 3IAHA 4FFRA 3KLMX 2YQ4A 4FS3A 1IL0A 1QYCA 4I5GA 5TSDA 5DOVA 5G4LA 4PG8A 2OXIA 3WR5A 3IS3A 5KNLA 1QYXA 3WQRA 1ZMTA 3I6QA 4CM3A 4DPMA 3PJDA 3BZUA 1WVGA 3KSUA 1GU7A 2PK3A 1LBEA 4NI5A 4W7IA 1F12A 2GN9A 3OIDA 1A4IA 2P91A 4O63O 3DXFA 5JE8A 3ROQA 4E2WA 3SVTA 4Z3KA 1N8KA 1X0XA 3KEQA 3BTSA 3TRIA 2DFVA 3C85A 3RUEA 4CMBA 1UP4A 5KKCA 2AXQA 4LGVA 4WLFA 1DPGA 4HWKA 1NR1A 4NBWA 3SC6A 3GGOA 3PK0A 3QJ5A 1X7GA 4BVAA 1HZZA 4J4BA 1FMCA 4IMPA 5K6AA 3KETA 2HO5A 4YACA 4HADA 4GX5A 4ZJUA 1KEPA 4DXHA 3JQDA 3RKUA 2WD7A 1PJQA 1M75A 3FWNA 1BVRA 4J2OA 4XIYA 1M66A 3RVDA 1EVYA 1NWHA 2JKVA 1J0XO 1M6HA 4BNKA 1M76A 2J8ZA 4EUEA 2CVQA 4R1UA 1YXMA 3D4PA 2NQTA 1LI4A 1H5QA 4E13A 2NWQA 1D4FA 2W4QA 1UXIA 1Q7GA 3AU8A 3DBHB 4UEOA 2BI8A 4BO7A 5I8WA 3QWAA 2NM0A 4L4XA 4QQRA 4CQMA 4XYLA 4BL5A 2NVUA 4AFNA 5KTKA 4RQUA 5L4NA 3B70A 1ZK0A 2HK8A 3E6AA 3QVXA 4UUMA 5FF9A 4FJ0A 4A0SA 2OOSA 4XJSA 4OQZA 3H5AA 2C82A 1YH3A 3G79A 3O4RA 4LRTB 3ZGYA 2P68A 3PVZA 4MP3A 3JQ9A 1ML3A 3ZNOA 4IXWA 5F1PA 3HWRA 3LC7O 4PG5A 1TVEA 3BMQA 4INAA 3H2SA 2DTXA 2Q46A 5L3ZA 3WGTA 1UP6A 2EHDA 4IGFA 4UVEA 2GUGA 3E9NA 4GMGA 2JJYA 4XWYA 3VDQA 2HUNA 3L4SO 1QRRA 1XKQA 5BNIA 3LF1A 1G6KA 1O89A 1ONOA 5COAA 5G4KB 2CF6A 5EESA 2IEBA 3MEQA 1JU9A 1R4MB 3ABIA 3GAFA 1WDLA 5DBFA 3EUWA 2IYPA 3B6ZA 3VTFA 2Q50A 3CZMA 4KWHA 2O3UA 3VTZA 1EBFA 2OGUA 3JQAA 3K96A 4UULA 3BHMA 3F1LA 4IDEA 1LSUA 2Q4BA 2FP4A 5A9SA 3KHUA 1Z75A 3VZQA 2VHYA 5JS6A 1WWKA 4AJHA 4ZQFA 2BMAA 1XIVA 3NTQA 2DT5A 4TRJA 1U3UA 4GKBA 3L9XA 3H65A 4OIMA 1P44A 3JQGA 4O5OA 2SCUA 4YPOA 4FFOA 1KEVA 1AXEA 1GAEO 4HUJA 3WGIA 1LUAA 2VZ8A 4GWKA 3C1OA 1SZJG 4CQMD 1NVTA 3U4DA 1YKFA 1W73A 2V6BA 5DT9A 1U4SA 3EZLA 3GVHA 1VJTA 2HKIA 3EK2A 4U0JA 4F6CA 2FR1A 1HWYA 3M1AA 4RVDA 3LVFO 2Q2VA 3B1FA 4GX1A 1H9BA 1X13A 5L9AA 3LLSA 2EV9A 4NJOA 4EITA 3KYDB 1NWCA 4JXKA 1MC5A 3F1KA 4Z9FA 2PTGA 5JLAA 3KYCB 1SEPA 3RBZA 5CEJA 3D5TA 5JAIA 3GC6A 2X5OA 1PS8A 5FEUA 2ILTA 1MV8A 3WTBA 1GTMA 3KBOA 1GY8A 1YOVB 2Y0DA 4YRBA 4JJFA 1IOLA 1ZZEA 4CLHA 3BYZA 4DIBA 5TS3A 1HDZA 2QYSA 4FFNA 1YJ8A 2YDXA 3RC7A 3ZNPA 3LSYA 5KVQA 1P1KA 2O3TA 5FI5A 1PZFA 5F1OA 4RVHA 2O3QA 4DPLA 1PJLA 2Q49A 4TRRA 3KV3O 1PGQA 1P1RA 4UVDA 1WMAA 3EGOA 1P1JA 2OBNA 1EUCA 1T25A 4BNIA 3GUCA 4WLEA 4RGBA 3H9EO 3LF2A 4XA8A 2Y93A 4DL9A 2FZWA 3UUWA 3KO8A 4R51A 5B4VA 4AJJA 5B1YA 1F14A 3D5QA 3G1UA 1QMGA 2DM6A 5DCYA 2BH9A 1QV6A 3H9UA 5DN9A 3BMNB 1QYWA 3RROA 2Q1SA 1XWFA 4X54A 3I23A 3DTYA 5AXBA 5JDCC 3OQBA 4GKVA 1MG5A 2OORA 1BDMA 2B4RO 5TNXA 4I9NA 3GF4A 2NV6A 1XHLA 4KTTE 4LRSB 4Z9XA 3ENKA 4GH5A 4PRLA 3OQ1A 4CL8A 3HN2A 5CFZA 3DZHA 2O3SA 1I10A 3ULKA 2GZ2A 1IULA 4XQEA 5EN4A 3VH1A 1YL7A 4GSLA 3WNQA 3KZVA 2P2SA 2YJZA 5GMOA 2CF5A 3S8MA 4IZIA 1N2SA 3QLJA 2VWHA 4WNIA 5HA5A 3INTA 3FTPA 1E1NA 4R3WA 1N7HA 1NAIA 3ZHBA 5A04A 1SO8A 1JAXA 1T1SA 2GASA 4BKRA 4CV2A 4YT4A 2WM3A 2PD6A 1MC4A 3G49A 4E31A 4CV3A 2JFGA 2NVBA 2X0NA 1E5LA 3SLGA 4E32A 3GH3A 1M67A 4U5QA 3UH1A 4CM8A 5KIAA 1NFRA 2BFPA 2G76A 3OECA 3C24A 2D5AA 3GEDA 1ENYA 1LRKA 4Y9DA 1I24A 1UDCA 4K1LA 3ZWPA 3WGQA 3CE6A 2C7GA 2V7PA 2DBZA 3ROMA 1PWXA 3ZU4A 3RD5A 3E03A 1HXHA 3V1TC 2I3AA 1PJSA 3F4BA 3TPCA 3JD1A 4BNWA 1D7OA 3CH6A 2Q1UA 1SAYA 2BGLA 4A27A 4OKIA 3RCBA 1AE1A 1HT0A 1HDOA 1HF3A 4N7RA 4BO2A 1I2CA 1O94A 1PL6A 3S2FA 1P3DA 2B35A 4XB2A 3DZJA 1ZCJA 4YJHB 1V3UA 4FFLA 2R00A 1T1RA 2AEFA 3M6IA 2GZ1A 3DHEA 1SB8A 2ZYAA 4QSMA 4C4OA 3H9GA 5DULA 3WIDA 1BHSA 2X58A 3OJOA 4IJKA 1SB9A 5HBRA 1LU9A 1MG0A 1E6EA 1V6AA 4R1TA 3QWBA 2CDAA 2CNBA 1IPEA 1VKOA 2F00A 3QVWA 5BSFA 1S7CA 1DC4A 4YVFA 4DBZA 4LVUA 5TQVA 5JAMA 1GR0A 2G17A 1CQJA 3IUPA 3ZW8A 1O8CA 4HP8A 2HMTA 3E18A 4IBOA 3ZW9A 3K31A 2D4AA 4E5PA 5IN4A 3TZ6A 4NQZA 2PR2A 3DQPA 4XGNA 1T2FA 2IZZA 4JJGA 4GVLA 4PIVA 4TVOA 4AJ4A 4H3VA 4EYEA 9LDTA 4GBJA 5EIOA 2Y99A 1HDRA 5MDHA 5ITVA 1U5CA 3H7AA 3KM0A 1KETA 5KOIA 4J7XA 4RZIA 1KEWA 1VL6A 2X0RA 3M2TA 3SLKA 3MTJA 5THKA 2VUTA 4BV8A 3WJAA 2Y05A 5KVSA 1Y9AA 3INGA 1PGNA 3WQSB 4QUKA 3NDJA 4WCDA 3GVCA 5I9MA 1XQ6A 2Z95A 3Q11A 1H0KA 1ZEMA 4LMRA 3LC1O 4LISA 4B3HA 5FWNA 3WMWA 4AJPA 1F0YA 3S2GA 2VOEA 3H3FA 1Y5MA 3V2HA 4YWJA 1GCOA 3RUFA 1N92A 4D3FA 4DTIA 3ANLA 4DRYA 4BKPA 3RIHA 1PGOA 1L7EA 5L4SA 1QORA 3MCVA 1MFPA 4J4TA 4TRMA 3E5MA 3TN7A 4I5EA 1HETA 4MO2A 1GZ4A 3E9MA 3UVEA 1CQIA 3MOIA 3NV9A 3VZRA 1PS9A 4KQXA 4DYDA 1N9GB 1X1EA 3LLVA 4RL6A 4ZRNA 1NAHA 4P38A 3TQHA 4J7UA 5JCJA 3ETGA 2Q3EA 1DFGA 3KEOA 3KYDA 3HB4X 4W9NC 2UUOA 3VH2A 4F3YA 1DC5A 3CMCO 5DF1A 1DIBA 4CR6A 4PN3A 2AHRA 5A02A 1VM6A 2J3JA 1PR9A 1NTOA 4EJ0A 3AW9A 3RFXA 2IYOA 1PWZA 2B0JA 1GADO 3LT2A 4DUPA 4AJIA 3QA9A 3ITDA 1C0LA 1E92A 1LNQA 4L8VA 1X1TA 3PLNA 4EUFA 1LSOA 2AMFA 4A03A 1YONA 1W0CA 5KJFA 2HCTA 4S3MA 1V35A 5IDWA 1Y8RA 1I2BA 2JD1A 3OIGA 2WTBA 5U4QA 3BXXA 1HSZA 2HAEA 1DRUA 1NVMB 4IY1A 2UDPA 1GYQA 1Z73A 3FNHA 4URFA 4AJ2A 4XX0A 2W98A 4RO0A 1YJQA 3U4IA 4CLDA 5BSHA 4CMEC 3VZPA 5A06A 1DAOA 2O7SA 3TJRA 4NJMA 2AE2A 5IXYA 5TC4A 4U6SA 1VJ1A 3WBBA 2P4HX 1GPJA 5GZ1A 4PLCA 5JBIA 4E5KA 1T2DA 2ZYDA 3MJEA 4W9NA 3WFJA 4CMEA 3GN1A 4YJGB 3GVIA 3ZHZA 5HRUA 7ADHA 2IDZA 4FC6A 1UXGA 2Y1FA 3M1LA 4ITUA 2BFOA 2BKAA 4G65A 1LLUA 4MOWA 1BXGA 4EBFA 2X9VA 4WLNA 3AY3A 5L45A 4QXMA 4Z0HO 4JQCA 5IG2A 3P2YA 5B4TA 1EE2A 2I67A 5JDIC 1Z7BA 1GZ6A 2YHUA 3UCFA 4E6PA 1IHYA 3G1TA 4LSWA 3VKVA 4M49A 3ZH2A 4ZQHA 4PLZA 3ONFA 5ENDA 3KSDO 1IB6A 4RF3A 3AY7A 3FF4A 1QYDA 8ADHA 1XEAA 3ZV4A 2EXXA 3GNSA 3ZNNA 4MKRA 1U3TA 3ZWCA 1QV7A 4IDAA 1OC4A 5IF3A 2B69A 1ZJZA 3RUAA 1HDGO 3TDKA 3ST7A 4MPDA 4EJMA 3FBTA 3QHAA 2W90A 4NJMB 1KIFA 2X0JA 2E48A 1BXKA 4KWIA 4RORA 3TNLA 4XQ9A 3JYLA 4XYBA 3RUIA 5BSEA 5B4UA 5JDIA 3LDHA 1Y7TA 3E8XA 4HV4A 1CYDA 3GDOA 1E1LA 2X0IA 4EUHA 5IFLA 2XXJA 4D41A 1QP8A 1XR3A 4K6CA 4E21A 2UV8A 5DP2A 4DC1A 1QR6A 2B4TO 4YR9A 1J5PA 2BGKA 2D1YA 5TGDA 4JGBA 2DBRA 2PZJA 3A06A 1Z6ZA 3OSUA 2X9GA 5A3VA 4QO7A 2X6TA 4CLRB 3CZRA 1LC3A 1L1FA 4BB5A 4CQLB 3MOGA 4U6QA 4UVHA 2F1KA 4J6FA 4YJDA 4GAEA 3RC9A 4DQXA 1EUDA 4KUEA 3RI3A 4WCFC 4YB8A 2NTJA 5C7OO 1GEEA 2BLLA 1H93A 4UUOA 3WMXA 1D3AA 4DREA 1KVSA 2VHVA 4DVJA 3KB6A 3DFUA 2OO5A 3QVOA 3KSZO 4IIUA 5T8KC 3GUYA 4RQTA 3ZV3A 1ENZA 1JN0A 4E12A 1SC6A 4TRNA 2NU7A 2EGGA 2J5RA 3QE3A 1LLQA 1Q0HA 4NK5A 3DOCA 4CMGA 1HE3A 3PQEA 2HJRA 2EWMA 1A7KA 2QQ5A 3PQDA 1P77A 4KMSA 3JQ8A 1P1HA 1VE9A 1DIRA 1H6DA 4GI2A 3QY9A 4M8SA 2YDYA 2AE1A 4YTEA 4PG7A 3D3WA 2FMUA 5FI3A 1NPYA 6LDHA 3HUDA 1QKIA 3R3JA 1NHGA 1LDMA 5I7EA 4FSHA 4XRGA 3HADA 3OICA 5EPOA 1HL3A 3PYMA 3PFWO 8LDHA 3F46A 4UUNA 1EFKA 2VN8A 2EG9A 2E4AA 4IDFA 3UCEA 3CUKA 4P8RA 3W4JA 1YL6A 4R54A 5EL0A 1E7WA 3W6ZA 1H2BA 1GV0A 1HE5A 3DMTC 4J43A 3H5RA 3HNPA 3GNTA 1CWUA 3WX0A 1CJCA 3PIIA 3N7UA 4R1NA 2DC1A 3VZSA 2GDZA 4RF5A 1LA2A 3H4VA 4GQAA 1H2HA 4D45A 4UREA 1YO6A 2OP0A 4ND2A 3PXXA 4MIOA 2Y1OA 3P5SA 2YFHA 5JDCA 4L0QA 1PR3A 1F06A 4IXTA 4Z0TA 3L6OO 4IJVA 2JD0A 2EKLA 4PLGA 3DBRA 3DAPA 2VHXA 4CMCA 2O2SA 3SBOA 3JYQA 5A05A 3I83A 2W2LA 4LCJA 3MZ0A 3GVXA 2YV2A 1E3SA 4ZGWA 1Y8QB 1NPDA 1DO8A 3VKUA 3FR7A 2EW8A 2GF2A 4TKLA 4YJGA 1X7DA 3ANMA 3K92A 4OL9A 4CMJA 1BW9A 4ID9A 2DU8A 4ND4A 2DLDA 1T4BA 2H9IA 4MIYA 3MWDB 5K9ZA 4JJIA 4JX8A 3CIFA 3GEMA 3QWIA 1EE9A 4D44A 1CERA 3KLPX 4AJLA 3O38A 4A10A 1NYTA 1ZK4A 4DA9A 1RYEA 2JL1A 4NNJA 1ZO8A 4BO5A 1YBVA 1ZK2A 3L6DA 4CQLA 2EW2A 2HSDA 3WB9A 3BMOB 2NSDA 1V9LA 3DBHA 1H9AA 3V1UA 2AQHA 3V2GA 1KC3A 4EZBA 1LDYA 2DAPA 2RHRA 4CMIA 3TF5A 2HRZA 4BKQA 1B15A 3NGXA 1PJTA 5L7YA 4KUGA 1YB1A 2O4UX 1XGKA 1O9BA 5T64A 2C5EA 4B7XA 5H81A 1ZNQO 3IMFA 4OM8A 4BNNA 1XELA 4WASA 1OMOA 3RBVA 3O9ZA 5DBGA 4JROA 3HQ4O 3K73O 1B3RA 2AEMA 3K30A 1R4NB 1PTJA 4B3IA 3WBFA 5JC1A 1I3MA 4AJ1A 4E2ZA 1KVTA 4KDFA 4BNUA 3S2IA 3ONEA 3Q9UA 2IZ0A 3BMQB 3FR8A 4CUKA 3WGZA 3E9QA 4CR8A 4L73A 3TZHA 2D59A 1Z7EA 3TWOA 3IP1A 2NQ8A 3PP8A 3JQBC 4AJKA 4JP2A 2O3JA 2WJPA 3WJ7A 3QWFA 4NU6A 2A92A 5TX7A 3P7MA 5GZ3A 4PRKA 3F3SA 4YAGA 1QXSA 1LDNA 3RAJA 3NT5A 3GK3A 4R4JA 4JP3A 4YXFA 5COQA 4Q3AA 4A26A 2DPGA 4ZU3A 4CV1A 1TXGA 2J3KA 1YBMA 2IZ1A 2QRJA 2PGDA 3PEFA 5T57A 4BNGA 5CHEA 2Y67A 4XRRA 3BMCB 4GSKA 3K6JA 2R6JA 4NBTA 2NU8A 3PJEA 2EIHA 1N1EA 5I9NA 3DZIA 4BO3A 2CDCA 2C2YA 4RLHA 3TZQA 4MVJD 3RUDA 5CEFA 4Q3EA 5FFFA 3I9MA 4XEHA 4A73A 3TZCA 2JCVA 4BO9A 2CSUA 3LT1A 4IQ0A 3DC2A 1YBAA 3HSKA 3PHGA 3EY4A 2QZZA 3NGLA 1YRLA 1LDBA 5KKAA 1PL7A 2PLAA 1HLPA 3K5PA 1T2AA 4MP6A 4CMKA 3WS7A 3U5TA 3DDNA 3VPFA 3OMLA 1Y81A 2PZMA 3VH3A 4M87A 1U8XX 2V65A 1DFHA 2I9PA 1MX3A 1HE2A 4ALJA 3C7DB 5G0SA 4OXKA 3RJ5A 3W8DA 4JN6B 3ZWWA 3V1YA 3E48A 3WYBA 2NU6A 4IJWA 3SJUA 1K6XA 3DZGA 4UVGA 4XD2A 3F4LA 2XAAA 1PEDA 4R01A 2VNAA 3R1IA 4FOSA 1KY4A 2PFGA 2GNAA 2YV3A 1YOVA 4LK3A 3RFVA 2WD8A 2H1SA 1ISGA 4P4NA 2DQ4A 4GPD1 3ZV5A 2PY6A 1UXKA 1VC2A 4G5HA 4OXNA 3NTOA 4YCAA 2DPHA 5L40A 3NDRA 1ORRA 1ADCA 1HKUA 1E6UA 4KQWA 4BO1A 1WW8A 4MVJE 4DMLA 1Q1NA 4CUZA 3QP9A 3IOYA 3S55A 3RSHA 3LK7A 5ITWA 3RQSA 2JFFA 2EJWA 2VT2A 3IL2A 1HTBA 3PDJA 3BTUA 4MVJM 2HK7A 3PHIA 2YQ5A 1WNTA 4LSMA 2VTEA 3GZ4A 1HDCA 5MGBA 1LXCA 4M54A 4IINA 6ADHA 1GEGA 4B8WA 3OJFA 1PQUA 5DZSA 1W4ZA 3L77A 1ZJYA 3X2FA 1PJ2A 1Y5RA 4BOYA 4B4UA 4I9UA 4XJTA 3ZZNA 3U49A 1DLIA 3JD0A 2RIRA 1E1KA 5A9RA 5JMPA 2YHIB 2WDZA 1HLDA 3FN4A 1FXSA 5COBA 2VQ3A 1K2WA 2EJVA 3TOXA 4CUJA 1TA4A 1T2EA 3PJFA 3UAGA 1EVZA 4L75A 3P19A 4WECA 4BNMA 5KWEA 2PZKA 5ES3A 2YZ7A 1A72A 1ZXLA 1AHHA 1U9JA 1F17A 2A4KA 2XOXA 3JCZA 1NPTO 3GMDA 3GHYA 1MGOA 3PGJA 1RPNA 1DAPA 3N58A 1YQDA 2PA3A 2VZ9A 2ZKLA 3Q3CA 3NJ8A 4CQMB 5IZ4A 4PCVA 1HDYA 4PVDA 3IC5A 1PJBA 1GV1A 2WYUA 4OH1A 3DONA 1DJQA 4A2CA 5F1KA 1KY5A 4JNKA 4OOFA 3DHNA 3VPGA 1BRMA 1XDWA 3NX4A 4JK3A 1LX6A 2PKQO 2POQX 1YDEA 2J5KA 4IQ8A 3TL2A 3WGYA 4ALKA 3EVTA 2X7HA 3DZKA 2P5YA 4R5MA 1C1DA 1HYHA 1YQGA 3Q9NA 4OHUA 3ETDA 4BNLA 4GL4A 2GR9A 4YJFA 2WYWA 1B2LA 3D4NA 2FRDA 4E4YA 5JYEA 3K8ZA 5JCJD 2I76A 2H63A 2ZQYA 2D3TA 4HXYA 3JQCA 5G0WA 2GERA 4AVYA 1NFQA 5DP1A 2Y1EA 1OI7A 3AOGA 2EERA 4NH4A 2BELA 3JQAD 4IS2A 1RM0A 3OJLA 3JSAA 1NP3A 3O8QB 5TJ9A 5H82A 1B16A 2QRLA 4FW8A 3BTVA 3D64A 1KVQA 3DBLA 3UXYA 4W82A 4ZVVA 1ZVMA 3OA2A 4QO8A 5AOVA 4E30A 5IN5A 1I30A 3RUCA 1LJ8A 2EF1A 1ISIA 3U62A 3ETEA 4WNCA 2CMDA 1E77A 4DLBA 4PLYA 4RPHA 4BQPA 4IDBA 3ORFA
chains in the Genus database with same CATH superfamily
1D6SA 4MGEA 4X0EA 2WKWA 4LW8A 3U09A 2FKAA 2FLVA 4N0MA 3HDQA 2JLBA 3B1JA 1YRYE 3U44A 3VKFA 4B46A 4Y0NA 4YLEA 3ZVMA 3LXUX 1EE1A 2IPLA 3IPYA 4YRZA 5LYJB 4XGIA 1OA1A 2D74A 2KI5A 5B1DA 1RLMA 3TFOA 4AJEA 4C3UA 3T41A 3LU1A 4GXTA 1YQUA 4FFPA 2B1QA 3KE9A 4MJLA 4Q9NA 1N1GA 4PINA 3D0OA 1LSSA 5BN3B 3V8BA 3S68A 2OYSA 4YP1A 2O8DA 5AKEA 1S9HA 3LJKA 4I3GA 3IAEA 3FWHA 1GD1O 5A71A 3TW0A 3G5LA 2R25B 2ZLBA 1TPZA 4LC1A 4MKIA 4B85A 1SCUA 4HUTA 1Q1QA 1UK7A 4NE2A 3VAAA 5FOWA 3MWJA 1LRJA 2OV2A 1DQYA 2CL7X 2VRCA 1U0TA 3BC1A 3JAWA 2PUHA 4KJXA 1VJGA 4H4CA 3KQMA 1CEXA 1ZJWA 2VAWA 1A0OA 1C4KA 4YIHA 3NYWA 2NUAA 3BA1A 1D6JA 1O5IA 4ZEXA 3FPCA 4ZHSA 1YQQA 4F3KA 4EKEA 2KX7A 4LZAA 3P27A 4QOHA 1ORDA 3KD3A 3KCNA 4LRQA 4UUPA 4QQNA 1CR4A 4J91A 4DDUA 1CEQA 1W52X 3TIGA 2GNOA 4HGQA 1Y4ZA 2Q45A 1E7RA 1YR6A 4H0NA 3PSAA 4BO0A 4EPXA 4JI0B 3FD8A 1ZRMA 3JQRA 2ECKA 1HQKA 2ON6A 2WWFA 4TSKA 1T9DA 1Q7EA 1L5GB 1E4EA 2AD1A 3WOHA 2ZM6B 1XG5A 4D6PA 3H9QA 4A91A 2CLMB 1YMVA 2VBIA 3E3LA 2XXAA 1FXUA 1XCPA 3U7EB 3V34A 1P9WA 1RFLA 3IQDB 4MVJP 4TZKA 3ADBA 4QASA 4M1ZA 4HGOA 4ARUA 1T3LA 2QKYA 4RQAA 2HCBA 4TLCA 2GO1A 3F6YA 3FE2A 2PUWA 3QW4B 4FI3F 1C3XA 2ZI4A 5JHHB 5LMCA 3KQQA 1D04A 2IY7A 1KBQA 1CEYA 4MLZA 4D26A 2MSKA 4ETIA 3VYTB 3I5AA 3G9ZA 2QRQA 3V97A 3GXOA 3IQIX 1CVRA 1OYYA 4QBGB 5CB8A 3FSRA 5J2UB 1BDIA 1Z0JA 1EJ0A 4QXOA 1VI2A 2RGAA 1SVNA 4IDOA 4J16C 1S2LA 3DPSA 2OZEA 4PX3A 2CD9A 4NENA 4TMTA 3A10A 3V8VA 2E7ZA 1P0FA 1I8TA 1DBVO 2VQ6A 1S8NA 4G8CA 3U17A 2FR8A 2LDXA 1AX9A 1CW2B 3LHSA 3NUQA 4DA4A 4YRQA 4XH9B 5E1MA 3HNOA 3KXPA 3RNOA 4YR7A 3FX2A 3QFTA 1GUBA 1YZGA 4OMDA 1XWIA 1IG0A 2OO5C 3UCXA 4BZXA 2JGNA 3HXLA 1XALA 1JEOA 2QQFA 1LDEA 4MVJI 4ZAZA 4E70A 3CRVA 5FLEX 4D4JA 2EC5A 1SEVA 4K2HA 3IPAA 1I5EA 3I34X 3M6MD 4UEJA 5BQ3A 4CIWA 4ES6A 3FOFC 3PC4A 4J1QA 4WOJA 2EL9A 1ECGA 4UCWA 5ALYA 3IVXA 1P6QA 5K3FB 5CLFA 1PGJA 1A9YA 3ESRA 2V74B 4FYVA 1NZFA 2VRCD 2Q8QA 1KYZA 2QJRA 2E82A 1MP0A 3B52X 4ZU6X 2OFPA 1ZFNA 1NQOA 3SF0A 4Y98A 4DG9A 3UV7A 1AD2A 4WK6A 1U0FA 1ABEA 4WZAE 2AZTA 2D8AA 2JKZA 2I29A 3FHCB 2AN3A 1GQQA 3HWX1 1P5ZB 3NFYA 4U7WA 2FXIA 5E2BA 4B3JA 4TMFA 3B2QA 1BN6A 2XF8A 5IAEA 4M9CA 1JA1A 1C0EA 1P2BA 1EQ2A 3FFWA 4COOA 4RD0A 2YIVX 3AI2A 1URPA 4KFSA 4XLTA 4EWLA 2OXFA 5ICMA 1KYTA 2O59A 2VWPA 4DARA 5AW5A 3WAJA 1WMBA 4M55A 1Y33E 1S2OA 3PPXA 4TWZA 3SFZA 1IAVA 2VF8A 4II3A 1P1BA 4DCCA 1DWPA 3IUJA 1MT3A 5F78A 5H83A 1K6JA 3BULA 3ZIUA 4GT1A 1ZZGA 3UXMA 4I1RA 3VZCA 3HXQA 2F17A 2XVZA 5FOXA 3QA3E 4UCXA 1MTZA 1PYGA 1R16A 5J58A 4LY9A 1XNHA 3K0BA 3UAOA 1DADA 4KXLA 4ZAGA 1P5JA 5HKOA 5JAZA 1GWNA 2W00A 3AM5A 1QPGA 2CFOA 2CBZA 2PO7A 3P52A 4ZIRB 2G5CA 1KU0A 2V9ZA 1OQAA 1UK8A 4J1TA 4YQEA 3SIXA 4DLKA 1EVIA 2I66A 2W6OA 3MHPA 3WNVA 4YT2A 4UXJA 1D8AA 1T3HA 1EFRD 1ZONA 1CRWG 2PAFA 3SAJA 4URXR 5JV5A 2WY2D 1ZD5A 2OQIA 1ZMBA 3PDWA 3RKSA 1VHDA 9ATCA 4R8VA 1SZDA 1WJGA 1DKRA 2G77B 1GZ7A 2Z8YM 3CVOA 3DEFA 16PKA 3FHLA 3HGTA 4LDRA 3TTTA 1U1GA 1U7DA 1AKVA 1JFFA 2GKOA 2GXQA 3A3OA 2PKRA 2O0MA 3GGGA 1Z5GA 3HYSA 4MTCA 5H7XA 2XKAA 3LXRA 3JWEA 1U0GA 4XYGA 4O0LA 4RMGA 421PA 1AQUA 3MGGA 2JLAA 1TAHA 2F59A 4EJSC 2WSIA 1SZPA 3DL0A 3OQIB 2RH5A 5TY0A 2I4LA 2PVCA 3LC2O 1FK8A 1ONPA 2C2HA 4IQGA 3TTUA 5AW3A 1TQ4A 3VYSB 5HWSA 2ASVA 1WF6A 3ZJVA 1UC4B 3JY6A 1VLJA 2DERA 4HLCA 3QVUA 1FSPA 5JEEA 3FPLA 1PSZA 1JLSA 4QYTA 3ROZA 1JLHA 4WLOA 4DE5A 4F4UA 1XTZA 3OEHD 2QUZA 4B83A 3LOUA 3VA7A 2YN2A 2E4XA 2QX8A 3AI1A 4HDSB 4W99A 4ZOEA 4ZICA 5KJ6A 1W1IA 2FPMA 3ROPA 4Q4LA 4FM9A 5CDFA 3NRCA 3U7RA 3V2UA 1KZ1A 3DBIA 5K8VA 1AMNA 8AT1A 3EG5A 3FM9A 3R20A 4G84A 4BNTA 2AOVA 3AFGA 5LOVA 3O8CA 2PO5A 4RA6A 1NURA 5T4EA 4F8JA 5A62A 1X9IA 3F7OA 3OZWA 1IJBA 3C7TA 5HE9A 3KOXA 3FI9A 2J5XA 1CF2O 4QRHA 4Y6OA 3IBFA 4RLQA 5IKXA 3T54A 2GD2A 4M0CA 4NATA 1GITA 3C5HA 4PHGA 3L0CA 5EQDA 5FA5A 2BZGA 2A84A 3EFBA 4B9AA 1U4NA 1PV2A 4OXXA 3UT0A 3OUUA 3K1JA 5KSZA 2XE4A 4R40A 1UAAA 2ZREA 1YE8A 2GGSA 3PUXA 2AFHB 3MWFA 4HH4A 3R7DA 1RCUA 2ZPTX 4TKUB 4BP1A 2J7PA 1KL7A 2XTZA 3NPAA 2CJWA 1EDOA 2JGRA 3ZWNA 1GM5A 3KOWA 1G7SA 3GLIA 4YJHA 1PJZA 3KAQA 7GPBA 3IURA 2AW5A 4BJHB 2AUNA 3UICA 2ZB7A 3KWFA 3ANSA 5LYJA 1Z0UA 4FBMA 1JA9A 2WA2A 1K27A 1WZIA 2XMSA 2VJMB 1E9CA 4ZGBA 3KXIA 3GFOA 2G71A 3PWSA 3L8ZA 5EEHA 3K8QA 4EO4A 2YFQA 1K6MA 4A4DA 5CFQA 5IS2A 1EK5A 3QF4B 2GHRA 2YRXA 2FWMX 1HYGA 2HF8A 4O02B 5AH0A 5AW6A 1E8MA 3ZLJA 2ET6A 4D5EA 1TFUA 1XZGA 3M3PA 3U7QA 3VPHA 4KVZA 4ALLA 4B4KA 3X1ZA 3RC8A 5HCIA 1DJOA 1PFKA 4ENWA 1T36A 1PG0A 3IRUA 1J8DA 5DNWA 4C4AA 5G1NA 1GUYA 2IS2A 1M8PA 3QM1A 3SX2A 2BLNA 3UXEA 1PSDA 1RPTA 3NT4A 4D9IA 1FYVA 3IV6A 3UB2A 1T6ZA 3NJ4A 1Q14A 4P4LA 4GM1A 2R7KA 5I9IA 3THXB 1RE0A 1LJLA 2OQRA 1JIKA 1RKBA 4E2XA 4YRAA 4BVLA 3UOGA 4OBWA 3DOUA 5LQNA 1DIGA 3IMKA 1X14A 3EEBA 1JS1X 1N2BA 4IH1A 4RVUA 4NMHA 4RY8A 1VSVA 1OUMA 1TCUA 3JQBA 3PLRA 4R81A 3UB4A 4CMHA 1OIVA 1UXOA 3GFFA 5E6SB 4YRCA 4QUHA 4KFCA 4UQLA 3T52A 4KAXA 3EQ7A 5C1DA 4F2PA 4HGYA 4Y67A 3SZOA 4QYSA 2V6IA 5GJCA 1C41A 1RTTA 1QYRA 2YC2C 3SXUB 1J6UA 3N6XA 2JFWA 2AIRA 3FRJA 2JIOA 2QRKA 3GRYA 1UDAA 3SICE 1I4TD 3DBRB 3WXBA 1B0UA 5JT1A 1WXDA 2YNMD 3C3YA 3GLTA 4HAXA 2GF9A 2P4QA 1T3ZA 5DNDA 1FBTA 4BV2A 2G63A 4X41A 3TNJA 5EZYA 4JFRA 2QTGA 1YU6A 5L7TA 2ZR8A 4PLHA 1Z4KA 4XVUA 1N5MA 2TMDA 4HAZA 2J7PD 4HY3A 4B84A 4LJ6A 1M0WA 3QH4A 2BGJA 1P2UA 2WZCA 3RRZA 1BD4A 2XE8A 1RYHA 4DGSA 4CM4B 5EQFA 4IO1A 2JNWA 5AR1A 1LSJA 3NXSA 4JUCA 2PSFA 2I2BA 5DLYA 3RC1A 3RBXA 4KN8A 4W6ZA 3T61A 1TUBA 3KL2A 3CB2A 4UHFA 4LYGA 1UDRA 3KSAC 3OJXA 3OPYB 3L5OA 3QHPA 5K0LA 3A4VA 5HFNA 4YIKA 5JFGA 2PSHA 2Q7DA 1MH1A 2LRHA 2JG3A 2QLFA 2C31A 3U3OA 3GMSA 2XCSB 2FYTA 1OTYA 1YB7A 4N7MA 2H4WA 2QRZA 3FNRA 4N5MA 1T6XA 2IC5A 1IE3A 2GM9A 3HY4A 5D86A 4WXPA 4M0KA 3CGGA 5DYTA 2PXAA 1ADGA 9ABPA 3DPUA 2HCJB 4J2TA 4UBKA 2X3FA 4IG4A 4EY4A 1VI6A 5PGMA 5IKPA 3K70C 3WGOA 2QXTA 1CUHA 1OYOA 2RKWA 3SP1A 1G7CA 3ZE9A 5KJEA 1GUZA 1NLZA 1R0BA 1CRZA 5CG1A 4RKQA 4PGAA 1XRJA 4IH9A 1IHOA 1PUJA 3LP8A 3IP3A 4OI1A 3HWWA 4EMTA 1DHRA 2DY0A 4B2YA 5LXTA 3U7HB 4UE6A 3GIDA 3MIZA 5JRDS 5LIPA 2JJQA 1F2TB 2AFIA 3MTGA 1IEWA 2MIIA 4O6VA 4NYMR 1ODTC 1U3CA 2QP4A 2YWJA 3RC3A 2PLWA 4BMXA 1F7VA 3WP1B 1GQYA 1A96A 1T0IA 2FEWB 7AT1A 2FZEA 4FN4A 3PEYA 2VEOA 4GR4A 2E3JA 2EKBA 2GBLC 3K0KA 3KKEA 1G2QA 4II7A 3ZQ4A 4WFIA 4EG7A 4MS4A 3K70D 2Y71A 4KV9A 3WIEA 4QHYA 3I9LA 4QUDA 2QX9A 1RKXA 4W8HA 2Z5VA 3M3HA 1EX6A 2H1IA 5G2OA 4E07A 1CDZA 5IVHA 1FFWA 5CDYA 5IZCA 3M49A 1G9SA 4R8SA 5JNTA 1E2NA 1ZKMA 2B99A 4DRZA 1MEOA 2A0FA 3PNLA 4FJ2A 3USCS 4CKCB 4NZMA 3VISA 2AZDA 1JQBA 3B51X 1XRPA 13PKA 1D7AA 2RJNA 2VDOB 3LZDA 2PL1A 3A7DA 3SYTA 1L4GA 3F90A 4FMDF 4MRAA 5BN5B 2ZIEA 3IBTA 1Q0UA 4O2LA 4RA9A 4OAPA 3K6SB 2Z8YA 3BWYA 2PH7A 4GVXA 4MQ5A 1NXOA 4RFVA 1LDGA 2L42A 3HFSA 4Q3CA 3TOCA 5AW7A 3C3KA 2I3DA 3GVPA 3H04A 3KJFA 1NZJA 2AL7A 3GT7A 4GMHA 4MMXB 1MRNA 5GONF 2AZ4A 2BGRA 3FUXA 2Z1DA 2WSBA 2BYTA 3OM9A 4MQBA 4E3ZA 5DN6A 2VXBA 121PA 1EK0A 4EW2A 1TO6A 2CEKA 1C3OA 1X42A 3Q87B 4W9MC 2CSXA 2QLMA 1I33A 3Q41A 4HQLA 4UU8A 2QK4A 4OP1A 4I4TB 4AKHA 2VTBB 1DRKA 1RKUA 1PBTA 4WOKA 1POXA 2RHCA 1TC2A 2QUKA 2YYYA 4WH0A 1UDXA 5K0EA 5DNUA 2C2XA 3KQKA 2VJDA 2W2XA 4YJ3A 1IDOA 1YHZA 1VIMA 3VPSA 2WKRA 3NWEA 1J2YA 1OV4A 1R8XA 4CM8B 5CFRA 3ELBA 2I6XA 1J0CA 3IXMA 1DQNA 2DY1A 5SV2A 1FLNA 1W4AA 4LZLA 1AZSC 2J59A 5DLEA 5E0KB 2GJKA 2COUA 5FOSA 3EMDA 5IBCA 2AJLI 1YUBA 2HDOA 3C5VA 3NKLA 3QKSB 4A6XA 4CTKA 2O8BB 3K9QO 2ZOSA 3JYOA 2P0AA 1FB5A 4YRDA 5AVQA 5KNCD 5F2EA 4ZVKA 1O6FA 4J16A 2DULA 3DTVA 1E9VA 1L9XA 4K6KA 4MUNA 4RMJA 5KWIA 5HZGA 2D0OB 2PG3A 2WJVA 3H16A 1E6KA 3R0JA 3KPVA 2AG5A 2XA9A 1CR0A 1QTNA 1VRWA 2Y0CA 4LJLA 5EE3A 4I1SA 1ZOLA 5HDBB 3WB1A 3ZWYA 1W0JD 3K5WA 1QR2A 4OKNA 4JXZA 3BD9A 2O1EA 3U3KA 2OZPA 3F67A 3VR6D 5LUAA 1HLGA 1VLZA 1Y7LA 1EXDA 3CEHA 2Y8EA 3UW3A 1JTFA 4WFQA 5T4BA 3HN7A 3N8IA 2KBFA 1D6MA 1R37A 2V6JA 4CM7A 2OD7A 5LFAA 2WM9B 5JI2E 3C5CA 4BFTA 1ZQ9A 3U13A 1NJ6A 2D0IA 2Q6TA 2C8VA 4YCMA 1CRLA 1NNUA 3VU9A 2ZAMA 4NHEA 5IASA 4EA8A 3TZEA 5DGXA 4KX5A 3THWA 1Z4IA 4GPIB 1HY3A 4OI0A 4UDOA 1GFWA 1ZH8A 3H2IA 1U63A 5JC8A 1A71A 4QJBA 4BVJA 4NG5A 3H2YA 4MW6A 5DCUA 4CEIB 1Z82A 3KTOA 4U1RA 2IYRA 3F3KA 2NU9A 4RENA 1PZEA 2QNBA 3OM0A 2E6UX 2R5WA 3Q7TA 1H0HA 4EHAA 1B41A 1N2OA 2CHFA 4XX1A 5C34B 4OGGA 1ZI8A 1QCZA 3QPCA 4YCLA 3A9RA 4LGMA 3UNXA 1U0NA 3AU9A 3RW9A 3M3DA 1EFPA 4QQKA 3COZA 4ESOA 4YRKA 3JRWA 3HCEA 4NOLA 2O2YA 1ZISA 2BFNA 3KBBA 1UZAA 3TTYA 5IRCD 4NECA 3LE8A 2WIJA 3DB1A 2P6PA 3DFKA 3FXAA 4QT0A 1AHIA 2QMHA 3EDRA 5B57C 3R7LA 2BRUA 5JAQA 2NOAA 4C30A 3FBGA 1E2UA 4FOOA 4TS4A 1V6CA 1Y3CE 1NN3A 4CU2A 3IVGA 4M38A 2PZGA 3GNQA 3RH0A 3RUHA 1GAWA 2GHQA 3OBBA 2WFAA 1QZZA 4F86A 2H1OA 1VYVA 2D7JA 5JCOA 4ZYUA 2X8JA 3FMPB 1R6XA 1QK4A 3TSCA 4DZZA 1XXHE 2B34A 1U2QA 3AP1A 4R69A 1BGXT 1XF1A 1JB1A 2VKTA 5K2MA 1SCBA 3H5NA 3HI6A 1QGUA 4F71A 1HEYA 2C20A 4PGFA 2IBSA 4H6WA 3UWOA 3NCHA 2ZUFA 1EDEA 3MRSA 1RAHA 5TRTA 4XWTA 3TMAA 4EG5A 2I78A 3TCKA 1F60A 1UM9B 5K05A 3TR5A 1QE0A 1U1IA 3SIPA 3SYMA 1MN6A 1VJDA 2IHYA 2XSZA 2C57A 1PGPA 4I9GA 3AVUA 3REOA 1JECA 1G5IA 4HAVA 1V3TA 4G0VA 2P9QA 3FW1A 3QENA 3GJTA 2XB9A 4P4UA 4BNFA 4M9XA 4XIIA 2CUKA 2QY9A 1RJFA 4FOPA 3OLXA 1L4UA 1BEZA 3DXXA 3O92A 3NVDA 2JJ1A 2RAVA 4X7RA 3FGZA 3SHOA 3OJ0A 5ECYA 1Z74A 3I0ZA 3SEQA 3TRHA 4HNTA 4UZSA 4AZ0A 1FFCA 1Z17A 2XT6A 1WE2A 3DO5A 3N86A 2HZBA 4GQBA 2JKYA 2Q3DA 4JBIA 2CWDA 1DFIA 3SS9X 3V4VB 3GLSA 5BUQA 1XMQB 5BUSA 3RT9A 2EBFX 1NW8A 2HWWA 1E0DA 2QTVB 3UGKA 5A3JA 1Z56C 2GBCA 2B82A 1B8NA 2H5EA 1SMKA 2QJTA 3ETNA 2CHQA 3FOAA 3HYNA 1HE4A 4PANA 3EW7A 3LCRA 4IVQA 3LPCA 4RTQA 4RPLA 1HFKA 2FEAA 5D7NA 3WZ2A 4CN8A 4EPYA 4NEQA 1W7AA 1TD1A 4KUHA 2PU5A 1YL5A 2GZHA 2RHHA 3ZDXB 5C80A 1BYIA 4IP0A 3SX4A 2QE7D 5BV8A 3BFJA 5IULC 2O8NA 4NAVA 4QXRA 5JCZA 1IONA 4DWOA 4RWEA 1CY2A 4Z51A 1N5LA 3DUWA 5H8WA 5ALRA 1NBOA 5ALOA 4MKFA 1A8UA 1EVEA 1CIPA 3MTAA 4XDYA 2FMHA 3DOHA 3LUBA 4ZZ2A 1S9DA 3JYPA 3EGXB 1DSSG 1NVFA 2OHGA 3I2KA 3GFBA 4MWBA 5EKXA 8ATCA 1FFYA 4G4IA 2AR9A 3RTAA 1EWYA 3R6DA 4M76B 1AO3A 2FN7A 1VLHA 1W34A 1BQEA 3CRNA 3C74A 1G1MA 4FPXA 3RRYA 1QPZA 1P17A 1R27A 2C4NA 2UZ1B 5TLSA 1C1YA 1M7BA 3PJGA 3UMVA 7MHTA 3IESA 1BS1A 1W85A 3EPJA 2HC9A 2WWWA 4M22A 4OXRA 3S27A 4EABA 2QJOA 4BXOB 1N5OX 1XCLA 1M2NA 3GP3A 1U6KA 3DG9A 1HRDA 2CHUA 2QVYX 4B1FA 2H2IA 5KDLA 5KTMA 1QHHB 4NBRA 4EECA 2IWHA 2C2OA 2BBOA 2C88A 2HQ1A 2VZLA 1N2GA 1X7HA 3N28A 1U9ZA 3AB7A 4EFNA 3OWXA 4PICA 1T10A 5I7VA 2I9KA 3I62A 2K5UA 2W2QA 3KTAB 3KQVA 1BIFA 2IZ6A 3PC3A 2A35A 4FMPA 4ID3A 4N3AA 2ZR9A 1GZHB 1LLCA 2PZBA 4K87A 2FW9A 3U9LA 4OQYA 3UO8B 4I55F 4E5YA 3VNVA 3C3JA 4GGMX 4CL3A 2ZXUA 1DB3A 2ZP1A 1PJ4A 5JSYA 2OTCA 3FNQA 1D2MA 2XNKA 4RCZA 2OGZA 1JLLA 2DWOA 3A31A 4RVCA 5AM1A 2VCYA 1H4TA 3GAMA 4V3BA 5IBRA 3ZUGA 1T26A 2PQ6A 3RIYA 3SS8A 4YPVA 5I7HA 1FRFS 5JWRA 1RXIA 3IEKA 3UV6A 1TEXA 5C3UA 4FHFA 2P9FA 1OAOC 4OYLA 4QDTA 4ZQCB 3UGTA 4LYEA 3MS4A 1VJRA 1E2KA 3AEXA 1RJWA 1DAIA 2QHXA 2HPVA 2CW5A 1V8OA 5DBIA 1FJXA 1YCDA 2B37A 1YKSA 4ZYTA 2KMLA 3MT8A 2PGOA 4FFWA 1M83A 3LUAA 4IDQA 4K9PA 1ZCBA 5IJZA 1GCUA 5J23A 1NQAO 1DDIA 4AXXA 2WSSA 3DDOA 5G41A 1TM2A 4X1IA 1G0NA 1D0VA 3L7OA 4ZVOA 2ONJA 3ZI7A 5HKBA 2ENWA 2Z58A 1ZSYA 3H8VA 3KT6A 3CV3A 1YFJA 2RH8A 2XODA 1ETUA 1YNOA 2AQ8A 4OU5A 2P67A 1KI4A 3CUTA 3GQVA 4R71A 5JD4A 3LD9A 4OLHA 4JLDA 3JQEA 1LV8A 2FEKA 2XGOA 4JYPA 1JWBB 1JDTA 3ICOA 1AJEA 1BN7A 5EJ9A 3ASYA 1XCBA 1WUKS 3HR7A 1UT5A 2XBUA 2ZS7A 3AV0B 2DB3A 2A7XA 1NYLA 1Y89A 5EMHA 5HS6A 1BCRB 3STUA 1RZRD 2Q3MA 1HNXB 1KAQA 3HG7A 1Y7HA 2VPZA 4Q93A 4QNRA 2IEDA 3JQ6A 4JLMA 5REQB 3UPUA 2Q2NA 3NCTA 3O3CA 1NVEA 2GN6A 2ZJAA 4K6FA 4XB1A 5LZ2A 5KCMA 1KAHA 2FFHA 3CIOA 4ICIA 4DIKA 1TECE 1JJAA 2YS7A 3P2IA 4UTOA 4OMFG 5CH5A 3CT4A 1T1EA 2B83A 3EY9A 5GIPE 1UFVA 2ZS8A 4XSVA 1FS6A 4EHFA 5M3BA 5H9WA 4X7BA 5ED0A 2QBYA 2IA5A 1ZWKA 4L5AA 3T7CA 3D6UA 1O1YA 2VK2A 4BNYA 1EZ4A 1NX9A 5L51A 1FUKA 5JNLA 4Y6RA 3SEFA 3C48A 1HOTA 1I2ZA 1E7QA 1L7AA 1T2NA 2CNKA 2R48A 2VPXA 2XVAA 3TQOA 2DVMA 1EHCA 1F8YA 4Q39A 1PEKE 2PIAA 3S2ZA 3DHYA 3UMCA 4DPKA 4YRGA 1WY7A 2CNWD 4ER0A 4X91A 2C9BA 3Q12A 3TYXA 4IJMA 1BJKA 5AXDA 1KSJA 3E9EA 1EM8A 3EC7A 4I8IA 3WIVA 1MNQA 4RTPA 3V42A 4A0RA 2ORED 4BIIA 3OHPA 2G9RA 4CXMA 2VSNA 1FZTA 2D2EA 2H1HA 3JQ8B 3SQDA 3FETA 2IFTA 3R44A 5I45A 1FQJA 4FNMA 3WKEA 3D8SA 4PXSA 3Q2KA 5IH7A 1C9EA 2DBYA 4P98A 3QJGA 1FU4A 3NPMA 4CV0A 4JYZA 5HMLA 5FKJA 4F45A 2NVUB 3C1TA 4HFRA 3I4LA 1XVVA 1UJBA 5GQSA 4KWCA 1K06A 1FYEA 3EH2A 4KPUA 2D5CA 5HJ5A 1YR8A 5KCZA 2Y0EA 1U3VA 5T4FA 1F38A 1Q7BA 2RHGB 3WOVA 4B7CA 1WCWA 4QUAA 1QU3A 3WYEA 4W5TA 4MXDA 4PIPA 4FWBA 3QLVC 5HJ7A 1XU7A 1XTTA 1LW7A 1O95A 2BTQB 2WUVA 3HCAA 3AR6A 4QXAA 3N8HA 3W2GA 3P71T 1TAUA 1XRSB 3W78A 4I55A 4G1CA 1XMIA 4HYTA 3RV4A 4TVSA 1N57A 2H2WA 4IIJF 3H2GA 1UPCA 1KQ3A 1FQKA 3ZWVA 5AXCA 4TN5A 4AMZA 4W63A 4KLRA 4X1OA 3G8AA 3PZRA 3OZXA 4UAGA 5FPHA 1CJBA 1Z36A 1C14A 3FJYA 4HX5A 4HG2A 5T6MA 3RKRA 4D57A 2ZXFA 3HEBA 1Z0AA 4OHWA 1G8FA 1HLFA 2X22A 3V1MA 3L4BC 2X1LA 1F8UA 5ALMA 5WRFA 2NXWA 2FN9A 2IEZA 3WYAA 5ICGA 3AUSA 4BU0A 1OI3A 1K68A 3P32A 1CQIB 1OFVA 1E1MA 1EX1A 1FDVA 3QUTA 3OUTA 1JQEA 2OCKA 4WKNA 4E0BA 3V33A 3A8TA 4RPGA 5CPFA 1IHUA 5ITZB 1WMSA 2P2YA 2PWZA 3NU1A 4HWGA 3WWOA 1I6MA 2FSVC 4CETA 2OC4A 1LLDA 1VE1A 2JATA 2ODQA 3JYNA 4WK4B 5KDOA 5LOVB 3UUEA 2ZRGA 1FVXA 4V0OA 3F98A 2O14A 4I0WB 1IM8A 5TJHA 4WRRA 4YRNA 3TTSA 5A4FS 2PJZA 2ZANA 4G8DA 3TAUA 4CLEA 4EJ6A 2C94A 2RCYA 4M9ZA 2J6HA 3E23A 4MA5A 4OQ4A 1MX1A 1ORTA 4V03A 1OZAA 3B5EA 5EIAA 3VC7A 1X77A 3MWEB 1TEHA 5FL3A 1R0WA 2BHNA 4EKNB 1LS6A 2CLEB 2WD7B 3EXFB 1C7IA 3CLSD 4JJ7A 3PDCA 4AWAA 2HM7A 1T1IA 4CM1A 3VQTA 4YQYA 2PBFA 1N75A 4YUZA 1Q20A 1ZBQA 2QG4A 4EO7A 5E4YA 1XVIA 2HPHA 3UMYA 4K9LA 4FFBA 3H9CA 4FXPA 1PX0A 4HZGA 2IHVA 3RRXA 3C8MA 4LYYA 4A6PA 5IKMA 2B9VA 2HJVA 1MJHA 4GLOA 5FCDA 1R12A 2J33A 4OQFA 1SG9A 3NP7A 5EFOA 1M6WA 2CEAA 2RJOA 2VYVA 3ZHTA 1Y98A 1C2YA 4JCCA 4ECEA 1KNXA 3UQZA 2G4VA 1AMUA 2CVHA 4AZTA 3W5SA 1HDXA 1NVVR 2FHSA 2YOFA 4D9GA 2Q5JA 3NC0C 1GAQA 2PX8A 4DLUA 3S2UA 2DQYA 3AF0A 1E6MA 4BGVA 4LXQA 1ID1A 1KPHA 1MUUA 4ALMA 4CM5A 4EW1A 1C0PA 2C98A 2X4DA 4D46A 2WNSA 3DLPX 3I9V1 2PGJA 4N48A 4OLFA 3K20A 1TDJA 4K9NA 2YVKA 3I2IA 1C29B 1QPBA 2GCEA 4QM6A 1QGOA 4DGQA 4D7AA 4L5BA 2C9DA 4KXMA 3DP7A 2RK6A 1L5ZA 2BL4A 3GRZA 4O1IA 1FDUA 1KFCB 1E3TA 1RZVA 2XNCA 4ITRC 2XZPA 2IUUA 1RBYA 1WEKA 3A9VA 4IIFA 1U8UA 2A1TS 1IZ9A 2FPGA 5KU7A 1YU9A 5DK6A 3FPEA 2QD5A 4MUHA 5TVKA 2NU9B 4CM9A 1KI1A 2WVJA 1BQ3A 1YMUA 3I1FA 5D6NA 2F3TA 5DSZA 2XQFA 1T2VA 1DEAA 4IAOA 4DKJA 2UYHA 3QG1A 3GLFE 1NVKA 4X97A 4X3CA 3F6CA 4LSZA 5AK5A 3WSVA 5B1EA 1FTNA 1ZI9A 4UU0A 1SBCA 3T5PA 6CHYA 4DV7B 3S2EA 4QOGA 1DKPA 1AS3A 2I3ZA 1U0HC 5E7QA 2XE6A 2ZYHA 1ZS9A 3U81A 3WK4A 1IN4A 3ORYA 4FX5A 4F7WA 2CNLA 3ML1A 3LVRE 2JBAB 2VUSA 4V0ME 1DAKA 4HL6A 2Y6VA 4LDAA 2QIPA 3WLEA 2J9FA 4WESA 4CDRA 1KQNA 4G26A 3N2KA 1XTVA 5DOZA 4DV5B 4C43A 1IBMB 2H0RA 4RJJA 4ZAFA 1T0JB 1F2DA 3W5IA 2GYYA 4BP9A 3SD7A 1IJEA 2JHCA 1O95C 4XFDA 1VIVA 5CIWA 2M6KA 3W9UA 3R75A 3PXAA 3I5XA 2QW1A 2DUNA 1IY9A 2PWAA 4MQLA 5F9MA 1L7MA 4M7RA 3RG8A 1I1NA 3RRBA 3RRFA 3RS9A 1PQWA 4DV6B 1FFDA 3VMFA 4F96A 1UWLA 5CDGA 5L3SB 3TIXB 2HJ9A 2G07A 3SSAA 3ABSB 3S3TA 3MWEA 1MDBA 4JB0A 1FFHA 3TPFA 5K8CA 4KXFB 3B6JA 2W6JA 5CNIA 4DQUA 1Z63A 1SXGA 1IYZA 1SU6A 3AHIA 4RAQA 1WLYA 4UFNA 3FFAA 1P31A 2JC3A 3U4MA 3ITNA 5DHUA 1C3JA 3TE7A 1XQ9A 2OWEA 2BP7B 2HFJA 3E7PA 1G8YA 4MX8A 3VR5D 2JFNA 3K9HA 3IT0A 3MBIA 1O6BA 4DDMA 1BMTA 1QB8A 5A4KA 1ULAA 3OA0A 3DVQX 2A9RA 2WG2A 3K3PA 1G1AA 4RD6A 5TMDA 1T4DA 5JMTA 1A9XA 5C4MA 2EEZA 2R6GA 2VHEA 1YZUA 2LP4Y 4ZMRA 3RU7A 4ND8B 3T9EA 3EXIA 1H05A 1YSCA 1WQ3A 2ASEA 3M5DA 4LOIA 4YRTA 2PJDA 3MK31 1XZAA 3S44A 3JQ7B 1HZJA 2B21A 2AMYA 2VDPB 5JD5A 4RLSA 1GNTA 1LV7A 4NNPA 3ANXA 1T6NA 3P20A 4NJEA 3VKGA 5HK9A 2HBZA 3H1EA 2AOTA 2QP9X 5MF6A 5HQTA 3QPWA 4BATA 1WF3A 3O2NA 1P6UA 3GOQA 3KV1A 2Q28A 4PZPA 4BBZA 4C0SA 5LLSA 4UQOA 3OCXA 3ELDA 4LBYA 4E1VA 1AGRA 4AQ7A 4N0PA 1IZ8A 1QYCA 5G1OA 5DOVA 1WV1A 2IUEA 3BK2A 3NHZA 3WR5A 1SXQA 3WE7A 2I4IA 5IWAB 4ISBA 4AG6A 4DPMA 1U6JA 1GGKA 1XN4A 4WL0A 3DOIA 2IYXA 3KSUA 3OF3A 4DSOA 1F12A 1E1CB 3AF3A 1B8OA 2H31A 5JE8A 4M1TA 4PXYA 4ZO4A 4A8JB 5LP1A 1U1DA 3TRIA 2DFVA 3C85A 4G5QA 4CMBA 4M0FA 1UP4A 1VCOA 3JVEA 1TTQB 4E1BA 1DPGA 3G85A 4E7PA 3LY5A 3PUZA 2ECOA 4KBYA 1CXZA 2XUHA 3GGOA 1XD9A 2JJ2D 3QJ5A 3HB9A 2XB4A 4J4BA 4FHZA 2IP2A 4JB2A 4PPGA 3TAXA 5K6AA 5L6LB 4LXUA 1JHOA 3PUYA 4HADA 4Q9DA 2JK0A 1CY1A 2NUTA 1GSOA 1PJQA 2IY8A 4A8PA 5MN4A 1QIDA 1NF3A 1M75A 4ZVLA 3ZGXA 4L51A 4KPEC 4J2OA 4XIYA 1EVYA 2R66A 4NV0A 3OOEA 4EF6A 1GPNA 4EUEA 2AMVA 4R1UA 1YXMA 2IU0A 1GTL1 4H17A 3SQOA 5DHQA 1JWLA 4PSCA 1PTKA 2QSUA 2QTVA 3PQ4A 1CRPA 5DX0A 3IIMA 5F2OA 2GAAA 2ZRAA 5D5HA 4FYYA 4KE9A 4K9QA 3DWIA 3T3IA 5ALXA 1JHVA 3FZGA 1UXIA 5K0GA 2JEZA 4YAWA 2HMYB 4BO7A 1WPXA 4RXMA 5T4HA 3TGWA 2ATXA 3CZ9A 4RIGA 4ER7A 1E3MA 1WXHA 4L4XA 3IR6A 2PZFA 4L16A 1GTZA 4LZPA 1IMOA 3KOMA 2REQB 5HK8A 3TJZA 2VHJA 4AFNA 4RQUA 3BE5A 4ZDIA 1HT1E 3B70A 2C4KA 4WHMA 3W5DA 4YRJA 4AYTA 1A69A 4GOXA 4B3DA 3HJGA 3IUYA 2I1QA 3HPRA 4A0SA 4NCIA 2RHBA 4OK5A 5B3JA 2C82A 1R00A 4U2GA 1Q16A 1HC7A 1HUQA 1MRSA 2WF9A 4KVGA 5KYYA 1KJJA 2EFDB 3DAOA 1H3EA 1HORA 2G4LA 4UBJA 4XM2A 3QNMA 1QRDA 5F1PA 5CA0A 5KWVA 1T0HB 3Q7QA 4HMOA 4X1IB 4MV0A 2DTXA 1NZDA 3X2SA 1H2FA 1SWVA 3AB8A 3BICA 2FFBA 5EIWA 4C08A 1FP4A 1POWA 3FOEC 1GT6A 1ZY2A 2OCGA 4YRPA 2GUGA 2E0IA 1THTA 2VVTA 2JK1A 1XKQA 3C70A 2QTHA 1X1SA 2NO4A 1XHFA 3N05A 1O89A 2JLCA 2Y0PA 4BFYA 1BX0A 1YR3A 1AV7A 1C9MA 1MQ9A 1OTHA 1OVMA 3IPLA 3JVVA 5EESA 3TI9A 2GKSA 4LPSA 2CLIB 3ZWQA 4PRYA 4YX9A 2R1ZA 2ZAGA 3SBDA 1WDLA 2M98A 2IYPA 2C5FA 1CNFA 1ES9A 5BSRA 5BP7A 5EXXA 5DM4A 4EW3A 4Z1OA 2YIDA 3LBYA 4JOBA 3FMVA 1CY7A 1X1QA 1E4VA 1A7UA 2CLKB 3PFGA 1EBFA 1VMIA 2BVNA 4H6PA 3BHMA 4PFSA 1FXWA 2BFEA 1PV4A 3C8DA 3E4CA 4XGRA 4XVQA 5HIIA 1U7OA 3OM1A 4PM4A 4JKOA 1U2SA 1NATA 4MLDA 4AJHA 2FP4B 1XIVA 3FOBA 3QXJA 3BFVA 2DT5A 5CNMA 2X1MA 2ID9A 4Q02A 3IMGA 2NZUG 3AGPA 1KIAA 4DMRA 4R83A 1R0CA 1P44A 4US2R 1I14A 3OZIA 3DPIA 2SCUA 1QQTA 3IAAA 4P3KA 4FFOA 1Z34A 4Z9AA 621PA 1G4UR 2W71A 1GAEO 4HUJA 3IT2A 1PWYE 1SZJG 3NOQA 4D25A 3S0JA 4CQMD 3T1YB 4HDOB 3D8HA 4X8OA 4RKFA 1W73A 1JRLA 1IQRA 5EWLB 4C0QC 3GVHA 2Q3JA 3GDHA 1TUEA 4U0JA 5FWDA 1H85A 1ZH0A 2FR1A 1V71A 2H17A 3M1AA 1IY1A 4HAOA 4R1OA 3TD6A 2Q2VA 3CH7A 2ZVJA 4GM4A 4PC2A 1M6VB 4OQPA 3N0VA 3LY7A 5CU7A 3N2GB 3HKEB 1M73E 1RVDA 1U7ZA 5L9AA 3BORA 2WVGA 4EITA 3QVGB 1NWCA 1SHJA 2PLRA 3BRWD 3FKSA 2QLLA 4YJ2A 3KYCB 3NS7A 4Q12A 1ZH2A 6PFKA 4B3GA 4E08A 3MA0A 1PHPA 3ZS9A 3GC6A 2JH8A 5D3KA 5FTJA 5EKSA 1LKZA 1H3FA 1L5WA 2RH9B 2ZJZA 3WTBA 1OBHA 3KBOA 4GPEA 1LBTA 1ZOOA 2G4CA 3KZOA 4IFIA 1LD3A 3BYZA 4EFDA 4DIBA 1B23P 2QYSA 1Q3HA 2J46A 4FFNA 4RELA 3RC7A 3ZOKA 4BVFA 3ILSA 3NBXX 3D2BA 4C0AC 1YZFA 1PZFA 1S89A 3D8RA 5EP4A 5JVDB 2YMMA 1WXEA 3PDHA 1JEEA 5F1OA 1PJLA 4TRRA 1PGQA 3W34A 1SHTX 4JHXA 4UVDA 2YJNA 4K7JA 2VRWA 3EGOA 4DIUA 3WHLA 2G1JA 3LGSA 4ZVNA 3Q5GA 4JQOA 2W8BB 2PAAA 3H9EO 3HCBA 4QEKA 5H4HA 3ZCPA 4PY2A 3LX5A 3PE4A 2J0EA 2Y93A 4O4JA 4DL9A 4EMSA 1JNYA 1OY1A 4PEVA 4KO1S 4JS0A 4RZ2A 4N82A 4U8HA 4Y2YA 5BY2A 5MGNA 2PUBA 2BH9A 1UEIA 1WX1A 5JWHA 3ZK8A 1QYWA 3RROA 1RCFA 2FQQA 2Q1SA 5K7SA 1VBMA 4KODA 3GLHA 5GGYA 2F2TA 3FCXA 1UKYA 3K7EA 1CR2A 1RQ7A 2FUNB 2HHJA 5DI3A 5TNXA 4NBLA 5IK2D 2GD6A 3BSYA 1SULA 4I9NA 4JBXA 5LZ9A 4PQRA 2XUIA 5B1HA 4KTTE 1OBCA 4URWR 3M9WA 4B09A 2OSBA 4GH5A 4PRLA 3OQ1A 4U6NA