4QECA

Elxo with nadp bound
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
248
structure length
248
Chain Sequence
b'MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ElxO
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Oxidoreductase
total genus 86
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qecA00
2YHUA 2EERA 2AQ8A 5GZ1A 1Q2XA 2JFGA 4U6SA 1LSUA 3AM5A 1Y9EA 3FHLA 3W1VA 1TEHA 4I1IA 1PQPA 4C7KA 5TS3A 4P4LA 1DIRA 2UYYA 2DT5A 1E7SA 1I8TA 4OXYA 1P1RA 2Z1NA 3AFMA 1Y5MA 1GDHA 4CQMB 4R1TA 4I5GA 2ILTA 5DOZA 3I4CA 3G17A 2R6JA 2IEDA 3WLEA 4XEHA 1ISJA 1TI7A 1E3SA 2HKIA 4J9VA 5DNAA 4EEZA 4RDHA 2EF1A 3GFGA 2WE7A 4XR4A 4XYEA 3V1YA 4WLVA 1T2EA 1JTVA 2I65A 3RBVA 3W8EA 5KVSA 2ZYDA 4TRRA 2HU2A 3WYCA 4O63O 3ZWAA 1MXFA 4J0EA 3LQFA 1EMDA 4TRNA 4DWVA 1K6JA 5AXDA 2J8ZA 1HZZA 2ZB7A 2X0RA 1JWAB 3WS7A 7MDHA 4XYLA 4LVCA 1AXGA 4NIMA 5B4UA 2OHXA 1YL5A 3DHNA 2IZ0A 2RHRA 3D3WA 1U8FO 3VH1A 4MVJD 4U0KA 2BRUA 1WP4A 4CQLB 5HM8A 3RQSA 3PWSA 3OSUA 3TFQA 1EE9A 3GRPA 3WR5A 3O26A 2C2XA 3KYCA 2NM0A 3VZQA 1H6CA 2RCYA 2PH3A 1LSJA 4FIZA 4J3FA 4S1VA 2WYUA 5GMOA 1AGNA 4FC6A 4RF5A 1HXHA 3L4BC 1VI2A 2XAAA 4NFYA 3VTFA 3A9WA 4OJNA 4AJHA 3GG9A 3FCOA 5KKAA 2VHVA 2HDHA 4BO9A 2NTJA 4MINA 3WJAA 4BKOA 3WLFA 4NR0A 4YT2A 2X9GA 4DPLA 2NTVA 3FBTA 3H5NA 4XGIA 3AY3A 5A9TA 1XU9A 1UXHA 3U9LA 5B37A 4TROA 4PG5A 3OJLA 3PIDA 1BDBA 3PFWO 3S55A 5J23A 4BO8A 4CMIA 2BI8A 1E7YA 1LDYA 2Y68A 4MVJP 3QWFA 1Q0HA 1Y8QB 1GCUA 1YOVB 3CMCO 1GR0A 3KHUA 5JC8A 4WLFA 4JNKA 2CVZA 4TKLA 1ZBQA 4L4XA 4YJHB 4I8XA 1CERA 2ZJ1A 4XYBA 4F46A 4AJIA 3C7CB 3HQ4O 3WDSA 2HRBA 1LQTA 3QA9A 2BLLA 2VOEA 5G0WA 2E4AA 4WCFB 1UDAA 5KJFA 3ZI0A 2DBZA 1DIAA 1C3VA 1C1DB 1R4NB 3V2UA 1DIGA 4FFMA 4UUMA 3CH6A 1TT5B 3RBXA 3L0DA 4BO4A 5AXBA 4WGGA 2I76A 2AEJA 4TZKA 1V9LA 3PWKA 4FJ0A 4IQ0A 3PYMA 3JQ7B 3H5RA 2DPHA 1ISMA 5F1PA 4URFA 1XU7A 2AMFA 3GVHA 2BD0A 4BNMA 3ASVA 3AY7A 1G0OA 1XDWA 5C37A 1AXEA 1EBFA 1LQUA 4OO3A 1GCOA 2FMUA 2HLPA 2CDBA 4YAIA 1SZJG 4XGKA 5DULA 2RH4A 2CZCA 1UDCA 1VPDA 1BMDA 2O50A 2Y1FA 3R3SA 4PZCA 4RVHA 3WGOA 3PVZA 3EVNA 1J6UA 1SEPA 2Y99A 4K6FA 2ZB4A 3U62A 3NGLA 1HKUA 3LF1A 1F17A 2Y0EA 1K2WA 1ADFA 1NWHA 3JQAA 3ICPA 1NQTA 1SCUA 2EWMA 4Q39A 3FNEA 3IMFA 2CF5A 5L7WA 4H3VA 5BR7A 4BNJA 3H3FA 3BTVA 3HB5X 3K8ZA 5AVOA 1LA2A 4XRGA 1B2LA 4GWGA 4YAEA 1H9BA 3H9UA 4NBWA 5CDGA 1LDGA 3NT5A 4PRKA 1G6KA 5HRUA 4IJKA 2ZTMA 5COAA 1DAOA 4R51A 2Q4EA 4O5OA 4FR5A 5ADHA 2CF6A 2IZ1A 2QYTA 1DJNA 1H9AA 3TF5A 3K31A 1KVQA 4LSMA 2G0TA 2OGUA 4D0RA 3ZDFA 4G5HA 4IDFA 5I8ZA 5TT0A 5B4VA 5CEJA 2X7HA 3D5QA 3ADOA 4Y8VA 2B4RO 1U3TA 3H5AA 1ISFA 3AUAA 4YR9A 5EL0A 4E2YA 3ABIA 4DBVO 1RM5A 3RFXA 2PKQO 3AUSA 4U5QA 2B5VA 2DPGA 4EUFA 2OBYA 3TOXA 1ZFNA 4BNXA 2A92A 3ZNPA 2EKLA 3KSDO 3VH3A 3WTCA 5I7FA 5JDCA 3VPFA 3PZRA 2VN8A 3QVXA 4J9UE 2YQ4A 1XLTA 3MWDB 3QVWA 4YRDA 4Q3EA 1IE3A 4JXKA 5A3VA 3V1UA 1E0DA 4PLFA 1W73A 1MP0A 3H9QA 1EZ4A 1KEUA 3NRCA 2VTDA 3BHIA 1P0CA 3CZMA 2VWHA 4PG8A 1XG5A 4NU6A 3VVBA 2CDCA 1TXGA 3ZWBA 4NU5A 3JQ7A 3L77A 1I2ZA 1W0CA 5F5NA 1QYXA 4NFSA 4ALIA 3QHAA 2BKAA 2PGDA 4R3NA 4FB5A 3HN7A 4YXFA 3RSHA 1C0PA 3C7DB 1CETA 1XKQA 1J4AA 3H7AA 2GNAA 4E5MA 1DJQA 1OC4A 1HWYA 3ZU4A 4CJXA 4GSKA 3JQCA 2X22A 3F46A 1KY4A 4WEQA 5T8KA 4BO7A 2GSDA 4KUHA 2WSBA 3EVTA 1YJ8A 1DIHA 3UUWA 4YT4A 5ER6A 2YY7A 5KWEA 3BA1A 3KV3O 3UFXA 3MJEA 3TZCA 1B15A 1PJQA 3MTGA 3QE3A 4NJMA 1GFSA 2C07A 4Z0TA 1E3EA 4WCDA 3F9IA 4E5YA 4HXYA 3AJRA 3PDUA 2QYSA 4YT8A 3G1UA 3MZ0A 4HBGA 5B4TA 1B3RA 1WZEA 1Q7CA 3BXXA 4K26A 5CPFA 4GH5A 1NXQA 2OORA 5BSHA 1L1FA 4W7IA 5CP8A 1LSSA 5KVVA 2FWMX 1B8VA 2PKRA 2WJPA 2DTDA 4NG5A 3W4JA 3K73O 3RC9A 4PLCA 3R3JA 4KMSA 4XX0A 3ZWWA 5F3RA 3OJFA 2CVOA 5EIOA 2J3KA 2D4AA 1ENPA 1BW9B 4ITUA 4MIOA 4QXMA 3X2EA 3TFOA 4B7CA 3GOHA 4XIJA 3JYNA 3HSKA 2I5PO 1FDSA 1EFLA 2O48X 1NWCA 4GKVA 5EESA 1Q7GA 5L3ZA 1PJ4A 4R16A 3QV1A 4Z0PA 2CD9A 2X4GA 3FF4A 2QRJA 4FDAA 2O3QA 3RUFA 3OIDA 3CE6A 3ADPA 2JD1A 2UV8A 1DRVA 5JYDA 1A9YA 2WD7B 4EYEA 4CLOB 4GX0A 4PG6A 1DPGA 4CMEA 2GGSA 2Z5LA 4N5MA 4B3HA 4BMSA 4OYRA 1NASA 1JKIA 5FI3A 3ULKA 1LEHA 1U3WA 3ZWXA 4R9RA 1ULSA 3GMSA 2VT3A 3EDMA 1LDBA 4YB8A 3ITDA 4JLWA 4UUOA 3ROQA 3UCXA 3S2GA 3GA0A 2C54A 3H9JA 4DIFA 1SOWA 4CR7A 2JKVA 4BKPA 4CMHA 1UR5A 3HADA 3UHAA 2HO5A 3JQ9A 2HJRA 3CUKA 1I3KA 4JBHA 4QO7A 4NBRA 4J1TA 3OIGA 3GY0A 1HE5A 3FBGA 3JV7A 1KC1A 2BH9A 3VPGA 4CV0A 3RU7A 3DBRA 2O4CA 2POQX 3IKTA 1KY5A 3B1KA 3B20A 4PN3A 4BNVA 2P68A 3M1AA 1EUCA 4IBOA 4BNGA 1XHLA 2E6UX 1LC0A 2R00A 1R4MB 4FFLA 1DDOA 4QSMA 2PZKA 3PHLA 3ON5A 1SAYA 2QZZA 1DHRA 2ZQZA 3CTMA 5IDYA 5JNLA 3DO5A 4YYZA 1BG6A 1V0JA 2PV7A 2ZYAA 4XB2A 3P2OA 4Z9YA 3ROMA 3PWZA 4UEOA 3LT4A 4UVDA 4EZBA 4ID9A 3RI3A 3HWRA 4CQMD 4CM4B 5LDHA 1E92A 2Y1DA 1U28A 1BW9A 3GVPA 1HL3A 2VNSA 1FF9A 4MP6A 1I5RA 5K9ZA 3TZKA 2TMGA 1U3UA 4AJOA 2VQ3A 3GZNB 4FS3A 5KJ1A 3AFNA 5HA5A 3FWNA 4B8WA 5JPIA 4R68A 2Y1EA 1KERA 2OBNA 1GUZA 1U5CA 4GMFA 4CMBA 5DCWA 4ESOA 3D7LA 4GLLA 5T64A 2BGMA 5A9RA 1ZUD1 1I33A 1HDOA 1L7EA 4DGSA 1U2DA 4LRTB 2B4TO 2AQKA 4BNHA 1VL0A 4CUZA 3LDHA 1EUDA 1FDTA 4LCEA 2EKQA 2EJWA 1A7KA 3GT0A 3LU1A 3E9QA 3KLMX 3ZHZA 4ZRMA 4Z9XA 1RYEA 2ET6A 2XXJA 1LRLA 3DONA 1UZNA 2WM3A 3PYLA 1ADGA 2JD2A 3GHYA 4JBGA 2NQ8A 1RYDA 3A4VA 4AJ1A 1KVRA 1PZFA 3C85A 4KQXA 3WMXA 3IKVA 3VDRA 3JD1A 5IXYA 3ZU2A 3ZNNA 2ZB8A 3L6DA 1N9GA 4FJ2A 1U2GA 4RPJA 3VAZA 2NTNA 2P5YA 2NVUA 3FWZA 4XR9A 4CV3A 5A05A 5ITVA 3FNHA 1NYTA 4ZA2A 1TLTA 1ZEMA 2FPIA 4PLTA 4RDIA 1D1TA 1ZVMA 2Q49A 1DOHA 1QV7A 3EW7A 3LSYA 3ZGYA 1WPQA 1O5IA 2QHXA 2VWQA 3CXRA 2W2KB 3MJ4A 4RVGA 2GUGA 4FOSA 2CY0A 3FPCA 4CLHA 2FPPA 3RFVA 4EEXA 2J6IA 3BAZA 5JAZA 4AJKA 1IZ9A 1RM4A 3I83A 3IUPA 5DT9A 1W4ZA 2BF7A 4BNNA 1M76A 3MJCA 5FYDA 3ZWVA 4J0FA 1A4IA 2GO1A 1D3AA 1R6DA 4B4WA 4E2XA 1PEDA 1ENYA 1ZK1A 3DWFA 4B3IA 4K1LA 3PI7A 1X15A 3KB6A 4GVLA 4QTZA 1EDZA 2ZK7A 3KYDB 4GI2A 1DC4A 4E4YA 1DHTA 1N92A 1HDCA 3VDQA 4RL6A 3I9JA 3DBHA 4HFRA 3KEOA 1UUFA 3H3JA 3QWIA 1Y1PA 3JQFA 4NJOA 2DAPA 3RU9A 5JAMA 3GEGA 3QW2A 2YW9A 1XEAA 1MGOA 3UF0A 3R1IA 3Q9UA 4OKIA 3H2SA 5JCJD 1X0VA 5DBIA 3NX4A 1WWKA 3AM3A 3ICCA 2G82A 3JSAA 3WIEA 3WYEA 4BO1A 1YGYA 2BHLA 2AG8A 4TVBA 5A03A 4NQZA 3ETEA 1VSUA 5CDUA 4I08A 1B7GO 1BGVA 3RFTA 5MDHA 1Q0LA 3D4NA 3GVCA 4OHUA 3UVEA 3PEFA 3CIFA 3EAGA 3UKOA 5THQA 3OQ6A 5LCXA 3WSVA 5L4SA 4Z3DA 1E6UA 1OZAA 1T2DA 4E2ZA 5GY7A 3DHEA 2J3HA 5IN4A 1BVUA 1GZ4A 4GAEA 3DZKA 2NVBA 4E2WA 4IINA 3RIHA 1KEVA 5A02A 1NQ5A 4TRMA 3OQBA 3Q2IA 3VKUA 3EUWA 4R5HA 3FR8A 2VZ8A 3GDOA 5FWNA 1S6YA 4RQUA 2Y0DA 3K92A 1B0AA 1T26A 1YONA 4MKRA 4XRRA 5COQA 4EUHA 4YJDA 2IZZA 3WMWA 3Q11A 4GLOA 2QQ5A 1IB6A 1UDBA 2P91A 2A9FA 3IP3A 3GGOA 1DRWA 1VKOA 4YDRA 1O6ZA 4I5EA 2XXBA 4YAJA 2H6EA 3JD2A 2H63A 4BUCA 1R0KA 4NMHA 3TDKA 3DOCA 3FTNA 2AE2A 1ZXBA 3H9EO 3KYCB 4M8SA 5T57A 3NEPX 5TRTA 5I9NA 3INTA 3G1TA 4BS9A 1HDYA 3MEQA 1DB3A 2VHZA 4RO0A 3N74A 2PNFA 3O8QA 3I9LA 4PLZA 4WPGA 2HK8A 1R15A 2WD8A 4B4UA 4EITA 1GUFA 1ONOA 2ZKLA 4AJ2A 2WEKA 4CM9A 1TVEA 2PGJA 3C24A 4CODB 3NYWA 3JQEA 4BNYA 3R0IA 4D7AA 2Q46A 4BMNA 1AE1A 5I7VA 5IDXA 3KBOA 3RBZA 4XZ3A 1FK8A 1PQWA 1FMCA 1A9ZA 1WLYA 1CJCA 2OUIA 4GMGA 5TSDA 5T67A 5T6BA 3V2HA 2EGGA 1PU2A 4HY3A 3RWBA 3S2IA 4DPKA 1IHYA 3KEQA 1G0NA 2FSVA 1P77A 2HAEA 4WJZA 3PDJA 2J3IA 1A27A 4CMIB 1C14A 1GPDG 3KZVA 5H82A 1LLUA 5EINA 4XGNA 1GTMA 2HUNA 1W6UA 3LC2O 4R69A 3OBBA 5DF1A 1P33A 1EVJA 2YHIA 1ZKMA 2JCXA 3QSGA 3KXDA 4J2HA 2I66A 2V6GA 1B8UA 1MC5A 1DC5A 4L9RA 4MIYA 1T25A 4HWKA 3MWEB 1ZSNA 2CNBA 3ZH2A 5DOVA 1ZZEA 1WVGA 5GZ3A 9LDBA 3H8VA 2NACA 3ST7A 3WOHA 3F3SA 1PL7A 4LCJA 3P7MA 3D4OA 3RASA 5KTKA 1KEPA 4ONEA 1EVZA 1M2WA 4GX2A 4A2CA 3I9KA 4L74A 3UW3A 5I9LA 3QY9A 4N54A 3GPIA 5EQDA 2JJYA 4K6CA 4IMPA 4LGVA 4WCFC 4Y9DA 1HSZA 3TJRA 3AK4A 2Y67A 3DEYX 4ZQFA 3E82A 1E6WA 3JQGA 4J1NA 4Q9NA 4FGWA 3V1TC 4E30A 5ILGA 5KIAA 1T2AA 2Z95A 1C0IA 4NDNE 1HTBA 3ANMA 5U9CA 1GAEO 1Y81A 1UZLA 1YQXA 1PSDA 3JQ8A 4PLGA 5U1PA 1CRWG 1GY8A 1DEHA 2Q3EA 2RIRA 1H2HA 3B1JA 4ZQBA 3ORFA 3GPDG 3SC6A 5CG2A 1R12A 1R37A 3KRTA 2J3JA 1SOVA 1UP7A 3JQAB 3IL2A 3GEMA 3DC2A 2AA3A 1E1KA 4O6VA 1NP3A 2A4KA 4N7RA 1PL6A 3S2EA 5JLAA 3WXBA 2O23A 1QRRA 1Q7BA 4J7CA 1UH5A 4J16A 4YAGA 1I10A 2NWQA 5L40A 2RBEA 2FZEA 4YJFA 1UP4A 1D7OA 4D43A 4FQ8A 5JMPA 3SLKA 4L8VA 3I9MA 4K28A 1F06A 1YXMA 1BXGB 3OICA 4NK4A 3WGGA 3U09A 3DMTA 8LDHA 3UAGA 4OMUA 1E7MA 2B35A 2W8ZA 3AWDA 3HB4X 1R66A 5HWSA 3ZV5A 3HFGA 1O8CA 3IP1A 3D0OA 3ZWYA 1NFFA 3W8DA 1PZHA 1RJWA 1ZMTA 2HMWA 1XGKA 2Y93A 3DFUA 3ZW9A 1ZXLA 2X5JO 5A06A 1HSOA 1E3LA 3OF2A 3QVSA 4J4BA 3WGTA 3WQSB 2Q45A 3ZV4A 2X23A 2Y1OA 3AUUA 3JQBC 3L4SO 4LW8A 1D1SA 4FSHA 2WYWA 1LDNA 2FZWA 3ENKA 5JY1A 2AE1A 4CLRA 1BHSA 3WQQA 2BFPA 2W2LA 4Q3NA 3ZW8A 1DFIA 1IY8A 2P9CA 1V3UA 4RF2A 4CM7A 3F5QA 3UN1A 4W7HA 4ALKA 3SVTA 3MJVA 4E0BA 2OL4A 4JX8A 1W8DA 1YBMA 3NKLA 3FRJA 1MLDA 3EZLA 4LVUA 5TGDA 1N1GA 5IN5A 1LJ8A 3R6DA 4MPDA 5ES3A 4IGFA 3VTZA 1E5QA 2FY8A 3OJOA 3TRIA 1KETA 4MP3A 3VZPA 2X0IA 3QP9A 1NHWA 3U0BA 4A7PA 4GX5A 4FD3A 3FR7A 2JHGA 3M2PA 4DQXA 1GADO 1YB1A 5A1TA 1YO6A 2B37A 1ZH8A 2BMAA 3U5TA 1PS8A 2JFHA 1U8XX 4GSLA 4WLNA 3IQDB 4WLUA 3T7CA 4UULA 1DAPA 2VWGA 1GYPA 4NJMB 2GDZA 4XD2A 2UUOA 3KYBA 4KDEA 1KVUA 2GLXA 5IZ4A 5L7TA 2NLOA 3MCVA 5I7SA 3OFSA 4EW6A 2C59A 5JDIC 2HMSA 3IAHA 3LLVA 3RC1A 1X1TA 5JAIA 1PIWA 5C5IA 2D5CA 3TZQA 1ZJYA 1VRWA 2P2SA 3KLPX 5F1KA 3LF2A 3L07A 2OMEA 1BXGA 4YVFA 3ZNQA 3F4LA 2VOJA 3HZZA 4DQVA 3STHA 1I3NA 4PCVA 3PHHA 1TB4A 3NTQA 3T4EA 1VL6A 1PJ3A 3PQEA 2G76A 3WBFA 1PGOA 2CDAA 1C0KA 2PTGA 3GQVA 2FR1A 3K2BA 3WGYA 4BOYA 4IZIA 1J0XO 3ENNA 2P5UA 4F6LA 1LLQA 4D44A 1M6HA 4TKMA 4HV4A 4W9NC 3CKYA 1J5PA 2VTEA 1YJQA 2OXIA 4J49A 4J90A 4R5MA 4R41A 1YWGO 1QR6A 4R1NA 3I5MA 4IQGA 4J4HA 1X13A 4RLSA 2X1HA 4BGVA 5TF4A 4MVJE 4RGBA 3WWYA 1BVRA 5BSFA 1NAIA 3WICA 4B79A 3UOGA 1AHIA 1SB9A 3LVFO 2DUWA 5AXAA 1VE9A 4NBTA 1PGJA 2X9VA 4EJ0A 5EMHA 3IS3A 3I9NA 3UCEA 1FJHA 3Q6IA 3EYWA 5A9SA 1C1XA 2VRBA 4IIVA 3DZIA 4PRLA 1ZMOA 5CHEA 2DTEA 4EJ6A 4CM8A 4F45A 3SLGA 3SX2A 1SPXA 2CSUA 1U4SA 4BO0A 3F6YA 5K6AC 1U9JA 1PJ2A 3S2FA 3A14A 1MFZA 2E82A 2YYYA 1PR9A 3ZU3A 1E7QA 1MB4A 2HRZA 2PZJA 4J4TA 4JJFA 4JK3A 5JE8A 3GHHA 4RZHA 2C29D 2PD3A 1ML3A 3DBRB 5CPBA 1HE3A 2OO5A 3E8XA 1KOLA 3PHJA 3Q0EA 4CM9D 1ZJZA 3U4DA 1NVGA 5ILOA 1YQDA 3CPSA 1MC4A 3NDRA 5C7LO 2AHRA 2E48A 4KWHA 4CM5A 3KOUA 4TMFA 5KVQA 2NU9A 3L4BA 2P4QA 3N58A 3PLNA 5ENVA 2PZLA 4ZICA 3QLJA 4R1UA 1BTOA 2VHXA 1IZ0A 2Y0CA 4W6ZA 4E13A 4RPKA 1VL8A 3H65A 4MKXA 1U1IA 3G79A 1K0UA 4IXTA 4D3DA 4ZN6A 5BNTA 5I7EA 1O9BA 4R1SA 4B7UA 1Y5RA 5EQFA 4DRYA 4CR8A 2BFMA 5JW6A 5TJHA 3LC7O 2A35A 1NPTO 3MJTA 1UXJA 1NR1A 4TZTA 2UUPA 1DC6A 4XQGA 1PWZA 1CIVA 1H6AA 3VOSA 1HDRA 2IXBA 4KQWA 1K3TA 2D5AA 3GUYA 4CMAA 1UP6A 2XPCA 4DYVA 1QORA 3P2YA 4IJVA 4MKZA 3UXYA 2D8AA 3ZV6A 1HYEA 4ALLA 1HDGO 3LZ6A 1T4BA 2DQ4A 5AYVA 1I32A 4WASA 4Y67A 1LLDA 3PHGA 4FBGA 3W4KA 4BGEA 3TL3A 3AOEC 4M87A 1ZK0A 1PX0A 2GYYA 4BB5A 4FFOA 3DDNA 3QVOA 3WG9A 2Y1GA 2GASA 1OFGA 5KJ6A 2GZ1A 1T4DA 2ZCVA 2Q1SA 2V6MA 1GEGA 4D0SA 2PD4A 3A1NA 2NQTA 3B1FA 1HRDA 2YZ7A 1Y9AA 1M6WA 3DBLA 4AJNA 1N9GB 4EUEA 2Y1CA 5KJCA 4Y6RA 1M75A 5L45A 1NPYA 2NVUB 4BIIA 1Z7BA 2DLDA 4RVUA 1I36A 1LRJA 4G65A 4GGOA 2NU6A 4ZVVA 4PG4A 3F1LA 5I9MA 3U3XA 1YL7A 3DB2A 3RUHA 4BNWA 4U7WA 5C7OO 3TL2A 4E6PA 2JHFA 2NU7A 1P44A 3WQRA 1EEHA 4J43A 4BKQA 4BO2A 3DAFA 3RUDA 1OOEA 4GVXA 2AQIA 3WFJA 3UGKA 4AJEA 2EW8A 5BQFA 1LC3A 3RUCA 4XB1A 1HYGA 3ETGA 3ONEA 2B69A 5L4LA 3D5TA 2V65A 4ND5A 1ZSVA 3DFZA 5L95A 1VSVA 2JL1A 3NDJA 1A4UA 3DTYA 3F47A 3GEDA 2YV3A 4XCVA 1ZK2A 2HK7A 4XQCA 4BNKA 1JLLA 3DBHB 3T4XA 1OAAA 3EY4A 3LYLA 3K30A 1B14A 1PS0A 1X7HA 1DSSG 4DVJA 2BGLA 4XJSA 1EK5A 2VCYA 1HETA 4II2A 3AOGA 2QX7A 2C82A 2VRCA 4KDFA 4WEOA 1LBEA 4RPLA 2EV9A 2O3UA 4MOWA 1EQ2A 1NQAO 1QP8A 3K5PA 1VJ1A 1QV6A 4L76A 4IS2A 2ZATA 3WIDA 1YBVA 3AM4A 2AW5A 3VC7A 4NBVA 1P74A 3HDQA 4PLYA 3JYOA 4MO2A 1WDLA 1JKFA 4D3SA 2PH5A 3PGJA 5G4LA 2BFOA 1E5LA 3QWBA 4R3WA 3GGGA 2VYNA 4QX6A 1I01A 1ISHA 4RLHA 3SJUA 4ILKA 1K89A 1FDWA 3BMOA 2VYVA 1YKFA 3D4PA 3GDGA 4FOOA 3KO8A 4N18A 1MG0A 3U4CA 1MXHA 3DOOA 4GBJA 4J91A 3GR6A 1DLJA 3NUGA 1KBZA 3HHPA 4ZQHA 3IJPA 1U7TA 5DP1A 1ADBA 1CDOA 2FSSA 1NFRA 1WMAA 5ENDA 3DMYA 4HADA 4ALNA 2H5LA 2VUTA 5JFOA 4KUEA 3A06A 1R16A 3W6UA 2HQ1A 4OGWA 8ADHA 4HKTA 3OEYA 3C1OA 4MVJI 2R2GA 3FNGA 3P19A 3JQAD 4J2OA 2GRAA 2O3SA 3CSDA 3EMKA 5DCUA 5T5QA 5K0ZA 2OOSA 3ETDA 3K6JA 1YDEA 3HN2A 1IPFA 4AG3A 1L7DA 1ORRA 2DBRA 4J7UA 4WOKA 2X0NA 3WGIA 1R0LA 4BQPA 4WE3A 4YJGA 3VPSA 5H83A 4D41A 4PG7A 1V3VA 2VZ9A 2XOXA 4JJGA 2FHSA 5KCZA 4ZJUA 2IEBA 3AUTA 2Q1TA 1ZSYA 3RCBA 1Z6ZA 2SCUA 1IYZA 1I0ZA 2X86A 2PGLA 3O8QB 2DFDA 5ER9A 5TQVA 3KETA 1JKJA 1E3WA 3BMCA 3RROA 3F5SA 5TX7A 4Y6PA 3TN7A 3BTOA 1QLHA 1UAGA 2G1UA 3E5MA 1LDMA 1NAHA 2DU8A 3IOYA 1VLLA 3S1LA 2W98A 5DCYA 4BVAA 4E3ZA 3OETA 3BHJA 3GK3A 1F12A 5CEEA 3MOIA 1B16A 4BO6A 1AN9A 1H0KA 5FI5A 4FCCA 2BELA 2IYPA 4IGEA 4ZQEA 1GU7A 4PLWA 4DYDA 4ZGWA 1VC2A 3ZN2A 5B1YA 5L4NA 2UDPA 2PY6A 1XELA 1H2BA 1F14A 2Z1MA 3ZNOA 1NBOA 1UZMA 3OM9A 2IDZA 3C7AA 3M2TA 4CM1A 5AQ1A 1SBYA 2QRLA 2YHIB 2FOIA 4QEDA 4IIUA 1SB8A 2XF8A 4YPOA 3PJDA 4DC1A 4YT5A 3HUDA 4ROSA 2QG4A 1NR7A 4O1MA 4WOJA 4BV8A 2FR0A 1IHXA 2NSDA 4A10A 3DXFA 4RPGA 2FRDA 2NU8A 1SC6A 2X0JA 4TVOA 1A7AA 1GUYA 5G2OA 4BNFA 4YACA 5DBFA 4DIBA 4D42A 4UEKA 3B70A 4RZIA 4ZD6A 5EN4A 1WXDA 4HFJA 3RVDA 1DRUA 3ZWMA 2VUUA 4DQUA 1VJ0A 3JQGB 3L9XA 1RWBA 3E1KA 1NVMB 1QKIA 3I9OA 1UXIA 4BNLA 4ZRNA 3TQHA 1K5HA 4A03A 1SMKA 2YV2A 1OMOA 4RV9A 4WKGA 4I9NA 2YUTA 4P8RA 5L9AA 1CWUA 3GUCA 1P9LA 2DBVO 3JQ8B 1IULA 1O89A 1ENOA 1QG6A 4OAQA 2X8LA 4QFCA 3NDIA 3PZBA 4CL8A 2GD1O 3BMQA 2D59A 2C5EA 3OEWA 3WSWA 3P5SA 3FD8A 4RJTA 3PJEA 2WWRA 3B6ZA 3JD0A 4CLEA 6LDHA 3ONDA 5IFLA 1T1RA 2GZ2A 2HJSA 1X0XA 4R9SA 3OMLA 3WYBA 4M54A 3D64A 2F00A 4L4SA 4U8GA 2C20A 3DQPA 1GQ2A 4ND4A 2NADA 4MIEA 4LISA 4TRJA 4CUKA 4IDDA 4YJFB 4PFJA 5DP2A 2O4UX 5A04A 4E32A 3LC1O 1TA4A 2W90A 1LLCA 5L7YA 3A28A 2Q50A 1U3VA 2ZYGA 4KP7A 3HDYA 1MUUA 1HEUA 1GQQA 1NX6A 2IODA 1KVSA 1QSGA 2EGHA 4ALMA 1E1LA 4RF3A 3HDHA 4BV9A 4AFNA 1XSEA 4M86A 1LTHR 4PZDA 2FN7A 2NNLD 1VM6A 1GD1O 1YB5A 2D1YA 4PVCA 1ADCA 1V8BA 5JO0A 2X6TA 1WAMA 4U0JA 2V6FA 2RHCA 1E7WA 2GN8A 3PJFA 4MDHA 1GEEA 4YBZA 1S7CA 1M66A 4L73A 4D79A 4NK5A 3GLQA 4O59O 4Z3KA 2EXXA 3ZWCA 5HTOA 4UUNA 1GYRA 1ZO8A 4CLRB 3X2FA 4U6QA 3VPXA 1A5ZA 9LDTA 5L53A 3GVIA 1DLIA 2IE0A 3UICA 3SC4A 2OP0A 2PLAA 2QIOA 4YCAA 3JTMA 4W82A 5JDCC 4QO8A 2HK9A 5KJEA 1E6EA 1GPJA 4KWIA 3IUSA 1Y8RB 4PGFA 2WYVA 4ZU3A 4OOFA 4CL3A 2EHDA 1YH3A 4UUPA 2Y05A 2IYOA 3DTTA 3AW9A 1ID1A 1PL8A 4LK3A 4P4NA 4JCOA 4XYGA 5BNIA 7ADHA 1DFGA 1MX3A 3SXPA 4PZEA 3RUEA 5IG2A 4CPDA 1I3MA 5JAQA 5EPOA 4AJJA 5JYEA 4MVJF 2D0IA 5IF3A 4EBFA 2D3TA 2DM6A 3BTSA 3AY6A 3FPLA 1WDMA 4L0QA 5G4KA 4P38A 3WFIA 3OA2A 3WB9A 4A73A 3RC2A 1EDOA 1IOLA 5DBGA 3KSZO 4JP2A 4DUPA 1N1EA 3NJ4A 2ZIZA 3U4HA 3INRA 1GZ3A 2WE8A 4Z6KA 4JQCA 1EBUA 1ENZA 2QW8A 1IL0A 4UEJA 3WTBA 1I2BA 2JD0A 1SNYA 3GN2A 5T8KC 3GAFA 2VRCD 5CG1A 4AJLA 4IJWA 3OA0A 2PZMA 4DL9A 3FTPA 4Z0HO 2WMDA 4RPHA 4NH4A 1P1JA 4O0LA 3DR3A 1T2CA 2I6TA 4OXNA 3ZHXA 1HLDA 3I52A 3TZ6A 4H7PA 1XA0A 4B4VA 2QRKA 1VKNA 3H2ZA 4NFHA 3K96A 3N7UA 1JAXA 1JN0A 2VYND 4BQRA 3F1KA 4N5NA 2B4QA 3KTDA 1PJBA 5BSEA 2VYVD 4OOEA 1UXKA 5LC1A 1ISGA 1IUKA 1F0YA 2I9PA 3RUAA 3JQ6A 1XQ6A 4HNHA 4D45A 2EG9A 3QVTA 2W4QA 4IQ8A 4BKRA 2ZTVA 1YS4A 4UVGA 1P1HA 1BSVA 5FF9A 1V35A 2C5AA 4I9HA 4HUJA 1G1AA 1JU9A 4WNIA 1BXZA 4WECA 1P3DA 1LSOA 4RQTA 4CQMA 2VUSA 3TNLA 3AI3A 4CMKA 1PJTA 1RM3A 4L4RA 1A71A 3RAJA 3W4IA 2O2YA 1EFKA 4MVJM 2BGKA 3KVOA 2X5KO 2DC1A 4JBIA 3KM0A 3M6IA 4UREA 1DBVO 3GFBA 5EJ2A 4XIYA 4YA6A 1CF2O 3EC7A 1Y8RA 4BGUA 1X1EA 3L6OO 5HBRA 3PK0A 3IIEA 2YDXA 5A9SB 1C1XB 2BI7A 5JC1A 4D3FA 1GZ6A 2GN9A 4XJTA 3Q2KA 4CM8B 2ZTUA 4CMEC 3MJSA 3WGQA 1CQJA 2PFGA 2AEFA 1H94A 3OQ1A 4NI5A 1HT0A 4UVEA 4XYMA 4KUGA 2H1SA 2ZCUA 3JD3A 1BRMA 2EKPA 5AOVA 4E33A 3ANLA 4MP8A 2GN6A 1PQUA 4GPD1 3GRKA 4XKJA 1SEVA 4NBUA 4OQZA 4OSOA 1ULUA 3LT0A 4QQRA 1QYWA 1P31A 1XCBA 5TT1A 3JYQA 3DZGA 1LXCA 2J5QA 2PD6A 4H16A 4IDBA 1EUZA 4IUYA 1X7GA 4R54A 4ALJA 2C0CA 1U4OA 4YRAA 3JQ9C 5C7IO 3BIOA 4WLEA 3DZBA 5TJ9A 3ZWNA 3SJ7A 4CQLA 5CEFA 1NFQA 3G49A 3MTJA 3I4FA 3E48A 1GQYA 3PFFA 1Z75A 2CVQA 3SEFA 2O7QA 1B8PA 4CV1A 3HJAA 1ZW1A 2EW2A 5IZCA 2D2IA 4QFDA 1PZGA 3GNSA 3RJ5A 3V8BA 1ISIA 3GZ4A 1I2CA 4M49A 4OXKA 4CMCA 2R00C 1H93A 4PVDA 4J6FA 1UAYA 4I9UA 5BT9A 5TIIA 3RC7A 1OBFO 3NGXA 3H6KA 3RKUA 1KYQA 2LDXA 2Q2VA 4R4JA 1LNQA 2E37A 3C1AA 4J1SA 3V2GA 1C0LA 4JN6B 3RKRA 1YBAA 3BYZA 4FJ1A 1XWFA 4IPTA 1P1KA 1PJCA 1PZEA 3EHEA 4I5DA 3MOGA 4HFMA 1K6IA 3WNQA 1EVIA 4G2NA 4X54A 1GV0A 1ZK3A 1N8KA 1ZK4A 3O38A 4FPXA 5BNFA 4DMLA 3T7EA 4CMJA 4BMVA 2GCGA 1QLJA 3GNTA 1Y8QA 2HSDA 1YOVA 2GR9A 5TC4A 1IPEA 1EK6A 5JO9A 2VWPA 4YJHA 1NPDA 3QRWA 2VHWA 1LRKA 2I67A 3JYPA 4MVJG 3I3OA 3W6ZA 4Q3DA 1JQBA 1OI7A 2WDZA 1E77A 5DN9A 2ZQYA 4C7JA 2EP5A 4A5OA 4WCFA 3Q1LA 1KC3A 5JCJA 5A3JA 3DBLB 4YQYA 4F6CA 3S8MA 3FNFA 4KTVE 4OM8A 2JFFA 4LMPA 1R4NA 1C1DA 3FI9A 1OC2A 3JD4A 2GERA 2ZJ0A 4RVDA 4BNUA 1TT5A 5U4QA 3NT2A 4IS3A 5G0SA 3TSCA 3GVXA 5BSGA 4YAKA 3Q9NA 1Z82A 3TPCA 4BNIA 3DHYA 3OJEA 5KVCA 4LRSB 3OIFA 3QWAA 3GGPA 4OSPA 5CAEA 4CUJA 2O3JA 2Q2QA 3E9MA 5DDIP 2O3RA 4AICA 2G17A 2I3GA 3UH1A 3IJRA 2I3AA 2I99A 3AI2A 5L51A 3IDSA 3VVCA 4AL4A 4JP3A 1H5QA 1LUAA 4II3A 3ANNA 4DPMA 5B12A 2FP4A 3DBVO 4N5LA 1X7DA 2C7VA 4DREA 4K9DA 1GL3A 1JW9B 1YB4A 3E03A 4D46A 3ZWPA 1Y7TA 4FN4A 2AQHA 1PJSA 1QXSA 4S3MA 1O95A 4EI2A 5CDYA 2YQ5A 1F8GA 3O9ZA 2NUAA 1E1NA 4M1QA 4JIGA 5LDGA 4HX5A 5DZSA 2O2SA 4AJ4A 5ICSA 4OL9A 3I6IA 2C7GA 3PPIA 5F5LA 4YEDA 3WWZA 3I23A 4KTTE 2Q1WA 4YTEA 3COSA 3Q3CA 4I5FA 1KS9A 3PHIA 4JGBA 1I30A 4KZPA 4NHEA 4Y6SA 3EK2A 1WNTA 1AUPA 4IDCA 5TNXA 4DBZA 3E6AA 4E5KA 3WGHA 4E21A 4EDFA 1Y6JA 5KOIA 1PWXA 3JQDA 3LLSA 3HE3A 3WX0A 4NPCA 3PGXA 1Z7EA 5CDTA 4HFNA 3JQFC 3TZHA 5GZ6A 1JAYA 1XR3A 2VZ0A 1JA9A 3JQBA 3OH8A 4WNCA 3V5NA 4FGSA 4A26A 5G0TA 5JBIA 4IDAA 3OHSX 5JS6A 2WTBA 4EGFA 1H6BA 3ROPA 4IDGA 1JVBA 2JAHA 4CV2A 3BMOB 3D1LA 3RUIA 1NNUA 1AHHA 1WMBA 4Y98A 5KNLA 4IDEA 4Z9FA 2Q1UA 3K9QO 3DAPA 2X9NA 4LN1A 4PLHA 4BL5A 1YRLA 1N7GA 4E5PA 4W99A 4UVIA 4UAGA 2JAPA 5F1OA 1MA0A 5COBA 1XYGA 4GKBA 5MGBA 3CZRA 1X14A 1I3LA 1YL6A 1J49A 1D8AA 1Z74A 2YV1A 1U7HA 2CMDA 3AU8A 3W8FA 3E18A 2X5OA 4JROA 4L75A 1FXSA 1E7RA 4F3YA 4BKUA 2HMVA 3RJ9A 2OFPA 1Q1NA 1GV1A 1Z73A 3PIIA 5HS6A 3PYXA 2G5CA 3QWHA 2V6BA 1E3IA 4G81A 2UVDA 4DLLA 1F8FA 4P22A 2EP7A 3FSRA 3I6QA 4NZ9A 1DFHA 1PTJA 5IAAA 3HDJA 4B4OA 4W4TA 5IXSA 4YJGB 3LK7A 4J7XA 4GWKA 4XQEA 4AVYA 1BXKA 1MG5A 2PKQP 2YFHA 2P9GA 1MV8A 5JCXA 3PLRA 2EIHA 3H4VA 3OP4A 3L6EA 2GN4A 4Q3AA 1NVTA 3BZUA 4BGIA 1MFPA 3ROKA 5JDIA 1E3WB 3BMCB 2P9EA 1T2FA 4Q3BA 3PQFA 1T1SA 1ONPA 4DLAA 4BO3A 4HNGA 2O7SA 3GH3A 3PXXA 1WZIA 3G0OA 4H15A 3PQDA 3EZYA 3QQPA 2DFVA 4MVJA 3CMMA 4XQ9A 4YQZA 4XDYA 4DMMA 4XA8A 5H81A 3ZV3A 1XQ1A 1Z45A 4TSKA 3GMDA 4CLDA 3H9GA 2PR2A 4BNZA 2UAGA 3VH2A 3DZJA 4P4GA 4RVFA 2B0JA 2X58A 4AJPA 1P0FA 5ICMA 3KUXA 1QYDA 3GN1A 1U5AA 4FFNA 2EEZA 2C2YA 2W2LD 1T24A 2FR8A 2ZTLA 2DVMA 2CFCA 4DLBA 4EJMA 4W9NA 2DTXA 1JWBB 3OECA 4WLOA 4C4OA 2GF2A 3BTUA 1QYCA 4Q3CA 3G3EA 3ONFA 4ZHSA 4KOAA 1DC3A 1HE4A 2P4HX 3U4IA 3EGOA 1K6XA 4DIOA 5A5EA 2GZ3A 4ND3A 1PS9A 5IJZA 2VHYA 4XWYA 5IDQA 1CYDA 1E1MA 4BB6A 4BNTA 3DZFA 4QECA 4FFRA 1LU9A 3GNQA 3BHMA 3ZZNA 4UVHA 5I8WA 3PTZA 3PJGA 4WK6A 1FDUA 1ZNQO 5CDSA 5JSFA 2J5KA 1E3JA 4DTIA 1O94A 4BO5A 4FC7A 4A0SA 3ZCXA 1PGQA 3U49A 4IM7A 1KEWA 5ITWA 1QYVA 1PR3A 2DKNA 2Y66A 2WD7A 4TWRA 4CLOA 2RAFA 3C3XA 2YDYA 2FPGA 3M1LA 2QZ9A 1N5DA 1ZIDA 1EVYA 3D3EA 3NTRA 4ZQGA 5K6AA 1A72A 5TLSA 3DAGA 4RVSA 3PRJA 2TMDA 2F1KA 3ITKA 3AU9A 5THKA 1N7HA 1ZEJA 3DOJA 3BMNB 3NAQA 3UCFA 3VZSA 1HDXA 3VPHA 4OQYA 1R0SA 3IC5A 5G0VA 3KSUA 1P45A 1H6DA 1PJLA 5CFZA 1B26A 4NNJA 4RCVA 1RM0A 3L9WA 3BMQB 5JXWA 1WDKA 2AG5A 2H9IA 2PK3A 5A5FA 3CEAA 1KIFA 2YJZA 4OIMA 1RPNA 1LI4A 2EJVA 2LDBA 1KVTA 2VT2A 4M89A 5F21A 4IJUA 5JMWA 3AI1A 1FDVA 3VH4A 2B36A 3CINA 5C3MA 4B8ZA 1D4FA 1B3BA 3HNPA 1R4MA 3OJ0A 4IY1A 5JY6A 5FEUA 4LMRA 4PIVA 4CLXA 4IMRA 3GG2A 4BHTA 1JVSA 3DL2A 2HMUA 2PWZA 3VZRA 1BWSA 3F4BA 4IXWA 2DBQA 4YWJA 4IZHA 1UJMA 1JDJA 1I24A 4CM4A 2HMTA 5A4DA 1V6AA 1YDWA 3WBBA 4GGPA 3GF4A 4DC0A 2RH8A 2HCTA 1CQIA 3INGA 1ONNA 1M67A 1V3TA 3DMTC 4LSWA 3TWOA 1NHGA 1N2SA 3ZHBA 2JCYA 3K2EA 3NJ8A 3GZNA 4E12A 4CR6A 3HFSA 2Q2WA 4E5NA 1XIVA 1HLPA 3AOEA 2IRWA 4M55A 4MJLA 1ZCJA 4YRBA 1NQOA 2JCVA 4JJIA 3GDFA 4GX1A 3VKVA 5G0UA 4DXHA 1EQUA 5IDWA 4GL4A 4OH1A 3C1TA 3E5RA 1Q0QA 3VHRA 3PP8A 3WNVA 3JCZA 2A94A 3DZHA 4ND2A 2GPTA 2Q99A 5AXCA 3LT1A 4E31A 3JYLA 2BFAA 3ASUA 3QIVA 2DUUA 2E49A 4CMGA 2J5RA 1HF3A 4R01A 3NTOA 4A27A 3ZWOA 3BMNA 2CUKA 3LT2A 5FFFA 4TQGA 1YE3A 1CEQA 1RKXA 3O4RA 2NV6A 4PLVA 1LDEA 5G4KB 4INAA 3TOZA 2AXQA 4QT0A 2B5WA 3HG7A 1P1IA 1LX6A 3NV9A 1NTOA 1YVEI 2OP1A 2VNAA 1P1FA 2Q4BA 5EERA 2V7PA 2OZPA 1PGNA 3ZU5A 3NT4A 4ND1A 1DIBA 3D3WB 1GYQA 1YQGA 4B7XA 4B3JA 2YFQA 1O0SA 5HS4A 2PA3A 1HDZA 4RF4A 1DXYA 5KKCA 3WJ7A 1QMGA 2W2KA 3C8MA 3WGZA 1UXGA 4J1QA 3SBOA 1HYHA 3GAZA 3ZHYA 1WW8A 1NM5A 1SO8A 4QUKA 4CM6A 4HP8A 4GQAA 3RD5A 3E9NA 2ZB3A 3O03A 3GC6A 4FW8A 2B83A 1TT7A 2NVWA 2O3TA 1HE2A 4FFPA 2AEMA 1DO8A 3QJ5A 6ADHA 3KYDA 1HZJA 1VJTA 1PGPA 4OKNA 2IXAA 1ARZA 3FN4A 4MVJH 4WUVA 4XDZA 4CM3A 4DA9A 5IZCC 1EE2A 4RORA 4PLPA 1BDMA 3I1JA
chains in the Genus database with same CATH superfamily
3V8MA 3EXHB 2GI4A 1WV0A 1XEXA 3LHFA 3HKDB 3II6X 1Q2XA 3H2JA 1PR0A 3O92A 1E2UA 4JT9A 4P92A 5A0VA 4NE9A 3V7YA 3LPCA 2P9ZA 1PQPA 2MU1A 2UZ1B 4QT4A 4JJAA 2HA5A 4D4HA 4FSXA 4BC1A 2XA1A 4NYJR 1DIRA 3O1IC 2DT5A 1N57A 2PLNA 1I8TA 1NQXA 4MYRA 4RELA 1JQLB 1GARA 1BX3A 3ZX5A 4AY5A 5ESWA 4R83A 2H1HA 4KDCA 1U9IA 2JLAA 3ZY3A 4CQMB 3L0CA 1DX4A 4RV4A 1DQSA 4I5GA 2UZ0A 3S1SA 3C3DA 4CDMA 3Q40A 4IJQA 4FMCF 2WU4A 3C5VA 4ES6A 2R6JA 3E22A 4A36A 2X7JA 1JIUA 1QIHA 5F77A 3WLEA 4CNBA 3HM9A 4N40A 3KPJA 3AM1A 2OBBA 3PUVA 2EF1A 3V1YA 2WE7A 3E27A 4WLVA 3TIFA 2I8AA 1L4GA 3QUTA 3A31A 2ZYDA 4FDVA 4E1BA 4YLYA 2X2EA 5BN4A 4MUHA 5NULA 4MEBA 3PEWA 1KS2A 1LJUA 2QLMA 3E2MA 3DNFA 1RTTA 3LQFA 5CVUA 4CQNA 1X7WA 3TLYA 1GZUA 3ZU6A 3RRNA 5CGZA 4REQB 4ZAVA 3B3GA 1SUAA 4DG5A 2WHYA 4MS4A 4X62B 2BJHA 2X0RA 3RW9A 3NTXA 4HBZA 5L8VA 1N6NA 4L5BA 2AOVA 3HCRA 1YK0A 2Z5VA 4E4TA 1U7PA 2QN7A 4ZTUB 3OG9A 2OHXA 4PX2A 1BA2A 3RSFA 4B3BA 3DHNA 1OLUA 2IZ0A 3SEZA 4KQ2A 4U0KA 1JNYA 4YS6A 2O52A 1ZU5A 1AZSC 5G40A 4E94A 2QSJA 5DTJA 1DXHA 1UWVA 3OSUA 4Z4GA 3E7DA 3NHFA 4ZT6A 3S7ZA 1YNSA 2CKMA 3VR3A 4CF3A 4ZCIA 3WR5A 4YONB 1UFRA 4LOKA 1ZNWA 4Y6OA 3CKLA 2W83A 1H6CA 3T9FA 1LF5A 1OAKA 1UWKA 2RH5A 4IFTA 2WA2A 2PH3A 4FIZA 2WPDA 4S1VA 2WYUA 4MQFA 4IP0A 2JJ2A 4JBWA 1KYTA 4R81A 5GMOA 2ZJFA 3IP8A 1N6RA 2E18A 2VJLA 4J0HA 5MN6A 1B23P 1HXHA 4EAAA 1YJCA 3R6WA 1I9CA 3HCEA 5LQKA 1SHJA 1BMQA 3PDIB 1X2BA 4NFYA 3KLNA 4R1PA 2BFCB 4MCJA 3EVAA 1KMMA 4S1WA 3O4JA 2V8BA 1IQRA 4CN8A 3NP9A 5EWLA 1HE8B 3CA8A 1YTLA 2QVBA 2WKSA 3SMVA 5MFPA 3ISVA 5KKAA 2VHVA 1J2RA 4PYMA 2E4ZA 5EOVA 1WBDA 5BSEA 2QOEA 1ZCBA 3N2EA 3D43A 3WLFA 4NR0A 4DA0A 2QX8A 5HZGA 3LOQA 4G0XA 2P9BA 5A9TA 3I9FA 1UXHA 2ILVA 4H60A 5B37A 5EA2A 1NOJA 3S55A 4RA6B 3GRFA 3PFWO 1O94D 1P8AA 3L41A 5AJTA 3SHVA 4FBLA 3ZDBA 4CEJA 3FCXA 2VDUE 2NGRA 1E7YA 4QFMA 2Y68A 4MVJP 4PY2A 3ROXA 4EZIA 5FWAA 2XQFA 3NPAA 4GBED 3A1EA 3IVXA 3HVUA 2HFJA 3ND5A 1ACMA 5CW2A 1IWBB 4E11A 1DAIA 4FZJA 4RXUA 4UTOA 3UAXA 3P4YA 1YUBA 1M6EX 1ZBQA 4YJHB 2G1AA 4I8XA 1YVUA 1KQNA 3FHOA 2RHGB 4YLGA 1NP6A 2ZUBA 2ZPAA 2G1JA 1XPJA 3GGJA 1LV8A 3UK6A 4CNQA 2B7BA 2A1UB 1V1MB 4ZVKA 1JEAA 4RA9A 5IC5A 3QA9A 4ARIA 2JAQA 2GJ9A 2E4AA 1KE1A 4ENPA 3VTAA 1VI6A 3ZZMA 3HUEA 4ZPXA 3BXPA 1A69A 5DWVA 5LP6B 2M32A 2XQJA 5GJWC 1OXSC 1DIAA 1ORVA 3GFTA 4H7FA 4UBMA 3V2UA 2IYFA 3RJZA 1FQWA 4FDMA 3CH6A 1AKMA 3AYZB 2M6LA 1VIDA 2ZRCA 3G82C 3RHZA 1JHOA 3L0DA 1GFWA 1XNJA 2IPOA 3CFYA 3PTLA 3MQ2A 2I76A 5EGNA 5AXBA 4BO4A 4TZKA 4OQMA 4BVLA 3IJ5A 1PT6A 1ZQ1A 2QXTA 2BUBA 4O08A 3KX2A 4BEWA 1U0BB 3I5AA 2P41A 2DPHA 2BFNA 3H5RA 1ISMA 2Q5OA 1XOIA 3VPDA 4XLTA 2AMFA 3A9CA 3BWCA 3GVHA 4MRAA 4OQPA 2H11A 3AY7A 1G0OA 1LLFA 5D5PA 4CT0A 3G68A 1NA5A 2XODA 2GKSA 3AVPA 3B1XA 4OO3A 5K2OA 2VT6A 1GCOA 5CD1A 3GGCA 4MZDA 1FJGB 2R5NA 4XI9A 2HLPA 3PUHA 4YAIA 3TQQA 4QVKA 5DULA 5KTSA 3WLLA 2R96A 1IBKB 1VPDA 3TFWA 4N7JA 4MQUA 1BMDA 4F04A 3SX4A 1EPUA 1JLKA 3P9SA 4RVHA 2FZCA 4DNXA 2WWGA 3AHHA 4QARA 3A7DA 3KTFA 4BWYA 3EVNA 4ERXA 1Z5PA 1SEPA 2P3QA 3D31A 1G17A 4OM7A 4JWTA 1HKUA 3LF1A 1UC4B 1E60A 1F17A 2Y0EA 4IV0A 3M70A 5IANA 3U61B 1V8OA 3F96A 3WIBA 4AKGA 3WZMA 1ADFA 1F9AA 4M8IA 3X0DA 3JQAA 2YWRA 4DUZB 3EA0A 3T7IA 1NQTA 1WF3A 1UBCA 4FGLA 4KK4A 2F3SA 3FNEA 4URZR 2CF5A 3T38A 2BFCA 3EYAA 3SXJA 4WOBA 4YAEA 3DE1X 4PTZA 1RRKA 1VHWA 1XX6A 3BJRA 5EPUA 3GLFE 1BX0A 1H9BA 1ZMXA 4Z4QA 3IR5A 3ZGLA 2OV2A 5BSMA 5DU2A 2F8LA 5HRUA 1DAOA 2ETVA 3OP1A 1VL5A 2V59A 4AZSA 1Y80A 4R51A 5HK8A 4JLVA 1BMTA 5I5GA 3QPDA 4BRSA 1N34B 2EARA 1CNFA 1XYYA 5JNTA 1QBGA 2CF6A 2ZJAA 1B41A 2AC4A 1MT0A 2GVDC 3LLUA 4AD8A 2HOQA 1W44A 4D0RA 2WOOA 4IDFA 1T8SA 4EPVA 2JGAA 1T9GS 5CEJA 4KWEA 2X7HA 4WCVA 3D5QA 1ZNXA 3VR2D 4KQ1A 3K1JA 4O4HB 4D0LB 1XZAA 2FDCA 1ISFA 3AUAA 2QRMA 3H9CA 3B6KA 2JH9A 3CT6A 5EL0A 3LX4A 5LLSA 3TK1A 2PKQO 3O74A 3W77A 4EECA 1UC9A 2YZNA 4EFNA 2Q6VA 2OBYA 1ZFNA 3ZNPA 4LKOA 1C0EA 3KK0A 2DETA 4AMUA 1UODA 1Q74A 3PZRA 3TL6A 1TQ8A 3H0KA 3OCXA 1CZKA 1KO4A 3M6MD 4J9UE 4IRXA 1XLTA 3QVWA 1A98A 2NSYA 3BF7A 4PPYA 2CCKA 4X94A 4YRDA 2YC2C 1KSGA 5J43A 1DU4A 4JXKA 3KJXA 5A3VA 3V1UA 2B99A 4PLFA 1ZIXA 1QQ5A 1EZ4A 5IYZB 3EXFB 3V8NA 3MUFA 1RC8A 2IFTA 4QQFA 2R7KA 2Z5FA 4XLZA 3USZA 1MPTA 4ZZIA 3ZGNA 2XADA 4FGUA 1XLWA 5ALKA 3LO8A 2CDCA 3LVRE 1NZDA 2W6ID 4NU5A 3K1ZA 2C2ZA 4IDPA 4Y2XA 3TSWA 3C97A 5JJCA 3ZJUA 2CJWA 2PL9A 5EUMA 2IBTA 3DYIA 3D8HA 3F3MA 3HN7A 5I4IA 1KEKA 2A9OA 2GPSA 1NJ8A 1ECBA 1WE2A 1OC4A 1S9HA 4OAOA 4RW0A 1XTKA 3WHLA 1S3FA 1LPNA 1SIOA 3S2ZA 4CJXA 3GH1A 2J32A 3F46A 5D1HA 4UUBA 4WEQA 5ERYA 4HAIA 1JAHA 2XUGA 3EVTA 1JR3D 1QK3A 2YOFA 4LKRA 2BC9A 4LFBB 3JVVA 4O3FA 4J76A 5ER6A 3TAUA 2YY7A 2IPXA 1E1YA 1FDRA 4O02B 5AMXA 3UHPA 5A4MS 4A0QA 1RZUA 1PJQA 1CEEA 4DADA 4RJIA 3PNMA 4E5YA 4HXYA 2AWNA 2CBZA 5FPSA 2I22A 2YJ5A 4EQZA 2QTCA 3HJBA 4EWLA 8MHTA 1ABFA 3ESQA 1QC5A 1WZEA 5B4TA 2CE2X 3BXXA 1PSZA 4A6DA 3KOOA 3MYYA 3DWIA 1QTIA 4C2TA 4O3MA 5IU6A 2FLKA 1XDGA 3C3YA 3I9V1 3GPCA 2OD2A 5CIQA 2FWMX 3U7JA 2VZLA 3W4JA 4JI4B 3RC9A 3N7TA 4DQ0A 4XX0A 4TS3A 2PZBA 4BQQA 4RM2A 5BR4A 4DS3A 2W9XA 3GD5A 5F3RA 2E5FA 1M8FA 2F8SA 3SG0A 2D0PB 3OJFA 1ESEA 4LNUB 4RHEA 5HUQA 5JEDA 3RTDA 5I9IA 3WQHA 1EXMA 1M3SA 2ZJ6A 4PC3A 1TJPB 1BW9B 2FMXA 2P30A 3TFOA 4UNQA 2JFYA 1RFGE 3GOHA 4XIJA 4ZT4A 3VOTA 1F8XA 1IXSB 1IDOA 1QGUA 4GKVA 4QUHA 3GLHA 5E2AA 1SHZA 4L72A 2WWVD 4B3CA 1QU3A 3NM5A 5CDFE 5BYAA 2GJ4A 4MV7A 1JXQA 3ND8A 4Z0PA 3FF4A 3C4VA 1WQ4A 2W6MA 3SM9A 1WMDA 3ADPA 1A9XB 2CNKA 4PZYA 2Z9BA 2GPBA 3IEUA 1O57A 2XMPA 1CUEA 4DJJA 3RVPA 4PG6A 4CLOB 3WYNA 5KTTA 3QENA 2HGSA 1M8KA 3V46A 1P2TA 2PPLA 1M2OA 3KFXA 2KBEA 3ZGVA 5LIRA 5LYJF 4O0MA 3RYFB 5GPBA 3K70B 4JCCA 1OKKA 1CLUA 5E0OA 4D3ZA 2CYBA 2HRDA 4I7EA 5C8VA 2P6RA 1E0AA 1NXXA 4O2RA 2Z2KA 1LEHA 4HEA1 3GMSA 2VT3A 3JATB 1EFAA 5B2EA 1LDBA 5SY6A 1UM8A 2IVZA 5FNVB 4WBNF 2XTJA 3DSRA 4UUOA 3ROQA 3AHDA 3UGQA 4DIFA 2C54A 2ZPUA 1QHIA 1SOWA 1UJ2A 1Q20A 1QHFA 1KP9A 2PEYA 4CMHA 3FDZB 4Z9BA 4BP1A 5DISB 3FUWA 3HLKA 4JS0A 2HJRA 1MEEA 4JBHA 3MTBA 2OLEA 5E6SA 3FUCA 3B3FA 4ZAWA 4TMYA 1R3UA 3C3KA 4JQSA 5BRJA 1QH8A 3FOBA 4XSGA 2G0AA 3DBRA 2O4CA 3NHMA 5K8JB 4PN3A 1PCXA 3GCXA 4BMPB 2E6UX 1ZG3A 3QOXA 1LC0A 4NCKA 1QH1B 5JSQA 4XDHA 1J21A 1RHMA 5JPDA 3N1UA 2JIPA 1XAGA 5DNUA 2VO1A 2PSJA 3GUVA 3W3ZB 1SAYA 1WKBA 1DHRA 4BFCA 5IDYA 1ECGA 4YR7A 2QLLA 2JCBA 5KWVA 3CEPB 2IE8A 3T3MB 3SI7A 2CVFA 4U02A 5EIWA 4IH4A 2LNDA 3ZK8A 3TM4A 3V33A 4A91A 1VG8A 4LQ4A 1L5SA 5HKLA 1XZGA 2WIKA 1TM1E 2I2CA 2WSIA 5HIJA 1BW9A 1F51E 1FF9A 3FYUC 2WP0A 4MP6A 3ZHUA 2FZVA 1N36B 3E0XA 4AJOA 1BD3A 2VQ3A 1DCFA 2ZQ5A 3GZNB 5C31A 3DOIA 2BM9A 2VG8A 1F6WA 3A27A 3CVOA 2I54A 3NEAA 5HA5A 4DQLA 3FWNA 5JPIA 1CZUA 3N70A 3H84A 2RIPA 2WWTA 2Y1EA 3TLXA 3CSUA 4PAGA 1GUZA 3I5XA 1KPIA 4CMBA 1KH2A 1XDSA 4IMIB 5DCWA 1SXQA 2AMLA 4ESOA 1DKPA 3D7LA 3FYDA 2IV7A 3I6YA 4IIBA 1T9ZA 2PR7A 4ETNA 4JV5B 1A9XA 1WHSB 2D2XA 1YRHA 2XYPA 4GXRA 2BEUA 2VP6A 4HAXA 3S28A 4DDKA 4F85A 4LRTB 2B4TO 3RS3A 3B1WA 3PF8A 2NZVG 3WB1A 4BNHA 1NMZA 1E2HA 4EARA 4KOEC 1C4XA 2HWYA 2HU5A 1R1DA 2TRSB 2EJWA 3DKRA 3KZMA 3LU1A 3M4ZA 4LCEA 4U63A 1AKWA 1H85A 2IDMA 4YCBA 3ZHZA 2RH9B 1U9IC 4G63A 4OY3A 1ZGJA 1AKYA 4Z9XA 4YREA 3CVUA 1ZM3A 2GCOB 2VJNA 4AXXA 1BFKA 3UT5B 5ADWA 3DONA 3L1JA 3IPXA 1BCSB 2JD2A 5CA1B 5HK9A 4KFUA 4DRZA 1MOPA 1VCNA 1R8YA 1USWA 3A4VA 3ETCA 4JITA 4EEKA 1PLKA 4FXOA 4ERNA 3PXUA 4B3TB 2H7YA 2J3QA 3K2IA 1OBVA 2VCHA 4C7BA 2ZB8A 3L6DA 1PFGA 4KZKA 3OFND 3ZHQA 2O2JA 1GRQA 3PICA 3VAZA 5EIBD 1AS2A 3NOOA 4CV3A 2HCBA 2R6GA 2NZWA 3FNHA 3W3AA 3VTKA 3WOVA 1TLTA 2JI7A 4RPCA 3QLVC 3QVKA 3EASA 4PLTA 4ZDWA 1ZVMA 1Y3FE 4QM7A 1DOHA 3ZE2B 4GRIA 2JI9A 1WPQA 1KSHA 1O5IA 1OTXA 4ZMBA 2JFUA 4GZLA 2VWQA 1Z8FA 3CXRA 4G1CA 5JWRA 1VL2A 1GIAA 3FGZA 4COKA 4UOZA 3EQ7A 2WSSD 5C3UA 3BAZA 4AF8A 1T9DA 5K0LA 1RM4A 3IUPA 1RJ9B 1A96A 1W4ZA 2BF7A 4BNNA 4OBEA 5CW1A 4I1UA 4ZJYA 5B7QA 3IDZA 5EP4A 3ZWVA 3SZRA 3GFOA 1C3XA 3C2QA 3DWFA 3S3TA 2XHZA 4D74A 4MKHA 1FW8A 3KB6A 2BISA 3MRSA 3LLCA 3QY0A 2ZUCA 4F2DA 3D8SA 1EDZA 4JLAA 5KTNA 2FHPA 1BRTA 3W79A 2JVKA 4WNYA 1N92A 1YDMA 3BZBA 4QODA 2XNKA 3MTEA 3DBHA 1CZOA 4IFIA 1VG9B 1E79D 4L5JA 5BQ5A 5SYNA 4DDVA 5B57C 3HCBA 3QWIA 4KHPB 2I1LA 3GT3A 4WAUA 3GZJA 5HIIA 5C4GB 4GDFA 1KU6A 1W87A 5ALEA 2IW3A 4Q4DA 4D8YA 3W04A 1JFVA 1U7OA 1IXKA 3KD2A 3JQFA 4NJOA 5JAMA 3GEGA 2YW9A 3DWGA 2WUEA 1LB1B 4IIEA 3IELA 3I62A 4RSRA 1NG9A 2JLBA 1FU7A 1II8A 2J48A 2PWAA 2YY5A 1SD5A 1JHRA 2GBGA 3T5AA 5DBIA 3QEMA 1WWKA 1OX6A 3EXHC 3ICCA 5ALVA 2CBXA 5KYXA 2H4FA 4OQFA 1EI9A 3F6RA 4P08A 4G0UA 4LWZA 5A03A 3LQRA 1VSUA 2A84A 5B36A 5BNZA 5C1OA 3EARA 4I08A 2YNMA 2JIQA 1B7GO 3TW0A 1BGVA 1WHSA 3PGLA 5LXTB 1Y8AA 3OM1A 3O93A 2DH5A 2I2FA 2ZRFA 4EY4A 4F9FA 3WNZA 2PT7A 4HHEA 4G5GA 3UJ7A 2W4IA 3LKBA 5KNBD 4AECA 2A9PA 2BR5A 4Y6LA 3A1VA 5KPDA 4Y1GA 1OZAA 1T2DA 3KPWA 5DTMA 5HDQA 3RTAA 5GY7A 3DHEA 2J3HA 4E2ZA 1WB9A 1ZVKA 1VMEA 4GAEA 4RH0A 3DZKA 4XSVA 1P5JA 2JS7A 2GEKA 3FIJA 1JMVA 3E1SA 4IINA 4E2WA 3EAFA 5D86A 1QGYA 1YTUA 5CHYA 1ZVJA 5A02A 3CQ9A 1KRWA 1EAMA 4TRMA 2W22A 5BSKA 1QIGA 1RZRA 4M9UA 4L3VA 4LX0A 1W96A 2G83A 3GDOA 2ZS7A 4DLUA 5FTMA 2DFTA 2Y0DA 3R5TA 5COQA 4PGHA 1YONA 2WIBA 3ETJA 3WHPA 3ZJ5A 4YJDA 2IZZA 2C3PA 4Y1EA 3FPGA 4LS3A 4WMLA 3OEED 3VUEA 1H3FA 2AR9A 3LCUA 4EG8A 3TEFA 2D00A 3JWIA 1OT5A 2P91A 5AQEA 3DT6A 4ZOEA 3GGOA 1V25A 4PW0A 3EW9A 1Y1KE 2FUG6 1N2GA 1O6ZA 4OI2A 4D9JA 3FLEA 4MS3B 1ZESA 4RM3A 4M1TA 1TCBA 1U11A 1Z35A 3BERA 4X85A 2DR0A 3OM0A 1DWPA 1R0KA 1OYOA 2HDNB 5LYJB 4OFWA 4IWYA 2M6RA 2AE2A 4HLDA 1M2FA 3G2KA 7GPBA 3OFJA 4HN2A 4BYGA 1TQ4A 4Q9IA 4EA6A 1Z6AA 1AJEA 1I6WA 5F3WB 4E7PA 1DOZA 1PEKE 2ZP1A 2JIZA 1NV9A 1F0KA 2GH1A 3PRHA 4W9RA 2VHZA 3F3YA 4IHKA 3N74A 3O8QA 5LMCA 5IULC 5KYWB 2NO4A 2V96A 4HDKA 4O2AB 2QD4A 1ETHA 4W6QA 2P77A 4KAAA 4B4UA 2MYNA 2OZKA 4MQ6A 4AJ2A 4PFKA 1KK2A 3T41A 1TVEA 4GR5A 1GPAA 4CODB 2OKCA 3R0IA 1GPUA 4MLDA 2Q46A 1Z39A 4PNEA 1U0TA 3LA8A 3AZQA 5IDXA 3DVAB 4QHTA 3H8WA 3Q98A 1VGRA 2E89A 2JJMA 1MF7A 5JYBA 2OUIA 3COWA 4RTSA 3MWYW 5SV2A 3UFBA 3DEZA 3CNOA 3S2IA 3RTEA 3SY8A 1IHYA 3KEQA 2I3ZA 4YRRA 1J33A 1Z0ZA 1P77A 2C3OA 4OHRA 3WKBA 2R8YA 3PDJA 3RYIB 3X2SA 4B87A 4F1JA 2GJAA 1MJNA 4P5PA 3KZVA 1GT91 3G02A 1KI1A 4L9AA 3RC8A 1Z13A 3TKYA 2EZTA 4N47A 2VRWA 2DF8A 3AJAA 2J7KA 3OLYA 4R69A 5FBKA 1P33A 1Z62A 5LZ7A 3V4SA 5EYPB 3ZS8A 1C3EA 3GP3A 3KSBC 1UF9A 1RRCA 4Q4HB 5J4KA 5BR1A 3KXDA 1AOXA 4J2HA 1CXZA 1OUMA 4WRRA 2EQAA 4L9RA 3TTSA 4BFUA 3DV0A 1LWNA 2FQXA 1R18A 2CNBA 1OR8A 3AR6A 3IOBA 1ZZEA 4QGBA 5DOVA 1WVGA 4EB6B 2GESA 3EBOA 5GZ3A 2ZZNA 1T4GA 4G5RA 4WKCA 2J9XB 1L5OA 5C4MA 3NHUA 1REQB 4G01B 2Q7OE 5C5DA 1P0QA 1X1QA 1NRJB 4M38A 4TTAA 3WDLA 2XUJA 5FLXA 4W5TA 5BVGB 4R31A 1Q95A 4P7KA 3OTGA 2GNOA 3NYQA 1FYVA 4G1FA 5DLYA 3WV4A 1EVZA 4ZEMA 1M2WA 4V1CI 5HSGA 3UGJA 4A2CA 4C4ZA 3TR5A 4X0EA 2YIMA 3ZI4A 3R5FA 5J2TF 1DCMA 2JA2A 1KK3A 3T7AA 5EQDA 3UW3A 2JJYA 3W5AA 4QELA 4IRMA 3LK6A 4MWGA 3UC9A 2QA5A 3VNAA 4Y9DA 3AK4A 2ZIXB 3TTTA 5LP6C 4WESA 1MHPA 3E82A 3SSMA 1OFUX 4E1AA 2JLYA 1SBZA 4J1NA 1V96A 4ZYWA 2I4MA 4FGWA 1UBTS 4R2WA 2KQUA 4E30A 5CU7A 1S2LA 1KNQA 3SKXA 3SSOA 1T2AA 4HB4A 2Z95A 1C3OA 4C0WA 4W7SA 1XXHB 4DIUA 4D25A 1PYGA 1AGYA 4LE1A 1U6JA 1HTBA 1P6QA 3ANMA 5L3VA 3JQ8A 1YQXA 4PLGA 2V9PA 5U1PA 2WFMA 4KG7A 1XKTA 3YASA 2C9BA 1ZIYA 3NVAA 2ID7A 1DEHA 4LTNA 1JYEA 4TWAA 3F5DA 2Q3EA 2RIRA 5KAMA 1H2HA 2L17A 2PBLA 3B1JA 3DOEA 4XWOA 1F2VA 3K6SA 2JK0A 1KEZA 3IB3A 3MN1A 4F3KA 3L7KA 3KRTA 2J3JA 3IMKA 3NBFA 5DBEX 2H51A 4Q1EA 3DC2A 4WBNA 1SCUB 2Q6KA 1T8TA 1R88A 1P5ZB 4O6VA 4PHGA 4KQFA 4V0SA 4CKEA 3ONWA 8OHMA 3IUJA 4AN4A 4N7RA 1L5NA 3WXBA 2F4NA 2WT4A 4NBLA 4DLNA 4J16A 5CNJA 4NAUA 2NWQA 2ZJ4A 3JASB 5IKOA 4GOXA 2FZEA 1NXTA 1UP4A 1D7OA 2TMYA 3OT1A 4NG4A 4NS4A 1MVNA 3EXIA 3NWPA 1E3DA 2JRLA 2OBLA 3PD1A 4GI7A 5JMOA 1HNNA 2GPNA 1F06A 2ZBDA 1BXGB 3OICA 3OIWA 4EABA 2FTKE 2FFRA 3A6DA 2FW6A 2OE2A 2XBUA 3DMTA 4OMUA 3RQIA 3M6WA 4B2YA 5J4VA 4L5AA 2BTEA 1NXSA 4PZUA 1DCTA 2GZRA 5IM5A 3AF4A 5IARA 2FMKA 1X94A 4Q7KA 4KNWA 4OXIA 2Z98A 3HFGA 5C1DA 3ZWYA 1RACA 4IX9A 1NFFA 4KSBA 4P0TA 3ED1A 2IHKA 2V7XA 2QRUA 1UMDB 5EVJA 4U2CA 4B3MB 2WIJA 5IHXA 2Y93A 1V95A 3QVJA 1GKUB 1DV1A 4JB8A 1ISSA 1ZC3A 5AVXA 2X5JO 2XMDA 5D6NA 3SYLA 3IEPA 4J4BA 2WKQA 4KSYA 2WFAA 5BWCA 5AO9A 4C0XA 2Q45A 2X77A 1VE1A 4FZVA 2JLRA 3I39X 4QOHA 3RVBA 1PF7E 2BMVA 5B1IA 4EB6A 2P2ZA 1D1SA 1X1RA 2AXPA 1IJFA 2XITA 2BBWA 1XZQA 1ESMA 4PXSA 5BT8A 2CMKA 4BQIA 1J42A 1BHSA 3AERA 3VPCA 1F2TB 2BFPA 2W2LA 3WRXC 4ARBA 3AETA 4L1KA 2PH7A 2I6GA 1I14A 3GCZA 5LD2B 2BTQA 1W52X 3MT9A 3GJ6A 4W7HA 1NUUA 1Q7TA 3RTBA 4E0BA 1WKCA 2OL4A 3NUQA 4AZ0A 1W8DA 4RACA 1K1EA 3NKLA 3X3HA 3D8RA 1HK7A 2C9MA 2P8JA 2FLWA 3BIJA 4B7AA 2WQ7A 1J1UA 1RYBA 3MMZA 5HFAA 4C2BA 4O2LA 4RETA 2OUKA 1N1GA 4PX5A 5IN5A 3T1QA 5AVYA 3L04A 3VX3A 4MPDA 4FZ3A 2V9CA 5E95A 1DAGA 1L4NA 4DLSA 2CFTA 1Q17A 1UDRA 2R8XA 5HQ3B 4QNRA 4C06A 4MV8A 1RD4A 1K9SA 1WJGA 2X0IA 1NVVR 2C4TA 4AW9A 3QU7A 1C8VB 2JHGA 4D5EA 3PUYA 2QUHA 3BS4A 4YAOA 2FFQA 5A1TA 1M0SA 1YO6A 2B37A 1RCTE 2ZRNA 4R1LA 2A5JA 1DVRA 4CIDA 1E69A 3OLVA 5AW2A 1GYPA 4NJMB 2GDZA 3HU3A 4XD2A 3GLGA 4Q66C 2QX9A 1XZ8A 1FYFA 2XGOA 2Z2XA 3KYBA 5IJ9A 1EUQA 1KVUA 1UJNA 4G1EB 4EPWA 1IXYA 2GFQA 1PFUA 4FIDA 1ES9A 4RGVA 4A5SA 4D97A 5A2GA 1CRQA 1SCNE 4XJXA 1HDIA 2XBMA 1VLHA 5BW8A 2C59A 3RV3A 1JFSA 5E6RB 1PVOA 1NMYA 2WSYB 4IKOA 2PWPA 3IAHA 3LLVA 5DX0A 3RC1A 2QMZA 4X5OA 2CV0A 3DHWC 3G59A 3T12A 2PT9A 5IBPA 3TZQA 3Q7IA 1ZJYA 2P7IA 3AB8A 3OCJA 5F1KA 3LF2A 1JHYA 1ID8A 3L07A 2OMEA 4H7HA 2PGNA 1SBIA 1BXGA 4YWHA 3KE9A 3LFUA 2RJNA 2VOJA 3QX7A 4XM2A 1K6MA 3IE1A 2APJA 1FP2A 1BH2A 1ZD4A 2EFGA 3ZZTA 3SYTA 3UUGA 3NTQA 1T36B 1B6SA 1PJ3A 4NYIQ 2G76A 5K51A 1W93A 2GD6A 4U3JB 5BN5B 2GKOA 3FOZA 2OENG 3U3DA 5C8YF 4BOYA 2CV2A 4IZIA 1SQFA 4EPTA 4KR7A 1G3UA 3WGNA 3HP4A 1I6KA 4I1SA 2JI4A 3KOZA 3O4HA 5IWCA 3OPMA 4LTMA 3TE7A 4EG7A 5KWIA 1M6HA 3VR4A 1TRKA 2IC5A 3E3NA 1J5PA 2VTEA 3ESBA 4JDUA 4LJKA 5HMLA 4ZHQF 3LPNA 4J90A 3ONNA 1J09A 1EFHA 5CT8A 4BLQA 2QTLA 5EE9A 1AU9A 5FIUA 3VKFA 1ISPA 2Q3BA 4ER6A 3NBAA 2L19A 4GLBA 1JEQB 1N75A 2VDQB 2J3DA 3CLKA 1Q19A 2PBZA 2X1HA 1NY6A 1O6CA 4PC6A 6NULA 3KXKA 1YQTA 1TKAA 1NAIA 3HI4A 3WICA 3X43A 3CM0A 3THYA 4NBTA 1SGWA 4K6GA 4RDCA 1NXWA 1QFXA 2X9VA 4LXXA 5D5HA 4EJ0A 1TTQB 1E8DA 3OIVA 4XOIA 4Y1RB 3IS3A 4OU5A 3SYRA 5KYXB 5K6RA 1RW4A 2XNHA 3AJ8A 3L6CA 3Q6IA 1TAQA 1Z16A 1OZ0A 1C1XA 4IIVA 5L3QA 4PRLA 1ZMOA 1BIFA 5CHEA 4A6PA 4ZVUA 5H3HA 3VSEA 3D3KA 1YR6A 2V54A 3HXLA 3PNOA 4LDZA 3K70C 3DVRX 3PC8C 2XOKA 1VRVA 2QG9A 3GFFA 4YK7A 1ONBA 1RLMA 1AKEA 5FOWA 4BO0A 4EL5A 5CLJA 4ZT7A 5K6AC 4S05A 4QJBA 4G0WA 3DS8A 2YYYA 2FCAA 4FNOA 4KGXA 4D8XA 3KDPA 4XIIA 3ZQJA 2BKEA 4N3GA 2C2GA 3TINA 3HZRA 1P7CA 4JJFA 4UNIA 5AI0A 4EKDA 3COJA 4RZHA 3VU3A 5CPBA 3E8XA 5L6MB 5IK2A 2Q07A 1ZJZA 5ALPA 2ID9A 4H08A 1SIBE 3U4DA 5A5DA 1KIAA 2BEVA 2UZAA 5AM4A 3DOFA 1YQDA 5IT0A 3EGXA 3I1YA 5D1NA 4I36A 4MHOA 1RQPA 4Q4JB 4ZVNA 2XDYA 2DPMA 1IM8A 3PKIA 4KO2S 2YUIA 3UT0A 2JLWA 4M8LA 4TMFA 1DQYA 2NU9A 2MR5A 1XDZA 1NN3A 1IK4A 3WLNA 1J2JA 1UBUS 1XMXA 2Z8XA 1ESDA 3C14C 4ZKDA 4N6NA 4RQBA 5EJ6A 1RTKA 1TFUA 1Z17A 1BOFA 1EAYA 2O1EA 3W34A 3ET4A 5KC8A 4Q24A 1M1UA 4W1RA 3H65A 3VI4B 4MKXA 2IGTA 4I0WB 2DY1A 3G79A 3PSHA 1K0UA 4IXTA 5BV1A 4ND8B 4ETWA 1P1CA 1O9BA 2Y92A 1FFAA 2OCLA 1DPFA 1YFJA 2QM8A 5EQFA 2WQZA 1FC0A 3RO7A 2XWQA 5LBIA 2BSAA 1UXOA 1R0BA 3E9DA 5BSTA 2QI9C 1Y37A 1UKVY 1DKOA 1CUDA 3B2NA 3BXHA 1SVMA 3B7GA 3ICWA 1MOQA 3LC7O 2XLBA 4LV6A 1UXJA 4TZTA 2CBGA 1YGPA 2BBOA 2EFCB 2EZ4A 3OZ7A 3ODPA 4MV6A 4WA8A 1OH8A 1Q3HA 3KQYA 3KJZA 1HDRA 3Q8LA 1UKYA 1K3TA 3ICOA 2H2IA 4L16A 4CMAA 2VEDA 5FWYB 5B1EA 4OQQA 2K6GA 121PA 4ZOBA 1QORA 4HI0E 1AQIA 1LBHA 4MKZA 5DBHX 1Z22A 2D8AA 3STYA 1T4BA 3ZY5A 1RFLA 3HKCB 3W5BA 2CW5A 4FBGA 1NXPA 3W4KA 4BGEA 10MHA 2ZR0A 4JUFA 1SVWA 3I01M 3TKAA 3OZCA 4FFOA 3DDNA 1SFRA 3CGGA 2O6HA 4J75A 1WHTB 4MQMA 5TMEA 2Y1GA 3GLSA 3WG9A 1OFGA 1QH0A 2X0DA 3UB2A 3U31A 1VPVA 2WYIA 2GO7A 4RYDA 4Y1RA 4RK6A 1BS9A 1M73E 3EAQA 1T4DA 1XC7A 2BI4A 2ZCVA 1N5MA 1EGVB 2O20A 4LECA 5GQSA 5JANA 5IKXA 3L7AA 4D0SA 2PD4A 3THWA 2PX6A 1N9GB 5FDFA 2Y1CA 5LR6A 5BSUA 5LQDA 2COUA 2Z04A 4BMZA 1SQ0A 2J41A 3BZWA 2M1XA 5KOHA 3WNCA 4K8OA 1PO7A 3EMVA 1N2OA 3AHFA 1IHDA 1G7CA 4GGOA 3SIPA 1E6KA 4H7KA 4DY6A 4JUBA 5EJ8A 3O1JC 4ICIA 4NV3A 5KWSA 4OX9B 4PNPA 4CEIB 3D02A 2BPOA 3U3XA 1HNWB 1XHFA 1N2IA 2QP3A 3TL2A 3AVUA 2JHFA 2NU7A 1GPKA 2IU0A 3SF0A 1RAFA 1AD2A 2FZLA 2FKAA 1Z0DA 4NSNA 4MI9A 3DAFA 4BKQA 3RUDA 4FNAA 4BO2A 4AKHA 3JX9A 1B0PA 2FXIA 2KW5A 4D8VA 5FOXA 4GVXA 3W1EA 3K1TA 2QUKA 1NF3A 3UGKA 1E32A 3LUFA 1KI4A 1B1AA 2G04A 5J2TA 3MUNA 4TN1A 1HYGA 1T5IA 1L5ZA 2IKSA 2QRVA 1NBHA 3CRQA 2B69A 3EA4A 1WEHA 3HJCA 5DWQA 3VNRA 4ND5A 1ZSVA 1RXUA 2D74A 3SIWA 3QG1A 5L95A 2NXWA 2YWHA 2IYSA 2PMWB 2WV9A 3H6GA 1DAMA 1UBRS 1A4UA 3ABOB 2H1OA 4MR7A 4KQHA 3FJOA 3GEDA 2BUCA 4BQOA 1ZK2A 3HKEB 4PF1A 4X3CA 5CT6A 3T4XA 3R0XA 1IQPA 5K0GA 1NM5C 4Y2JA 3NDBB 1PS0A 3EH2A 1UMBB 1VB5A 2A67A 2P78A 3C16C 1SHKA 3LI2A 2VCYA 1X3LA 5E3JA 3ZQKA 5T7BA 4CGZA 1CRPA 1TLLA 2NAPA 4II2A 6REQA 5JH7A 5JYCA 1G63A 1K7XB 2YHBA 1XMJA 4L02A 2NW6A 3U81A 2LW7A 1T1IA 3UW1A 1LZKA 1M1YB 3A10A 1P7PA 4IVNA 4QAJA 5BW5A 1O9HA 3X1ZA 5IEJA 1EHYA 1ZH0A 4ACBA 4K0RA 3N76A 1V4VA 1PDVA 2ZATA 4O29A 3WIDA 1PK7A 4F91B 3AM4A 4QM6A 2ETXA 1MO2A 3FCEA 2AW5A 4ND7A 2H1FA 1RYNA 4WZBA 5E1OA 4MO2A 2IPAB 2WAAA 3UBMA 3DE3X 3HBAA 4WT7A 2D3WA 1FTSA 2W8BA 4ADSG 5A4AA 1LD3A 2BFOA 3KU1A 4TMTA 3I2JA 1KTVA 2ECFA 2IXTA 1I01A 1ISHA 2KWIA 4HWOA 4E2FA 3BMOA 2VYVA 3OPYB 2HYIC 1VGVA 2Y1LA 1FFWA 5I7UA 3HJTA 4WJKB 3MQ4A 1BCRB 2VJMB 4ARCA 1XZLA 1QX3A 4CQJA 3GR6A 1DLJA 2ZVQX 4ZQHA 1PJZA 1U7TA 5DP1A 1QUEA 3KTOA 5KX5F 2NO9A 1NFRA 3KUKA 4JLMA 2HC9A 4HADA 4JJZA 5K3SA 5JFOA 1F9EA 1ZH6A 3TB4A 4OSEA 1R16A 5C8YB 4HXEB 5LZ4A 2BVNA 2CJPA 4ENSA 1Q7RA 3LD9A 1VKZA 3IAM6 1K8ZB 4S35A 2R8OA 4WNAA 5BPHA 2R2GA 1R9MA 3FNGA 3HYSA 5K0ZA 1RI4A 1OGIA 2IPLA 5IVPA 4CEIA 1GP2A 1XFAA 1DQPA 1LFAA 2P69A 3EWSA 4QRIA 2Y0BA 4X6LA 3PFKA 1L7DA 4C3ZA 1HZZC 5K8TA 3VO9A 2Z2IA 3DNMA 1WCIA 1GKLA 3U2QA 2O07A 2OO3A 2LV8A 3IVRA 1P75A 2IIPA 4L15A 5CXUA 3DO6A 2CC2A 1D0IA 2WHXA 3UWMA 1VHQA 3D6NB 4FCTA 2BEJA 4O1IA 5E9WA 1VHJA 3O90A 3AG5A 2DFDA 4HZUB 4E1VA 4QJIA 3U3KA 1F0PA 3MQFA 3MYRA 3BMCA 1WOYA 1JNXX 3LC0A 3R2JA 4K3VA 4QHYA 4Y6PA 3TN7A 5BWOA 4IF6A 2HT1A 4HUQA 3E5MA 2WW8A 4WY2A 4PPNA 5LYYA 1LDMA 1NAHA 1ZJ5A 1DRKA 1VLLA 3E4DA 2W98A 3QYFA 5DCYA 4EKNB 1WMEA 4LY6A 5EHXA 2YIDA 3IP9A 1V43A 3WJ2A 1AQUA 4BX9A 4WQMA 1XL1A 3FKSD 1B16A 2GEDA 4OU4A 1AN9A 4BO6A 1H0KA 1JIXA 2P1RA 4FCCA 4B5LA 5K20A 2IYPA 3B85A 3LOPA 4ZQEA 4BIMA 4PLWA 4ZGWA 5B1YA 1UPAA 4GMDA 4DANA 2A0KA 2Z6QA 1E9DA 2F1OA 3DXZA 3OPQA 3CX3A 3TTUA 2PY6A 1RXWA 3I73A 1KJJA 1H69A 4R6WA 1NBOA 4RZUA 4K9OA 2IDZA 2G09A 2I3DA 3JZIA 2H7CA 4MK4A 1SBYA 3GFPA 2I33A 5DLDA 3SZMA 2DYKA 1EWRA 1RBMA 5CYFA 1A8QA 1AK9A 1KJWA 1NZJA 2XF8A 2ZS9A 4KR0A 4OKSA 8ATCA 1UBNA 2GEFA 5LA6F 1VE5A 1G8SA 2QG4A 3F0TA 1NR7A 1QIFA 4N3NA 4I6GA 4BV8A 4ZVQA 2FVYA 4EG3A 2B5OA 5F12A 3WISA 1FMJA 2PG3A 2IUEA 4ZFNA 4DAOA 3I4LA 1NQVA 2QB5A 4KQEA 4AT1A 4PC2A 1KQ3A 4Q21A 4I8IA 1QONA 4D92A 3KQSA 3TS1A 4RPGA 4CKCB 5FBRB 5CVJA 3L7LA 2Q5EA 1FSPA 5EJ7A 5AM2A 1ZKDA 4TMXA 5KYVA 1A7AA 3L4JA 1GUYA 1B93A 1U2ZA 2XB8A 3IEXA 1UQRA 4YACA 5BSVA 3M82A 4ISCA 1RWVA 4RJKA 4RJ2A 1SXJD 4FFDA 5C8YA 4B4DA 1NI4B 2JC3A 2X8JA 4OPMA 3WP0A 4TL9A 1WXDA 3ZLJA 2JATA 5PGMA 3WK6A 2AW3A 3VNSA 1VKHA 4DQUA 3I0NA 3MSXA 5DYTA