4QECA

Elxo with nadp bound
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
248
structure length
248
Chain Sequence
MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
molecule keywords ElxO
molecule tags Oxidoreductase
source organism Staphylococcus epidermidis
total genus 86
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qecA00
1SNYA 2EF1A 2AE2A 4H7PA 4IJVA 3JQ9C 3RUCA 4RQUA 4IS3A 2VZ8A 4BQRA 4CODB 2YDYA 3QA9A 4BOYA 4O63O 2EP7A 3HE3A 2CDAA 4P4LA 5A9RA 2AEFA 2VNSA 5U1PA 4EEZA 3RBVA 3B20A 4XDZA 4KTTE 4HX5A 3A1NA 4E4YA 3UCEA 3K6JA 1ADCA 3LSYA 1LJ8A 2BH9A 2E49A 2P5YA 3DMTA 4CM9D 4M8SA 4BNZA 2C54A 3OIGA 5JDCC 4CMIB 3EHEA 4WCFB 4PLPA 2NU6A 3TZHA 2ZB4A 1EVZA 3OA0A 4INAA 2GCGA 3VH1A 4J1TA 1U5CA 1GUFA 1P74A 2J5RA 4PLHA 4FFPA 3KM0A 3CTMA 4PVCA 4CLRA 3QRWA 4YA6A 2HU2A 4FCCA 1DRVA 2D4AA 3D1LA 4H3VA 4CLDA 2X9NA 1B2LA 3W4IA 8ADHA 3U09A 2DC1A 4JJGA 1BW9B 4YTEA 1Y8QA 1PIWA 1YQDA 2UYYA 3LC7O 3PJEA 2JAHA 3PLRA 4C7KA 2ZB8A 3EY4A 3S2EA 1ISIA 1NYTA 4KQWA 4YJHA 3GLQA 4RPHA 1T25A 2BFMA 4BGUA 1XLTA 3H9UA 3JQ9A 4DWVA 2B4RO 1B15A 1ZK0A 1NR1A 3BMCA 2YJZA 4J0FA 1O94A 2NU9A 4NIMA 4GL4A 4YPOA 3C1AA 1P3DA 2Y0EA 5TX7A 1ZK2A 3WSWA 4ALKA 1B8UA 1Y5MA 4XYGA 3Q2KA 1YONA 2WYUA 4GGPA 4ZICA 4DYDA 4E5YA 2VZ0A 1T1RA 2GRAA 5EPOA 3RROA 1M66A 1J6UA 5IDQA 2HJRA 2ZQZA 5THQA 1UDAA 3NGXA 3Q3CA 3WX0A 3X2FA 4RDHA 5AXAA 3D3WB 4OSOA 3GH3A 1HYHA 1PJBA 3D5TA 4R01A 4UULA 1R16A 2X5OA 5JDCA 5I8WA 1DEHA 5JAMA 2EEZA 1DLJA 3DR3A 4XB1A 2IODA 4BB5A 1JDJA 1KERA 5U9CA 1ZNQO 3H5RA 1FJHA 1K2WA 1NP3A 2DPGA 3ZNQA 1UXHA 2RCYA 1P44A 3QHAA 3GOHA 1BG6A 1ZKMA 1NQOA 4Q3CA 1F8GA 3V1TC 5LC1A 4GWKA 3T7EA 1BXGB 1FDSA 1UP7A 1SBYA 2HUNA 2YHUA 4NPCA 3RKUA 3PYLA 3GG9A 3QP9A 1J0XO 2QRKA 3JYQA 3VOSA 5BSGA 2VWQA 1LDBA 1XYGA 2GN9A 2G17A 3ULKA 4HFJA 5T57A 4CM8B 4E21A 3HB5X 1E3WA 3OJ0A 2B69A 1PGOA 3U5TA 5COAA 1KEWA 1PZHA 2FMUA 4DGSA 4WNCA 4OQZA 1N7GA 1PS0A 3I9KA 3OJOA 1F0YA 2PY6A 4JP3A 3L77A 2FHSA 3JQGB 4DA9A 4CUZA 4NJMA 5ADHA 3BTUA 3PHGA 1N92A 1YBMA 4N54A 3UICA 2FZEA 4XQGA 5JBIA 4OKIA 4WLEA 3CEAA 1UR5A 4PLFA 4F6LA 4YR9A 5CHEA 1O89A 3R0IA 1UZNA 3GPIA 5CG2A 2D8AA 1E1NA 2Q50A 2GF2A 2ZB7A 2YZ7A 2GN4A 4P4NA 4D3DA 2O7QA 1PGQA 2NTJA 3BMQA 1KYQA 3KOUA 4KWIA 4YRDA 4B3IA 1ARZA 4MVJA 2JL1A 1RJWA 2FOIA 4G65A 1HETA 3EW7A 4AICA 1PJ2A 5JNLA 1PL7A 2CSUA 1SB8A 2QG4A 4YQZA 4HV4A 3W8EA 1TLTA 4NK5A 3FPLA 3OJFA 1EK6A 4YVFA 2XAAA 3AM3A 4WEOA 2C07A 3C24A 3ETGA 1NBOA 1UZMA 2Y1DA 1PJ3A 3DBLA 2G0TA 3U9LA 3U4CA 4D45A 2QZZA 3RU9A 1C1DA 1XU9A 4BGVA 1QKIA 1H2BA 4Z9FA 4HP8A 5JLAA 4I9HA 4BGEA 3WYBA 4YJDA 1WZEA 4E5KA 3FF4A 1B3RA 3GVPA 1K89A 3C7DB 1P1KA 1XG5A 2EGHA 3K5PA 4FIZA 4XEHA 3STHA 2GPTA 1EBFA 3E5RA 3F46A 4PG5A 4BO2A 1Y9AA 4EJ6A 1G6KA 1ZFNA 3O8QA 3KSZO 1KVUA 4BNUA 1ZK3A 4CL8A 3EGOA 3INRA 1XEAA 2HRZA 3CKYA 3UGKA 3BMOA 1U4OA 3WNVA 4M1QA 1KOLA 3TNLA 1HDRA 4GVLA 1S7CA 3GK3A 4MKXA 1V6AA 3H6KA 1KEVA 4R1TA 4D0SA 4J43A 3OETA 2RHCA 4ITUA 1V0JA 3RUFA 4WOKA 3V1YA 3LC1O 4AG3A 1OAAA 1E6WA 2AEMA 2C59A 4IPTA 3U4HA 2QQ5A 4QFCA 1SMKA 2HK9A 4MVJI 1EVYA 1R12A 2RH8A 3VDRA 2VCYA 4N7RA 3PZRA 3UOGA 5FYDA 2O4CA 1ZSVA 2FZWA 1X7DA 4AJJA 3RAJA 1HDGO 2B4QA 3I4FA 3UFXA 1QV6A 1C14A 3R1IA 3QWHA 1DHRA 4MVJD 1B8PA 2QRLA 3UVEA 3DC2A 5CDGA 4FOOA 3WBBA 4EYEA 2WWRA 4LK3A 3K73O 3ZWOA 3BTOA 4IXWA 4MVJP 5A05A 4TVOA 5G0VA 4IDEA 2NTVA 3GEDA 5T5QA 3TOZA 1WW8A 4HWKA 5I9MA 1N5DA 1JN0A 2J5QA 4I5DA 1T1SA 4EW6A 1HF3A 2P2SA 4AJPA 3HDYA 1RM5A 4YAJA 5JDIC 5CDTA 4AJLA 3WJ7A 5DCWA 1D3AA 4EGFA 1U28A 3QWBA 1GR0A 2X58A 1CYDA 2ZTLA 1RKXA 1WDMA 2JCVA 4RO0A 1UDCA 3TZKA 1LSJA 1DB3A 3N74A 3PQEA 3QW2A 1M2WA 4PZCA 4DQXA 3GVHA 4IMRA 8LDHA 5ITWA 1IOLA 2P9GA 4XZ3A 4JCOA 4MVJF 1UZLA 3MJ4A 1V8BA 1VSUA 3KO8A 3UAGA 3QSGA 1ZBQA 4HNGA 2PZJA 1R6DA 4BGIA 3VPSA 3H9JA 4IMPA 4FFRA 3RQSA 4Z6KA 1U3TA 1KETA 4CMGA 2F00A 1C3VA 5A06A 5IDXA 3TJRA 3EVTA 4K1LA 3MJTA 3H2ZA 1HTBA 2EW8A 3FRJA 3NT4A 1NWCA 3DBHA 3NTQA 2ZQYA 1DJQA 3QLJA 1ZUD1 1EK5A 4XIYA 1ZK1A 2JD1A 1T4BA 3D64A 4W7HA 4RF2A 1Z7EA 3MZ0A 5TJHA 5ITVA 5JDIA 4NFHA 2C82A 4G5HA 2W8ZA 1HYGA 4BNJA 4EDFA 1X15A 4CQMB 2D5AA 2DLDA 4U7WA 3INGA 2BLLA 3RBZA 3AI1A 1T2CA 3HFSA 3ASUA 4TRNA 1KY4A 1DIHA 2PKQP 1E5LA 4J16A 1UP6A 3PQFA 2ZB3A 2X5KO 3WLFA 4E12A 2NNLD 5C7LO 1EQUA 1E1LA 1U8FO 4J7XA 5TT1A 2VNAA 4J9UE 2AMFA 2OL4A 4CMIA 1Q7GA 1ISGA 4J49A 3TPCA 3D7LA 2BKAA 1Q0QA 1NXQA 5EESA 1NTOA 1P1JA 5F1OA 5T6BA 2Q1UA 3IP1A 1XELA 4R4JA 1IULA 1YH3A 1KVQA 2JAPA 4CM7A 4PFJA 1NVTA 4MP6A 2B37A 5JW6A 3IL2A 5G0UA 1ZMOA 5G4LA 4MIYA 4YEDA 2JFHA 3Q6IA 2CF6A 3DZHA 4KQXA 4B3JA 3VHRA 1G0NA 4YXFA 3RASA 4RDIA 4DYVA 3M1LA 6LDHA 5JSFA 3GDFA 3QE3A 3JQBA 3FSRA 4YT2A 5C7OO 3ZH2A 1DIBA 2FRDA 3KUXA 4UUOA 1D4FA 4NK4A 4B7XA 1DO8A 2QW8A 1I32A 1GZ4A 2NQ8A 4NI5A 4YJGA 1GY8A 2B0JA 3I9MA 4IDBA 4NBVA 5EERA 2C7GA 4LVUA 1GEEA 2C7VA 1YS4A 4MJLA 3LK7A 2VOEA 4ZVVA 3VTZA 4NR0A 4P8RA 5LDHA 4FDAA 2VTDA 2PV7A 4TRJA 2JCYA 1W4ZA 4BNTA 3FR8A 1X13A 3DOJA 4J4TA 5GZ6A 2HK7A 3ZW9A 1KC1A 2FR8A 5G4KB 3BXXA 5ENVA 5TC4A 4BO6A 4BV8A 3TF5A 1EFLA 1E7MA 4RQTA 4UVGA 3UCFA 4M54A 1E0DA 1GUZA 3AI3A 3EAGA 4NFSA 4BNGA 5TRTA 4S3MA 4ID9A 5JS6A 5KWEA 4WKGA 3A28A 4OL9A 4MVJH 2CUKA 1BXGA 4NG5A 3TSCA 3GAFA 3PYXA 3JD2A 4GAEA 1UUFA 4QO8A 4FJ2A 2PKRA 4B4OA 1QYWA 4TZKA 4DPKA 3WGOA 1DFGA 3GEMA 2C2XA 3ST7A 3ZWPA 3B70A 1M6HA 2LDXA 3PDUA 3ZZNA 1HE3A 1HZJA 3VZQA 4CM8A 4CR6A 1BMDA 5IZ4A 3FNEA 1R4MB 4YT4A 5B4UA 2GZ2A 2Q2QA 2YV3A 5FFFA 3KBOA 2HMSA 1XWFA 3RWBA 1PS9A 1XKQA 3GRPA 1VE9A 5ILOA 1PR3A 3GDGA 3PK0A 5CEJA 3VH4A 3WDSA 3K8ZA 4L8VA 5TLSA 4KTVE 3JQGA 2GERA 1CF2O 1LLQA 3WJAA 1OC4A 1ORRA 2NU7A 3UXYA 3MJCA 4UREA 1HWYA 2W98A 1X7HA 3DBVO 3RFXA 4RVSA 2DT5A 1HDXA 2XOXA 2GNAA 4M89A 3NX4A 3R3JA 4RF5A 4EJ0A 4B7UA 1ENZA 2CVZA 4WPGA 4O6VA 5L4SA 2NVUB 4GI2A 4J1NA 3KLPX 3RUEA 3U62A 3ON5A 1LDEA 1AXEA 3BMNB 1W8DA 3RUDA 3KB6A 4RF4A 3TL3A 3VVCA 3EZYA 3WQSB 2O7SA 4E2YA 4XGNA 1GYQA 1VM6A 3H65A 3OA2A 3AUAA 3OQBA 4HADA 1E3LA 3JQCA 4BNHA 3LF1A 1N8KA 2X23A 5C37A 3LZ6A 4R51A 2PK3A 2Q49A 3PPIA 2RHRA 2X7HA 3FNHA 4UVDA 4WK6A 5BNFA 1J5PA 4OXKA 5JC8A 1VL8A 3ZNNA 4CMKA 5CAEA 1HXHA 3JQ8B 4EUEA 5JAZA 3ITKA 1VJTA 1TT7A 4OHUA 1CWUA 1HDOA 5GZ1A 5F5NA 1U3UA 1CQIA 4LRSB 1R0KA 1GFSA 2C5EA 4E6PA 1NHGA 1WNTA 2G1UA 3DFUA 3OQ1A 3PQDA 4GWGA 3TFOA 4KMSA 3VH3A 3T4EA 1VJ1A 5TIIA 2H63A 1YOVA 4IY1A 4R54A 1ZEJA 3OHSX 2B5VA 5BT9A 3JSAA 1Z6ZA 4GLOA 3GR6A 1K0UA 3PWKA 1GV0A 4Z0PA 4YYZA 3FTNA 1DSSG 4AJ2A 4OQYA 3JD0A 1Z73A 5COQA 3HWRA 4FOSA 3E82A 1GTMA 3ANMA 1I5RA 3VKUA 2I5PO 5TT0A 5J23A 3RI3A 2XPCA 1FMCA 4Y67A 5A02A 3ZU5A 3OIFA 3QVSA 2GYYA 1AE1A 3NAQA 3ONFA 1ZK4A 3OQ6A 2BFAA 2D59A 3OM9A 1KBZA 4OM8A 4K6CA 3AM5A 1UJMA 2NTNA 1AGNA 3E9MA 4TZTA 2FPIA 1ISMA 2BFOA 5ER6A 4C7JA 3SEFA 2BF7A 4UVHA 2VHYA 1X1TA 1ZO8A 1S6YA 1PTJA 5CDYA 1GYRA 1W6UA 3JQ7A 2POQX 3NDIA 5IF3A 4GVXA 4DQUA 5L53A 4OJNA 1I3MA 5JMWA 1NQTA 4BVAA 1X1EA 2VRCA 4Y8VA 5DOVA 3HUDA 1J49A 3Q11A 1T4DA 2GZ3A 1NPTO 2OUIA 4F45A 2PLAA 2A4KA 3F4BA 2G76A 4CMJA 5L45A 2EV9A 1LQTA 2WE7A 2I6TA 4BO7A 3CINA 4GLLA 3VTFA 5KKAA 3WGQA 3VZRA 4YAIA 3HDHA 1LRLA 2P9CA 4KOAA 1PJSA 2X5JO 4QSMA 2CDCA 2Y05A 3K92A 4LCJA 1Y9EA 3AUUA 3ENKA 3PGJA 3WWZA 4HXYA 3H3FA 4BV9A 1D8AA 1YQGA 4RZIA 4ALMA 4TSKA 4JJFA 4JJIA 5G0SA 2EW2A 4PLZA 4ZHSA 2VHVA 3ZV4A 1GZ3A 3RJ5A 1G0OA 4E2XA 4KUHA 4GSLA 4OXNA 4IS2A 3WGTA 5L7WA 2W2KA 3RKRA 4ND2A 2PGJA 4A10A 3ITDA 1MP0A 2F1KA 1DLIA 3NTOA 1Q7BA 3IUSA 4UVIA 3RFVA 1LC3A 5DP1A 1HKUA 4K26A 4A5OA 2ILTA 1RM0A 2P5UA 1EEHA 4BMVA 1LBEA 3OEYA 5L4LA 5A1TA 2Y93A 1QYVA 1YL7A 3IMFA 4NBRA 5B4VA 4E2ZA 3BYZA 1SO8A 2HDHA 1E1MA 5AXBA 3GVCA 3C3XA 2Q2VA 3A9WA 3I3OA 3JD1A 1PZEA 2ZTUA 3M1AA 5DT9A 1PQPA 2O4UX 3WFIA 2VOJA 4QUKA 3ZWVA 5BNTA 4MVJE 5LDGA 1NAIA 5DF1A 4EUHA 2JD0A 3B1JA 3V2UA 3KYCB 4J7UA 2X22A 4LCEA 1HDZA 2VUUA 3RIHA 1PS8A 4IQGA 1X0XA 3PWZA 1ZXLA 1DC6A 3WNQA 4A26A 2VRCD 2V6FA 4BMSA 1H0KA 3B1KA 4AJ1A 3DTTA 1A4UA 1I10A 4JBGA 3M2PA 3QVOA 1I2CA 5L7TA 5DCUA 3SC4A 3V1UA 4AJNA 2YYYA 1ONOA 5B37A 1IL0A 3CE6A 2YFHA 3NT2A 2O3JA 4H15A 3MJEA 4ZQGA 1C0LA 4BO0A 1DC4A 1PZFA 3JV7A 5JCXA 5H82A 1ZSYA 5JMPA 4ZQEA 3I9NA 1B7GO 4Z0HO 4EITA 3QIVA 3WTCA 1O0SA 4Y98A 3LT0A 4CL3A 4L4SA 2O48X 3DZIA 3F1LA 1DXYA 4L73A 3JQDA 3L6DA 4DUPA 1YL5A 4FFOA 4J2HA 3M6IA 4BNIA 5HTOA 3S1LA 1Z82A 4BNYA 1E7SA 4FBGA 1E7RA 1PWZA 4MVJG 3NJ4A 2DM6A 2PZKA 2FR0A 2HK8A 3KLMX 3DZKA 1Z74A 4XYBA 1LQUA 4I1IA 1YB1A 3A4VA 4IDDA 4YRAA 1Y6JA 1H93A 4MINA 4YAEA 1GEGA 3RFTA 4DC1A 4PLTA 4XQCA 4BKQA 3U4IA 4W4TA 5CEEA 3WLEA 2VYVA 4DLAA 1BXKA 1QRRA 7MDHA 3WGHA 1SAYA 1SPXA 3OIDA 3PRJA 5EMHA 2HMUA 3AJRA 3PVZA 1E6EA 1KIFA 3ZWXA 5BSEA 2OBNA 1FDVA 3T7CA 4IIVA 5DBFA 3DTYA 2J5KA 2I76A 2Q1TA 1CEQA 2WYVA 2HKIA 2JCXA 2WD7B 3CH6A 3FNFA 4W9NA 1FDUA 4PLVA 2D0IA 3IKVA 1LSSA 4ZU3A 4BUCA 2ZYGA 1Q1NA 4CM4B 4OSPA 2Y0DA 1FXSA 3I23A 1P33A 1ZIDA 3GY0A 3NEPX 4L74A 4FB5A 3IJPA 3GRKA 4IINA 1CETA 3JQFC 7ADHA 3HJAA 2BI8A 3SJ7A 1BVRA 1ONPA 3WWYA 1LU9A 2X4GA 4QX6A 1R4MA 4IZHA 3MJVA 3TN7A 1WMAA 1V3TA 3E1KA 3EVNA 3PZBA 4D46A 4E2WA 2AXQA 1I24A 1UXGA 1FDWA 3KTDA 3MCVA 1CERA 2WYWA 1V3UA 4A2CA 4NJOA 5EQDA 3AOEC 3VZPA 2Q4EA 1HT0A 3G3EA 2J3JA 4N5NA 2ZATA 1JA9A 3A14A 1ULUA 2HMWA 2FSVA 4XYEA 5MGBA 4XGKA 2P68A 3JYNA 3JTMA 3GGOA 3U3XA 3WIEA 1PR9A 3ZV5A 2BI7A 9LDBA 5JAIA 9LDTA 1JKJA 4O59O 2GDZA 1E3JA 2Q4BA 3OJEA 1K6IA 2J6IA 4IDAA 4CMBA 4B4VA 3VPHA 1IZ9A 1QYXA 3BMNA 3I83A 4XA8A 2EKLA 4CLXA 5IFLA 4JK3A 2DUWA 2YFQA 4NMHA 1YXMA 1LSUA 1LDMA 3N7UA 1RM3A 4Q9NA 1ADGA 3ZCXA 3JQFA 3JD3A 2Y0CA 2JFGA 4L75A 3RC7A 4NBTA 1DC5A 4F3YA 4ZQBA 3D4OA 5A9TA 1GQ2A 2D3TA 3KSUA 5A5FA 4UEOA 1PJQA 2JJYA 3EMKA 2PGDA 3I52A 4FC6A 4R68A 4UVEA 4J91A 1ISHA 4WGGA 5T8KC 3AOEA 4TRRA 1BXZA 1K3TA 4EEXA 3RUAA 3GFBA 3LLSA 1BTOA 2UDPA 3HADA 1A27A 2GN8A 4CV1A 4YBZA 1ENYA 3GZNB 4OAQA 3Q9NA 4IM7A 1A4IA 1D1TA 3NT5A 4MP8A 1UXIA 3WMWA 5JXWA 1XIVA 2FR1A 1JAYA 1U4SA 1YDWA 3DHEA 2NACA 4AVYA 1XU7A 2D1YA 3MOGA 3PHLA 4F46A 3PP8A 4DVJA 5IDYA 4WLVA 5KJFA 4WCDA 3PXXA 2DTDA 5KJCA 2IYOA 2NUAA 3TRIA 4D3SA 1WDLA 1PEDA 1IYZA 2YV1A 3DMYA 1K5HA 1JAXA 2JKVA 3D0OA 4J90A 2I3GA 3WBFA 3L9WA 1ISFA 1P1FA 4PIVA 3OEWA 2Y1FA 1TI7A 3TWOA 3C1OA 3UCXA 3QV1A 4JN6B 5IN5A 4AJ4A 1XQ6A 2O3RA 4BHTA 5CG1A 2IZZA 4RPJA 3ROKA 4XRGA 4MO2A 3L4BC 2EJWA 1QV7A 5A3JA 1DJNA 3OH8A 1HE4A 3ADPA 2R6JA 3BAZA 3IC5A 2A9FA 2X0IA 2Y99A 2Q46A 5T8KA 1O5IA 3VAZA 3DO5A 4WCFC 6ADHA 1DHTA 1B0AA 1YBVA 2B36A 1YL6A 3P2YA 1ML3A 1V3VA 2Y1EA 1R15A 3O9ZA 5I9NA 5A04A 1MG0A 3SBOA 3TZQA 4JXKA 3RBXA 1H2HA 1M75A 1VSVA 2I65A 3WG9A 1TT5B 1QSGA 1H5QA 4XYLA 4U0JA 1ZVMA 4IUYA 4R5MA 2WD8A 3ETDA 1GL3A 2PD3A 2VTEA 4AJEA 5JY6A 2AQHA 2HJSA 2WE8A 5HA5A 1VC2A 4PLWA 4OYRA 1GPDG 5KVCA 1MXFA 3KRTA 4MOWA 2V6GA 5THKA 2YV2A 4FJ1A 2FP4A 1LI4A 3JQBC 5IXSA 4ZD6A 2J3IA 4B3HA 3RUHA 3S2FA 2H5LA 5GY7A 4CR7A 1BRMA 1HLPA 4XGIA 1UXJA 4LGVA 4R3NA 5G2OA 1E7WA 3L0DA 4IDFA 1Q7CA 3WYCA 2EKPA 3L4BA 5T64A 1GADO 4TROA 2QYSA 4CLRB 4Z3KA 4B79A 4BKPA 1N1GA 5KNLA 1NFRA 2VUSA 3PJDA 3H9GA 4W82A 3T4XA 1U7TA 3H8VA 4Q39A 4FD3A 3H7AA 4WCFA 3JQAB 2PH5A 3TZCA 4PG6A 4ZRMA 3HHPA 1P0FA 3P19A 3MEQA 5TSDA 3PHJA 3HNPA 1GUYA 4MIOA 2O2SA 1T2DA 3GGGA 3FNGA 4FFMA 3UW3A 4BO3A 3AU9A 1SZJG 4ZQFA 3NGLA 3LC2O 1A7AA 3OP4A 4U5QA 4YWJA 3PTZA 3K30A 4PG7A 1GCUA 1SOVA 1Q2XA 5LCXA 3ONDA 2I67A 4M86A 1BW9A 3WB9A 4WJZA 4UEJA 4YQYA 1MC4A 1PQUA 4N5MA 1A9ZA 3ZWCA 1H6CA 3I6QA 2BHLA 4W99A 5JYEA 4FFNA 4NDNE 2CD9A 3GAZA 3QJ5A 2A35A 1XR3A 4PRLA 5FI5A 4LRTB 3KYCA 3MOIA 4DXHA 3OMLA 1Y5RA 4AFNA 3ORFA 4RGBA 1PGJA 4EUFA 1MA0A 2X0NA 2Y67A 4R16A 4BNFA 2BGLA 4MP3A 1B16A 4HNHA 1WP4A 4Q3AA 5A5EA 2EIHA 1AHHA 3H3JA 1U9JA 4IGFA 3ZWYA 2QRJA 5AQ1A 1E7YA 3OSUA 1KVSA 4CR8A 4NHEA 1EVIA 4FGWA 4PVDA 3ROMA 2HAEA 3UHAA 4TRMA 2EHDA 3H4VA 3WMXA 3R3SA 1BDMA 1C1XB 1WVGA 2ZK7A 3NTRA 4HFNA 4YJFB 3DOOA 1OFGA 1N1EA 3D3WA 1SEVA 3LDHA 2OGUA 3WICA 2C5AA 1EDOA 4AJIA 2O23A 2DBVO 4ND1A 5F21A 4D43A 1L1FA 4EZBA 4NU5A 3FPCA 4IBOA 1E3EA 4GGOA 1GZ6A 1ZJZA 3PJGA 5F5LA 1MLDA 3K2BA 4PRKA 2O3QA 1DRWA 3I5MA 4QO7A 4DC0A 3MWEB 3G0OA 5KCZA 2WTBA 3CIFA 2UAGA 2O3TA 4I08A 1YBAA 2H9IA 5I7SA 2HMVA 1YB5A 4N18A 1LTHR 3FN4A 1HE2A 3GVXA 4JX8A 1YE3A 1ZSNA 1L7EA 3I9JA 4JNKA 3UF0A 3Q0EA 1IZ0A 4XD2A 2E48A 4I9NA 1YDEA 2C2YA 3GNSA 3JQ6A 3VPXA 3I6IA 3IUPA 3TOXA 4ALNA 3KETA 5COBA 1XA0A 5CDSA 1YKFA 3F6YA 3W4JA 4D3FA 4YCAA 1ZXBA 1ZCJA 1A5ZA 2IZ1A 5G0TA 4GKVA 3KXDA 1CRWG 2W2LA 2CDBA 4FJ0A 5TJ9A 5K0ZA 2EGGA 5F1KA 4YT8A 2RIRA 3CPSA 3L07A 2DPHA 1U7HA 1IHXA 1C0KA 5AYVA 4DMLA 1KY5A 1NAHA 3C1TA 4U8GA 4BNNA 1UAYA 2CZCA 2NM0A 4QECA 4Z9XA 1I33A 5EINA 4QEDA 4JROA 4OIMA 3IIEA 1XQ1A 3IJRA 4Q3NA 1HE5A 4WNIA 3GVIA 4DIOA 1NHWA 2OXIA 4XQEA 3E5MA 3L6OO 4FPXA 3Q2IA 4ILKA 1IPEA 1B14A 4YAKA 4I9UA 2EKQA 4E5PA 1I3NA 5JO9A 4E30A 1JLLA 2UUOA 2BMAA 3GN1A 5L3ZA 5KVSA 1UDBA 4ZRNA 1R66A 2Y68A 4BQPA 1LEHA 1U5AA 2J3HA 1F14A 1SCUA 3AY7A 1O9BA 1TXGA 4NBWA 1Z7BA 2AQKA 4TKLA 4YT5A 1N7HA 3G1UA 3F3SA 2A94A 1I01A 4OGWA 4I8XA 3VH2A 1PGPA 4DBVO 3AWDA 3BMOB 5JY1A 4G2NA 2AEJA 3KEQA 5IN4A 4DBZA 1HDYA 5DOZA 3P7MA 4R1UA 3H2SA 1R0SA 4OXYA 2OORA 2Q1SA 2Y1OA 3PDJA 4LMPA 2NLOA 5EQFA 2RH4A 2UUPA 4XR9A 3ZN2A 1DIRA 3GZ4A 5L95A 4TWRA 3ZNOA 2W2LD 3H5NA 1CJCA 2OOSA 1WAMA 3K9QO 3ZWMA 3ETEA 2IXBA 1GDHA 2IYPA 3W6ZA 2GUGA 4PG4A 4R5HA 2AQIA 3OF2A 3PJFA 4J9VA 4CMHA 1E5QA 3CSDA 3ROQA 3VVBA 3GG2A 4E13A 1LRJA 4ZJUA 4B7CA 1MC5A 3PFFA 5JFOA 3WR5A 1PJCA 4P4GA 5TNXA 2R2GA 4D42A 4RF3A 3AY6A 1OC2A 3GC6A 4UUMA 1HSOA 4GPD1 1C0PA 3NUGA 3GZNA 4ALJA 3BIOA 2DUUA 5EN4A 4RCVA 4I5EA 4OMUA 1L7DA 3AY3A 3S2GA 1RYEA 1Z75A 3P2OA 1P1RA 4QQRA 5EIOA 4BO1A 1CQJA 1FF9A 1Y8RB 1ZEMA 4U6SA 3V2GA 2VWHA 5ILGA 4CUJA 1U2GA 1I36A 3OJLA 3ZI0A 1BGVA 4GMGA 3QVWA 3DXFA 4JP2A 1XGKA 3PIIA 1E92A 4CM1A 1A71A 1OZAA 4O1MA 4BNKA 2P4QA 1D7OA 2VRBA 1H94A 2ZJ1A 1NVGA 1Z45A 2QYTA 1AHIA 2WMDA 2DFDA 1NASA 1U8XX 4BO9A 5CFZA 4BNWA 2AA3A 2CNBA 4WLUA 4L4XA 4LSWA 4CQLB 3GNTA 4ESOA 3GDOA 3S55A 5GMOA 2C20A 2ZCUA 4NNJA 2GZ1A 2CVQA 1UH5A 1RM4A 1DPGA 2RBEA 2V6BA 3BHIA 4MKZA 3GUCA 1UAGA 1NX6A 3PEFA 5JCJA 2PR2A 1QMGA 3AI2A 5HM8A 4HBGA 4NQZA 1NM5A 3GMSA 4IZIA 5C3MA 3O38A 4KUGA 3HSKA 3KEOA 1PU2A 4ZQHA 5B1YA 1IHYA 2E6UX 3GNQA 2GN6A 4TVBA 4GH5A 4L4RA 5L40A 1MFPA 4E5NA 3E9QA 3PHIA 4N5LA 5L4NA 1TT5A 4UAGA 1D1SA 4DREA 4MKRA 3LLVA 4AJKA 1SEPA 3QWAA 1O8CA 1B8VA 1NWHA 3U4DA 5KVVA 4E5MA 2GD1O 1A72A 5BR7A 5A9SB 3GHYA 3IP3A 3KSDO 3AW9A 2YQ5A 3CMCO 1F8FA 4Q3BA 1WLYA 4C4OA 4NBUA 2VN8A 4CV3A 5I7VA 1QYCA 4E31A 3IAHA 3INTA 3ANLA 4JIGA 3DAGA 1P0CA 1HZZA 3W1VA 1P1IA 4CQMA 1MXHA 3QVTA 2HMTA 1I2BA 2HO5A 4IDGA 2X86A 4CPDA 4YACA 3ZV3A 2G5CA 2Q45A 5IG2A 2NVWA 2E4AA 2WSBA 3I4CA 3HN7A 3E18A 4KZPA 1TEHA 5KVQA 1CDOA 5BNIA 1EE9A 2V6MA 1E6UA 1X7GA 4GMFA 1NPDA 3PWSA 3DZJA 4J1QA 4TMFA 1JQBA 3W6UA 3F47A 3B1FA 4Y9DA 1VJ0A 2OFPA 1JVBA 5I9LA 4FN4A 3H9EO 1ISJA 1E77A 3DONA 4CV0A 1CIVA 2O50A 4XJTA 3JQAA 4R3WA 3OICA 4II3A 2PD6A 2TMDA 4CM5A 3Q9UA 5DZSA 5KJ6A 1MUUA 3EZLA 2BRUA 1DFHA 2A92A 3MWDB 3FCOA 3DDNA 3ZW8A 1F12A 2AG8A 5JCJD 1ADFA 1WMBA 3DBRB 1Y81A 4LN1A 2PTGA 2SCUA 3F9IA 4KDFA 2E37A 1E1KA 3HG7A 3JCZA 4W9NC 1U1IA 1YQXA 3SLGA 2EJVA 4RPGA 4YJGB 5K9ZA 3W8DA 5CDUA 2OBYA 2PD4A 1JKIA 2OP0A 1DOHA 1LDNA 3PYMA 4DIFA 4WE3A 3RC2A 3FTPA 4GX2A 4OOFA 5T67A 4RVHA 3WQRA 1H6AA 5JYDA 5DBIA 2AW5A 3W4KA 4JQCA 1LSOA 3CXRA 4KDEA 2EXXA 4Q3DA 1ZW1A 2O3SA 2X6TA 5AOVA 4E0BA 1JTVA 1KEPA 4YJFA 1C1XA 2PGLA 4CLHA 4R69A 2I99A 2Q2WA 4CLOB 1IE3A 1B26A 5KKCA 1K6JA 2BFPA 2J8ZA 3AUSA 3TL2A 5CPBA 5H81A 4IJKA 1T2EA 4BNLA 4CQMD 4GX5A 4DMMA 4LVCA 2ET6A 3ZWNA 1LX6A 1GV1A 3V2HA 2DKNA 3DWFA 1P1HA 3G17A 3KVOA 3U0BA 3GN2A 5G4KA 4R9SA 2XXJA 1LDYA 1LRKA 3A06A 3AFMA 4WLOA 4XCVA 5DNAA 4LMRA 4RV9A 3MJSA 4IGEA 3ASVA 1H9BA 2VHWA 4E32A 2GLXA 1EUCA 3JYLA 1QYDA 4WEQA 1XHLA 1Q0HA 3SLKA 1MB4A 4A7PA 4ND4A 5KJEA 1R0LA 5IJZA 1VI2A 4TKMA 4RVUA 3JQAD 3BTSA 2WDZA 3E8XA 1NFFA 3E6AA 3NRCA 4GKBA 4XX0A 1VLLA 5AVOA 5IAAA 1PZGA 4Z3DA 4WLFA 2YHIB 1HLDA 1LXCA 2NV6A 3RU7A 3DAPA 3HDQA 2PKQO 1F06A 1EUDA 2TMGA 3ZWBA 3QQPA 4W6ZA 3WIDA 3SX2A 2HCTA 4BO4A 4A27A 2GSDA 2X9VA 3KHUA 4RVDA 3ZWWA 3FHLA 5ENDA 1GU7A 1HSZA 1I3KA 2OHXA 1TB4A 2GGSA 3GHHA 4PGFA 2B83A 3RD5A 4ALLA 5BSFA 4FSHA 3I1JA 4QT0A 4NH4A 4GX0A 2DQ4A 4PLCA 4CM3A 4FR5A 2JFFA 3CUKA 4WOJA 3DZBA 1N9GB 2QIOA 1WPQA 3KV3O 4FS3A 2O2YA 3LT4A 1KVRA 3ADOA 4L9RA 1M76A 1WWKA 3E03A 1SOWA 2LDBA 1ZJYA 4JGBA 4RLHA 2DTXA 3QY9A 4BIIA 4RZHA 4D41A 2FPGA 4CMAA 1ZZEA 2NVUA 1OI7A 2VHXA 5KIAA 3O03A 5A03A 3F5QA 4RL6A 1HRDA 5K6AC 4PG8A 3NJ8A 3ZNPA 3ZU3A 2VYVD 3ANNA 1GQYA 2X9GA 3RVDA 4BNMA 1F17A 2NWQA 4FGSA 3S8MA 1YJ8A 1JU9A 1FK8A 3IDSA 4S1VA 2Y1GA 2Y1CA 5I7EA 1JWBB 5U4QA 1WZIA 2ZCVA 1DIGA 1LUAA 2VUTA 4JBHA 4BKOA 4DTIA 3B6ZA 4IQ8A 2ZJ0A 4XWYA 4HY3A 1V9LA 4EJMA 2VHZA 3PLNA 4CLEA 2P9EA 3WYEA 2JHFA 1DC3A 1YRLA 3JQ8A 1YOVB 3ROPA 1H9AA 3K96A 3QWFA 1PJ4A 2FN7A 5HRUA 2DBQA 5FI3A 3CZMA 2FSSA 2EG9A 1R4NB 5B12A 3MTJA 4ZA2A 4ND5A 5JAQA 3BTVA 3D3EA 4IXTA 5F3RA 2IEBA 3GF4A 1MFZA 3WTBA 4BO5A 2G82A 3NDRA 2GR9A 3NV9A 1QLJA 3TQHA 3L4SO 1YO6A 4BNVA 2CFCA 4IQ0A 2WM3A 3O26A 2VYNA 3HDJA 3GUYA 3QWIA 2DU8A 1A7KA 2DTEA 5CEFA 4QXMA 2DAPA 2I3AA 2P91A 2EERA 3IOYA 3JYPA 3EK2A 3KYDB 5K6AA 2AG5A 4J3FA 3DZFA 4IJUA 3LYLA 4OOEA 2I66A 2X1HA 3GFGA 4NFYA 2PA3A 4FW8A 1KVTA 3D5QA 5GZ3A 3K31A 1EQ2A 1FDTA 1I3LA 1U3WA 1QP8A 5I7FA 4J6FA 3C7AA 3KYBA 5HWSA 4RLSA 1DRUA 1HL3A 2C0CA 5IZCC 1XCBA 5F1PA 4MDHA 2I9PA 1JWAB 4B8ZA 2Z1MA 1DAPA 3ENNA 3JQ7B 4UUPA 3BZUA 3H5AA 5ER9A 3SC6A 2BGMA 1KC3A 2YQ4A 3ICCA 3IKTA 4IIUA 2NVBA 4BKRA 2PNFA 3Q1LA 4PZDA 3C85A 4YDRA 4AJHA 4MIEA 5ICSA 1OBFO 3G1TA 3FR7A 2YDXA 2XXBA 5HBRA 4B8WA 4G81A 1Y8RA 1EZ4A 4BKUA 1P45A 2IE0A 4EBFA 5TS3A 3ZHXA 3OBBA 4ROSA 1T26A 1KEUA 4GBJA 2W90A 1YWGO 3U49A 2B5WA 1HDCA 3WGIA 1QORA 1DDOA 5JE8A 4II2A 1LLCA 3G49A 5L9AA 3N58A 1PSDA 2JHGA 4XJSA 2EP5A 1O6ZA 2ZKLA 4X54A 4GQAA 4CQLA 4UEKA 1QG6A 2ZIZA 4MPDA 4J0EA 3ZU2A 1R37A 1XDWA 4RPLA 3RUIA 2PZMA 1MV8A 3H9QA 4Z0TA 3AK4A 3TFQA 5EJ2A 1BSVA 4J4BA 2VWGA 4K6FA 2NADA 2AHRA 2VT2A 1EMDA 1LLDA 2VYND 3EYWA 3LT1A 2W2KB 4LISA 1ENPA 1HEUA 2XF8A 5DBGA 2CF5A 2IDZA 5IZCA 1QLHA 1U3VA 1H6BA 1T24A 3DHYA 5B4TA 3FI9A 4BL5A 1MGOA 1IPFA 1UP4A 2UV8A 5DULA 3LF2A 3EUWA 3K2EA 1BWSA 4AL4A 4F6CA 2GO1A 3VZSA 3WXBA 3DFZA 3UH1A 4KP7A 4A03A 1Y8QB 4R1SA 4YB8A 5G0WA 1O95A 3C7CB 2C29D 4B4UA 4IDCA 4YJHB 3GGPA 2JD2A 4D0RA 3NDJA 5A9SA 3FWNA 2D2IA 1NR7A 4FFLA 2GASA 5IXYA 5KTKA 3BMCB 4CUKA 5AXCA 4LSMA 3DQPA 3DZGA 2VT3A 4KWHA 1AXGA 4L76A 1X14A 4OKNA 2O3UA 3IQDB 4IJWA 2AE1A 4RVFA 4BB6A 2YY7A 5MDHA 4D44A 4BO8A 1E3IA 4Z9YA 4RPKA 5JC1A 2X8LA 1VKNA 4OO3A 4L0QA 4PZEA 4U6QA 2VQ3A 4WASA 1I8TA 1W0CA 1RPNA 3HFGA 5HS6A 3VPFA 1BDBA 3DAFA 1EBUA 4XR4A 3JYOA 4GX1A 3CZRA 2HSDA 4M49A 1JKFA 4PLYA 3F4LA 3GQVA 4D7AA 1P9LA 1SB9A 2NQTA 1RYDA 3AUTA 3PI7A 1W73A 3BHMA 3BA1A 3SXPA 3BHJA 1PGNA 1ONNA 3LVFO 3RCBA 2NSDA 4Y6SA 5A3VA 2FWMX 3EC7A 2ZYDA 3UKOA 3FBGA 3NKLA 3WS7A 3WGZA 2NU8A 1SC6A 2Y66A 4WLNA 5C5IA 2HLPA 4PN3A 3GA0A 4K9DA 3TZ6A 3GMDA 5TQVA 2FY8A 3DBRA 1PX0A 1LC0A 4DL9A 1Q0LA 1V35A 4BNXA 5JPIA 2EWMA 4P22A 4FC7A 3LU1A 3UN1A 3WSVA 1NVMB 4BS9A 2QZ9A 4CMCA 4CMEC 3FWZA 3OFSA 1ULSA 2FPPA 3P5SA 1A9YA 1Y1PA 1ADBA 3R6DA 5DDIP 1VL6A 1MX3A 3FD8A 4XDYA 4M87A 1MG5A 1PJLA 5CPFA 3HB4X 3RSHA 3V5NA 1E3WB 3HZZA 2R00C 1DAOA 3DOCA 4ONEA 1P31A 3E9NA 5DN9A 1GPJA 3DL2A 4HFRA 4J2OA 4QFDA 3GEGA 4UUNA 2IZ0A 1EVJA 1NNUA 1T2AA 1PL6A 2BD0A 2BGKA 1PQWA 2ZTMA 3SVTA 4RORA 5FWNA 1Y7TA 4O5OA 4R1NA 4CLOA 2Q99A 4NJMB 3GT0A 3MTGA 2V65A 3F1KA 5IDWA 1YVEI 2DBZA 2DFVA 1GQQA 3AM4A 4I5GA 3RC1A 4DRYA 4E3ZA 4H16A 2P4HX 1GD1O 4Q3EA 3VDQA 4DPLA 3I9LA 2WD7A 4JBIA 1ID1A 3BMQB 3W8FA 4D79A 3ONEA 1YB4A 4CMEA 4CV2A 1AUPA 4QTZA 1T2FA 2ZTVA 4CM4A 1E7QA 1TA4A 1NPYA 1IUKA 2B35A 2J3KA 2HRBA 4P38A 3TDKA 1I2ZA 4WECA 2YHIA 2V7PA 3ZHBA 3E48A 2DBRA 3ABIA 5TGDA 3EDMA 3V8BA 5TF4A 3VPGA 3ZHZA 2BELA 4R41A 2R00A 3PFWO 5ICMA 3SJUA 4DQVA 2AQ8A 3HN2A 1GAEO 3DBLB 3QVXA 3ZV6A 1ZH8A 1C1DB 1DIAA 3JD4A 1XSEA 3DHNA 1HYEA 2YW9A 3ZDFA 5C7IO 1GYPA 1EFKA 2X0JA 3RJ9A 2ZYAA 1DFIA 3L6EA 3WOHA 3ZGYA 4KUEA 4YAGA 4XQ9A 3ZU4A 1M67A 1U2DA 3L9XA 3AOGA 1X0VA 1VRWA 1NQ5A 4NU6A 3ZHYA 5CP8A 2PZLA 2QX7A 4RJTA 1ENOA 2Z95A 3WQQA 4PCVA 3WGYA 5BQFA 5HS4A 4R9RA 1N9GA 1C0IA 2WJPA 3O4RA 2E82A 1WXDA 3O8QB 4RVGA 1JVSA 3C8MA 3F5SA 1OOEA 4U0KA 4M55A 4A73A 1NQAO 4W7IA 4ZGWA 1B3BA 3RC9A 5KJ1A 4BMNA 4DLLA 5BSHA 4J4HA 4ND3A 1RWBA 5H83A 2VWPA 4HKTA 2IXAA 1LNQA 1LA2A 2H1SA 1EUZA 1J4AA 2WEKA 3CMMA 4ZN6A 3VKVA 4J7CA 4DPMA 5A4DA 3FBTA 4XRRA 4ALIA 4OH1A 2HQ1A 1VKOA 4TQGA 2Q1WA 5ES3A 1BHSA 1LLUA 3LQFA 4O0LA 1VL0A 4LW8A 4XKJA 1GCOA 4CM6A 4I5FA 2DVMA 4A0SA 4CJXA 1ZMTA 1P77A 1VPDA 1WDKA 3COSA 3LT2A 1H6DA 2IRWA 5L51A 1TVEA 2Q3EA 1PWXA 3G79A 2B4TO 1DBVO 4EI2A 4GSKA 1LDGA 1QR6A 4E33A 4Y6PA 5JO0A 2QHXA 3KZVA 3PGXA 4HFMA 4AJOA 1R4NA 1K6XA 4PLGA 3M2TA 3D4NA 4WUVA 1OMOA 3GPDG 2UVDA 4URFA 1E3SA 3PHHA 5FEUA 4J1SA 1N2SA 4XIJA 4CM9A 4DIBA 4FQ8A 5FF9A 4B4WA 4YRBA 1UXKA 1JW9B 1PJTA 3VC7A 5KOIA 5L7YA 4MVJM 2W4QA 2VZ9A 3KYDA 1NFQA 2OO5A 5DP2A 2OP1A 3ZWAA 2Z5LA 1PL8A 1YJQA 2H6EA 1QXSA 2IEDA 5AXDA 3S2IA 3DB2A 5I8ZA 3DEYX 4K28A 2X0RA 2Z1NA 4HUJA 1EE2A 3DMTC 3X2EA 4Y6RA 1IY8A 4XYMA 2CMDA 2CY0A 1I0ZA 2OZPA 3JQEA 2OMEA 1M6WA 3AFNA 1AN9A 1YGYA 3PIDA 3D4PA 3OECA 2RAFA 1BVUA 3WGGA 2PWZA 1IB6A 5EL0A 3AU8A 2CVOA 4JLWA 2YUTA 3I9OA 3IS3A 2PFGA 1G1AA 3DBHB 5DCYA 3NYWA 1EDZA 2PH3A 4NZ9A 1I30A 1KS9A 4XB2A 3UUWA 3ICPA 3WFJA 4DLBA 3HQ4O 2D5CA
chains in the Genus database with same CATH superfamily
1SQGA 2MHCA 3GXBA 3U3JA 5KPDA 3FKSA 2NX2A 3P0EA 5DH9A 1XLTC 3JQ9C 4IJVA 2JVKA 4MW6A 5C80A 3BJZA 4RQUA 5CM8B 3ZCUA 5LU8A 4CEJA 1I13A 1T3ZA 2QJOA 3MW8A 1IEWA 1TA0A 1Z7YA 4HLCA 3CBGA 4UNIA 3M3DA 2DH5A 1GZDA 2HIHA 4ROTA 5FOVA 2XUHA 2FP3A 4BOYA 2ON6A 3DEZA 3OZXA 1NNEA 1MKYA 1IN1A 3G0DA 5IWAB 2EP7A 1A3CA 3HE3A 2CDAA 3C3DA 4UE6A 1X80B 2I91A 1Q20A 1KTIA 4O8ZA 1W581 1NNLA 5CT5A 4KXMA 1FCJA 4JEHA 4RTOA 1LVGA 3ZY4A 2FYTA 3A1NA 4JQYA 4LDQA 3LSTA 2XA9A 4UNNA 1J00A 1LJ8A 1ZITA 2E49A 4J03A 1G20E 2FCRA 2HSWA 3C98A 4RK6A 2VDKB 3HFRA 4CM9D 1JEEA 2XMPA 5IHPA 4JL6A 3OIGA 4LYAA 2OYSA 5KYVA 2ZIVB 1W46A 3NASA 1JHXA 2P3LA 4NEGA 4PLPA 1U0RA 4WCFB 1YCFA 1EVZA 1Z33A 2WSLA 3TZHA 1U7ZA 3A9VA 5BO5A 3VH1A 1RXCA 5HPYB 1KAMA 3CCCA 2Q28A 3PNSA 1PD1A 4MS3A 4BB5A 4B3MB 4IFTA 1IPHA 4FCCA 1K97A 2IYNA 4X9XA 4CLDA 4M8NE 1DPFA 3W4IA 4AKTA 3M9WA 5AKZA 3ZE9A 2PKXA 1BW9B 2X2EA 1SUSA 3OMXA 4PGAA 3ZJYA 1T3HA 4C7KA 2ZB8A 4YJFA 1NZFA 2AWOA 1ISIA 4FOTA 1T25A 4BUZA 1OA0A 1CUHA 1SWVA 3LUDA 4LV5B 2VIIA 1B15A 4K9RA 5LZ4A 3KPVA 4W9MC 2UXBB 2DHDA 2NU9A 4NIMA 3FPAA 8AT1A 4IHJA 4CKEB 4QDKA 2XMBA 4H7HA 4CCAA 4QDJA 2ZE5A 1DQRA 1S3FA 2WIAA 4B33A 1P61B 3SKYA 1Y5MA 4JY7A 4RABA 5TE9A 3ZDYB 4UAUA 3SNKA 1SC3A 4ZICA 2QTTA 4KE9A 1Z62A 5DYWA 4DYDA 1T1RA 5ELXA 2CZQA 3BREA 4UD6A 3MHTA 1J6UA 2HJRA 1U0EA 4YRCA 2D13A 2ZQZA 5K01A 3GLFA 3ZZMA 2X4IA 3X2FA 3BWYA 3D3WB 2L0XA 3BXHA 3GH3A 4F4CA 1DS6A 4R01A 5BOSB 2X5OA 3IAEA 2BFDB 4Y2PA 4PS1A 1DEHA 5LQMA 1XNHA 3CVYA 1JEYA 2IW3A 1CY2A 3VNBA 3DR3A 5MN5A 3Q85A 2IODA 3AP1A 2H08A 1WV1A 2YIMA 3K72B 1JDJA 1XDBA 4N1AA 4OFXA 3TO5A 3KLBA 5A3QA 2B8TA 1RQGA 4HWSA 5F7ZA 1H2FA 4QUJA 2ZUUA 3AFOA 1E2EA 1UXHA 2B21A 3C5HA 2RCYA 3ET4A 5CW1A 2ONKA 1P44A 4DCOA 2X1MA 2H4ZA 1TJ3A 1VRCA 1DARA 2NXJA 4Y6QA 3SIXA 1MDFA 1YZUA 1MJNA 2GAJA 1F8GA 3C6KA 3D7SA 3N7AA 3NHZA 2MR6A 4G5SA 2R60A 1NI3A 1KQOA 3EQ2A 4HMOA 4JT8A 4UBJA 2ZJ6A 3EZGA 4E1VA 1NXOA 1UP7A 1SBYA 3M4XA 5B3JA 3UJBA 1UANA 5EG5A 5AVKA 3VDNB 3KJGA 4Y2GA 2FLWA 3DEHA 5FJIA 1W34A 2ADOA 3IULA 3HZOA 1OX5A 4LJLA 1DJOA 1SBZA 3JWHA 5BSGA 3GARA 4LBWA 2P41A 1EB9A 3IEXA 2G17A 2R1VB 1A8UA 2G9NA 5AUNB 5JS8A 4YJKA 2QTFA 4D4JA 2QAGA 2OGZA 3TYXA 4PSKA 5H9VA 3OJ0A 2IYFA 2W37A 3PQ4A 5B6JA 3U5TA 4EG0A 2YR0A 4JZKA 1MH9A 1PZHA 2C9OA 2FMUA 2PL3A 2Q5CA 2C0QA 1ZD4A 1W5TA 3M1IA 2IF2A 3M4NA 3HMQA 3KT6A 4O4IF 4GYYA 5TEWA 5JAHA 4JB0A 3JQGB 1XTZA 4CUZA 4UTVA 4ZTUB 1KZ6A 3O95A 3ACCA 4G36A 5EMNA 1C80A 2NU7B 2HF9A 1TVMA 1N92A 2NG1A 5FH9A 4H7KA 3E9ZA 2HA2A 4M9UA 4N54A 2FZEA 2NV0A 1YCDA 3OPYB 5HK8A 5JBIA 3HU5A 1JFFB 3CF4A 1P73A 3LDUA 4PLFA 1GKIA 4PWZA 5GIPE 3BILA 2XDWA 2D7DA 5CHEA 2QM7A 5KQSA 5HKOA 1QFXA 2ECKA 2WPDA 3TAHA 1J2YA 3V1MA 3GPIA 2D8AA 4FLFA 4FX5A 4MLPA 1ZOIA 2GF2A 3U2QA 1WKCA 4DWOA 4EUNA 2G4VA 4P4NA 5B1HA 2O7QA 3D7RA 4Q1VA 4Z5XA 1XWWA 4ZI7F 2H18A 3PU6A 5AW3A 1IK4A 1QGYA 4LXUA 3VBEA 2G8NA 2QMHA 3K2IA 1UKEA 2AT1A 2CSUA 1SB8A 2HWKA 3UWPA 2A5GA 5B2ZA 5KNDA 3AO0B 3WDLA 1NR5A 1ZZGA 1KYZA 5IAOA 2XAAA 1IMJA 3OOEA 1VTKA 3FTQA 4ENRA 1X3LA 3STWA 2AUMA 3U7QA 7REQB 2PWPA 2QUBA 2Y1DA 3LUBA 3I5UA 3OZVA 2XEXA 4KG7A 4QM7A 4C7OA 3MGBA 2DKOA 2XVZA 1RWMA 2W2NA 1U9IA 4RY8A 2PSDA 2HT1A 5E7IA 4BEBA 1XU9A 2A0WA 2A0XA 1I6MA 1OWNA 2G7MC 3T0GA 4BGVA 1X42A 3R41A 3P4YA 5EUQB 3NHWA 3CLTC 4WI1A 4KQ9A 1T0JB 5FR2A 2D5LA 4QG7A 1SVNA 4JQOA 1VIVA 4DS3A 4E5KA 2QMQA 3FF4A 3CJRA 1K89A 1T0BA 1RRVA 3TI7A 3K5PA 4I1SA 4WKBA 1MJ5A 4FIZA 5E9WA 3SE7A 1A98A 5C35A 1E2NA 2CHQA 3FOFC 1QPGA 4L5YA 2MSWA 1G16A 1FUKA 2WINI 4D98A 1E2MA 4BO2A 2IS1A 1MW9X 4JLVA 3KSZO 4BNUA 3CQ9A 4KC0A 5AUOB 3NHRA 4MR9B 2CXOA 2HRZA 1C3EA 2GVNA 2HV8A 1XEXB 3GRVA 2IDJA 4M1QA 4P36A 5DK6A 2P7IA 1HDRA 1NT2A 5LYJA 3TNLA 3VDMA 4BX3A 3T7SA 1D6NA 1Z5WA 4X00A 1O03A 4R1TA 3ZJ4A 3EBOA 3KKZA 4FMDB 5TB5A 4RKEA 3V1YA 1ND6A 4AF6A 1DO0A 4WOKA 2P6NA 3LC1O 2AVNA 1ZI9A 3CLRC 1E6WA 1S02A 3QI2A 4HH4A 3RRZA 2ADFA 3TKYA 4QFCA 5FNZA 1SMKA 2FEWB 4IHQA 5DPMA 3ED1A 2IS2A 1BS1A 1TAQA 1UM9A 1CF9A 1EVYA 3DDCA 3LWNA 4MVJI 3VDRA 4YMIA 1URPA 3GCDA 4EGJA 2QT0A 4N7RA 3TEJA 3PZRA 1D8TA 4MIKA 5MF6A 5FYDA 2O4CA 1E0JA 4PC1A 2FZWA 1X7DA 1UXOA 1Z22A 2D0DA 5ALUA 5FWXA 3SZ3A 2FJ0A 2ZE8A 3QUCA 3I4FA 1WZ2A 3N6RA 2CEAA 4XLZA 3QWHA 1HLFA 1DHRA 4MVJD 3OC0A 3OQIB 3RT9A 4DQ0A 2QRLA 3JAMA 2ZP1A 3WBBA 1XT6A 1YUNA 5ESWA 4KJXA 5IEBA 2SECE 3K73O 1W36C 2I3ZA 4TVOA 1NW9B 1L2TA 2NTVA 2XUQA 4TWAA 3TQSA 3CURA 4MUXA 4NL4H 4QXPA 3DOUA 4B4DA 3DGFC 1LX7A 4YMVA 1J2UA 1HF3A 2P2SA 3NBMA 5LMCA 4WD3A 3NVDA 1W1IA 3HDYA 3PFGA 3N2KA 2GMWA 1TF2A 1IAQA 4XVQA 1TAHA 3KPYA 5DCWA 4AMBA 2KYRA 3HVUA 5LP6A 4O2BF 1O6BA 2R85A 5J2UA 4NCNA 1QFSA 3TGLA 2ZTLA 3GP5A 4II7A 4MK4A 3RVBA 3DP7A 1XP5A 5ICGA 1EFRA 3KT3A 1DB3A 1YR2A 2IOQA 1AGRA 1L8QA 3QW2A 1A5SB 4PZCA 2WUGA 3ABZA 3B7WA 1XJCA 4ENPA 4JJ7A 1DAHA 1KJWA 1ZUNA 2P8SA 3EGDA 3HBAA 3HWWA 4XZ3A 2O2GA 2ZYSA 1W7AA 3NALA 3HWX1 3T5DA 2GCNA 3DJFA 5NULA 3UAGA 1SVLA 5DW0A 2QRNA 2Z2KA 4G0MA 2BUCA 1N2HA 1XMVA 4HNGA 4KVGA 1PBNA 2I54A 4LXHA 5FR1A 3H9JA 2JAWA 1IRXA 1BH2A 3BBPA 4NQRA 3JXEA 2XUDA 1OLXB 4Z7NB 2E87A 3FOWA 1AF7A 4QNRA 1W2HA 2YICA 3MBIA 1LPMA 1V11B 3QG1A 5ESRA 3W2FA 2OXTA 4EKNB 3GPLA 1HTBA 4R8MA 3SC2A 3GLGB 3E9CA 3ZUPA 4JQSA 4H17A 1IBSA 4W1QA 3TUJC 2JI9A 3W2IA 4D9FA 3PC3A 1DJQA 3VR5D 1ZUD1 5E2AA 2PS9A 2H4HA 1JI0A 5GOZA 1ZK1A 2IA5A 4KO4S 3LCCA 4ETNA 3DHVA 1CR4A 3FSGA 4BZQA 3MT9A 1Z7EA 3MZ0A 2PSFA 2XKBA 4B3RB 1WMSA 2C82A 4L5CA 1RKUA 2OCLA 2A8YA 1D7AA 1X92A 4OAOA 9ABPA 4Q9DA 1II8A 3HXTA 1HYGA 2C2ZA 4BNJA 4EDFA 5IKPA 5T7BA 3CLTD 1L5NA 3LP8A 1KHHA 4CQMB 2PJUA 1JQ3A 4U2FA 2G4LA 1U1GA 1M5UA 2XY4A 2WMNB 4GKJB 2PUGA 4J16A 4LYFA 5J59A 6YASA 3RU3A 2ZB3A 5E1DA 3DL4A 2DUMA 3D9QX 4G41A 4P3NA 3THYA 1U8FO 2F59A 4L7VA 3VV3A 2VNAA 4J9UE 3GLIA 3ZLVA 4ZYZA 2GLTA 1IN7A 2FXIA 2V4ZA 3AZOA 3IUJA 1W5AA 1FEZA 3D7LA 1ZNYA 1Q0QA 1L5RA 3HLTA 5E7QA 4LJ7A 3UBTA 4YP0A 4A8JA 2IXTA 1XELA 1XPOA 2V7VA 4R4JA 1YH3A 4H0NA 5FWAA 5I9BA 1DJPA 2ZWPA 4C87A 2L18A 1LVHA 2DFPA 3AUJB 3LL7A 3IE2A 5JADA 1KAGA 1E5VA 1L4BA 1L8XA 3L1HA 3PXUA 5HZMA 1T4MA 3FJOA 5G0UA 1P18A 5E6SA 4MKHA 1WDWB 2FHPA 1TK2A 4KQXA 4B3JA 1DINA 3RASA 1LZKA 2F4VB 1BQ4A 4ECAA 6LDHA 3T35A 2OM2A 1UODA 1AMOA 3ELWA 2ZUVA 3MLBA 1W93A 3HJUA 3KAJA 3DVAA 3A4TA 5TS2A 1NW8A 2PVCA 2ZVJA 1D4FA 4NK4A 2JIZA 4OHXA 5AVSA 5H8WA 3PNPA 1W36D 2H3HA 1B73A 1TYCA 1T9ZA 3M49A 4DHWA 1I32A 1GZ4A 3R6WA 3ELBA 3AB8A 3UKJA 4ZJZA 4X20A 3IIKA 4LFCB 1KF0A 5DNWA 2WF7A 4OQQA 2LCIA 1GEEA 4DT1A 1P8AA 3PD0A 1KEEA 1QE0A 1WUTA 3P2JA 3RSLA 1YS4A 3FCCA 3LK7A 4C7BA 5AJUA 4ND8A 2PIAA 4UCQA 5I7WA 2XRZA 3OUUA 3D43A 3LUFA 3VTZA 2O8EB 4HVTA 1XRNA 4JYMA 4ESHA 4REMA 5LDHA 1SG0A 3T38A 2VTDA 4TRJA 4YBRA 1W4ZA 3QBTA 3ESDA 4QQ8A 4NDZA 2C7QA 3OLWA 5L3QB 5LL6P 1YRYE 3FFXA 4J4TA 1M83A 1MABB 2H07A 3HVRA 3RYCA 2OUKA 2AMLA 1VKHA 1VDZA 3ZY6A 2O7NA 1WV0A 4GOLD 2FR8A 1T0IA 1SELA 3QKWA 1ZIOA 2D7CA 1ML4A 3BXXA 4L8GA 5LVAA 3E22A 1BRTA 1E7MA 3KJFA 4GI1A 2HR1A 4N03A 2OECA 4M38A 4TMWA 3AI3A 4D26A 4C6RA 4UTOA 4RS3A 2G7ZA 3DMFA 1BZYA 1XRQA 3JR7A 4XB6B 3ZHQA 3N5CA 3ANYB 4ED9A 3IUMA 2ECFA 4WKGA 5JS6A 2VZEA 1RRCA 3I30X 2GN1A 4UHJA 1W5FA 1XMJA 1U3GA 1RKVA 4NBLA 2CV2A 1Q15A 2H7CA 1BXGA 2XMQA 4JLNA 5DM0A 3NATA 2PPVA 4GAEA 1T36A 3VU9B 4MLZA 2KS6A 5J63A 3ZGXA 3GEMA 1CJBA 2YHSA 2C2XA 3FTCA 4GE3A 3ST7A 4D74A 4MRSA 3LJKA 3PDUA 1I5EA 1HZJA 3Q3EA 4XVUA 2P75A 5FV7A 4RZ2A 5IZ4A 3FNEA 3HKCB 1R4MB 4Q82A 4YT4A 3UHJA 1RQPA 5B4UA 4FHFA 2ACWA 3TCKA 2FQQA 1YS7A 3K9WA 3OJXA 5EHQA 2IL1A 2Q5LA 2R8OA 3KBOA 1XWFA 4DFDA 2VYFA 3FBWA 1V5EA 1ZQ9A 4YYEA 3TLKA 1VE9A 1MJGA 2LNDA 2OB2A 4UPDA 5DT2A 1G7SA 3ETCA 4DY6A 3VR6A 5CEJA 2QTCA 1KI1A 3E3AA 4L8VA 1AQNA 4CETA 1J0BA 1IY1A 3FDIA 4TTRA 1ES9A 3D1JA 5DHAA 1EX6A 4BB0A 4EENA 4Q3LA 4NICA 2W98A 3EAFA 3QKTA 3ZTWA 1ZM2A 4NYIR 5IC6A 4WFIA 2DT5A 1HDXA 1G291 2LUOA 3VDXA 1CUJA 4P31A 1V48A 3HFJA 3GJQA 2R8PA 1E1RD 3L7NA 4JUAA 4KQHA 5DTIA 5HVNA 1JG2A 3ESXA 3R3JA 4ECEA 1N1DA 4RF5A 3BGVA 1AV6A 4B7UA 1ENZA 4WPGA 2CJXA 3MCUA 4GW3A 1S4MA 2GK4A 4NCXA 4GI2A 3RUEA 1EUYA 5EWJB 3U62A 2XVMA 4WBXC 3IJEB 1LDEA 4QT4A 1AXEA 1V8PA 3BMNB 4RCZA 1MZPA 3AEUA 1OXXK 3VVCA 1BOFA 3PQ5A 2Y1KA 4LKRA 3THRA 3OOJA 2DZDA 3HP7A 5B36A 2PX8A 3O8DA 1U3CA 2QMZA 5DTJA 1GYQA 1R9MA 3H65A 4HNAB 2P6PA 3BL6A 3TLEA 1QOZA 3GBPA 3OA2A 3OQBA 1FW6A 3PB3A 2OD7A 4BNHA 1EX9A 2FMIA 5C37A 4YJ2B 4RFSA 4FUQA 5JH7F 2FZGA 3CG4A 1XHFA 1XC7A 4P92A 2RHRA 2X7HA 1Q12A 3FNHA 4R51A 1D0IA 4WK6A 1J5PA 1J1ZA 2FSGA 5BNFA 1ID8A 4OHKA 3U3KA 1WCV1 3LX6A 2ZUWA 4TKUB 1H23A 4Q9IA 4Z4QA 1U3FA 1HXHA 2ZQ5A 5TQ2A 4KR2A 1RJEA 3ITKA 1E66A 3GFPA 1TT7A 3ORHA 4OHUA 4YROA 3E5HA 2QLMA 4M0CA 3LYUA 3VI4B 1W75A 1ORTA 2B1IA 4O4JF 3M9LA 1IZYA 5JG7A 1GFSA 4E6PA 1D2HA 3LY9A 3VI3B 4TKVA 3DFUA 3TFOA 4CEHA 1WMFA 4GWGA 3UJNA 2ZITA 4HQOA 2OG1A 4P9NA 3AEQA 3VH3A 3KU4A 5KOJA 5FBZA 1VJ1A 4XCXA 2HZBA 3THWB 1YOVA 5JRJA 2B8WA 3OHSX 1FUEA 2UVPA 3GNLA 3JSAA 5K3CA 3OPYI 3DNPA 3MSCA 1GV0A 3U37A 4ZOQI 1IXRC 4E6EA 2GCPA 4AJ2A 2Y0BA 2ZT5A 4OQYA 1Z73A 1Y8AA 2JFYA 1UZAA 1JEQB 2HL6A 4FOSA 3S2UA 1AKRA 2XUOA 3ANMA 3EUFA 2XZLA 2GEBA 1FU8A 1EE1A 2XTAA 1C9JA 5AHKA 2PS0A 1S1CA 4XFJA 4O2RA 3A4NA 2NYUA 2M6RA 5FL7A 3UBMA 1ZAYA 3L46A 3K0SA 5CRIA 2FPKA 2PMFA 4QOIA 4Y67A 4DQDA 3ZU5A 2Z6QA 5ALNA 4C2BA 5CFOA 4HHEA 2SICE 2DECA 3UH0A 2V7WA 1AE1A 4AZSA 1MBZA 4K9KA 4WZAA 2ZJ5A 3ONFA 3P94A 3V1KA 3IXLA 1Z36A 2BFAA 2ZU0C 1G8YA 2Q3LA 2Z3ZA 4KMMA 3GLFE 2KLHA 1F60A 1L7VC 5DMHA 5HUHA 5JIBA 2NTNA 3DE6X 2VP6A 4OQMA 3V97A 3ILSA 2RJ3A 3JARA 1T0UA 3NS7A 4RIEA 5HGXA 2FEXA 2OHJA 1AF4A 3LPLA 1ZH0A 5D1HA 1E6CA 1PTJA 5KSYA 4RZQA 4ZOAA 2H1OA 2POQX 5IF3A 3A6FA 5GJCA 4KHPB 2P6MA 2WBLC 5JMWA 4DA7A 1B8NA 1T5SA 3H1FA 1X1EA 4BVAA 1SIBE 3HUDA 5DOVA 3UGTA 4OFBA 4RAOA 1L8AA 5GONA 2F90A 4M1MA 2PO7A 1SCQA 3F4BA 2G76A 2P4UA 3BSFA 1J1UA 4Y2VA 1Z8DA 3DUWA 2NUPA 1JTFA 1QHGA 3H4MA 1N3BA 3AJEA 4ODIA 3VTFA 1AKUA 4M4SA 3B36A 4MB0A 4RD3A 3Q5EA 4K9OA 4YAIA 3L4JA 3MGGA 3DYVA 4HAXA 2YY6A 3WISA 3EGEA 1CY7A 2BW0A 4GZ3A 1DKRA 3KQKA 3B78A 3WKCA 5JXIA 1TZ2A 1X8XA 1AG9A 2JGAA 2ADMA 3IAUA 3I5YA 2BKLA 2R87A 1D8AA 3T3HA 3UZUA 2FSPA 4ALMA 3ZYZA 1TE2A 3THXB 3K6RA 4EJSA 1TJ4A 5CXUA 2VHVA 3ZV4A 4AG6A 1T2VA 2ZJBA 4WNAB 1Y7PA 4E2XA 4WKNA 4GSLA 1Y1TA 4OXNA 5AK3A 1HEYA 5SYNA 5A4KA 4DA4A 2IWHA 2XWBF 3ITDA 1IDN1 3T3NA 1DLIA 1MOSA 2ODQA 4MV7A 5A03A 5F2OA 3IUSA 4CWAA 1DO2A 5FI1B 1LC3A 4F1KA 2A0UA 5DP1A 4XIFA 5BPFA 1W4CA 1RM0A 2P5UA 4BMVA 5LWHA 3FNBA 4XWOA 4FDMA 3SJBA 2CFRA 2PWYA 1QYVA 3O4JA 4HDCA 2WSSD 1J7KA 3KBBA 3VSDA 1SO8A 1I1HA 3P9CA 3TMAA 2MSDB 5HR5A 3O91A 1I3OA 3GVCA 3C3XA 1AGXA 1WBJB 4DG9A 2ZTUA 1DTWB 3M1AA 1XRSB 5LIRA 4TLDA 2YFKA 5DF1A 4BC1A 4EUHA 2GFQA 5KTOA 2C57A 4B2YA 2Z8YA 1TIPA 4LCEA 3UJ6A 1CHNA 1OAOC 2ZRNA 4WJKB 4OLHA 4KXWA 1RP7A 2BJVA 3DFKA 1ZXLA 2FN9A 1DC6A 2YCBA 3L6CA 1SBIA 4UMEA 5EXXA 4Z4FA 4CT4B 1TKBA 1DBQA 4YASA 2IU4A 4IGKA 3VR1A 4AJ1A 5ALWA 2WB4A 4NMMA 4KPEC 1I10A 1JF8A 4JBGA 5E8JA 3M2PA 4ENSA 4BVEA 3WIBA 3ZY2A 1BFKA 2JGDA 3JPYA 1Q95A 3MTAA 2DFLA 4MARA 1JR3D 4ZO9A 4D81A 4BNDA 5HUJA 3CE6A 2YFHA 1RIFA 3NT2A 1M2JA 4QA9A 4MGEA 2OHVA 3TKAA 5K09A 4H15A 2NU8B 1MDBA 3MMSA 4Y9UA 1C0LA 1EQAA 1G8JA 2ANBA 1AIPA 3PFKA 4OJMX 2CXSA 2EWWA 3JV7A 2O5VA 5JCXA 1ZSYA 5JMPA 3FPJA 4UNSA 3C39A 3DDHA 1IDOA 5FBWB 5KHLB 1CKEA 3CNLA 2I2WA 3FPFA 4JL5A 4Z0HO 4B2PA 4EITA 2WSMA 1J22A 3CSSA 1T8PA 1E18A 3OQMA 5KYYB 5IJAA 3RS3A 1T9DA 2OE2A 2YRFA 2ZJAA 4Y98A 2ECPA 1MB0A 3G5LA 2CGEA 2QE7D 1DXYA 4CL3A 1MAUA 5ALMA 3W06A 1FMFA 1NSFA 1F9AA 1BXRA 2W9XA 1YL5A 4FFOA 4J2HA 2EFYA 3M6IA 4HF7A 5JWOA 5HTOA 1Z82A 4TXHA 3DDSA 1FFYA 3P0RA 2EJTA 1T4GA 4E70A 1E7RA 4MUJA 1G5FA 4MVJG 5IYZF 3TUZC 2DM6A 4LQCA 3BL5A 4HDKB 5TVGA 4QEZA 3GEEA 5LPNA 1LQUA 4I1IA 4EB6A 1YB1A 3PC8C 2FUKA 1K4YA 1E9SA 1FVHA 5G53C 2XE7A 4DMGA 1EFPB 2G25A 5IFKA 2QUIA 1ZMBA 1GEGA 2G9VA 2V45A 3I0NA 2NZUG 1EIZA 4M7WA 1FYVA 4PLTA 4DC1A 1F2VA 4XQCA 1RYZA 2JARA 4BKQA 5PGMA 2ZIUB 3DAHA 1DIOB 2ZI6A 1Z15A 5E4FA 3LYAA 7MDHA 2VJQA 3WGHA 4R9NA 2VPZA 2XCOA 5CD9A 1UDWA 4ML3A 2BCEA 4QASA 2J41A 4EX7A 1XZ8A 3LUPA 1KIFA 5L3RA 3ZWXA 1Y3BE 1FDVA 5G1PA 3VR4D 5A62A 5DBFA 2XHEA 5EWLA 1VHLA 3GJ0A 2J5KA 1H0HA 1TTTA 1P9RA 2XMSA 1OH8A 3QHPA 3FNFA 4W9NA 1FDUA 1I4LD 1O4WA 4RTQA 4PLVA 3ISTA 3OEHA 4TV8F 1TJNA 4EHHA 4ZU3A 2CLCX 4BUCA 2FPOA 4CM4B 1RADA 2Y0DA 2ZDHA 3WYDA 5DHUA 1ZIDA 3GY0A 2FUCA 3O3OB 4L74A 1LK5A 3PPVA 5EP2A 3ZOZA 4AMUA 1RCTE 1PFWA 2C83A 4J0CA 2IH4A 1S8NA 2BI8A 4OQLA 3SJ7A 2Z0MA 3Q0IA 3U44A 1VE1A 3ESQA 1LW6E 3BORA 3CW2A 3QX7A 4YAOA 3EVNA 3PPWA 4D46A 4GBMA 3U1TA 1SXQA 4ZOLB 2NUTA 1I24A 4DG5A 4ACAA 1JLLB 5IBRA 3W2EA 1RVDA 1SOUA 3AF0A 3O2JA 1RWPA 4J0IA 3OFJA 5KX5A 3GJ4A 2E5LB 1A88A 2P5SA 5A0TA 5EQDA 3AF5A 5JSUA 4NXNB 2WU3A 3GZTB 1HT0A 2PT5A 2FK7A 3A8TA 5EXTA 2ZATA 3ER9A 3UYLA 3KJIA 4XYEA 4WXPA 1W52X 1SM4A 5AUQA 3P20A 3WYGA 4ZT3A 1OX4A 1YDHA 3WIEA 2JDID 3ZJVA 3QUQA 2VT6A 2BI7A 2XYQA 1ZYUA 3QUTA 1PFYA 4OI4A 2XJ4A 1F2UA 3RS0A 2YZ2A 1XN4A 4PZZA 4EQ6A 1XCGB 3OAAD 2AVDA 1FX1A 1R0BA 2IYAA 2GDZA 1E3JA 1U2QA 2JLCA 2P69A 4O59O 3W8NA 3N2ZB 4YV0A 3HA5A 4QTTB 4CMBA 1TAUA 3VPHA 1I9CA 1UBEA 3I83A 3K0FB 1PE0A 4Q7KA 4CLXA 2RHMA 3KTAB 2DE0X 4HNVA 1O97C 1RDFA 5J58A 3MMPA 4KVFA 5LA6A 5CFLA 5JR3A 1ECJA 2YFQA 1U28C 4QNNA 1ZP6A 1CCWA 4KO8A 1LSUA 3B8HA 4Q1AA 4YAWA 3ZCTA 4EHFA 3K0AB 1G6HA 1Z7WA 4TLMB 5BQ5A 2CZGA 3ZCXA 3JQFA 3ZDCA 1R8YA 4EGQA 1UPXA 4BP9A 2Y0CA 3JYHA 3EVBA 2AMYA 4XDHA 3Q41A 4F3YA 1NN1A 1ST2A 4RS4A 5A9TA 3FOCA 1B41A 1QWOA 3KEMA 2QNRA 4NU8X 1W87A 1PDWA 4K0KB 1JXMA 1OI4A 2GZSA 4IVQA 3RVNA 3TNYA 4CHGA 1A82A 1ECGA 3CRQA 1W35A 4R68A 2HD4A 3PUWA 4J91A 1J39A 3TTXA 3QNUA 1TUGA 5BRJA 5YASA 1U2EA 2Q2NA 2QVGA 5ISMA 4Z4EA 1BDHA 3OJCA 2GN8A 4CV1A 1K8QA 1C3OA 4YBZA 2XZOA 4BP3A 1WW2A 5D3ZA 1JPUA 3Q9NA 3L82B 4G4SO 8ATCA 4IM7A 3GJZA 5GJVC 1D1TA 3GRCA 1UXIA 2CNOA 3E9DA 1JDZA 2Q9BA 4K6OA 1BU5A 4OHBA 3KC2A 5AIAA 4ZOEA 4ERNA 5KSOA 4NBKA 3AW8A 1KJQA 2ECQA 2W58A 5KJFA 4WCDA 3ODGA 1SRRA 3HEBA 3PXXA 4RMNA 2J45A 4ZOBA 5KJCA 1JEOA 3TRIA 5JSKA 5DSTA 3ZLBA 2BE9A 3W90A 2WQ6A 3D2AA 1BYUA 2IYEA 2ZYTX 4G8CA 1CNEA 4LHSA 4P83A 4YJ3B 3L7IA 2JVJA 5LXTF 1K5HA 1VQ1A 4I2VA 5AVQA 1JAXA 3D0OA 3H42B 2J0VA 4ZHQA 1F2DA 1HTWA 2RI6A 3WBFA 1I80A 1W85A 3ZJTA 4IIEA 1TI7A 3C1OA 4DIUA 2BH2A 4JN6B 1I4OA 1ESCA 5IN5A 2HHCA 4EVSA 4OD0A 1E79A 1HOTA 5CG1A 1XA4A 2HDOA 2W43A 2C2WA 4RMJA 2FX3A 4RW0A 5DNUA 5GVSA 4Q4HA 1CEYA 4ARBA 4KWTA 2JIRA 5CLHA 3RT1A 3HCNA 5A3JA 1G17A 3H2GA 2WKPA 4RD2A 2XZTA 3LL4A 3HJCA 5DNYB 4BLTA 4M98A 2FN8A 2WP0A 5T8KA 1XTIA 1O5IA 1Y3AA 3DVLA 4I14A 1V43A 3DO5A 3NWBA 3EBLA 3HCEA 3AVWA 4YGYA 1DHTA 3FROA 3LDFA 4H3HB 4DMRA 1YBVA 4HG2A 4PZ0A 3N9IA 4UHDA 1AJEA 4JSTA 3P2YA 3WZ2A 2ZAIA 1XD9A 3G85A 4UZSA 2EZ8A 4D96A 5JSZA 4OI1A 1N33B 1M75A 1VSVA 3QEMA 2YXDA 1XZCA 2GHQA 3L8YA 4O4LF 4CFSA 2GD6A 2FGJA 4KHZA 3AESB 2H00A 3ORRA 2JFWA 4MEJA 4L4UA 1PG2A 3ELUA 2PD3A 2VTEA 4G26A 3SEAA 3GFFA 5JY6A 1CVIA 2AQHA 2EKZA 2OXCA 1DDIA 3CNEA 1VP3A 1XCOA 1YZNA 2FWIA 4RA9A 5DVZA 1WXQA 2N46A 3U3ZA 1MXFA 5JASA 2YVAA 5THKA 2YV2A 4N41A 2PHZA 3LV8A 5DN6D 1OI3A 1XK7A 4FYMA 3S2FA 4PXSA 3WHIA 2FPUA 3M6FA 4TVKA 1UADA 4B7AA 3VPFA 5KZMB 1JA1A 4JMPA 1QKKA 4YI5A 4LGVA 1SUWA 4R3NA 1XQ9A 4WK4B 1TW2A 2C0PA 5G2OA 5IAEA 1TFUA 1X7WB 2ATCA 2XWJI 3W6PA 3GJXC 4QXQA 2FWJA 1R5JA 3E9YA 2ZIXA 3IT2A 1I5OA 1M8FA 3OX1A 1GADO 4DSTA 2JNWA 2QYSA 4Z3KA 4N0PA 2OD2A 2ODWA 1O97D 2XSZA 4QU9A 1VPVA 5CVVA 4MJ3A 5KNLA 3QW4B 4W82A 2HADA 2P0EA 5FBQB 3C5VA 3ZK9A 3F49S 3ENVA 2CBZA 4IW3B 1JHPA 1RKBA 2X3YA 4Q39A 4PX3A 4QTYA 1WA5A 3JQAB 4FYIA 4N65A 4CKZA 1NOJA 1ODJA 2PH5A 1A0OA 1XROA 3TZCA 4N01A 2A6PA 1Y3HA 3FOZA 4Y6LA 2C7PA 3LHKA 5ALDA 3HNPA 1GUYA 3EF3A 2GD2A 3KQTA 1T2DA 2CEKA 3UW3A 1Y3CE 4B17A 3AU9A 1SZJG 4AP9A 3RAGA 4YWJA 3A3YA 2J7KA 3FF1A 2G08A 5LCXA 2XHZA 1SOVA 5KNBD 3DVSX 3GJSA 4IHJB 2FPSA 3T9BA 3O6VA 2OENG 4N5MA 3CKKA 2QVZX 3I04M 4FYVA 2B8EA 3GP8A 3OLYA 1F1JA 2PSHA 3DV9A 4NDNE 2CD9A 4EHDA 1IHOA 1IM5A 1U2PA 4JLOA 1XR3A 4Z9AA 4YRZA 4FX2A 1GZUA 3AHJA 4R81A 3UAXA 3VPDA 3ZDBA 1JDUA 1PGJA 1R9JA 5JQGA 2BE7A 2FMHA 1YJBA 3N0WA 3CC8A 3GLFB 4F2GA 2FW0A 5GM2A 4BNFA 4HNHA 2ZSHA 3ER8A 4NG4A 1BA2A 3KZCA 2EIHA 2EFEB 2RH9B 1ODTC 3RAPR 3GBSA 4C43A 3HU3A 1JEYB 5AVZA 3NB0A 1O57A 3IV6A 5AQ1A 2EGUA 2VF5X 2BKEA 4NHEA 1P2VA 4IMJB 1BX0A 3U7JA 1R2QA 4YMLA 4IIJA 4O29A 1OV6A 1CUGA 1J9EA 1L1QA 3IDOA 2B1JA 1Q0RA 2AN1A 1G9TA 2C7BA 1SEVA 3N86A 1H65A 3FDJA 2C5AA 3R5JA 4NCAA 3EWNA 3ZDQA 4JJ6A 2PUHA 4AJIA 1WJGA 2QS9A 2F67A 2HGZA 2PYIA 4A9AA 4V1CB 3T94A 2WAXA 2KM1A 4ZK6A 2C5SA 4JHLA 4QE3A 4EZBA 4ETMA 1VA4A 3U19A 3FPCA 1E3EA 4QGHA 3S3TA 3UQYS 2YRXA 1FJGB 3ZS8A 1DCKA 2YFYA 3PNMA 4MW0A 1NYQA 3AH8A 2X40A 1JAIA 1ZJZA 1TZJA 1XAIA 3NO4A 4FYXA 4WIAA 4YRGA 5F5LA 1DAEA 2Q6TA 5HKLA 5JXGA 1DRWA 3I5MA 3PKIA 1GPLA 2QAGB 4HAWA 3G9ZA 2BVNA 3G0OA 4R7GA 1AC5A 3FE2A 2WTBA 1QZZA 1SVIA 1YBAA 3QKRA 2I8AA 3QJYA 4FR2A 2G1AA 3JR3A 1LTHR 3FN4A 4QHYA 5BT8A 3Q2OA 1H1LB 1ZSNA 2ASEA 3I9JA 3Q0EA 2W6OA 1IZ0A 3CJQA 3L8CA 2VDRB 3FCUB 1OU4A 3I6ZA 4OL0A 4PPYA 5AUPB 4CKBA 5B3LA 2PBZA 4BFZA 4DLXA 4CKYA 1G7CA 1N6LA 2IBMA 3I6IA 3BGOS 3JQ6A 3VPXA 1EHIA 1P7WA 5JNTA 4HNUA 2ZSBA 3IUPA 4Q7MB 4WZAE 5BWCA 4YMSA 1D2NA 1YKFA 5CDSA 2GJAA 2Z5VA 3IA2A 4URYR 2ORED 4HS4A 4WOCA 1ZXBA 3NAZA 4GGMX 2IZ1A 5AK0A 4Z7OB 5H3HA 1HYQA 2W2LA 2Z8XA 4JP5A 4MW5A 3HUFA 3EJWA 3CUEF 1FIUA 3IVCA 2CDBA 4G0XA 4GM4A 2R4QA 2ZTHA 3QK7A 1NX9A 2RIRA 4N5DA 5G3YA 1NC3A 1U7HA 4V0KA 4PZLA 1C0KA 3G6WA 4DMLA 1EPUA 2AFHA 2TMYA 3BXEA 4TWJA 2AN4A 3CN9A 1C8BA 5CJJA 1G5IA 4C07A 1W48A 2YZKA 1W4RA 4OIMA 3ETNA 4FOPA 3C7TA 3LBYA 1XXHA 4UTZA 4GOXA 4I0WB 3IJRA 4WXMA 5FUVA 4ARZA 4GUDA 1UM8A 1HE5A 5CLIA 4DLWA 5KNCH 3V8MA 4XQEA 3X1WA 1JH8A 3U7QB 1KE2A 4Z8XA 1IPEA 1N5LA 4C7OB 1A50B 2HBZA 2QL7A 1AA9A 1LTKA 4P4TA 5D7NA 4C0WA 3FMPB 4OUKX 4UFOA 5LNK6 1J25A 1EG2A 2ENUA 1GPH1 3DTVB 2R8EA 3UXEA 2M9MA 5LLSA 5JO9A 4XWWA 1VYUA 3EZFA 1YZLA 1X8LA 1IXYA 4C29A 1QYRA 4A2PA 2OZVA 3ABRB 1RLMA 3IQHX 3H99A 3DYBA 5KVSA 2C4KA 4IP0A 1SCDA 3EEQA 2MT9A 1FA9A 3OCZA 1NLUA 3SMQA 4I50A 2Y68A 4FSDA 3VPCA 2CCJA 3HTXA 2CCKA 2HF2A 5LN1A 5EIXA 4OLFA 4POAA 1JB9A 4D80A 1F14A 2CLSA 3QKUA 4Y0VA 3KJHA 4TKLA 3NAMA 2J4CA 4BMCA 4E4RA 3OZSA 4L6IA 4OGWA 2NT4A 4E15A 2RKBA 3KUDA 2YBEA 2YJGA 4P3XA 3D6FA 3WGUA 3MQFA 1PGPA 3V9PA 1JQJC 1I4TD 5LYJB 4AY4A 2W2XA 2FZ5A 1MNAA 2AEJA 3EDCA 5IABA 1NQWA 3I2FA 4WX2B 3ZS9A 1YF3A 4BVJA 4R1UA 3TQOA 4LNHA 3EG9B 2QE6A 3EBPA 2Y1OA 4QYWA 4AECA 3TKLA 1F1BA 3D4IA 2NLOA 1SHLA 2C9BA 3FWKA 4LOAA 3P0JA 1VZ3A 4ESVA 2UUPA 4XR9A 1UM9B 1ULZA 3GUUA 1WY5A 2KPOA 3R23A 3ZN2A 5HJ5A 2HQOA 2M6LA 1NLFA 2CE7A 1BHQ1 3ZDEA 5HP4A 1GG9A 1J06A 5K3OA 3R44A 2VDMB 1KAQA 1WAMA 1YVPA 1UCFA 1TO2E 1HE8B 2BKUA 2IYRA 4FP9A 3V8QA 2B92A 5J2TB 4DUGA 2Y92A 1OVMA 4YP9A 4PG4A 3EGVA 5AVWA 2AQIA 1XCPA 2VO1A 4J9VA 4NMLA 2JZNA 3ZPXA 5H9WA 1E5QA 2H7XA 5KTTA 3GG2A 3LNTA 3O4IA 1WRBA 1LRJA 4NONA 5D5PA 5JJCA 1E9EA 4FE7A 4ZJUA 3KNZA 1JP7A 1G9SA 1MC5A 5JFOA 4OXXA 3TLGA 3P9KA 4MRVA 3WLTA 1PJCA 4MDEA 1NM5C 3WMRA 2WV9A 3U4QB 2O06A 2FFRA 3PF8A 2WICA 2XKKA 4TXJA 4X60A 3ZE6A 5K03A 1NJGA 3TD2A 4UU8A 4F12A 1ZOSA 3N2KB 3L7CA 3LVBA 4QARA 5EN4A 5LP6B 1KR2A 4I5EA 1EVQA 1NQUA 2ONJA 3MCTA 4Z7JA 5CB8A 1BS2A 4NABA 2H4FA 3AY3A 2VJPA 4FFVA 3QXGA 2FW9A 5K8JB 3P2OA 4HYQA 1P1RA 2VK8A 4P34A 3VR0A 1GPWB 1FF9A 1Y8RB 4PRZA 4B84A 2E5FA 2FF7A 3JVDA 4QTUB 3DXFA 1YE8A 1VL5A 3ASZA 3PXDA 4W5WA 4XARA 3HKDA 1NBIA 1QX3A 1NMSA 3EGDB 4BRZA 5AOBA 1E92A 1PYOA 4UDOA 1ZVKA 1OZAA 5DYYA 2A9PA 5FO1A 1THZA