4QEDA

Elxo y152f with nadph bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILFGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ElxO
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qedA00
1DIRA 4YA6A 1NTOA 4Y67A 1NBOA 2I9PA 4AJHA 4WLFA 4EJMA 1N1EA 1R12A 4H7PA 1T2AA 3WX0A 3FNEA 4R51A 4DGSA 4YDRA 5G0WA 3LLSA 2VZ8A 4GVXA 3ZH2A 3JQ9A 1J5PA 1GY8A 1A9ZA 1CERA 4X54A 3ANMA 4Y98A 5AYVA 3RQSA 4C7KA 4UEJA 4YJGA 2EIHA 4I8XA 2PKRA 1YBVA 4YR9A 4E0BA 2OP0A 3VPFA 2DKNA 3AK4A 4BNFA 4E4YA 1NR7A 3C7CB 3I9LA 1M66A 2CY0A 1EVZA 2X8LA 1NVTA 1FXSA 2C7VA 2OBNA 4ZGWA 3LT2A 2YDXA 1DB3A 3GVHA 3AY7A 4D41A 3BTUA 3U62A 2WYWA 2GN8A 2FSVA 4CMJA 3NT5A 3VPGA 4XIJA 1LSOA 1DIHA 4BO7A 1X7HA 1E7SA 3EK2A 4K6CA 5KVSA 3ZNNA 3OEWA 4GLOA 1MA0A 5KJEA 3H9JA 3GNQA 4FBGA 4GQAA 5BNTA 3RD5A 1PGNA 1FDUA 4TZKA 5HRUA 3DXFA 4HADA 3O38A 1I33A 4OOFA 4CQLA 3PHGA 4ZVVA 5JMPA 1ADGA 2GERA 5IXSA 3JQAB 1EVYA 4FFMA 4I5GA 4TQGA 4FFOA 1FJHA 3DL2A 2GN4A 4Y6SA 2VHXA 3CH6A 4R5MA 5CDSA 3PJDA 4B7XA 5G0TA 2C20A 1WXDA 4XRRA 1ENZA 4DPLA 1Q0LA 2HUNA 3GLQA 3JQ8A 3F6YA 4J9UE 1D4FA 4BNWA 4XDZA 1DO8A 4GX0A 3VVCA 5A9SB 3MJEA 3S2EA 1GZ6A 2G82A 4MKZA 4XQEA 1UP6A 3DZHA 4Y9DA 1V0JA 4HXYA 3KV3O 2WYUA 1WZIA 5J23A 4WKGA 4E2WA 3WYCA 5DBFA 2VYNA 3K2EA 1UP7A 1Y1PA 3TSCA 4BNYA 2HKIA 4YRDA 3FBGA 2VHWA 3ROKA 2BFOA 3Q11A 3BMQA 4U5QA 4WNIA 3WR5A 4E30A 3SJUA 2W2KB 4R41A 4OH1A 1OOEA 3IS3A 4E21A 3PZRA 5CG1A 1H9BA 4BL5A 2IZ1A 4NU5A 5CAEA 4JP3A 4D0RA 3C1OA 1DC5A 1LLQA 3JYPA 4UVDA 4B4WA 3HNPA 1PGQA 3GT0A 3D0OA 4IXWA 3VZQA 4AJ4A 3C7DB 5BNFA 3U3XA 1RWBA 3NAQA 1F17A 3RC7A 4RVDA 3H6KA 4WLOA 4YJDA 1A4IA 3WQQA 5G4LA 5JAIA 4CM9D 1PZGA 4HX5A 1PL8A 3EYWA 3WGGA 2DU8A 3WSVA 5L7WA 1MG0A 3FPLA 3RUCA 1HDZA 5T57A 4HV4A 1B2LA 2Q4EA 3K73O 3OJFA 1GTMA 2ZB3A 3JQ9C 4WEOA 5TQVA 5JY6A 3H9EO 2CVQA 4ALNA 4XZ3A 4GH5A 4NNJA 1BXGB 3WYBA 3HDQA 4NHEA 4B4OA 1FDVA 4CUKA 3D4PA 4OKIA 1JDJA 3K30A 3MTGA 4B7UA 2YQ4A 3ZHYA 3KO8A 3CPSA 3RUFA 3KXDA 3X2EA 1E7MA 1MP0A 4JBIA 1LDYA 5A5EA 4CM9A 3IAHA 1I3MA 3AI1A 1DIBA 2W98A 4Q9NA 3I9KA 4UEKA 4LSMA 4CR7A 2BI7A 3BHMA 2GSDA 1JWBB 4FFPA 1A7KA 4CM8A 4M54A 4CMGA 4OQZA 4AJEA 3P5SA 1PGOA 2CDCA 4CQLB 1UZMA 1PEDA 1ZJYA 2WYVA 3OIDA 2A94A 3PK0A 3QVTA 4P22A 3GAZA 3MWDB 4R9SA 1V3TA 3DHNA 1AXEA 2X5JO 3EHEA 2E82A 2GZ1A 2BLLA 1RKXA 3M1LA 1QV7A 4FGSA 3ROMA 4RVFA 5JCXA 2GASA 4CV0A 2P68A 5C5IA 4IMPA 2JKVA 1NM5A 2RHCA 3Q2KA 1QLHA 1VL0A 3OH8A 5LC1A 2JHFA 3PQFA 5KJFA 1DC6A 3JQ8B 4RZHA 1IOLA 1ZCJA 1Y7TA 4YJHB 5U1PA 4GL4A 4LVCA 2PH3A 1U2DA 4CV1A 4D45A 2HRBA 2O3TA 3OMLA 1ZKMA 2HCTA 1YQXA 1ZIDA 4O0LA 2VYVD 1TEHA 4P38A 4BNNA 1PL7A 4TRMA 3TRIA 2CZCA 3M1AA 1N1GA 4BO0A 3KEQA 4K28A 1E3SA 2BI8A 3JQ6A 1I32A 1H94A 4M89A 2C5EA 4J9VA 4Y6PA 1E6EA 1EVIA 1PWZA 2FZWA 4ZRNA 1R15A 5A03A 1T2EA 5JCJA 3P7MA 2OBYA 1EBFA 4CUZA 1D7OA 1P74A 3KYBA 3ZV5A 2CDAA 3GY0A 2YHUA 4BKRA 1W6UA 4ND2A 4KDFA 2B36A 4WGGA 1V3UA 2Q2QA 5IFLA 2JCVA 4ESOA 1EMDA 2EHDA 4PFJA 1DOHA 4BNTA 4O6VA 3WLEA 3H2ZA 3FHLA 3GNTA 2EEZA 4CLRB 2PGLA 5GZ3A 1UJMA 1B16A 1T26A 3KOUA 1HF3A 4LISA 4J4HA 1I24A 1PIWA 3JQGA 4ALMA 5AXDA 2D59A 3Q1LA 4DLAA 4YT5A 4FSHA 4IDEA 1QYCA 1C0PA 2EXXA 4GMGA 1MC4A 4KWIA 2BRUA 1IZ0A 1TXGA 1VI2A 3JD4A 3GEGA 3QVOA 2O4UX 1MC5A 2HK9A 4GAEA 3D5QA 4EBFA 9LDTA 3D3WB 4UVEA 4AJIA 3LT0A 2NV6A 4XB1A 4DTIA 3GGGA 4KDEA 4DPKA 5I8ZA 2E49A 5KJ6A 1IHXA 3LK7A 1LJ8A 4JGBA 1E3WB 1PJCA 2O2SA 1T4BA 4AJNA 1B8PA 1BXKA 3ONEA 4GVLA 4Q39A 1UXJA 1NAHA 3FWNA 4N18A 4PVDA 4Y8VA 4TSKA 4NU6A 2O23A 5FI5A 3ROPA 1EFKA 4PZEA 2IYOA 4YCAA 2DPGA 4ONEA 4PLHA 1GEEA 2AEMA 4OMUA 4F46A 3PJEA 4TRNA 1JKIA 1O94A 3DWFA 3ONFA 1ENOA 3MTJA 2DFDA 4LW8A 3VPXA 1FF9A 1R66A 1R0LA 3ADOA 1NQOA 3WFJA 4EUFA 1HEUA 3TQHA 4IJUA 1HXHA 2FRDA 3PRJA 2H9IA 3QV1A 2QYSA 3DO5A 1NWHA 1VM6A 3GGPA 3NJ4A 2RHRA 1R4NA 4JN6B 3HADA 2NTNA 1KVUA 4KZPA 1PQPA 1C0KA 1UXIA 1XQ6A 4RF2A 4CMCA 2P2SA 1YONA 1A72A 3H5AA 4M87A 4NK5A 4BNIA 1NHGA 4PLZA 3VVBA 3NYWA 1DJNA 1EDOA 5BT9A 3B1KA 3W4JA 4WOJA 2BGLA 4H16A 4N5NA 2C29D 3PHHA 3Q0EA 1UDCA 1X13A 1H0KA 3GC6A 2X23A 4J2OA 4J7XA 2I99A 4JK3A 2RCYA 4R3NA 5JO0A 1YQDA 2CVOA 4AG3A 5JAMA 2PZLA 4UUPA 1TT5B 1LI4A 2Q4BA 5T5QA 3WFIA 4IIUA 1XHLA 2HJRA 4FJ1A 4R54A 4RPKA 4R1TA 4DMLA 1WMBA 3ONDA 1NPDA 3GEMA 1VJ1A 5DCUA 3VDQA 3DAPA 4OO3A 1Y5MA 4ZQHA 1NYTA 2DFVA 5C37A 1YL7A 1GL3A 4R1NA 1WLYA 2HLPA 4KWHA 5EIOA 1U4SA 5DF1A 1OBFO 3FRJA 5EQDA 3QWFA 1NPTO 2P9CA 4NJOA 4CR8A 4IM7A 3PGXA 3V5NA 4BO9A 5ER6A 3U5TA 3JQGB 4PLWA 3VZPA 5DNAA 4BQRA 4NBRA 5AXAA 5EPOA 2CD9A 2Y0EA 4CM3A 2IZZA 3RUHA 3I9MA 5B4UA 4PG7A 5HS6A 1AE1A 1GADO 4UVGA 1GUYA 2AG5A 4GKBA 4QFDA 3HWRA 1TA4A 4CQMD 5JDIA 1YKFA 3FNFA 3IP3A 4MIOA 5COAA 1ZO8A 2Y05A 1E0DA 4MVJF 5DDIP 3SC4A 1H93A 4BO2A 3Q6IA 4K6FA 5CDUA 1IE3A 4EYEA 4D44A 1LQUA 4B4VA 1SCUA 1FK8A 5F1OA 3AFNA 1K6XA 1H6CA 1LLCA 3WGYA 1PU2A 2I65A 4W4TA 5KCZA 4OAQA 2QYTA 1BTOA 5JS6A 4XIYA 5CEJA 2VQ3A 1ISIA 1ZVMA 3DAGA 3KB6A 4ZD6A 1H6DA 1UAYA 1P1KA 4MKXA 3UVEA 4NK4A 4CM1A 2OL4A 5BSFA 4KTVE 1LU9A 1QR6A 4J16A 1LA2A 1Y8RB 4BMSA 1ZK3A 1KERA 2FPPA 3PGJA 5I9NA 4BNXA 1F14A 4PG6A 1DRWA 4CQMA 5IN5A 2J3HA 2O50A 3FTPA 2VHVA 4XCVA 3I9OA 1BDBA 1EE2A 4FPXA 3NGLA 3OP4A 4HWKA 2O7SA 2HMVA 4KMSA 3I52A 3ASVA 3HN7A 2FOIA 4XRGA 2NM0A 4NR0A 1CETA 1F06A 1SZJG 2PGJA 2W2LA 3SJ7A 4UVHA 1DC4A 2IE0A 3O26A 4Q3AA 3SBOA 2QRKA 3E8XA 5KTKA 4A7PA 1S7CA 5K6AA 2JFFA 4BKQA 2AA3A 3ZGYA 5JE8A 1I5RA 1CJCA 3DC2A 4JX8A 2Y1FA 1UH5A 1JW9B 4Q3EA 3WLFA 1E92A 3DBVO 4N5MA 4DC0A 4PIVA 4L74A 4FC6A 3F4BA 1MFPA 2ZKLA 5C7IO 3DDNA 3IDSA 1LRLA 2Q3EA 4RF3A 1DBVO 2Z1NA 3CE6A 1KEPA 1VPDA 4ZJUA 4RF5A 2E48A 1P45A 4B79A 3UKOA 1DFHA 5MGBA 3MJTA 2D4AA 2GGSA 1U4OA 2QHXA 1Q2XA 3H7AA 4XYGA 1VJTA 1MB4A 2J8ZA 5G2OA 4NBWA 4Z3KA 1YJ8A 4NBUA 3BZUA 3WSWA 2NQTA 2X5OA 3WGQA 3IKVA 1GCUA 3FF4A 3E9NA 4L76A 4DBVO 5KIAA 3RC9A 4CLXA 3L0DA 3F47A 4LVUA 2GO1A 4LRSB 3WIDA 5GZ6A 1LC3A 1T2DA 3WIEA 3GPDG 4HNHA 4XR4A 2P5YA 1DHRA 3GAFA 2V6BA 1TB4A 3KM0A 1OC2A 4P4LA 4QFCA 3BIOA 5HS4A 2JJYA 1H9AA 4FOSA 1HYGA 4MJLA 4RF4A 2EJWA 1SOWA 4PLVA 3WGZA 5JSFA 3FNHA 2POQX 5C7LO 4J91A 3JQ7B 5F5LA 4I9UA 3W1VA 1BDMA 1BXZA 4YQZA 4O59O 2A4KA 3JD2A 4FIZA 4OSOA 1QKIA 5JDIC 4L75A 4NH4A 3TOZA 2NVUA 3KLPX 2PKQO 4KOAA 3SC6A 3ZWCA 1PR3A 3NDIA 4M55A 1NASA 3AUAA 4FOOA 2AXQA 2DM6A 1HE3A 4HNGA 2FZEA 3OF2A 1SB8A 2IYPA 1PGPA 4O1MA 1XA0A 1PS8A 4MVJM 4Z6KA 4PG8A 3FBTA 3RUAA 1E3JA 2HMSA 4L8VA 4RVSA 5KVCA 1P1IA 4XD2A 1ONOA 3HDHA 3E9MA 3TJRA 2NADA 1L1FA 3BTOA 1GZ4A 1Z82A 3OM9A 3RBZA 5K0ZA 1CEQA 1E1KA 4W82A 1GQYA 2EV9A 2VHYA 4J1TA 2DPHA 3GF4A 4DA9A 3RFVA 6LDHA 5JAQA 5HWSA 3ENNA 2HK8A 1PZFA 3P2YA 3RJ5A 1JLLA 3F46A 3MJCA 4DQUA 1L7EA 2NTJA 5C7OO 3DOJA 1BSVA 3ZWOA 2CSUA 3GH3A 4OL9A 4MIYA 4WOKA 3WGHA 5A1TA 2UYYA 1P0CA 1T1SA 5GZ1A 3NEPX 4DLBA 4P8RA 4FFNA 2Y1GA 3QWBA 4N5LA 1GYQA 1CQIA 1DHTA 3FTNA 3O9ZA 5H83A 5ITVA 1DXYA 1O89A 3I3OA 4XEHA 5K6AC 2B83A 4R3WA 1N8KA 2ZYDA 1M67A 1P1JA 2NUAA 3E5RA 3ICPA 1RM3A 3IUSA 5IXYA 4UULA 4BO4A 2DVMA 3H8VA 4U6SA 3SLKA 3UCFA 3ST7A 1ISMA 3GFBA 1YH3A 2FP4A 2GD1O 1JKFA 2VNAA 2XAAA 1HDYA 2DBRA 2IRWA 4FW8A 4IJVA 1MG5A 3ULKA 4RVUA 1UDAA 3R0IA 1ZEJA 1E7RA 4AFNA 3VZSA 4CMHA 3OQBA 9LDBA 1YDEA 4Y6RA 4CMIA 4NPCA 3EUWA 1QXSA 2VRCD 1NX6A 4LCEA 1CIVA 4GLLA 1E6UA 5IDWA 5A05A 3VZRA 1K6JA 4CLHA 2PD6A 2V6FA 1DIGA 2GN6A 1B8VA 1YE3A 1XLTA 3WGTA 2QIOA 5IDYA 5A5FA 1X7GA 3DBRA 4XJTA 4DC1A 3ZWBA 4IY1A 4EW6A 5L4SA 4R01A 2WD8A 5TT1A 3NJ8A 1HDCA 2NU7A 3GPIA 1ZK1A 1EUCA 3PI7A 1JWAB 1VJ0A 4DREA 5KJCA 3ANLA 2ZJ0A 3G79A 3UGKA 4CMEA 1OFGA 4OSPA 2YJZA 4JJFA 1C1DA 3C8MA 5L95A 2VRCA 1BVUA 2BF7A 1K2WA 1GQQA 1MXHA 3V1YA 4LCJA 1ARZA 2WJPA 2PGDA 4N54A 3RBVA 2X7HA 5A04A 5BSHA 4PLFA 4RQTA 3BMNB 1QYWA 3DONA 4J6FA 2YYYA 3I4FA 4BNUA 1U7HA 3LC2O 1B0AA 4XGNA 5IZ4A 1M2WA 2O3RA 3E9QA 3LQFA 1GCOA 3ANNA 3AJRA 3V2GA 3OSUA 4JBHA 1XDWA 1Z73A 3GVIA 1BVRA 1Y5RA 3U4IA 2A9FA 3K92A 3UFXA 4ND1A 2Q50A 4CV2A 3L6EA 1YGYA 1XKQA 2B5VA 2C5AA 2Y1CA 3G1TA 3KYDB 1YOVA 2OP1A 4I5FA 5TJHA 4HUJA 5DBIA 4RDHA 5DT9A 1LDGA 3DZIA 4JLWA 1HRDA 4URFA 5EMHA 3U0BA 3DQPA 1V35A 2Y1OA 2ZQZA 3OICA 1HKUA 2Y1DA 3MCVA 1BHSA 1ZXLA 1I0ZA 2YV3A 3OA0A 3C3XA 3JSAA 4ZHSA 3WWZA 5DBGA 4Z0TA 3GN1A 4R1SA 4EITA 4PZCA 5B12A 1NPYA 4BKPA 4BB6A 1DC3A 2ZATA 4UUMA 2R2GA 1P9LA 2UUOA 4DVJA 3W6ZA 3TN7A 4RO0A 1XYGA 3B6ZA 3RKUA 4RPGA 5L3ZA 1KC3A 2X0RA 4CMBA 5DP2A 1F0YA 3RKRA 2YHIB 1X14A 3BTVA 2GZ3A 2GLXA 3C7AA 3GEDA 4UUNA 4B8ZA 2AE1A 4FR5A 3OQ1A 3RUEA 4MVJE 1NFQA 1RM0A 4J4BA 3RCBA 3D3EA 2VWGA 2DTEA 3MWEB 4MIEA 3ETDA 1E3LA 4Z3DA 2Q1TA 3EZLA 1SBYA 4FGWA 2GDZA 2RAFA 1E1MA 3WJAA 2NU9A 4RQUA 4L4SA 4QT0A 3RC1A 4E5YA 4BHTA 4XGKA 3AUUA 5JYEA 1KS9A 3B1FA 4YJGB 3SEFA 2VCYA 3O8QA 5BNIA 1NQAO 3GMSA 3WICA 3HFGA 1XGKA 3AM5A 3QSGA 3RROA 1U5AA 1PJ2A 2EKPA 3DZKA 1SB9A 3ROQA 1A5ZA 3GUCA 2DTDA 1GYPA 2TMGA 3ETEA 3QJ5A 3TF5A 3FSRA 4PG4A 1ISHA 5HA5A 5ILGA 4LN1A 1C1DB 4DIBA 2NLOA 2I67A 4IS2A 3AW9A 5TJ9A 4CMEC 3HUDA 3LYLA 1NWCA 3SXPA 4E13A 1CDOA 1NHWA 1H2BA 1YBAA 2VN8A 1R37A 3QIVA 1LTHR 5T8KA 5CHEA 2Y1EA 1K5HA 1SEPA 2UV8A 4XWYA 1DFIA 3KSUA 4J0EA 1YB1A 1E77A 2BGMA 1UZLA 1VRWA 4DIOA 1YDWA 3NRCA 4CJXA 1KVSA 4QECA 4GWGA 1ZSNA 5TX7A 4DMMA 5ENDA 2B4TO 3GFGA 4W99A 3AOGA 1P3DA 3BHIA 4AJLA 2R00A 3DZFA 4TRRA 2BD0A 1P1HA 3I5MA 1WWKA 1YO6A 4DQXA 3RUDA 2O3JA 2JCYA 4XGIA 3JD0A 3UN1A 1H2HA 4LMRA 1PWXA 3PHJA 4RL6A 5DN9A 2F00A 1AN9A 1M6WA 3IIEA 3LF2A 2G5CA 3BMCA 1WPQA 1FDTA 2GCGA 2PH5A 3A1NA 3KLMX 2Q1UA 2RBEA 3DBHA 3QE3A 4EJ0A 2VOEA 1Y81A 2JHGA 4Q3NA 1GUFA 3NDRA 3P19A 4ID9A 3S55A 5COQA 5ADHA 3WGOA 4WECA 1CF2O 5FEUA 2VTDA 2DQ4A 4ZICA 3E48A 4TKLA 2JD2A 3BMQB 4XQ9A 2HU2A 1P44A 2X9NA 3H9UA 3RIHA 1KEVA 1SO8A 3C24A 4G2NA 2FPIA 4PZDA 2BFAA 1U28A 2X1HA 4DPMA 2OMEA 1NQ5A 2AQIA 3EW7A 3PDJA 1XSEA 3LSYA 1LRJA 2YQ5A 3ZHXA 1D3AA 4S3MA 4DBZA 2VUUA 4AJJA 3E6AA 3X2FA 2EP7A 3WJ7A 2VYVA 3H9GA 4CL8A 5FI3A 2X0IA 1X7DA 1E5LA 3K31A 2C0CA 4DWVA 3LVFO 1D1TA 2OUIA 3F5SA 1ISFA 3OHSX 3L9XA 3U4DA 4F6LA 2V6MA 3F3SA 2QRJA 4INAA 4J1QA 4IINA 2YV2A 3RAJA 1QYXA 1ORRA 3I6QA 2XXJA 1CYDA 6ADHA 1Z7EA 4IS3A 4NFHA 3OQ6A 2GR9A 5B37A 3GDOA 4OXKA 4ALJA 1XWFA 4ND5A 5ICSA 1LX6A 3PQEA 1T4DA 4BNMA 1DLIA 4JP2A 3GZNA 2HQ1A 4KUEA 4E33A 1T2FA 1G0NA 1LDNA 1QV6A 3PJFA 5DOZA 3ZWNA 4BMNA 5C3MA 4XA8A 1RJWA 2OO5A 1KC1A 4YPOA 2Y93A 3GVPA 4CR6A 4IQ8A 1EBUA 1KY4A 1ZW1A 3RU9A 1E1NA 2DTXA 3OETA 2B69A 5K9ZA 2O2YA 5EJ2A 4I9HA 1BG6A 4CM8B 1Y6JA 4E32A 1C14A 4ROSA 5T8KC 1OAAA 5H81A 3LC1O 4FJ0A 1GPJA 1J0XO 2FR8A 3CEAA 1KY5A 1YB5A 3ZWPA 3R6DA 2IDZA 1PJBA 2QRLA 1E3EA 3ZV3A 3OEYA 5TLSA 4YT2A 3PP8A 1A4UA 1DIAA 3TZ6A 4BOYA 3HDJA 3OIGA 4QSMA 4QX6A 1R4MA 3KBOA 4M8SA 4IDFA 4NIMA 1BW9A 4BIIA 2X6TA 3A28A 4A5OA 3JQFA 4TMFA 3HG7A 3V1UA 4BO5A 5A9RA 1B15A 4A2CA 2R00C 3PTZA 3QWHA 3PEFA 4E2ZA 4YEDA 1BWSA 2XPCA 4R5HA 4RCVA 3C85A 3HB4X 3DBHB 4E31A 4YAGA 3MJVA 4IPTA 1XR3A 4XKJA 1KVQA 3D4OA 1B7GO 1C0LA 4J7UA 3PQDA 3BAZA 3NT2A 4BNGA 1X15A 3MZ0A 1IPEA 3C1TA 4XB2A 2Q2WA 3UAGA 4CM4A 5DOVA 1B14A 5A3JA 1DEHA 4M1QA 3IP1A 5L4LA 3DHEA 4ZQBA 1LDBA 3ICCA 3KRTA 4NBTA 5FFFA 5BSEA 5KWEA 5DCWA 4FC7A 2X9GA 1EFLA 3JYLA 3VH4A 5A06A 2VUSA 2EGHA 1NP3A 4GX2A 4I9NA 3ZNOA 3RSHA 3AFMA 1HYHA 2NVBA 4OQYA 4A10A 1HSOA 3OBBA 3DBLA 1PQUA 4J1NA 4E5NA 2NACA 4PLPA 3VC7A 3H3JA 1Z7BA 5A3VA 4E2XA 4WLVA 1HYEA 4DRYA 1SNYA 4L0QA 1FDSA 1KYQA 2PNFA 4R1UA 4TWRA 1VKOA 2YFHA 2OXIA 1VL6A 3ZWMA 1Q0QA 5KNLA 2X9VA 1A27A 1QG6A 4YAEA 2UAGA 1XQ1A 2AQHA 4RORA 4CLOA 3BA1A 4QEDA 2D5CA 4ALIA 1DAPA 1TVEA 3MOIA 4IJWA 3HE3A 2GZ2A 3EZYA 2VT2A 4UREA 5ITWA 2V65A 4UUOA 4B4UA 3TFQA 1XU9A 2Z95A 1U8FO 1YB4A 5EL0A 5ENVA 2CVZA 5CEFA 1ONPA 1PQWA 1SEVA 4C7JA 3KVOA 2A92A 2QZZA 1WZEA 5JPIA 4BNVA 4E5PA 2NWQA 3OFSA 3QVWA 1VSUA 2D5AA 2OHXA 4WUVA 5DULA 1JTVA 1DLJA 4NJMA 3BXXA 3CSDA 4WCFA 3AU8A 3HDYA 4A26A 1C1XA 1YL5A 3AUTA 1AHIA 1IYZA 1GUZA 3WYEA 3IKTA 1SAYA 2I6TA 2OGUA 3CTMA 1K0UA 1Z75A 3LDHA 5AOVA 1JKJA 2EP5A 1ZSVA 1RYEA 2UUPA 4RDIA 4IDDA 1WDKA 3CUKA 3G1UA 5T6BA 1U3VA 4CMAA 5JXWA 1R4MB 3V2HA 1SMKA 4UVIA 1BW9B 2EW2A 4FFLA 1DRUA 2P5UA 4E3ZA 1R4NB 3A06A 1ZXBA 4JCOA 1NR1A 1OC4A 3PVZA 3EC7A 2YDYA 3GR6A 3I9JA 4O63O 1MGOA 4TVOA 2X58A 4HKTA 3ITDA 3JQFC 4R68A 1O0SA 3NUGA 3JTMA 1PTJA 2HMTA 4IMRA 1BGVA 5DCYA 4YAIA 2O7QA 5B4VA 1QRRA 1O9BA 3BTSA 3KZVA 3R1IA 5BSGA 1V3VA 5F21A 4MVJP 1ZH8A 3PWSA 1N9GA 4IDCA 4QO8A 3F4LA 1B3BA 2HMWA 2Y99A 5ILOA 4E5MA 1O5IA 3ZWYA 5CDTA 5I9LA 3H3FA 3CZMA 1EZ4A 3SVTA 1I2ZA 4LSWA 5LDGA 4D43A 4MP8A 1GDHA 3JQBA 4M86A 5I7EA 2J3IA 5IDXA 4BNHA 3JD3A 5IN4A 2Z5LA 5ICMA 3G49A 1N92A 2ET6A 3ZZNA 1NXQA 1ZJZA 1Z45A 2WD7A 2O3SA 4U0KA 4EUHA 1IL0A 4UAGA 4O5OA 3UCXA 1IULA 3DTYA 4WEQA 3CXRA 1GZ3A 2E6UX 4WCDA 1I3KA 4HY3A 1WMAA 4JNKA 2PZKA 4P4GA 4A27A 3RFXA 3P2OA 4ALKA 4J49A 1ZEMA 1U1IA 2FHSA 5IG2A 2OORA 4J2HA 1ISJA 3DZBA 1JN0A 1GD1O 3F1LA 1M75A 4IIVA 3ZU5A 4LGVA 5HM8A 1VE9A 3E1KA 1W4ZA 3GG9A 2UVDA 1EK5A 1DJQA 5F1KA 1RM4A 1UDBA 1XEAA 4MINA 3ZW8A 2IEBA 2LDBA 3VOSA 4LK3A 3WBBA 2PA3A 5LDHA 3RASA 2UDPA 3GDFA 3DOOA 2TMDA 4CLEA 3H9QA 4MVJI 2FSSA 3I23A 1EK6A 3NKLA 2ZTUA 5TNXA 4NFYA 2JAHA 3E5MA 2WWRA 3L6OO 1OMOA 4Z0HO 1C0IA 2JL1A 3VTFA 3AY3A 1WAMA 1K3TA 2Q1WA 5TT0A 2CFCA 1ADFA 4BGEA 4HFRA 1PL6A 3DMTA 1P31A 4BO8A 3GQVA 3V8BA 4YT4A 3SX2A 3R3JA 3ZWAA 4FB5A 1ENYA 3N7UA 3JQAD 1Q1NA 1B26A 2VWQA 3I1JA 4G5HA 2VZ0A 4ZA2A 5L40A 3ENKA 5TGDA 5T67A 1LRKA 4WCFC 2EF1A 3M2PA 3IMFA 4CQMB 4AICA 2ZB8A 2ZYGA 3TNLA 4WK6A 1U7TA 3OJOA 1KEWA 2P9GA 2ZJ1A 4TVBA 2CF5A 4ZQEA 1ADCA 2ZYAA 4Z9FA 3AUSA 1FMCA 3FI9A 2G76A 3TOXA 4E2YA 3N58A 4CV3A 1GQ2A 1QORA 1I36A 3GRPA 1GPDG 1XG5A 3ITKA 3AM3A 3GRKA 5EINA 3W8EA 2Q46A 3W4IA 3ZCXA 5AVOA 1AGNA 3FCOA 2QX7A 2WSBA 4BQPA 5JY1A 1F8GA 1A7AA 4KQXA 5EQFA 2BH9A 4D79A 1JAYA 2JCXA 1LNQA 2PK3A 2OZPA 1PJTA 3F5QA 3ZNQA 2PD4A 3S8MA 5JNLA 4KQWA 3WQSB 2C59A 3BHJA 2P91A 4J43A 1KOLA 4QXMA 4PLTA 3V2UA 4D3FA 1XIVA 1I2BA 4XDYA 3DOCA 1IY8A 4YBZA 1DAOA 4L9RA 4CM6A 4IXTA 1WVGA 3LT1A 2BGKA 2VWPA 4JROA 1I2CA 2FN7A 3RI3A 5A9SA 5ES3A 3ZDFA 4J3FA 2C2XA 3HHPA 4TKMA 4B7CA 1DPGA 3AU9A 2VNSA 2DT5A 2RIRA 2WD7B 2DLDA 1EEHA 3JQBC 4GX5A 3VH2A 3PDUA 4LMPA 4B3HA 5L53A 4IBOA 1KVRA 4ZQFA 1ZZEA 2VZ9A 2D1YA 1EQ2A 1DFGA 3W4KA 1I3NA 2W2KA 2Q2VA 1E7YA 1HZJA 4U8GA 4PLCA 1HE2A 1FDWA 3HB5X 3UOGA 2PZJA 1GEGA 3L4SO 2IEDA 1G6KA 4DIFA 4PN3A 3W8FA 4AVYA 2EKQA 5KVVA 2Q1SA 5THQA 1PSDA 5A4DA 1CWUA 3NGXA 3PIIA 1HDXA 5CPFA 2C7GA 4ILKA 3WOHA 3GDGA 4FCCA 4RPJA 4I5DA 3S2IA 2J3KA 3FPCA 4KUHA 4XYLA 1EVJA 1QYVA 3T4EA 2WTBA 2NVUB 2IODA 3S2FA 5KKAA 3NX4A 5JDCA 1X0XA 1LLDA 1W8DA 1KEUA 2OFPA 5F3RA 3WWYA 1UZNA 3WS7A 1K6IA 1BXGA 2C82A 3JQCA 4U0JA 3DMTC 1W73A 1JU9A 2Q99A 3K5PA 4GI2A 1YS4A 1MXFA 4RZIA 1VC2A 4YAKA 2IZ0A 3ZI0A 1NAIA 5KVQA 2QG4A 5A02A 1GV1A 2AMFA 3QWAA 2PFGA 4XX0A 5IAAA 1BMDA 3ZW9A 1JVSA 4D46A 2BHLA 4OGWA 4BKUA 2VWHA 3G0OA 1PJ3A 2EGGA 3PHIA 1C3VA 1B3RA 4DL9A 4DXHA 4YT8A 1HE4A 5GMOA 1EE9A 3DZGA 5L9AA 4D42A 3AWDA 5B1YA 2GUGA 3NV9A 2G1UA 3QRWA 2WEKA 3UHAA 3IJPA 3JV7A 2FR1A 1BRMA 2I76A 3KEOA 2X0NA 2DC1A 2PKQP 1IHYA 3ZWVA 2VTEA 2VYND 2PY6A 1CQJA 3LLVA 3GA0A 2PV7A 1PJLA 1R16A 1UXHA 2DBZA 3VH1A 4ZN6A 2H5LA 3GZ4A 4MVJG 2WE8A 3PZBA 4FFRA 1CRWG 4QTZA 1ZK4A 3K2BA 7MDHA 1UAGA 3FR7A 3IL2A 3HZZA 2JFGA 3IOYA 4IJKA 4OOEA 3TFOA 1U8XX 4IQ0A 1ZNQO 4OM8A 3LZ6A 1KBZA 1WNTA 4H15A 3EMKA 4YJHA 3I83A 4AJ2A 1LC0A 3STHA 3D5TA 3WNQA 5FF9A 2VUTA 4MKRA 5CFZA 2P4QA 1GU7A 4W7HA 4EEZA 3QA9A 1A9YA 3CMMA 4CMIB 2AQKA 2AQ8A 2I66A 3TDKA 3W6UA 1JAXA 1WDMA 1QSGA 2J3JA 4WLNA 4EUEA 3TZKA 3INGA 3MJSA 1J6UA 4EGFA 3DBRB 2ZTMA 1HT0A 2QW8A 3VHRA 1F12A 5JAZA 3UUWA 1JQBA 4RV9A 2PD3A 1IB6A 3PYMA 3GVXA 2CNBA 3HQ4O 3OA2A 4IGFA 4Z0PA 5U4QA 4DLLA 3MEQA 4XQCA 4WLEA 4F6CA 4CLRA 1PS9A 1V8BA 3UCEA 4J7CA 1ML3A 1YQGA 2J5QA 5L7YA 4BO6A 1Q0HA 1MV8A 2P9EA 1K89A 1RYDA 1O6ZA 1ID1A 1VSVA 3CMCO 3EDMA 5I9MA 3PWKA 1U9JA 4GKVA 5THKA 1ENPA 2D0IA 3GHHA 3M6IA 1HSZA 1VL8A 5TS3A 3TZHA 5JDCC 4BUCA 3D64A 4ND4A 2D2IA 2WE7A 3T7CA 1SC6A 3CZRA 2AEJA 1R0SA 2NVWA 5JBIA 1XELA 1PZEA 2NNLD 4FQ8A 3AOEA 3ETGA 3D3WA 4C4OA 4YACA 4AJOA 4CM5A 2C54A 3GG2A 3HFSA 1M76A 3H5RA 3L9WA 5F1PA 1QMGA 4NMHA 2W8ZA 3L6DA 3QWIA 3B70A 1E3WA 1LDMA 4HFMA 5JO9A 3PWZA 5L4NA 1YOVB 2PWZA 2EW8A 2DUWA 3EY4A 2P4HX 3Q3CA 4J0FA 5G0SA 5EERA 1GYRA 4PGFA 2B35A 3WNVA 1HL3A 2IXAA 2BFPA 4DQVA 2FR0A 4GWKA 1GR0A 1I3LA 2HSDA 4M49A 1PR9A 1A71A 1EUZA 1HE5A 1HWYA 1X0VA 1MX3A 3C1AA 4PG5A 2ZCVA 3VPSA 2A35A 1ZFNA 4BV8A 3OJEA 3EVNA 5COBA 3ZNPA 4BO1A 3WBFA 4YWJA 2X86A 4EI2A 1HLPA 4Z9YA 4BO3A 3E03A 4K1LA 1T2CA 2VOJA 3MOGA 1WW8A 3PFWO 1ADBA 3ZWXA 1V6AA 4BGIA 3FD8A 4Q3DA 5JCJD 5AXCA 3INRA 2ILTA 1E5QA 5I7VA 2W4QA 1Q7BA 1P33A 1E1LA 3IC5A 5KKCA 3QHAA 4BV9A 4BGVA 3UH1A 4BNLA 1T24A 1PX0A 4MVJD 5G0VA 1NVGA 2DUUA 3FR8A 5IJZA 4OXYA 2PZMA 3ZV4A 4AJKA 4PVCA 2G17A 5JC8A 4CPDA 2X4GA 3QVSA 1QP8A 1TT5A 4FS3A 4JIGA 1PJSA 3Q9NA 4CLDA 3AI2A 3GOHA 1ZK0A 4D7AA 4F3YA 2VHZA 5JW6A 2I3GA 4IDBA 4XYBA 4L4XA 1ZUD1 3D4NA 4W9NA 1KIFA 3O8QB 4OHUA 2HMUA 2Q49A 3PPIA 3W8DA 4WLUA 1QLJA 3KTDA 4G81A 4MVJA 3TZQA 4DUPA 1ZMOA 2C07A 4AJPA 3K9QO 2ZIZA 3V1TC 1HTBA 3ZV6A 5BR7A 1UR5A 4NQZA 4JJIA 1F8FA 3UF0A 8ADHA 3E18A 4J1SA 3UICA 1E7WA 3PIDA 4D0SA 2V6GA 4KP7A 4GGOA 5TC4A 4DYVA 1EDZA 4OYRA 3WB9A 3N74A 1RM5A 2D8AA 3K8ZA 3WDSA 2Y0DA 1MFZA 3INTA 1T1RA 4BB5A 2CDBA 3NTRA 1J4AA 3S2GA 4WJZA 4IZHA 5KOIA 3PYXA 5IZCA 1VLLA 1U3TA 2NSDA 3HSKA 1P77A 1X1EA 1LSSA 1N7HA 4W7IA 2PR2A 1PGJA 4H3VA 1Q7CA 3HN2A 3GUYA 3IUPA 4II2A 3S1LA 4PLGA 1LBEA 4IDAA 2G0TA 4R4JA 4RLSA 4EJ6A 4CODB 5JYDA 3T7EA 3NTOA 2AG8A 4AL4A 1P1FA 3AOEC 3IJRA 2D3TA 3AM4A 5ER9A 2E37A 4U7WA 4JBGA 1TLTA 1XCBA 5L51A 3RJ9A 1H6BA 4XR9A 2C2YA 4E6PA 2H1SA 3H2SA 1J49A 2H63A 2I3AA 3DHYA 3KYCA 3B20A 5I8WA 3WQRA 1NVMB 3CKYA 3WTCA 1PS0A 4R9RA 1U2GA 4JJGA 2PTGA 1Y8RA 3UXYA 4BNJA 3BMCB 5L7TA 3KETA 1G0OA 4PLYA 5CP8A 4D3DA 1MUUA 4YB8A 5TSDA 5JC1A 4Q3BA 4HBGA 3MJ4A 2ZB4A 5TF4A 3PXXA 3KSDO 2NTVA 1TT7A 2YFQA 4IUYA 4ZU3A 2ZCUA 1ZSYA 4B3IA 4AJ1A 3ZWWA 3L4BA 1HETA 2OOSA 2HO5A 3TPCA 4W6ZA 2AHRA 3K96A 1GV0A 1QYDA 3WMXA 3RUIA 4GBJA 3AI3A 2YY7A 4TROA 4OIMA 3JYNA 4YJFA 3VKVA 4N7RA 1RPNA 4Q3CA 2WM3A 1YRLA 1Y9AA 3ZHBA 3PFFA 2DAPA 2RH8A 5EN4A 3G3EA 3PHLA 3PLRA 1TI7A 3UW3A 2FY8A 2WDZA 3WGIA 2E4AA 4E5KA 3VTZA 4RVGA 2HJSA 4YTEA 1HDGO 2B0JA 3B1JA 3BMOA 3O03A 2JFHA 3GGOA 4QO7A 2QQ5A 1Q7GA 5TIIA 4PRLA 3TL2A 4GSLA 1UXGA 2XXBA 4FDAA 5G4KA 3M2TA 3QW2A 1H6AA 4ALLA 1SOVA 4UEOA 5G0UA 2V7PA 4BKOA 4W9NC 4A73A 1HDOA 2RH4A 4YAJA 3GZNB 2IXBA 5CPBA 2JAPA 1YJQA 5HTOA 1ISGA 3ORFA 4Z9XA 2AW5A 1I30A 1DRVA 2GYYA 2F1KA 4PRKA 3QP9A 4KUGA 2B37A 4MO2A 3DFZA 3L77A 4BNZA 4HFNA 4YRBA 4WE3A 3H65A 4OKNA 1I01A 3OJLA 5H82A 4GMFA 3DB2A 3H4VA 4RLHA 3U4CA 1DDOA 2EJVA 2J5KA 1OZAA 3Q2IA 3DFUA 2W90A 3WTBA 2VT3A 5IDQA 1IUKA 4YYZA 4RJTA 2QZ9A 2NU6A 5IZCC 1ULUA 2YZ7A 2Z1MA 3JQ7A 2Y66A 3PLNA 1L7DA 1H5QA 3NT4A 1GAEO 3VPHA 1HDRA 3DZJA 5T64A 3LF1A 5TRTA 4QQRA 1Y9EA 1D1SA 1Y8QA 2GPTA 1AXGA 2W2LD 4MOWA 4NDNE 3A4VA 3KYCB 5F5NA 3LU1A 1PJQA 3D7LA 3F9IA 5KJ1A 2CF6A 1NFFA 4PCVA 3RBXA 3U9LA 4JXKA 1PZHA 4BNKA 1N5DA 2BFMA 3CIFA 3A14A 4S1VA 1XU7A 1NQTA 2Q45A 1OI7A 1ZMTA 5HBRA 2JD0A 3JCZA 1R6DA 2J5RA 2AEFA 2HRZA 3A9WA 4L73A 4BMVA 4YVFA 5JMWA 1GFSA 2Y68A 2GN9A 3JQDA 2ZTVA 5A9TA 5CG2A 4ITUA 1O95A 3TZCA 3TL3A 2HAEA 5I7FA 4CM4B 2HDHA 3LT4A 4HFJA 2B4QA 4TRJA 2BMAA 4J4TA 1DSSG 3QVXA 5BQFA 4I08A 3U09A 3O4RA 4II3A 4EDFA 3D1LA 1VKNA 3L4BC 3VAZA 1LQTA 3ADPA 2HK7A 2ZK7A 1T25A 1HZZA 1LXCA 1U5CA 3KSZO 1I8TA 3NTQA 1LLUA 1HLDA 1KETA 2AE2A 4GSKA 2SCUA 4YJFB 3DBLB 2O4CA 2I5PO 1EUDA 3RU7A 1LSUA 1UUFA 1X1TA 1S6YA 2BELA 4IQGA 1ZK2A 4EEXA 2YW9A 3I6IA 4I1IA 3BMOB 1V9LA 4R69A 3TWOA 4MDHA 1E7QA 2DBQA 2VRBA 3WG9A 4EZBA 4MPDA 4LRTB 1PJ4A 5G4KB 1M6HA 1JVBA 3PJGA 4NI5A 2PLAA 4A0SA 2LDXA 1NFRA 2FWMX 4CLOB 1LSJA 2DBVO 3NDJA 3OJ0A 4CM7A 4R16A 3QLJA 3KUXA 4RPLA 4CUJA 4BGUA 2BKAA 1B8UA 4MP6A 4YXFA 3GHYA 1ULSA 4B3JA 3GK3A 1SPXA 2GF2A 3GNSA 4CL3A 2NU8A 4FN4A 2H6EA 2O3UA 1G1AA 1IPFA 3DEYX 3EGOA 3T4XA 3RVDA 3I9NA 3OIFA 4XYEA 5I7SA 4QUKA 5IF3A 4GGPA 4NG5A 3KHUA 4J90A 4JQCA 4ND3A 5FYDA 4NJMB 1UXKA 4P4NA 3ZHZA 1ONNA 4WCFB 3QQPA 2FPGA 3GMDA 8LDHA 2J6IA 3HJAA 2YUTA 1C1XB 4NFSA 5CDYA 3EVTA 3IQDB 1D8AA 4OJNA 4B8WA 2JD1A 2O48X 4WNCA 2Y67A 4RVHA 2CUKA 2X22A 3COSA 2ZQYA 4K26A 3H5NA 1AHHA 1YXMA 4IDGA 3SLGA 1ZBQA 2XF8A 1N7GA 1O8CA 2EKLA 3E82A 3FN4A 7ADHA 1AUPA 1Y8QB 1YL6A 4ZRMA 3ON5A 3BMNA 3DTTA 4NZ9A 5AQ1A 3RC2A 1YWGO 2EG9A 3VKUA 4YRAA 2R6JA 4A03A 3BYZA 1LUAA 3PYLA 4XJSA 5DZSA 3JQEA 3ZN2A 2FMUA 2Y0CA 2EERA 4YQYA 5FWNA 1UP4A 3GN2A 3JQAA 1W0CA 3DR3A 4GX1A 4WASA 3JYQA 5B4TA 3K6JA 4I5EA 4L4RA 4E12A 4NBVA 2X0JA 4BS9A 1JA9A 3KYDA 3GVCA 2B4RO 1P1RA 1Z74A 4MP3A 4ZQGA 4K9DA 1U3UA 1N9GB 3OECA 4IZIA 1E6WA 5LCXA 1NNUA 4XQGA 4RGBA 3VH3A 3VDRA 3WMWA 3F1KA 3ABIA 4RPHA 3FNGA 1LDEA 1YVEI 5MDHA 2EWMA 4F45A 3LC7O 5GY7A 1IZ9A 4DYDA 4BVAA 5U9CA 1EQUA 3ZU2A 1MLDA 2WMDA 4GPD1 4WPGA 1Z6ZA 4FD3A 3JYOA 4D3SA 1U3WA 4TZTA 1WP4A 2GRAA 3CINA 3R3SA 5AXBA 2GNAA 5L45A 1E3IA 2XOXA 3FWZA 3ZU3A 1R0KA 3ASUA 3Q9UA 3ZU4A 3DAFA 1KVTA 4MVJH 4U6QA 3RWBA 3EAGA 5EESA 1I10A 2B5WA 2YV1A 3AY6A 3G17A 3U4HA 1LEHA 3JD1A 2O3QA 5JFOA 5JLAA 5CDGA 1P0FA 3L07A 2ZB7A 3U49A 4HP8A 4CMKA 2YHIA 4G65A 3WXBA 2CMDA 2ZTLA 3QY9A 4FJ2A 4XYMA 4IGEA 5CEEA 3DMYA 3I4CA 4OXNA 4KTTE 1N2SA 1WDLA 3RFTA 5DP1A 2X5KO 2NQ8A 1YBMA
chains in the Genus database with same CATH superfamily
3E70C 4Y67A 3NWPA 2I9PA 4AJHA 4P4SA 5F12A 1Z4MA 4WLFA 3WLLA 1WX1A 3CNHA 1N1EA 1TKBA 1MO5A 3FM9A 3OZRA 4H7PA 4PHCA 4U7PB 3WX0A 1FUUA 1Z17A 5G0WA 1AN0A 1MC1A 1AQIA 2QTNA 5P8WA 4DIDA 1H85A 3CG4A 2Q27A 5E7QA 2OAEA 3RAEC 2J30A 2ZI7A 3C3WA 4KYVA 2DCMA 4IIHA 4X54A 5AYVA 1OT3A 4C7KA 2Z6VA 2EIHA 4CQJA 1P2BA 4I8XA 1G8PA 3GCDA 1J22A 3LUAA 5FCDA 5H9VA 3OQOA 1U31A 3VJLA 2OV6A 3VPFA 2GXUA 2QPAA 4WK2B 2IC5A 4E0BA 5L3VA 4BNFA 3N86A 2C03A 1PL0A 4OBXA 4B80A 4ER3A 5BP7A 1L3BA 2WNSA 1EJ2A 3C7CB 5H70A 4Y2XA 2CY0A 3RSQA 3D4IA 3U4MA 2WJ4A 2B98A 2C7VA 2JS7A 2OBNA 4HRYA 4A5SA 4ZGWA 2ZRCA 4C7OB 1WP9A 1JR3D 3NVDA 3GVHA 4YV2A 4RPCA 4K0KB 1FU7A 1BDHA 4LYDA 3T5TA 2DP4E 3RNLA 2PUAA 2BGGA 1VB3A 4CMJA 1ZWLA 3FNRA 4RPIA 4XE5A 4UARA 4EA8A 1O97D 4ZO7A 1JLHA 4DDUA 1V4NA 5IKEA 2GZMA 1RZRA 4O3FA 4UU1A 3OEWA 2VK2A 4GLOA 5HYVA 3HH8A 5LQAA 3V1MA 5FIUA 3KSAC 2PJDA 3T0FA 5KC9A 3ZD6A 3T1OA 1PGNA 1FDUA 4GQIA 4TZKA 6PFKA 3S70A 3O38A 1IQ0A 1MQAA 1SBTA 1ZRMA 2VH1A 3RO7A 2OV1A 5IXSA 3HVJA 3GEBA 3P9CA 4L2IA 3OHPA 2V4ZA 4EKIA 3ODGA 3O3CA 1ZUHA 2E6KA 2DF8A 2YRXA 3S27A 5HQTA 5BMVF 3DL2A 4M37A 3LPDA 1I4WA 2VHXA 3CH6A 1XVAA 4R5MA 4KMMA 4NCAA 2OCYC 3PJDA 1ECFA 5G0TA 3LLUA 1XEXB 2C20A 1OF1A 3QE2A 3N39C 1WXDA 2ZE7A 5FUWA 1T91A 1MNAA 4QASA 1Q0LA 4I4TB 3GLQA 1X9GA 1OH7A 1RHUA 3IYLW 2VPXA 3KCQA 3GT3A 3F6YA 4GR4A 4J9UE 4JHLA 1TD9A 3UV7A 1VL1A 5BUCA 2VP2A 4O4HB 5FADA 3M5PA 3WSTA 4CKBA 4XDZA 1DO8A 3VVCA 4KR3A 5A9SB 4MW9A 1C1YA 5KNDD 4LOJA 2P2CA 2WG2A 2WB4A 1GZ6A 3S2EA 3W2IA 3B48A 4Q24A 2ENUA 4Y9DA 2JLBA 4HXYA 4HDAA 1J1IA 2Z3VA 4TL7A 4EYOA 2OXFA 4ZHQF 4E2WA 1S9DA 2CC2A 2QX8A 1Y1PA 3KHSA 4YRDA 5D6NA 1EU1A 3IEIA 3W0LB 3GP3A 2BFOA 3PPWA 1QJ4A 1YMVA 1CZHA 1N0WA 1RRVA 2R87A 1M0TA 3BVPA 1QO0D 3SDZA 3ZK8A 3G68A 2YR0A 3SJUA 1X94A 2CEAA 3SHWA 1EESA 1IJBA 2V7XA 3RYTC 3OE7A 4R41A 2J1LA 4OH1A 3BL8A 3IS3A 1YVUA 2DRIA 3SX0A 1H9BA 2IZ1A 4C89A 5CHYA 8MHTA 3A3KA 4C78A 3ZHOA 3K0CA 2QPOA 5DM1A 5EIBC 3KEGA 3NYIA 1A1SA 4IUDS 4TKVA 1PGQA 2CHUA 3D0OA 2WTEA 3LI2A 3QOYA 4ZYVA 1A2KC 4UM9D 3CKKA 4JKIA 1O5OA 3I39X 4BNDB 3ML1A 4DA6A 4W9RA 2COEA 2QM7A 3TAHA 1DKRA 1VI5A 4OMFG 5E0KB 1SGWA 1PZGA 3SICE 3UMRA 1KDOA 3UTDA 3ND6A 3WSVA 3ZD7A 1TQ6A 5L7WA 3RUCA 3SZUA 3BWMA 5T57A 5K2OA 1MO4A 5LMZA 2O2HA 4HD8A 2C8JA 1N6OA 3K73O 5KYYA 2J5BA 2PVPA 2ACWA 3OJFA 4XTRA 4YJ2F 5CVUA 2GA9A 4Z7OB 4KITB 4DJ5X 5JY6A 2CVQA 3NALA 4ALNA 3LJKA 4XZ3A 4NNJA 4AO8A 4QRHA 2VH5R 1EVKA 2BFFA 1WETA 1JT9A 2AB0A 3MTGA 3NV7A 3OCUA 2YQ4A 4HWSA 4N47A 2GJ8A 3ESZA 2BWJA 2XWQA 2ZJOA 4UCXA 1U63A 2BM1A 2EKZA 3HP1A 5D6OA 2C1ZA 5EJEA 5M29A 1WUHS 2JJ1A 1SKYE 2QPTA 3CPSA 4HXEB 4R9UC 3AX6A 3CUVA 3ONVA 3CUUA 1E7MA 3IE1A 4O2LA 1MP0A 3OJXA 4JBIA 4JLSA 4AP6A 1JG2A 1I5OA 4ZARA 1OXVA 3WHKA 5I3CA 4CM9A 3IAHA 1P5HA 1G42A 3VO8A 1DIBA 2W98A 4Q9NA 2A7XA 3I9KA 1AJEA 4UEKA 5BVHB 1J2RA 1SCAA 3IQFA 1DOAA 2G0AA 3WP1B 1ZGHA 4UDYX 3B9QA 4TT3A 4WBSA 3RSCA 1HG0A 4OQZA 1T3ZA 3WIOA 3P5SA 4M0PA 3A2NA 4WTOA 2C98A 1MRZA 2A94A 1U98A 3QVTA 4L2IB 4LA4A 4F4DA 3MWDB 4FFBA 1XTRA 1AXEA 3A11A 3DHNA 1SM4A 5AHOA 5D5PA 3A9TA 4BBPA 5CFOA 1L7OA 2XQKA 3EGEA 4MUJA 2BLLA 4GF5A 1MJGA 1TUBB 3DTVB 4QD3A 1QV7A 3G7SA 5L3SA 5JCXA 1THGA 5C5IA 1YUBA 1C3OB 4ZMBA 1AK2A 1FYFA 1NLYA 1R5NA 1NM5A 1QLHA 3V55A 2INGX 2JHFA 1E1QA 1U8TA 4Q0MA 4RLQA 2HPZA 3PWTA 3F7TA 1XZDA 1MVLA 1ZCJA 2IITA 4LYFA 4MQUA 4OY3A 1N1MA 2PDAA 1N5JA 4Q9IA 4CKBB 2GPSA 2PH3A 1U2DA 1FFSA 2QT1A 4D45A 5IU6A 5CCXA 2XB8A 3I3SR 1ZKMA 4KKVA 3D2BA 1FB5A 2ZAYA 2HCTA 3I92A 1DZ3A 4NCJA 1X3LA 1PBTA 4M0UA 3AJAA 3VKGA 1MX9A 1ZXXA 4BNNA 1ABFA 4NZOA 2ODWA 3L7JA 3QNMA 3M1AA 3NQ41 1RQPA 5FL3A 2UZ4A 3DMPA 2QGFA 5LYJA 2IDJA 2J0VA 4IHKA 1R7RA 3EVDA 4RHUA 4LF8B 3PI6A 3U3MA 7REQA 2I3ZA 5F7JA 5H3LA 2BI8A 2O0MA 3KAQA 4M8IA 2AYXA 1NRIA 3Q7QA 2R11A 4J9VA 2QENA 1K97A 2WM9B 3WDMA 4K9MA 2BZ0A 1YMUA 4ZIRA 4LF6B 3P7MA 2V97A 1XX6A 2OBYA 3FDXA 1CUWA 1IRXA 4CUZA 1P74A 3HUFA 3KYBA 3ZV5A 1KI8A 2CDAA 4BKRA 5K8TA 3B6MA 1W6UA 4KDFA 1QLWA 2ASEA 4TKVB 3TIFA 1TZ2A 3P9SA 2JCVA 4ESOA 3OQHA 4G4SO 5E2AA 3C6ZA 3ICWA 4BNTA 3STTA 4EY4A 3K0CC 5BQ5A 3I2GA 2ODPA 1IHOA 1WHSB 4XW2A 5CNIA 3HBMA 2OZEA 3NM5A 3I62A 1L5MA 3KG2A 3JAWB 2Y77A 1QIMA 4HEJA 3ZE8A 3J81A 1XRQA 3TCKA 4LISA 2HSJA 4PC2A 3GCXA 5UKDA 1PIWA 1CJTC 3IT2A 3ZWKA 4R0VA 2AR7A 3OZXA 3BWVA 1NQUA 2IIVA 2D59A 3G9ZA 4FEEA 4XJXA 3UEOA 4YT5A 4CI0B 4OX9B 2H1IA 3K9CA 3ZBQA 1C0PA 1UKBA 3H2JA 1CY7A 8GPBA 1FX1A 1BWRA 1RI3A 1VI2A 1GLGA 5BQXA 3WK6A 3AILA 4A15A 4UM7A 3A25A 3GEGA 3KQWA 1QQ5A 4TXJA 1NU8A 3BFPA 421PA 1MC5A 2WRZA 4Y2TA 3OQJA 3SVZA 4JJKA 3VJKA 2FEXA 1GN9A 1GUBA 1TU4A 3D3WB 3WIBA 3PXGA 3PENA 4YUXA 4QXOA 2R60A 1AT1A 1K7FB 1TE2A 3W34A 2JIPA 4AJ9A 2ENWA 3B1VA 1E3WB 4AJNA 3GEEA 1NVUQ 3NBAA 3CVVA 3VYTB 1SXJE 3ONEA 1TZJA 5GIOE 1FP6A 3HJCA 4KNVA 4PVDA 4RNDB 1M2KA 3TCXB 2NW6A 4I9FA 2BVNA 4EG5A 1ESEA 3CO5A 2QL7A 3LFHA 1M5TA 1M7GA 5LOVF 3FWHA 2RKWA 3CR8A 1KQFA 3PHBE 1FA9A 1J00A 4RELA 3ZDEA 3ZUPA 1DKMA 2DFKB 4IKPA 2JIZA 4JWKA 3OPNA 5ALXA 1JKIA 5ITZA 2I62A 2HNKA 4Y2JA 3ONFA 3CKLA 2WF6A 3CWCA 4I4LA 4GR9A 3JSXA 3VPXA 1PUXA 1YU9A 2OUKA 3ADOA 1NQOA 1T6ZA 2QLLA 2J9GA 3EOZA 3VZRA 1HEUA 5DNEA 1GG8A 3X1DA 2GCOA 1TQDA 3H2KA 4NHOA 5B58T 3O7MA 1NWHA 4JN6B 3P9RA 2RKOA 1KVUA 3I6BA 4JWTA 1GU0A 3CVWA 1XP5A 2VATA 1C0KA 2X77A 2Y1XA 3AF3A 4J3NA 2P2SA 3MLEA 4CMCA 1YONA 3AFHA 1NM5C 4NK5A 5JAHA 2EZTA 2P9FA 4H08A 2FW0A 4QTTB 5GPBA 4MUFA 1EDOA 2O7NA 5LLSA 2JFVA 2ZAIA 1RW4A 4LZWA 5BW8A 4AECA 4TWJA 3B1KA 5DHUA 3K70B 3HPRA 1JSLA 5B53A 1G2IA 4HAZA 4DW8A 1N77A 1QRUA 2R8BA 3W5UA 1GNPA 2C29D 1U2DC 5HKOA 1P7PA 4G0ZA 1LBQA 4MULA 2IKSA 3ANSA 1X13A 2WM2A 5HQ3B 1MOQA 3L1KA 3EASA 5DYWA 3SXUA 1D9ZA 5A7HA 3VZCA 2CVOA 4XIFA 2EJBA 5E2IA 4UUPA 3ZE9A 5CVCA 4IF6A 1N4AA 5JAMA 5KSZA 2A1TR 5T5QA 3PLAE 4DJDC 2WAOA 4EL5A 3ZVRA 2FFRA 1T1GA 1WMBA 3QLUA 1JEJA 4FNGA 4UBIA 3GEMA 3DEAA 3SP1A 1W59A 3JZAA 3OFNA 3LM8A 3HYSA 3PVCA 4JEUA 1GPYA 4FR0A 2C7PA 1SCIA 5LP6A 1V7ZA 1NYTA 4MGEA 3D8HA 3EWAA 3F6SA 4JR1A 4EHAA 2WJ6A 3MGAA 4R1NA 2HLPA 1GO2A 1RHMA 2JZOA 3MQFA 4BMDA 4WBNA 5I47A 1I0IA 3FRJA 5BORA 1ZN2A 4B85A 1AXRA 4HK4A 1QOZA 4OGLA 5DKFA 4US2R 3NTLA 4LXUA 1G5TA 2ZIUB 5ER6A 1T3GA 1BN7A 3ZDAA 5TPWB 1KO1A 5CCDA 2ID8A 1IWBB 1BFDA 1N6NA 4MUGA 1NT4A 1G8KA 2PT5A 5EPOA 4O1IA 1EX7A 3A0UA 1XFDA 2IZZA 4W5HA 4AKTA 4DIKA 4ZYWA 3DCNA 3T7IA 3BXEA 3I9MA 2VCEA 4QIHA 2C2WA 2O06A 5B4UA 5LWHA 1GADO 1CC1S 3U39A 1DCMA 1CNMA 1OW3B 1P1CA 3G5UA 4UC0A 4UVGA 1GUYA 4QYIB 4RFSB 1BO6A 4OHZA 1TA4A 6REQB 4G5HA 1M34E 4GMKA 4MIOA 3L1JA 1IU9A 2OCAA 4CCYB 4OKSA 2Y05A 3EVZA 3D6NB 3WXMA 3JATA 4B2YA 5I4BA 5GM1A 2ZRHA 1VLZA 1ZM3A 2UVPB 3SC4A 1H93A 1P8JA 2AJLI 2C4TA 3FOAA 3G7NA 1LH0A 3HSYA 3IOMA 3Q6IA 3LHFA 3FRIA 3GFPA 4D44A 3D7MA 1L4GA 3AFNA 3IOEA 1V25A 2WJVA 3C43A 2FEOA 1LLCA 2J45A 1PU2A 2I65A 4ZZIA 1IOZA 1BU5A 1D1QA 4OAQA 4G9BA 3N8NA 2P1DA 4YP9A 3DAGA 4RMJA 3FCAA 2APJA 2D7DA 1LV8A 4ZD6A 1OILA 3UVEA 4MKXA 4CM1A 3K09A 1P1BA 2OL4A 1ZNXA 2B1QA 4JMPA 2DWOA 1HG1A 1Y8RB 2OG1A 2PUVA 4J16A 4Y0AA 5I9NA 1C9MA 5L4NA 3ZK9A 4PG6A 4I1UA 3PNQA 4CQMA 2QXYA 3ICQB 1VJRA 2J3HA 2O50A 3FWYA 4ITVA 4TV9A 121PA 3MFQA 2WAAA 4MA4A 4FPXA 5IARA 2DFNA 1AKYA 1LK7A 2P75A 3H84A 1N3LA 3NGLA 1L5OA 3KQPA 2BC9A 2GCOB 2O7SA 4HWKA 4X1YA 4BN4A 1LS1A 4EDHA 3RJTA 2IXEA 4LI0A 1T6BY 2X2FA 3EG5A 3I52A 5AW5A 4B6GA 4RMNA 3BERA 1J5XA 1TRKA 1R6UA 1XAHA 3ELUA 4KV7A 1BGWA 1P0MA 1TUIA 4K6MA 4ZAVA 1SZJG 2PGJA 2Y1LA 3BJEA 4FB4A 1DT5A 4PPFA 5LN1A 1X8XA 1XEWX 1DC4A 3KKEA 2IE0A 3DT6A 4YP5A 4KQHA 4H7JA 4MLPA 1QVAA 1GCAA 3S29A 2RGAA 4R0NA 4I3GA 3ZGYA 1TF2A 1I5RA 4S1TA 1VDZA 3WJ2A 1FYDA 5JVDF 4UUAA 5JXHA 1CJCA 3DC2A 3VDNB 1U7XA 1Z0DA 4GRIA 1X2BA 2FEAA 3HO8A 2Y1FA 2FF7A 1JW9B 3PGLA 4Q3EA 4TSRA 3WLFA 4ZJPA 5EJFA 3SXUB 4MS4A 3R3YA 4L74A 3TMKA 5KNDH 2ZKLA 3G6WA 1KI1A 621PA 5CM8B 5KDOA 2V3VA 5GIPE 2C9OA 3UJ3X 1KL7A 4R1MA 5FA5A 1JAZA 1SVIA 4ZJUA 3BILA 1SKAA 1QQAA 3A4NA 2PUWA 5DN6A 2RGUA 3ZCQA 1C7ZA 1DFHA 5MGBA 3W5IA 1IBLB 3I8OA 3JW8A 2ZRDA 1N2OA 1NE2A 3IDZA 1W88A 3QLUC 3R6LA 3AVYA 2QHXA 1E0AA 3ETNA 5AHWA 3G2IA 3RIYA 3B3JA 4J6EA 4DR4B 3QOFA 1X7YA 4G1UC 5LBIA 2GZHA 4XYGA 1QWOA 2FMKA 1CY0A 2VPWA 5G2OA 4NBWA 1SN7A 2C4UA 1WS6A 2NQ2C 4WVFA 4Z3KA 4WBNB 3OLQA 1VG9B 4NBUA 5LP6C 2WHPB 1ZOSA 4WY5A 3BZUA 1UMKA 1KDYA 3IKVA 1GCUA 3WZ2A 4HN4B 5KIAA 1RLIA 4G5SA 4CLXA 3L0DA 3F47A 3UM9A 2GF0A 1C3JA 2IUSA 3CH7A 3CW2A 2Y0PA 1YBFA 3ZI7A 4LRSB 3SNKA 4Q9JA 5IKXA 4N41A 4HNHA 1JXMA 1QNFA 3RHTA 3GAFA 2IH2A 4WK0B 4QQKA 3B89A 2JI7A 5DNYB 4KFTA 1CUUA 1A97A 2A9JA 2JJYA 1E79D 1H9AA 1FNBA 1ODKA 4HN2A 1J33A 5DX0A 3CR7A 4F3KA 1PFVA 1QJCA 5CURA 2EJWA 4LYAA 3ADKA 1MRSA 1RXSA 3H1AA 4G37A 2E0IA 4NMMA 1CZOA 3NKFA 1B0PA 1V8ZA 3IP6A 4GM1A 1BDMA 4IJ6A 3VR3D 3RRMA 4O59O 3BRQA 3JATB 4PS0A 3QY0A 3JD2A 5CBPA 4Z4IA 1DC7A 1HY3A 3A32A 4L75A 4NF2A 1AHPA 2HMYB 1TAHA 2NVUA 4K3VA 4RA9B 2IUYA 3RFUA 3SC6A 2EDCA 4QLAA 3M1IA 2AV6A 3TW6A 4DC9A 3CNNA 5CH3A 2A57A 4W1SA 1WM1A 4FDLA 2P6RA 3RPEA 1S8AA 1HE3A 1QO7A 5KPJA 4O4JF 2I4TA 3C4VA 2IYPA 2GPBA 2KYRA 4DDWA 3IBSA 2JK1A 1V48A 4HMPA 1XA0A 4MVJM 4D3XA 4Z6KA 4AKIA 1E3JA 1WU8A 1E99A 4JR2A 4WKOA 3RSOA 3T38A 3KR1A 1SPBS 4XD2A 5JZ9A 1P29A 5KVCA 1FDRA 4O8ZA 2N46A 3E9MA 3PGMA 3G6KA 3ROEA 3TJRA 2XUJA 3QSYA 1Z82A 3OM9A 4MYCA 5PGMA 4HUTA 2OK8A 3BCUA 2FGKA 3K09C 2ZRBA 4TV9B 3NVMB 4W82A 3X3HA 5BWCA 2EV9A 2PGOA 4J16C 1DX4A 5CFRA 3GF4A 3RSSA 2QJOA 1MO3A 3L84A 2JLYA 3Q8WA 2BE9A 2GHQA 2XQGA 3GI1A 5EP1A 3LE8A 4BFSA 5HWSA 5JHHB 1U81A 4P5PA 1L7PA 1A5TA 1JLLA 1YNOA 4F2PA 3T7JA 3WBKA 1JG3A 4DQUA 3ZUGA 2W2VA 4KODA 1BSVA 4M60A 3HCPA 2XA9A 5G1OA 4AMVA 1A88A 3CQ9A 2VP5A 2VK8A 3MUEA 3GH3A 4A8JA 1JYSA 2GLUA 2I71A 1LPNA 1Z22A 2XQFA 1WIWA 2WTUA 2FFBA 1P0CA 2OB2A 2PX6A 2ZJ5A 3U60B 2G7MC 2V98A 3NBXX 4X97A 3ZXIA 1XZMA 1C7JA 4X1KB 3HEMA 2G9UA 2AW3A 1CQIA 4HDRA 2NZWA 4LHEA 1DL5A 1HK7A 1FFGA 1LBTA 2RCNA 2WFMA 2ZJ6A 3C87A 3DL7A 5K03A 4DBLC 2ZYDA 3BZBA 2FRXA 3PD0A 5GV8A 2GBIA 3CCCA 3ICPA 1RM3A 3IUSA 5IXYA 1LWNA 3HVIA 3HYLA 2WJJA 4BO4A 3U16A 3C5WP 4U6SA 3R23A 1DKOA 3UCFA 2CJYA 3ST7A 1ISMA 4JDUA 1N9KA 3GFBA 4KU4A 5FTJA 1AMNA 1YH3A 2FP4A 2VNAA 4FW8A 4C08A 2DBRA 2IRWA 2VLBA 5FBWB 5IULC 3CZ5A 5DLEA 3ULKA 2H2WA 1E60A 1CY1A 1W88B 2OKGA 4AFNA 2UZAA 4ZCTA 2C5FA 5F5XA 2P2LA 3FYTA 1OWPA 2ZE8A 4MUBA 5NULA 1X7YB 5LU8A 5JANA 1OH6A 1OH5A 3EUWA 2VRCD 4LCEA 4GS5A 1Y8AA 4I1OA 3HA7A 5A05A 1YB6A 1IN8A 4IXDA 1P4AA 1AM4D 1TEVA 2W48A 1GRQA 1NVBA 1RI5A 1DIGA 2V6FA 2WF9A 3I12A 3PC6A 3T9DA 3W7BA 3ZEIA 3N07A 4A2QA 1XLTA 3Q5GA 2V03A 3CXUA 5IJXA 2XNKA 2GPYA 4DOMA 4U5XA 2GHRA 1K8ZB 4M76B 2EFYA 2QIOA 5IDYA 3DE1X 4FINA 4JKOA 4PZZA 1THTA 3IQIX 4X85A 4RSRA 4ZOLB 2BW0A 1K7EB 3IDFA 1XMSA 3NP9A 4EG0A 3ROGA 2RAPA 2GFQA 1LPPA 1NW7A 1HDCA 1T4CA 3K0KA 5E1OA 2NOAA 5KDDA 1ZR4A 3PI7A 3IEKA 1JWAB 5J40A 4EPVA 1PI3A 5KJCA 1L0BA 3KZOA 3NHJA 1OFGA 4Q9KA 2IHYA 4P32A 4PXAA 4DJTA 5AICA 2YJZA 1RHRA 2D00A 4KXNA 2ACVA 5JEDA 4JEHA 2WZDA 2MTBA 2WMNB 2ZG6A 3THXB 2X7JA 5JZSA 3HXPA 5E6RB 1QDLB 1UJ5A 5H1YA 1GQQA 1M2VA 3N2KA 1MXHA 5E95A 4IQ4A 3TFWA 2O14A 1HOTA 2K7ZA 4NICA 3V1YA 3DFKA 2WJPA 3A8TA 1DXQA 1G3UA 2PGDA 1GNRA 5JIBA 4BWGA 5A04A 4PLFA 1Z6AA 3DXZA 3LECA 2I22A 2YYYA 2FMXA 1JIQA 1T0PA 4X6XA 3LC2O 3C3BA 1NMXA 2JCSA 2PAFA 3IUJA 1P2VA 2O3RA 3E9QA 4OHFA 4K88A 3KVRA 3UB2A 1SWVA 2CNLA 2P0YA 2H4ZA 1NI4A 3V2GA 1NJSA 1I9CA 1NVWQ 1PN3A 2I8CA 2H4WA 4JBHA 1HKHA 3WK7A 3IIIA 2Q2OA 4F9GA 2A9FA 4JP1A 3IRVA 2Q50A 5F73A 2ZW9A 3EUAA 4CV2A 4FYHA 4MV4A 2WWIA 2B5VA 2Y1CA 3C5EA 4MLCA 2V1UA 1YOVA 1KE1A 3H5OA 1P7ZA 4RDHA 1LDGA 1BE8A 2P35A 5C53B 4JLWA 5TEWA 2JFBA 3I2YX 5AVVA 1AF4A 1Z4OA 4KLCA 4URFA 4R8SA 3U0BA 2AC4A 1GGHA 4MB2A 3D7NA 4TKUA 2ZQZA 2XZPA 3P9KA 3IMGA 1Z0JA 3E1SA 1YC5A 3FVTA 4AMGA 1G9TA 2P9TA 4X5OA 2NNWB 4ZDWA 1U9CA 2C2BA 3EBPA 4A8JC 4C22A 5KC8A 5AW8A 1CQIB 2BSAA 5L6LB 5ADUS 1Z5VA 1DAHA 2RB4A 2XDAA 3GN1A 4WZBE 5IJ0B 1TQ2A 2JJMA 3EYAA 2EQBA 2VPQA 2BMDA 3AHJA 3TLEA 1MOSA 5TQJA 2QLTA 4MRMA 2Z2IA 5CXUA 3SD7A 2Z0MA 3L4KA 4IKOA 1OI2A 2G80A 1P9LA 2R2GA 1ILWA 2V8OA 2XHZA 3BGIA 5CK5A 5JT1A 4DV5B 2ACKA 4J0GA 5SZKB 4JV5B 1PRYA 1RC8A 1G6OA 3R6GA 1ZHOA 3U1BA 5IM4A 5L3ZA 4DV0B 3LBYA 3QYJA 3T7AA 4MRRA 3K1TA 3P4YA 5DP2A 5T4BA 5HNKA 5KMGA 1QOPB 1U0LA 3D5EA 3DT9A 4OYLA 4EFKA 5BVGB 1BKSB 4L6CA 4B76A 4AN1A 4B8ZA 1R4AA 3SM9A 2AE1A 4Z86A 4FR5A 2D5LA 3OQ1A 4I46A 3RAGA 3UJCA 5I01A 5JAOA 2ZS8A 3FFXA 2VJCA 5CAEB 1OROA 4N9WA 2AT1A 5KTRA 1TEXA 4J4BA 3D3EA 3MWEB 3ZXSA 4MIEA 1DTEA 5JARA 1J5EB 3PPYA 1XN4A 3H0KA 2KSQA 1M5UA 2R8RA 2RAFA 3X1MA 3PFIA 2D54A 4RQUA 1QFXA 2R8XA 3AWIA 3OVMA 2EATA 3L46A 3AUUA 5JYEA 3GQBA 2BGJA 1XLTC 1RRPA 2F9MA 1NQAO 3QSGA 5EHIA 3TKYA 5FOUA 1T4CB 3DZKA 3LPMA 3I9V1 2ZUSA 4U7HA 3GUCA 1G55A 2AG6A 2IT1A 4RACA 1TJPB 4PG4A 1ISHA 4Q7MB 2PH1A 4DIBA 2NLOA 1IAQA 4O4LA 1U7OA 1XMOB 3AW9A 2FEKA 2HHHB 1CU1A 4Y2YA 3HUDA 3LYLA 4ZXPA 1S8FA 3S2UA 4E13A 1KXZA 3U6BA 1WCWA 1NF3A 1NHWA 2VK4A 4HH1A 4IJ5A 1MZVA 4A8PA 1H2BA 3Q7EA 1NZJA 1YBAA 2F64A 3PQ2A 2RE8A 2VJDA 1F8XA 5ALDA 3QENA 3SMQA 3ZXUB 2OBFA 2ZUTA 3H5VA 4CDGA 3CEJA 3IVXA 2P2NA 2V45A 3RGWS 2UV8A 4IDPA 1G2QA 2VQSA 3MW8A 4XGRA 2QAIA 2X8WA 3AHEA 3LK6A 5KDLA 3ZHQA 1DFIA 1KKUA 1RWKA 1Y33E 3OU7A 4G0XA 2QJTA 3C8DA 4NYJQ 2QNIA 2VCHA 3KZ1E 4J0EA 1NV9A 1NI4B 2BGMA 1XEFA 3CCFA 4WNYA 5H3HA 4DIOA 5G41A 1QIJA 1YDWA 5IVIA 3TVTA 4ZT4A 4CJXA 1F2UB 4U6NA 3OCCA 2HMAA 2CFSA 5D1HA 4BMCA 3PITA 2XX3A 4DMMA 2V59A 3BZWA 4M98A 5EVJA 5BSHA 1O57A 4W99A 5BQOA 4ILEA 4C0XA 1B76A 5DLYA 3KJIA 4AJLA 3OTIA 1Z5NA 5HCIA 5JSKA 3DZFA 2DFPA 1CKEA 2BD0A 1Q1BA 4UPVA 3LY8A 3DVRX 3RUDA 2QMEA 3QBVA 1OXKB 5KO2A 3JD0A 4KN9S 1JQLB 2HK6A 4CCAA 5AI9A 5F3WB 1U0NA 1H2HA 1SKBA 3A9UA 3MUNA 4TKUB 5B5SA 3B1XA 5GQSA 3EEOA 2F00A 1AN9A 3TI7A 5J47A 2R1TA 5DIZA 4ID3A 2ALJA 1E2LA 2Z56A 1OSNA 1I0LA 3BMCA 3L7AA 2GCGA 5AESA 3QU5A 3QE3A 1LB1B 4LYYA 4Q3NA 4LGYA 1OLSA 1QIDA 5F2NA 1ACLA 1I2MA 3CUYA 1H2ZA 2IV3A 4FYJA 2RHLA 4HT3B 4TM8A 3NDRA 4QLBA 3P19A 4TV8B 2CDRA 3P0FA 1KAOA 4XLZA 1O03A 1CF2O 4MUKA 4MRMB 4BBAA 3D6UA 2C7RA 2DQ4A 1E4YA 3AONB 3E48A 3WLKX 3V4LA 2L2QA 2JD2A 3IODA 4LJAA 4FDMA 2JH9A 2Z98A 1Q0SA 4QTXA 4DIUA 1GP2A 1N5OX 1SO8A 3U7IA 3CLVA 2FPIA 2PG3A 3PFNA 4PZDA 5FLEX 4PTLA 1QPBA 1UKZA 4XVHA 2X1HA 4OQPA 3MRXA 2AQIA 2ZIXA 3GGCA 1Z2NX 4Q9HA 1N2ZA 2BCEA 4PONA 3ZHRA 4RQAA 5KMGB 4ES6A 4B3DA 3MJRA 4UTRA 3ZS8A 4DBZA 1FRVA 3E6AA 1CE8B 4GOOD 3X2FA 1RLUA 4BJ6A 1L4UA 1B73A 4BWFB 4E22A 3UMFA 3WJ7A 3IEMA 1VXOA 3I04M 3Q8LA 1X7DA 3K31A 4UE3S 3EXIB 4H17A 1HE8B 2C0CA 4Q9AA 4YRLA 2GCPA 4ZVRA 2ZRGA 3F5SA 1C50A 4JCCA 5DI3B 4Z4HA 2J3EA 3L9XA 3WWCA 1ZMXA 4BX9A 4Q4LA 3E35A 4C14A 2GCIA 2I4NA 4WESA 4OPMA 4J1QA 4GMDA 3FCEA 1VMKA 3VNAA 2QZPA 1JHOA 4RA6A 2Q0SA 1EGQA 1VQ1A 2BHNA 1NJFA 4MCHA 2NXNA 3ZDYB 3LWBA 3R20A 3KOZA 4UXJA 1GZVA 4IS3A 2IUUA 3OQ6A 5CLJA 1EM8B 1PHPA 5B3JA 3TB4A 1QRTA 1Q0PA 1X1RA 3QFFA 5ICSA 1L4HA 1JDBB 1FVFA 2LP4Y 2PQMA 5LBTA 4BNMA 1R18A 4ITRC 4O4LB 4PN7A 3CZAA 1JQ3A 1R9MA 1T2FA 1LDNA 2BFCA 5DOZA 3A04A 3DDHA 4MUMA 1DX9A 4QUJA 2FAXA 4ASUA 3ASZA 1JDBC 3LCJA 1EBUA 1PX2A 4BKMA 4YI5A 3IAAA 3CM0A 2VBGA 4X1IA 2JEZA 3RU9A 3MN1A 4UE6A 3IUMA 1EM6A 4Q4CA 2IIQA 2FZGA 1OFUX 1NV8A 5JBQA 3AFOA 4ZEVA 3DZCA 4I9HA 4E32A 1M72A 4ROSA 4QNNA 4ZZ2A 3O8OB 3ZCTA 1ETUA 2PX3A 3DCJA 3GCZA 4DMUB 1NONA 1TZCA 3PVSA 1YB5A 3GZJA 3KQSA 2IDZA 4ZTUB 2H16A 1E3EA 2VVTA 3ZV3A 1GSAA 1JYFA 1RJGA 1EFTA 3CRZA 3SSAA 1R64A 2HSZA 3OIGA 4GLJA 4IV0A 5EIFA 3TZ6A 4CTJA 3F6CA 5BOSA 4M8SA 2FU5C 4NIMA 2HWWA 2IHUA 4B1FA 2H0QA 1X1BA 4CEIA 5AUNB 4TTPA 3V1UA 2QMHA 2QRNA 3E27A 5KEIA 1M83A 4M9QA 4MROA 3RR2A 3OF5A 1KBOA 3ZCSA 2E18A 5IUNC 1A98A 1KJWA 2ECQA 2W58A 3QWHA 4A0SA 4BFVA 3PTAA 3UGJA 3EY9A 1W2WB 1MO6A 1P19A 3TUJC 2V7TA 5J5AA 1UBFA 2XV1A 1XAJA 4RCVA 1XDDA 4Q7LA 4GPEA 5ECYA 4MUNA 5JS1A 4YAGA 1OLSB 1HFWA 4G25A 4HQFA 3L7BA 2VDQB 1B7GO 4DG5A 2HIHA 3AVWA 2WA1A 3IA2A 4TTTS 3NT2A 1NZDA 1DMRA 3GLUA 3C1TA 4A23A 4XB2A 4CI9A 5AK4A 1ITZA 5A7GA 3GEHA 3HR7A 4UHJA 2PFSA 1DEHA 3AR9A 4ZQBA 1LDBA 3OOEA 2FPIB 2GARA 4MX8A 5DNCA 3DR5A 4MVWA 1FMTA 3JYLA 3KQOA 5DCWA 3LCVB 5TB5A 3SR4A 5A06A 1QAOA 2EHJA 1JJ7A 2ZIXB 1CXZA 2GAAA 3AXSA 5IJAA 3M6UA 5EJ6A 1G38A 2F3QA 1A5BB 1HYHA 2NVBA 2AD1A 3JRWA 3PSHA 3VSEA 4A10A 4AUNA 4FX5A 1YHNA 1WZUA 4POAA 1YTUA 3NFYA 4QEZA 4G0YA 4P2GA 3DBLA 1PQUA 3NBUA 4J1NA 3FAZA 4DLYA 4N1AA 3PE4A 4ATNA 1KTIA 1ELOA 2NACA 2QVZX 4FYMA 2ZI3A 2IGBA 3L7MA 2QUJA 4HB4A 1VG0B 4YRKA 1GWNA 3QKSB 3URMA 4R1UA 2I4OA 1RTTA 2PNFA 5DRTA 3CUSA 2OXIA 4OI2A 5HUJA 5HKLA 1DAKA 1KWKA 4AKHA 5HCUA 4WESB 3RU2A 4FZJA 2X9VA 3L79A 1BDJA 2XEDA 4RMGA 1A27A 5IX8A 1K3UB 4PV7A 2VHTA 1EFCA 4F06A 3IQZA 2R4QA 2M6KA 4Q4HA 2NZYA 1WZ2A 2R2AA 2C84A 4YUWA 3ZY6A 1UZAA 2WT4A 3BA1A 4QEDA 2D5CA 1NVAA 2NPOA 4ALIA 1BH2A 4QREA 3QE9Y 3HE3A 1CCWA 1NOJA 1QTNA 4HWRA 2TMYA 1T5TA 4GEKA 2V65A 4PGGA 4UUOA 1BE0A 1NXWA 2W0SA 3CS3A 2F3UA 3TFQA 2VP4A 2Z95A 1CY8A 1PNQA 2QG9A 4OJYA 1W5SA 2YJ3A 5EL0A 1TQ4A 2CVZA 5B3JC 1ONPA 1SEVA 3KVOA 1PWYE 1WL8A 1I4LD 2DUJA 5AM2A 4X1IB 1T5BA 3OFSA 1VSUA 2D5AA 1H8EA 5J1TB 1JTVA 1COZA 4FK8A 2F55A 4L5JA 2G0NA 1E1YA 3AU8A 4JGIA 4BTEA 3NTVA 1H4VB 1NI5A 5H3CA 1FP1D 4F11A 3AUTA 2ZTSA 1AHIA 3KQUA 1G41A 3O93A 2QN6A 4Q7KA 1JKJA 3FHTA 1W34A 3QV2A 3HUUA 1RKBA 4DEXA 3HHEA 1V8FA 4M53A 4RDIA 1SU7A 1SXJA 3TQQA 5BOSB 1U3VA 1YHYA 1VA5A 4ZT5A 2W6JD 4POOA 4IRUB 2ZU6A 2QLNA 2ZULA 4G26A 4UVIA 4CEIB 2W6OA 4YPVA 1KI2A 4JU9A 1R4NB 2XUIA 1OC4A 3WGVA 4KPYA 2XWSA 3H11A 3EC7A 3PQ8A 4EZEA 4G63A 1MGOA 4O63O 3EEQA 1HORA 1ZNYA 2QR3A 4KXFB 2DHQA 3ITDA 3TOVA 2PWYA 3M49A 3NONA 4JT8A 1O0SA 2P9HA 2ZBQA 3A1UA 2YZNA 4GXNA 2IHVA 3ZQKA 3SSOA 3JWEA 1JALA 4HTFB 3IT0A 3U48A 1CZUA 1M7BA 5MFPA 1PTJA 1UC8A 5JTTA 1YE8A 4X71A 1E4OA 1YFKA 4KQCA 3FLEA 5B4VA 2JBHA 2WJGA 4HDSA 4MQLA 3BOSA 3KZVA 2NUBA 3KZKA 3E7WA 1NNLA 4LXYA 4F6RB 2WKWA 4L6IA 6AT1A 4GKJB 2H7CA 3DS8A 2CLEB 3EQ8A 4MRNA 1P62B 2QGZA 1B3BA 2HMWA 1S1MA 3C1UA 4E5MA 1F38A 2QDXA 5I9LA 3MWKA 1JHDA 4IOKA 4JT4A 5B58C 1RC1A 2XJ9A 4C1NA 4LF5B 3M3PA 4HZGA 2FWIA 4CGYA 3H8SA 1GDHA 2CXXA 3JQBA 2J3IA 4BX8A 1RWOA 2VPYA 4D57A 1BU8A 5ICMA 1NY5A 2CXOA 3KTFA 3W2HA 3A1TA 3C97A 3V9AA 1YJAA 1NXQA 1QGUB 2TYSB 2O3SA 4PFKA 1C7IA 2GTPA 2VDVE 4GPAA 4MR9A 3SF0A 3ZYCA 2SKDA 4C07A 3PTLA 4QUAA 5K0TA 1IULA 1GN8A 1JQEA 1BWQA 1IN4A 3FLBA 3PUYA 2E6UX 1ZCAA 4FNOA 5ALSA 3CRNA 3WY9A 3F3MA 5E6SA 5BWLA 3N3BC 1TTPB 3ITEA 4YLEA 5GJCA 4HAXA 4RV5A 4BP3A 1FOEB 2PZKA 3L93A 4KWCA 2RG1A 5DK4A 5HCNA 1UC9A 4ALKA 1ZEMA 1U1IA 1ZQ1A 2FHSA 2KWIA 1ML4A 4J2HA 3JVDA 4EKNB 2P27A 4YMVA 1M75A 3STVA 4GOMD 3UMYA 2ZDHA 2WA2A 4O2BA 5AQEA 4BCDA 3E5NA 4HI0E 1G6Q1 5DLQC 5E7JA 5T4FA 4GL2A 3BMXA 1DJQA 1Q1EA 3ZW8A 3MELA 1FFYA 3KQQA 2IEBA 2J4FA 1MAHA 2PVSA 1VMDA 4OGKA 5LDHA 4QT4A 1YCDA 2PXXA 2EFGA 1STOA 2WU1A 1P2UA 3ESXA 4PYNA 3I23A 4JJAA 4Y2VA 4URYR 2PQ0A 4MAAA 1S02A 4C03A 1F4VA 3AR5A 1SUSA 4Z0HO 2XUOA 2W6CX 1IXKA 4B31A 4KHPB 1I7LA 3AY3A 1WAMA 1H65A 1K3TA 2X4LA 4BO8A 3N2YA 4BGEA 1RI2A 4C04A 1P31A 8AT1A 3GQVA 3V8BA 3VUFA 1AH2A 4GRDA 3L7NA 1NC3A 4LY6A 3SX2A 3ZR4B 2HLHA 4FB5A 2I7CA 3VR6A 1HUQA 3N7UA 4LAFA 4GKKB 5HQJA 1M34A 1B26A 3FFWA 3G5LA 4P35A 5IVDA 4PQFA 1QQ7A 2CUZA 2QN3A 1LRKA 2ZKIA 4F71A 2OYCA 1SQ6A 3GBVA 4AUEA 1II9A 2C5GA 1GT91 3M2PA 2OXCA 2PV0A 1JFRA 3T9CA 3TOSA 4YUVA 4AICA 5KTTA 2ZYGA 3LNTA 4V0RA 2YVKA 4QDXA 1QG0A 3W6OA 3PC8A 1JR3E 3IAUA 3P0HA 1ORHA 5HIAA 2ZM5A 4KSCA 3G2PA 1SXJC 2R6DA 1QORA 1TAUA 1I36A 4W5WA 4DEYA 4P5EA 3AM3A 3GRKA 5EINA 3U3OA 3FMOB 3BXOA 3W4IA 4DLNA 5KQGA 5AM0A 3KWFA 4R7TA