4QEDA

Elxo y152f with nadph bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILFGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Oxidoreductase
molecule keywords ElxO
total genus 87
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qedA00
1GZ3A 2UAGA 3DL2A 4NG5A 3WFJA 1ULUA 2UDPA 1CQIA 1SMKA 1W73A 3AM4A 4NPCA 2FY8A 2GCGA 3BMQB 5KNLA 1NFQA 1P1KA 1ZIDA 3QWAA 4QFCA 3ONFA 4ZQEA 3V5NA 2YDXA 3BMOB 4BKPA 4ZJUA 1XCBA 2DC1A 1UP4A 1WLYA 3P2OA 2VWPA 1Z73A 2VOEA 2JAHA 3WIEA 4J7XA 5C5IA 4ALKA 1PL6A 2XF8A 1T4DA 2CFCA 2G5CA 4CLOB 4YWJA 3GNSA 1V0JA 3CINA 2OP0A 5JPIA 5JMPA 3TWOA 4D46A 2CSUA 3OEWA 3AUSA 5L7TA 1JVBA 3BIOA 3T7CA 2DPHA 1CERA 4NFSA 1PGPA 5L53A 1IB6A 1QYVA 2ZYGA 3DZIA 3ZU5A 1HDRA 2PA3A 1YOVA 1FXSA 1FK8A 1MC5A 2EP7A 3WGQA 5CDGA 4BUCA 1ADCA 2PKRA 4CQMB 4KOAA 5CP8A 4GKVA 5JW6A 4IS3A 3N58A 3KEQA 1T26A 2P68A 4JIGA 4E31A 1Y6JA 3K2BA 3GQVA 4MVJA 1GDHA 3QRWA 1N9GB 3E18A 4D3SA 4GQAA 1A4IA 1ZXLA 2IXBA 5TJHA 1XIVA 5AYVA 3RFTA 1PQUA 4FOSA 1A9ZA 1AHHA 3LDHA 4BO7A 3ORFA 1O89A 2P5YA 4L0QA 5C37A 3ZV5A 5CEEA 2EGGA 3GH3A 4DBVO 1Z7EA 3MJSA 1U4SA 1X7DA 3F4BA 3DMYA 4XB2A 1PIWA 4RO0A 2FR0A 3H5NA 1LTHR 1YB5A 4UEKA 1E3IA 2CF6A 4MKZA 4EUEA 4XIJA 4EW6A 2VHYA 3FBGA 4YB8A 1Y9EA 5JFOA 4N5LA 4RVUA 3RUFA 5B1YA 3ZWPA 4BMSA 2VT3A 1NWHA 1F17A 4MIOA 4KWHA 3F9IA 2IEDA 1D4FA 3UCEA 2NU9A 2B69A 2Y1GA 4PGFA 3AU9A 3B1FA 5A1TA 3TJRA 4R5HA 3JQGA 1CQJA 2AEMA 4L4RA 3WGGA 5IZCC 3EAGA 1SBYA 2V65A 2PV7A 3A06A 2GZ3A 3DQPA 1E5LA 4BNJA 1ZBQA 4ZICA 5TLSA 2X4GA 4E2ZA 3NT4A 1PJSA 3C3XA 1EVZA 1X7GA 5C7OO 1R6DA 3VH3A 2J5QA 1IUKA 3GOHA 4MP6A 1I2ZA 2YYYA 2H5LA 3HUDA 4RVGA 1ID1A 2EIHA 3A14A 1LBEA 4GMFA 5F21A 1YJ8A 2C0CA 2CD9A 2BHLA 2I67A 3I9NA 3ENNA 3UH1A 4E5KA 5IJZA 1P1RA 3U4DA 1NAIA 4N54A 4GVLA 3FF4A 3C7CB 2UUPA 1F12A 4R69A 4HADA 3UHAA 1GL3A 1NVTA 2OOSA 1U5CA 3UGKA 4E6PA 4UVGA 3OA2A 4XGIA 4ZVVA 1BXKA 3KLPX 2CDCA 2HMVA 4CQLA 2GERA 3I6QA 3PHGA 4CMHA 2NLOA 1I32A 3ZWXA 2AEJA 3PTZA 1E1MA 3KYBA 1IPFA 4HY3A 1DOHA 3JCZA 1QYXA 1I10A 3KYCB 1UXHA 4OOEA 3RU9A 1PS8A 3D5QA 2I3AA 2Y1OA 3L6OO 1PQWA 4FR5A 4PG5A 4I1IA 4B3JA 1Q1NA 1T24A 2QZZA 3DAGA 4UUNA 4DPLA 3VTZA 5EL0A 3KO8A 1OBFO 3X2FA 1UXGA 4GX0A 4GX1A 4DQUA 4P8RA 4MVJP 3DOJA 5KVCA 1DAPA 3W1VA 5U4QA 1Q7BA 3GFBA 4XJSA 4R01A 1RWBA 1H2BA 1QV6A 3OQ6A 1YL6A 5MGBA 1B8UA 4GVXA 3PDUA 4YXFA 2YUTA 5ER9A 3EK2A 4WASA 1H0KA 4IGEA 3VDQA 4OKIA 3B1JA 5K6AC 2FSSA 3IMFA 5TIIA 4EDFA 1ENPA 4DPMA 4L76A 1XYGA 4NBTA 2A35A 1AE1A 4J16A 3ZWOA 4CM9D 3ZHXA 1R37A 1K0UA 5COBA 4IJUA 1LRLA 3L4SO 1YE3A 1GV0A 4JJIA 3DBHA 4UULA 4EITA 4IPTA 4Z0HO 5L9AA 2V7PA 4BNHA 4OMUA 4DLAA 3S2EA 1GY8A 1N8KA 1NFFA 4O59O 4FIZA 5EMHA 4BO9A 4DC0A 3GHYA 1R0KA 4UUMA 3MOGA 3L0DA 4GH5A 1LLCA 6LDHA 1DHTA 3IJRA 4R9RA 1Z6ZA 2ZCUA 3DOOA 3EZLA 3NDJA 4D41A 2JD1A 3K92A 4IIUA 1X7HA 4I5DA 1O95A 4OSOA 2C2YA 2J6IA 3E82A 1GYRA 3W8DA 4ALMA 3AY7A 3INGA 5CDTA 3IIEA 2BFOA 1SNYA 3PLNA 3ZV4A 1NVMB 4CMEA 4YACA 3CXRA 1KBZA 1HYGA 3NUGA 1EE2A 4ZA2A 1RM5A 4L73A 2WJPA 3HFGA 3I9LA 4J7UA 1HEUA 4MVJF 3H6KA 4WLFA 3AI2A 4IQGA 2VZ8A 1RPNA 3LT2A 2AHRA 1NQAO 1JKJA 1SO8A 4LVUA 1NVGA 3QIVA 3JQ8A 2E82A 3DB2A 1UH5A 2BKAA 4JXKA 3F4LA 4QO8A 2GNAA 2H63A 4WNCA 4AJOA 1D1SA 3O8QB 4DQVA 4B3HA 1ZW1A 2PR2A 4J90A 5TQVA 3HN7A 2JFHA 3JQ9A 1T1RA 4E4YA 4J1NA 3NT5A 2HMUA 1DC5A 1NWCA 4HFRA 4R1UA 4ID9A 3JD1A 5FI5A 1DDOA 2GN6A 1N1EA 3ICPA 2NM0A 3VPHA 3ETGA 2OO5A 1WNTA 2FR8A 5JE8A 2B0JA 3QWIA 4FJ0A 2HRBA 4JCOA 2X8LA 1N7GA 3KZVA 1EQ2A 2ZCVA 3JSAA 4JP3A 4U7WA 4PZEA 1KYQA 4CM9A 1J5PA 2PD6A 1M6WA 1PR9A 3H3FA 4KQWA 1YL7A 2VT2A 1WP4A 2GO1A 4R1SA 1RM4A 1EK5A 1DBVO 1UZLA 1O6ZA 1NM5A 4MP8A 4W9NA 4HFJA 1GU7A 3ST7A 1Q2XA 3RC9A 3IP3A 4GGPA 4YAKA 1AN9A 3QWBA 1NHWA 1E3EA 4I5EA 3H9GA 3RI3A 3RROA 3QWHA 4RVSA 2RBEA 3G0OA 1W6UA 1V35A 3CE6A 1ENYA 2YV1A 5HWSA 3NYWA 1HYHA 2NTNA 1DIAA 4O5OA 5HTOA 4J1SA 4Y6RA 5KWEA 3BA1A 1ZCJA 2I99A 2CDAA 2Q45A 3WGIA 2D2IA 2O3RA 2Y1DA 2IE0A 3LC2O 3IOYA 1LSJA 2VRCA 2YV3A 3ABIA 3PGXA 2DBVO 1GZ6A 3HSKA 4JJFA 2PLAA 3I5MA 3GPIA 3KV3O 2Y68A 3MZ0A 3C7AA 4MVJD 4BGVA 3NGXA 4IXTA 4D0RA 1FDUA 4II2A 1I5RA 1WDMA 5F1OA 2P5UA 2W98A 1VSVA 4C7JA 3PHIA 2OBNA 3H7AA 4B8ZA 1YB1A 5DP1A 5TF4A 3UAGA 2ZATA 3BMOA 3H3JA 4BNZA 2X5OA 1YBMA 3OMLA 4FN4A 3ZWYA 3PK0A 3GEMA 2W4QA 5KOIA 4MVJG 2HDHA 1AGNA 3JQ7A 3GF4A 3HB4X 2X0IA 3BHMA 3VHRA 5A06A 1E7QA 3WQQA 3KLMX 5DULA 2YFHA 4BO4A 3SX2A 1NR1A 1JN0A 3D7LA 2C82A 1UR5A 4JK3A 1NFRA 3DBRB 2HK7A 4WCFA 3ZZNA 3TZ6A 4NH4A 3ONDA 4C4OA 2HMSA 4U0KA 3PQEA 3ADPA 1C0PA 1CWUA 3BZUA 3OICA 4NHEA 4YJGA 5C7IO 3AOEC 3IC5A 4G81A 1U7TA 2JFFA 2Y1FA 4E12A 3CKYA 1H6CA 3ENKA 2JFGA 4GLOA 4DYVA 4R9SA 3I3OA 2FP4A 1WMBA 2AW5A 4OHUA 4P38A 4QFDA 4RPKA 4MVJE 1P3DA 5T8KA 3TN7A 4CL8A 1YXMA 2ZTLA 3VZSA 1QMGA 3OFSA 4XB1A 2ZTVA 2OXIA 1U2GA 1ZO8A 2ET6A 3WJAA 2P4HX 3QVWA 5THQA 3Q1LA 1UZNA 3AFMA 1E3WA 1I30A 3VZPA 3VH4A 2SCUA 1X0XA 5CAEA 3GAFA 4ZRNA 1I3KA 3FD8A 5T67A 2W90A 4BGUA 3WMWA 4CM6A 2R00A 1K89A 3WSWA 1LDBA 4H3VA 2AMFA 3FNHA 2Y67A 4DA9A 3R3SA 2DBRA 3MJVA 1DRVA 4Q3NA 2GGSA 1I8TA 3RUHA 5JCJA 4B7CA 3P7MA 5DOVA 5BQFA 1NQTA 1E6UA 4F3YA 4O0LA 4OM8A 2IYOA 3KETA 4CM8A 3S2FA 2FWMX 2PZKA 1ZK1A 1TA4A 2G0TA 2BFAA 1L1FA 1JKFA 5A9RA 3HE3A 1UAYA 4YBZA 3H9EO 3HHPA 3WGZA 5IFLA 2CVQA 5EINA 2VHZA 2CY0A 3ETDA 3RKRA 4MOWA 5EERA 5IZ4A 3PP8A 3LU1A 2VWGA 1HRDA 3DBRA 3M2TA 1Y1PA 2D1YA 4Q3CA 3WIDA 1ISMA 2Q1WA 4N7RA 9LDBA 4FQ8A 2AA3A 3HNPA 2FZWA 3RIHA 4BNKA 1KEPA 4BV9A 4IBOA 3FNFA 3IQDB 3DZJA 2R6JA 2UVDA 3KHUA 2PH3A 2O3UA 4TROA 4CLOA 3H9QA 6ADHA 5A9SB 3ITDA 5ICSA 3MOIA 4DRYA 4XEHA 1V3VA 3IKVA 3H5AA 3QW2A 4TZKA 2CF5A 1UZMA 2WD7A 4PLTA 4L75A 3GY0A 3QVOA 4EJMA 2OFPA 1PL7A 4GPD1 1ENZA 5KJ6A 4OQYA 1I3MA 5BSFA 3DHYA 1E3WB 4LSMA 1BXGB 1X15A 1MLDA 2R2GA 2VOJA 4CM4B 4DREA 3GVHA 3RC2A 2DLDA 1T2DA 1WZEA 4KUGA 4DWVA 3Q0EA 3ZWVA 1BWSA 4P22A 4WCFC 3Q2IA 2X5KO 3GEDA 4A26A 3C1TA 2PNFA 3AI3A 1DRWA 3JD0A 3ETEA 5DBIA 2OP1A 1RM0A 2GASA 5EIOA 2W2KA 4K1LA 1GTMA 4IQ0A 3F1LA 2DPGA 4CMCA 5G0VA 3W8FA 2IDZA 4BNWA 5DOZA 4YT8A 4OXNA 3EMKA 3GDOA 3GT0A 2Q2QA 2HU2A 2LDXA 3KRTA 2FR1A 4NFYA 4W99A 3FRJA 5JDIA 3S2IA 2W2LD 2AG8A 3KYDA 4A10A 1HLDA 2D3TA 1P9LA 5T6BA 5JCJD 2O3SA 3AOGA 3F47A 5EJ2A 5KVVA 3FR7A 4RGBA 3K31A 2JHGA 3ZV3A 1GV1A 1NHGA 2POQX 3E48A 1I3NA 1E77A 5BSEA 1H9BA 2O3TA 1GEEA 2H6EA 4XGNA 4XR4A 3R1IA 1HDZA 1DJNA 3JQAB 4LVCA 4Z9XA 5K0ZA 4OJNA 5FYDA 3PQDA 2JCVA 2ZB7A 4Q3EA 4PLWA 2CVOA 2VQ3A 1GFSA 3GN1A 3M6IA 3BTOA 5BR7A 4W7HA 2EJVA 1B3BA 3E9QA 4K28A 5JC1A 4CV2A 4J91A 1XQ1A 4K26A 5K9ZA 1LRKA 3ADOA 2X7HA 5JDCA 5HA5A 4YRDA 3K5PA 3TQHA 5BSGA 1CRWG 2O3JA 4D44A 7MDHA 3PGJA 5ICMA 2JD2A 3SLKA 1XHLA 3EYWA 2ZTMA 1D7OA 1HTBA 4DLBA 3VKUA 4Y6PA 1KEVA 3K6JA 3PPIA 4AJKA 1K6IA 5G4LA 2TMGA 1B8VA 1JU9A 4J2OA 3LF2A 3NTQA 4HUJA 1H2HA 2Q4BA 3AWDA 4IDFA 1A7AA 5COAA 1EE9A 3HZZA 3B6ZA 2GZ2A 3JQ8B 4A7PA 4YYZA 4TKLA 4BNLA 1MV8A 4QQRA 2PY6A 3HB5X 2GD1O 4R1TA 5AXCA 1X1EA 4RPGA 3RQSA 4KMSA 4EJ0A 5L4LA 3U3XA 2Z1NA 3ROKA 2NVUA 1PGQA 2BH9A 4YRAA 3M1AA 1Y8QB 3COSA 1X14A 3W6ZA 1GYPA 4NFHA 3I4FA 3PEFA 1GPDG 4JBHA 1DXYA 3SC4A 3DAPA 2VYVD 5JNLA 2VTDA 3LLVA 3NT2A 2DUWA 1QYCA 5KVSA 3BHIA 1P44A 3V1YA 3VPGA 5IN5A 1PGNA 5AXBA 3PJDA 1BW9A 4YQZA 5DF1A 1A5ZA 1E0DA 4CV0A 3PHJA 4P4LA 5IXSA 3VC7A 1NYTA 3VKVA 3VTFA 3S2GA 4GGOA 1O5IA 1J6UA 1ULSA 2D5CA 1HYEA 1HWYA 1XQ6A 3L07A 4YT2A 3F5QA 4LN1A 1UXJA 3VOSA 4B4UA 4WEOA 4ND2A 4N5NA 4NBVA 2C5AA 2ZIZA 1RJWA 5IF3A 1U5AA 4XYMA 4BL5A 2O50A 4FC7A 3RUAA 3MWDB 4YCAA 3JQ6A 3ZNNA 3F5SA 4CM8B 1IY8A 1U2DA 5JCXA 4MINA 1N9GA 4KTVE 1E5QA 1PZHA 3PWSA 2Y0EA 4XR9A 4CR7A 1P1IA 3E9MA 3ZNOA 4HX5A 4OIMA 3E03A 3WBBA 1N92A 5JAIA 5F5NA 4HP8A 1ISJA 3STHA 2EKPA 3EW7A 1LSUA 3ZU4A 2JCYA 4CLRB 4P4GA 1KEWA 2WSBA 4XDZA 3LC7O 1ZNQO 1P31A 1Z74A 2G76A 4XKJA 3E9NA 3GEGA 1ZJZA 2O3QA 3CUKA 3ROPA 4DMLA 2BGMA 4GWGA 4DGSA 3I9OA 4K6FA 4OL9A 3FTPA 5HS4A 3CZRA 3TZKA 3OA0A 1OC4A 4ND1A 5JO0A 2DTDA 1RYEA 1W4ZA 1FDWA 1HE4A 3QVSA 2YY7A 1E3LA 5CG2A 1VKOA 3IJPA 4RF2A 1EUZA 1E1NA 4PCVA 1QYDA 2P2SA 3I1JA 4IZIA 4XQGA 2GN9A 3RBZA 3DBVO 5JDIC 1A9YA 4HNGA 4R68A 2HK9A 1PGJA 2EERA 2HKIA 4R16A 4Y9DA 3LT4A 1PQPA 4RF5A 4E5PA 3GDFA 2FOIA 4B79A 5TNXA 1GYQA 1X1TA 4YT4A 4Z9YA 3C1OA 4BO0A 3WQSB 3WB9A 3WXBA 4QSMA 2VHVA 2YFQA 4BHTA 1A27A 1P45A 2P9EA 3DC2A 1PWXA 3QV1A 3QVTA 3SJUA 4XRRA 4WECA 3S1LA 1ZK3A 4PLCA 3GNQA 1EVIA 1W0CA 3UCFA 3WX0A 2O7QA 4XZ3A 2Q1TA 3I4CA 2ILTA 2QYTA 4FFPA 3WTCA 3ZWWA 4WGGA 1P0CA 4JLWA 3ZHYA 1ONNA 4W82A 1J49A 3DBLB 2Z95A 4NIMA 3KSZO 4XRGA 5JS6A 5IN4A 2Q46A 3X2EA 3VZRA 4PG6A 2EG9A 3SXPA 1YVEI 1AUPA 1FDSA 2NTVA 2B37A 4YAIA 3WWZA 3CZMA 2JHFA 4H15A 1E7YA 2GPTA 3L77A 3PRJA 3VPXA 4BMVA 4IJVA 1JQBA 2J3IA 4D42A 1JW9B 1VM6A 4YRBA 4Q9NA 5G4KB 3NAQA 1OC2A 3K73O 2ZK7A 4IGFA 4E3ZA 3Q9UA 3RFXA 4UVDA 1NPTO 4NBRA 5DCWA 4F6LA 3UKOA 3QWFA 1LLUA 4PLPA 4R41A 1YKFA 2E49A 3W6UA 1TT5A 1U28A 1AXEA 1WDKA 2PKQO 4QEDA 1H9AA 2RAFA 1JVSA 3WR5A 5B12A 1JLLA 2FN7A 3ZWBA 1LUAA 5JXWA 4DIFA 1CIVA 2QHXA 4FGWA 4R1NA 1WPQA 3JTMA 1GUZA 1OMOA 3MJCA 4KQXA 3UOGA 4RQTA 2BELA 3WWYA 1JWAB 2W2LA 4CLHA 4R4JA 4W6ZA 5A03A 4G5HA 5F5LA 1E7MA 1H6BA 3OHSX 4ND5A 5ENDA 1B7GO 1DC3A 3WJ7A 4PG8A 4CLRA 1WXDA 4B4OA 5MDHA 4JGBA 1TT7A 3H2ZA 1VL6A 1GPJA 5BNFA 4BNUA 4CMBA 4NMHA 1Y8QA 1PJ2A 2JJYA 3ANNA 4J3FA 3NX4A 4XQ9A 2QW8A 5H82A 4YJHA 5JMWA 1ZK4A 5ENVA 2Y05A 3R0IA 3I83A 4BKUA 4CPDA 1ZK0A 4D7AA 5DBGA 5L4NA 4HNHA 3I52A 4G2NA 3GG2A 1SOVA 3AY6A 1ADFA 5KJFA 1B8PA 1LDGA 2D8AA 4RV9A 1VRWA 2VWQA 3M2PA 1DRUA 3VPFA 4D79A 4E32A 5AXAA 3FPCA 4AJIA 5B37A 3JYPA 1A4UA 4I5GA 1PR3A 2VUSA 3ASVA 1UDBA 2DFDA 3U0BA 1YDWA 3WICA 4BNGA 4CV1A 5U9CA 4YJFB 1E6WA 5A9TA 3I9JA 4IM7A 4ND3A 3JYOA 1UXIA 2C54A 3JYQA 4UVEA 1ZZEA 2Z5LA 1GCOA 5JY1A 3WLEA 1DIRA 1UP7A 1SC6A 3H65A 3Q11A 3A4VA 3ZN2A 3ZU2A 4XYGA 4FD3A 1P1JA 4J2HA 3RVDA 3QP9A 3LQFA 4RVHA 1NAHA 1LDNA 3JQDA 4CL3A 4TVOA 1EMDA 4NQZA 3ULKA 4RPLA 4DYDA 1F8FA 4A5OA 4E5MA 5HM8A 2FMUA 3AY3A 2E6UX 4IMPA 3RCBA 3TPCA 3GC6A 5KJ1A 1E1KA 1E1LA 1J4AA 3TL2A 5JC8A 3MTGA 5G2OA 2IZ1A 2HQ1A 3DHNA 2VYND 3I6IA 2OHXA 2RH4A 3DHEA 5IZCA 4CLDA 3W4KA 1KETA 3PZRA 4YJFA 4D0SA 2AEFA 5L7WA 2V6BA 2HJRA 1R0SA 1SB9A 3G3EA 3O03A 1E3JA 4FS3A 2IRWA 4IDCA 1SB8A 1UXKA 5CHEA 1PU2A 2DBQA 3F1KA 4JROA 4L8VA 4BO2A 5JAZA 2EF1A 4DVJA 2WD7B 2GDZA 3K9QO 3DZKA 5A3JA 5JLAA 1DPGA 3TL3A 1YL5A 4ALLA 1IHYA 1XR3A 3DDNA 4L9RA 1SOWA 3TZQA 2VUUA 1UDAA 4ZD6A 3C8MA 5TS3A 1G0OA 2YDYA 4RDIA 1LLQA 2WMDA 1V8BA 4TRNA 3JQFA 4BMNA 1PZGA 1G1AA 3AI1A 3AUTA 2HJSA 3DMTC 1DHRA 1UP6A 5J23A 3INTA 2OUIA 4BS9A 4NJMB 1SEPA 1U8XX 3I23A 4TWRA 1R12A 3GK3A 3GR6A 4NBUA 1WVGA 1DB3A 1JWBB 1SPXA 4TZTA 4DLLA 1ZH8A 2R00C 3F6YA 3QJ5A 5ADHA 1C3VA 3D3EA 4ALJA 2NNLD 1U4OA 1WMAA 2W2KB 2BF7A 3H9UA 4LISA 3VVBA 3WTBA 1U3UA 4U6SA 1QXSA 2D5AA 2X0RA 2O4CA 1MC4A 3L9XA 1KS9A 2WM3A 3GRPA 1E7RA 5FFFA 2PWZA 2PD4A 1N5DA 2NQTA 2RHCA 2DT5A 2FZEA 2X9NA 2WD8A 1M76A 1BW9B 3AM3A 3H9JA 1R0LA 1VKNA 1LSOA 4GAEA 1MFPA 3GGPA 2DBZA 1YRLA 4BB6A 2GZ1A 2BMAA 2A92A 4BO6A 3G49A 3GAZA 3O4RA 3K30A 2B36A 1C14A 4KZPA 5JYEA 4OYRA 1JAYA 4NJMA 4M8SA 3FSRA 1YDEA 4XYLA 2TMDA 3FR8A 4M55A 1LDMA 3MEQA 2ZYDA 1VPDA 3C1AA 3PJFA 5EPOA 4AJ2A 5IG2A 3R3JA 5G4KA 1M66A 4Z6KA 5B4TA 1KC1A 3SJ7A 3HG7A 3OJLA 1LXCA 5GZ1A 5IDWA 1T2AA 4J0FA 4IDBA 2IZZA 1QR6A 2CZCA 4CLEA 1VJ0A 3D5TA 2ZQYA 4OXKA 3LZ6A 3PIDA 2NSDA 3P2YA 3A1NA 4OQZA 3INRA 5L40A 2E4AA 1TLTA 1T1SA 1ML3A 3WYBA 1VSUA 4L74A 2VHWA 2X0NA 3UUWA 2BFPA 3BMNA 1YS4A 1QLHA 2PGLA 3HDHA 3MJ4A 4CMAA 2B35A 4RORA 2DAPA 3RUCA 1IZ0A 4RF4A 1PSDA 4AJEA 1JA9A 2X0JA 1LRJA 2RH8A 1KVTA 1DIHA 4PG7A 3UW3A 3IKTA 4TVBA 1B15A 3V2GA 4CMEC 5JAQA 2X6TA 3AM5A 4Q3BA 3NDIA 3ON5A 2J5KA 1LU9A 1ZXBA 4TKMA 1XU7A 1DO8A 1M67A 3Q3CA 1R4MB 2P9CA 4D3FA 4A03A 2IODA 4J1TA 1MG5A 3WMXA 1CF2O 3GPDG 4FFOA 5IDYA 2A9FA 3E5MA 1KY4A 1XG5A 4YJGB 4DXHA 1MB4A 3ZU3A 3DZGA 3E8XA 2HUNA 1H93A 1E3SA 4WEQA 1NPYA 3GGOA 2C29D 2ZKLA 2Y1EA 2F1KA 2BI7A 3WS7A 1ARZA 3OQ1A 2YHIB 4LK3A 1HZJA 2Y99A 2QYSA 3OIDA 1VJ1A 3DWFA 1Z75A 5HS6A 1JTVA 2AG5A 3OECA 5FI3A 5LCXA 1Y9AA 1UUFA 3EVTA 3MCVA 5I7FA 1YO6A 4TRJA 5H83A 3PI7A 2I6TA 4FFRA 4XCVA 4AJHA 3OJFA 1U3VA 1MX3A 2NADA 4J43A 5I9NA 2HMTA 1KC3A 3ZHBA 5CPFA 3QLJA 1DLIA 1SEVA 3KTDA 3C7DB 1I0ZA 2GR9A 3KOUA 8ADHA 2Z1MA 2DKNA 3QE3A 5HBRA 1HXHA 2NU8A 2Q49A 3VZQA 3V2HA 1C0KA 2I5PO 3RJ5A 2X23A 4L4SA 2PZMA 1OOEA 4YAEA 1LI4A 2OMEA 4N5MA 4BGEA 1F06A 5EQDA 3FNEA 4BQPA 2JCXA 2Y0CA 3QHAA 2YZ7A 4NU5A 1KVRA 2RCYA 2I66A 3V8BA 3GVIA 1N1GA 4NJOA 4OOFA 4ZN6A 5HRUA 1NBOA 1DLJA 3DMTA 4NI5A 4IDDA 1IYZA 2NQ8A 2GLXA 1XKQA 1B14A 3OJ0A 3KYDB 2DUUA 1LSSA 5DP2A 1E92A 1GEGA 1CDOA 1ZMTA 1PZFA 3L6EA 4GL4A 1R16A 1F0YA 1EFKA 3OJOA 4J9UE 1LEHA 2AQKA 2ZB4A 4BIIA 2FPGA 4CMKA 3V1UA 5A9SA 5LDHA 1MP0A 2YJZA 4MDHA 1E7WA 4Z0PA 9LDTA 1OAAA 2DFVA 2BI8A 5A02A 4WCFB 3W4JA 3WBFA 4CM7A 4GSKA 3ZW9A 3PJGA 1IULA 4WLVA 5DBFA 5FF9A 1RYDA 2RIRA 2X22A 3ANLA 3L4BC 4J4HA 3T4EA 4P4NA 1R4MA 4OSPA 3BMNB 1VI2A 3G1UA 4Z3KA 3IL2A 1BXZA 4AG3A 3WOHA 4JP2A 2DVMA 3EVNA 5LC1A 5CEJA 4FDAA 1T2CA 1S6YA 5AQ1A 3ANMA 4GKBA 3JV7A 1WDLA 4AJJA 3QSGA 1B26A 1FJHA 1BVRA 2HSDA 3CTMA 4D3DA 1JAXA 5TGDA 2Q4EA 3IUSA 3FPLA 1C1XB 1I24A 2ZYAA 3NTOA 4AJ4A 4ND4A 4AFNA 2FRDA 1PX0A 3SEFA 3NRCA 4U6QA 1BVUA 2HK8A 3GUCA 3MTJA 1V3UA 4FPXA 4XYEA 1T2EA 4CUKA 2X9VA 3DTTA 4UAGA 1AXGA 3BYZA 4CMIA 4EZBA 1YOVB 1QRRA 1FDTA 3HN2A 4AL4A 3QQPA 2EEZA 3JQCA 3HQ4O 3V1TC 1CETA 5KIAA 2I76A 5C7LO 3MJEA 1ISFA 3RBVA 1ZK2A 4LW8A 3WLFA 2C20A 2QG4A 1VC2A 1Z7BA 3K96A 4ONEA 4OAQA 4ZGWA 4RPJA 5JO9A 2A4KA 4R51A 1FMCA 2G82A 1U3WA 1AHIA 4PG4A 3WDSA 1LQUA 5ITWA 3RJ9A 2PGDA 3C24A 5L51A 5CEFA 3IUPA 2DU8A 3HADA 1Y5RA 3TF5A 3TZCA 1HE3A 3O8QA 3ZHZA 2YV2A 3TNLA 1C1DB 1LC0A 1U9JA 1K5HA 1BHSA 2WYUA 3L9WA 4ITUA 1EQUA 2NU7A 2VRBA 4FB5A 4BNVA 1NQ5A 3TOZA 1GUYA 2QQ5A 1NPDA 3VAZA 1QG6A 4MVJH 2P4QA 1I01A 1O8CA 1I3LA 3CMMA 4OGWA 1L7EA 4DIBA 2Q3EA 3D0OA 2EHDA 4BV8A 1H6DA 4C7KA 1P33A 2AQ8A 4I5FA 4IJWA 3H4VA 3JD2A 3QY9A 3JQ7B 3EC7A 1FDVA 1NP3A 3RKUA 1S7CA 2V6MA 1BDMA 4PN3A 2VTEA 4WUVA 4A73A 2AE2A 3BMCA 4KP7A 5JYDA 1Z82A 4JBIA 2UV8A 4XQEA 5TC4A 4B4VA 1HDXA 4WLUA 3A28A 1P1FA 3ZNPA 1DFGA 1HKUA 4PLGA 1PL8A 3BTSA 1GCUA 2IEBA 1R4NB 4JN6B 1MXHA 2O2SA 5KKAA 2CNBA 4PLZA 4Q3DA 2GRAA 1O0SA 3PWKA 3GFGA 4J6FA 4CUZA 1XU9A 4FSHA 2PFGA 4LGVA 4AVYA 2HRZA 4WE3A 2QX7A 3CIFA 3GUYA 4GMGA 1I2CA 1HDCA 3Q2KA 4ZU3A 4RPHA 1EUCA 4N18A 3S55A 2PTGA 1ZMOA 1LNQA 3FWZA 3CPSA 1UDCA 4URFA 3A9WA 1K2WA 2B4RO 3H5RA 4CM5A 4WLOA 3U09A 2I3GA 3D1LA 4NDNE 5I7EA 4BO3A 1GQQA 1HE2A 5T8KC 4BNXA 4QTZA 2C07A 1VLLA 4RVFA 1QYWA 4GX2A 4UEJA 4FOOA 5FEUA 3ZGYA 8LDHA 3ZV6A 4M1QA 2P91A 4JJGA 3IDSA 3PYLA 1WAMA 2W8ZA 4UVIA 1TVEA 1Z45A 2CMDA 5THKA 2OZPA 1RKXA 4BNTA 1HF3A 4BNMA 1R66A 4LCJA 3RAJA 3HJAA 1XEAA 4PLHA 4ZRMA 1DSSG 3OJEA 4CV3A 4RDHA 1BMDA 4JNKA 2O48X 3UN1A 2Q2VA 4MPDA 3ROMA 4A27A 4PVCA 3RWBA 1G6KA 1CJCA 1ENOA 1KERA 3WFIA 5T5QA 4IMRA 1I33A 1HE5A 1T25A 2EXXA 1MFZA 2Y93A 3BMCB 2AXQA 3UVEA 3VVCA 5JAMA 2V6GA 1WZIA 1IOLA 2B5WA 1Q7GA 1ZEMA 2WEKA 4UREA 1K3TA 2XXJA 3DXFA 2NACA 4UUOA 3ZWCA 2ZQZA 5TJ9A 1XLTA 1BSVA 3KSDO 5DN9A 4BKOA 1YBVA 3WGOA 3DTYA 4MKRA 3SC6A 2DQ4A 4WOJA 2GYYA 4NU6A 3P19A 1F8GA 1D1TA 1E7SA 3PXXA 4IXWA 4O63O 2YHUA 3EZYA 3ICCA 4CR8A 1YONA 4J9VA 4M49A 4BOYA 3GNTA 4FBGA 2QIOA 2PKQP 4BGIA 2D59A 3FI9A 4PFJA 3U5TA 3JD4A 4AJNA 1R15A 3LYLA 4WNIA 2O4UX 2Q2WA 2BFMA 2ZB3A 3D4PA 3Q6IA 4FW8A 4PLFA 5I9LA 4Q39A 3JQBC 4LRSB 3RC7A 4R3WA 4XD2A 4F6CA 4BNFA 3WG9A 1EVJA 1X13A 4K9DA 4IQ8A 3GMDA 4WLNA 4PIVA 2HMWA 4IUYA 3TOXA 4X54A 2VN8A 5F1KA 5K6AA 1XELA 4Y98A 4F46A 4CQMD 4FC6A 4F45A 3EGOA 1HETA 2VCYA 4Y6SA 1GZ4A 1NTOA 4KDEA 3TFOA 3GZNA 3DEYX 1LA2A 4I9HA 2WE8A 4ALIA 4HV4A 1KEUA 5ES3A 3LSYA 3ONEA 2X86A 2OBYA 3VPSA 2IYPA 4YR9A 3RC1A 1LX6A 1Y7TA 1ZSVA 4W4TA 1I2BA 5EQFA 2EGHA 3EUWA 4GWKA 3D4NA 4O6VA 4UEOA 2WYVA 1Y8RB 1JDJA 1EFLA 4R54A 2I9PA 3ITKA 3GGGA 1CEQA 4BNYA 4YJDA 3FCOA 5DZSA 1LLDA 5GMOA 5CG1A 1SZJG 1DAOA 3I9KA 1PS0A 3G79A 1NQOA 3KVOA 4O1MA 4OKNA 1ZUD1 2VRCD 3OQBA 5I7SA 1HDOA 3MJTA 3UICA 2QRJA 5A04A 1B16A 2IZ0A 1DJQA 1YB4A 3QA9A 2D0IA 3PIIA 1EEHA 4YA6A 1MUUA 3D4OA 4R5MA 1BG6A 4WOKA 1GQYA 4BO5A 2CVZA 3OETA 3GZNB 1B0AA 3DFUA 4ZQHA 2NVWA 1A71A 5FWNA 4JQCA 2FPIA 5CPBA 4CMGA 3OP4A 3BMQA 3RUEA 2QZ9A 1P0FA 3L6DA 4WJZA 4CM4A 4D43A 1KVUA 4DPKA 1ZSNA 1QORA 3BTVA 3RASA 4CMJA 1IHXA 4B7UA 1NX6A 3OM9A 1K6JA 3HDJA 4YDRA 4FFNA 4MIEA 4B4WA 5C3MA 1G0NA 1C0LA 3BTUA 4GI2A 3WGYA 2PZJA 4INAA 3ZNQA 1GAEO 4FGSA 2BD0A 4BNIA 2Y0DA 1KOLA 4QXMA 4MVJI 1PS9A 4NK5A 3LLSA 3EDMA 4J1QA 3JQ9C 5GZ3A 1M6HA 2BGLA 4J0EA 5DCUA 4YAJA 3UCXA 5B4UA 5L3ZA 4M54A 4YVFA 5KTKA 2E48A 4BNNA 3PHHA 2GN4A 3VDRA 5ILOA 3T4XA 1HDGO 4IDGA 1Y8RA 1R4NA 3PDJA 1D8AA 5A5EA 1A72A 4EGFA 2X9GA 3GG9A 4CQMA 1Q0QA 1FF9A 2XOXA 4CODB 4XA8A 4Z9FA 2HO5A 3LC1O 3NEPX 2JD0A 3WGHA 1EBUA 3E5RA 2PZLA 5TT0A 3AW9A 5G0SA 2Y66A 5ITVA 1BTOA 4DL9A 5BSHA 1E6EA 1XWFA 5H81A 3HDYA 4MVJM 5I7VA 3OSUA 4YEDA 5T64A 3TRIA 2EJWA 1IPEA 3W4IA 4LMPA 3JQFC 4OO3A 4CR6A 1PJQA 4QUKA 3M1LA 2XAAA 4S3MA 5IDXA 3P5SA 5GZ6A 3LT1A 1YBAA 4I9NA 1BXGA 1QSGA 2XXBA 1TEHA 4PRLA 1BRMA 2CUKA 2BRUA 5KJCA 5B4VA 4DBZA 1C0IA 2GF2A 4KUEA 2Q99A 1ZJYA 4NZ9A 5CDSA 3NGLA 2ZJ1A 4PRKA 1EDZA 2X58A 3HDQA 3V2UA 3GN2A 5EESA 2Q1UA 1OZAA 1UAGA 3GRKA 3PHLA 5JBIA 1ZFNA 1ZVMA 2AQIA 4B8WA 3JQBA 2YHIA 3ASUA 2UUOA 5BT9A 3GZ4A 2X5JO 3ZH2A 1W8DA 3LK7A 1PJLA 1NASA 4XIYA 4IZHA 4QT0A 3OIGA 3F46A 2OGUA 2BLLA 3AUUA 2GUGA 1LDYA 3CH6A 1OFGA 1TI7A 1BDBA 5A05A 4IINA 2VUTA 3IP1A 5KJEA 3QVXA 5GY7A 2VHXA 1P74A 3NDRA 4E2YA 5DNAA 4RLHA 1KY5A 3AK4A 3G17A 2J8ZA 4ZQGA 1C1DA 1XA0A 2J3HA 1EK6A 2OORA 3EY4A 4YT5A 5L7YA 3UXYA 5I8WA 2NVUB 3VH2A 5TX7A 2C2XA 1YGYA 5LDGA 4LRTB 1V9LA 4TRMA 4GX5A 4UVHA 4OXYA 2P9GA 1PJTA 1QV7A 2E37A 2CDBA 2Q50A 3S8MA 3KM0A 3DZHA 4IIVA 3WSVA 4U5QA 3ZW8A 1C1XA 1Y81A 2EV9A 3AUAA 2O7SA 4KTTE 1GR0A 3PZBA 3PLRA 5DT9A 2RHRA 4WKGA 1EDOA 1SAYA 3JYLA 4DC1A 4E5YA 1XSEA 1UJMA 2WE7A 3SVTA 3K8ZA 1ADBA 3OF2A 4HKTA 4NR0A 2C7VA 2QRLA 1PJBA 3U4HA 1DFIA 4K6CA 4LMRA 1GUFA 4HXYA 4XDYA 2A94A 4XJTA 4Z0TA 3VH1A 1CYDA 1H6AA 3H2SA 2XPCA 1DC4A 4RZHA 1LDEA 1KIFA 1O9BA 3GHHA 3EHEA 4RQUA 1D3AA 4EYEA 4RCVA 1GD1O 2VZ9A 1PJCA 4J7CA 1KVSA 1QP8A 3DZFA 1MGOA 1PGOA 4S1VA 2EKLA 4RVDA 5JSFA 1PJ3A 3I9MA 4BO1A 4FJ1A 3TSCA 1GADO 3PYXA 3AU8A 1JKIA 4NNJA 1Q0HA 1GQ2A 3B1KA 1LC3A 4BB5A 2ZJ0A 3LVFO 3ZDFA 4A0SA 4AICA 2NU6A 4BKRA 3DR3A 3U62A 4CM1A 2EW2A 3AFNA 4M87A 1VJTA 4E21A 2LDBA 3DAFA 4E30A 3WNVA 5CFZA 4I08A 3FN4A 4NK4A 3WQRA 2GN8A 4ZQBA 3PFWO 2HCTA 1YQDA 2G1UA 4ROSA 3RU7A 5KCZA 3U4CA 2C59A 3WNQA 3K2EA 4XGKA 3ZWNA 4RL6A 5CDUA 3W8EA 1T4BA 2WTBA 4II3A 5KKCA 4YAGA 4FFMA 3AJRA 2AQHA 5I9MA 3FTNA 4MO2A 3FBTA 3FHLA 2PGJA 3KSUA 3NJ8A 4IJKA 4Q3AA 4CJXA 2WYWA 2VWHA 4WLEA 3NTRA 3CEAA 2BGKA 3SLGA 4FJ2A 3DBHB 4BO8A 4MIYA 1EVYA 3HFSA 3RSHA 1DIGA 1KVQA 3G1TA 4U0JA 4QO7A 4J4BA 2EW8A 3WYCA 1Q7CA 5U1PA 3DO5A 4J4TA 2B83A 3U49A 1V3TA 3ZWAA 3F3SA 3H8VA 3AOEA 3OBBA 3DOCA 2EKQA 5ILGA 3TDKA 1OI7A 3TZHA 1H94A 2NV6A 1PWZA 3T7EA 4RZIA 3OH8A 4CUJA 3KB6A 3JQEA 4YTEA 4MJLA 1IE3A 1U1IA 2VYVA 3PWZA 4H7PA 2I65A 4ILKA 2NWQA 4BVAA 3DBLA 4DIOA 4YJHB 5I8ZA 5A3VA 4M86A 1N2SA 4CQLB 5IDQA 3CSDA 1ZKMA 1EBFA 1SCUA 1XDWA 3TFQA 1LQTA 3FNGA 4KWIA 1O94A 2FPPA 2EWMA 4ALNA 2H1SA 1B3RA 3ZCXA 3GVXA 2IXAA 3C85A 1HSZA 3KYCA 3O26A 4QX6A 4AJPA 4AJ1A 4A2CA 1B2LA 2DTXA 3NJ4A 3WGTA 4CM3A 4ESOA 5L4SA 2J5RA 4W9NC 3BAZA 3PQFA 3B20A 2JKVA 4HBGA 4JX8A 1VL0A 1RM3A 3CMCO 3OEYA 4XWYA 2UYYA 1P77A 3GMSA 1TT5B 2F00A 1Q0LA 3RBXA 4GLLA 2B4QA 1YH3A 3ROQA 1I36A 1U3TA 4M89A 1WWKA 4CLXA 1XGKA 2YQ5A 1WW8A 1U7HA 4LSWA 1HLPA 4GBJA 5JDCC 4E2WA 1K6XA 4R3NA 1ORRA 4PZDA 1DIBA 4TMFA 3SBOA 4DMMA 3PVZA 3L4BA 4TQGA 1HT0A 3IS3A 1MA0A 4EUHA 2DM6A 3JQAD 2OL4A 1J0XO 1X0VA 1HL3A 1NXQA 3DFZA 4MKXA 3MWEB 3PFFA 1Y5MA 3U4IA 4IDEA 1PZEA 3RUDA 2PD3A 2DTEA 3OIFA 4EUFA 3UF0A 4Y8VA 4E33A 1EZ4A 5COQA 2PK3A 4UUPA 1YQGA 1TXGA 4TSKA 2PH5A 3WYEA 2D4AA 1H5QA 1F14A 4ZHSA 4PVDA 3GDGA 4XQCA 2YQ4A 1P1HA 2EP5A 2B4TO 4YPOA 2Y1CA 1NR7A 1DEHA 4WK6A 4FFLA 3JQGB 5EN4A 1YQXA 1YWGO 1ISGA 2HAEA 5CDYA 1IL0A 1VE9A 3E1KA 2ZTUA 2NTJA 1NNUA 2YW9A 4PLYA 3RUIA 3O38A 4MP3A 5TRTA 4E2XA 3IAHA 3ZI0A 1YJQA 3N7UA 5DCYA 5IAAA 4W7IA 4DUPA 5JY6A 4B7XA 4E13A 1ZEJA 2C7GA 4IY1A 4DTIA 4E0BA 2QRKA 5G0TA 4EEXA 2C5EA 4Y67A 4IS2A 2GSDA 3DONA 3Q9NA 3R6DA 4XYBA 3PJEA 4RJTA 3KXDA 1MXFA 3UFXA 5ER6A 2J3JA 2JAPA 4H16A 1ONPA 4PZCA 5BNTA 2NUAA 1HDYA 2FHSA 3JYNA 3GA0A 3LF1A 4TRRA 3ZWMA 4RLSA 2WWRA 5DDIP 4J49A 2O2YA 1ISIA 1VL8A 4FCCA 3E6AA 3D64A 5F1PA 5F3RA 4NBWA 3FWNA 2J3KA 3GVPA 5TSDA 3PYMA 5A5FA 4RF3A 1DFHA 2NVBA 4ZQFA 3BHJA 3KEOA 4JBGA 1A7KA 4BKQA 3U9LA 5A4DA 4WCDA 3NKLA 3O9ZA 2V6FA 5G0WA 5T57A 4KUHA 4BQRA 2X1HA 1QLJA 5IXYA 1L7DA 4CMIB 1HSOA 3D3WA 2VZ0A 4G65A 5AVOA 3LT0A 7ADHA 3N74A 1PJ4A 1LJ8A 4B3IA 1V6AA 1QKIA 3GVCA 3JQAA 4KDFA 4WPGA 4Z3DA 5L45A 1N7HA 3KUXA 4EJ6A 1T2FA 5G0UA 1ISHA 5KVQA 1HZZA 2WDZA 1DC6A 3B70A 2VNAA 4HWKA 1EUDA 4I8XA 2VNSA 5TT1A 3JD3A 4AJLA 4OH1A 4EEZA 4U8GA 4XX0A 1ADGA 1IZ9A 3GLQA 1PTJA 1TB4A 2HLPA 5BNIA 4PLVA 4DQXA 4HFMA 1U8FO 5AOVA 1M75A 2JL1A 4EBFA 5L95A 4GSLA 5AXDA 2Q1SA 4LCEA 1M2WA 4I9UA 4IDAA 3HWRA 2VYNA 3DZBA 4QECA 4EI2A 1MG0A 2ZB8A 3NV9A 3RD5A 4E5NA 2AE1A 1ONOA 3BXXA 2O23A 3D3WB 1BGVA 4HFNA 4L4XA 2H9IA 3RFVA 1ZSYA 1PEDA 2B5VA 2FSVA 2G17A 4YQYA 4D45A 3KBOA
chains in the Genus database with same CATH superfamily
4HVCA 6GPBA 4AJ9A 2ZT6A 1XNGA 1ZGCA 1W73A 3GPBA 1Q84A 3NOOA 3C6KA 4EHNA 2GCGA 3DHWC 1ETUA 1VB3A 4FZVA 4EG5A 2AD1A 1NFQA 5IX8A 1O3YA 3RG2A 1KDTA 1VL5A 2IHNA 4FX5A 4QFCA 1H0HA 3EG5A 4ZQEA 2FMHA 3HU5A 3PD7A 3U4QB 1AZTA 1L7BA 1V8PA 2WJHA 2XUPA 1XCBA 2PKYX 3TNYA 2QSYA 4WXRA 3T38A 2VWPA 4RSHA 1PSZA 2ZSDA 2FG6C 1CEXA 3JWHA 4F1JA 1UBGA 3ZWDA 4BVJA 1T4DA 2WG1A 3EIOA 2CFCA 3ND9A 5KPDA 4MQ4A 2G7MC 1JQEA 3D59A 1RYFA 3GNSA 1N78A 3FRHA 1FU8A 1QBGA 1FYVA 3HVJA 3N8HA 4UM5A 5LBUA 3TNJA 3TTXA 2YVQA 2CFRA 4XFKA 2ZE8A 2ECPA 2XI4A 1JVBA 3BIOA 3CJRA 3UWMA 2IP1A 4HX2A 1PGPA 4HR7A 1P29A 4NFSA 3T4UA 3IQHX 1YF3A 2ZJ4A 3F7NA 2J08A 4WXMA 2AFIE 3WRXA 5HX7A 4DY4A 3R3YA 1ZVJA 2RHGB 1PE0A 5CVTA 1FK8A 1MC5A 5JD4A 1MTZA 1Z4OA 5DWVA 4O4LB 4B17A 2FEPA 4CQMB 1LD3A 4OFXA 4GKVA 4IS3A 4ZKEA 4RM2A 3SLRA 3O8BA 4E31A 2V7GA 3ZE8A 4LNHA 3K2BA 1NBMD 2DKOA 3DMDA 4MCHA 5BSWA 1HG1A 3CF4A 1XCJA 1ZXLA 3ADDA 2IZ6A 3G1WA 4G26A 1KI9A 2OV1A 2VQSA 2XCIA 1SZPA 3FJOA 4KQ2A 3ZUGA 2HWYA 1A9ZA 5F77A 1W2GA 4RX1A 3VPDA 4ZYVA 1CQPA 3CNQS 1JJ7A 1ZNYA 2HJVA 3AGPA 1MQ8B 3MFYA 4Q1CA 4WT7A 4BO7A 5C37A 5CEEA 4G5SA 4V0OA 4RACA 3MJSA 1U4SA 1VHTA 4WH0A 1R5JA 1A4XA 1X7DA 3L4EA 3UK6A 2GQ0A 2ZULA 2HCFA 3GJ6A 4LHYA 2ZRGA 3AFOA 2JGNA 2PGOA 3H5NA 1LTHR 2WIGA 1Y34E 1E3IA 2CF6A 4LUCA 4MKZA 4PAGA 5LXTA 2GYUA 1WXEA 3HKDB 2VHYA 2QOEA 3FBGA 3OCWA 1L0BA 1IVNA 2Z3VA 5B1YA 5DISB 2FRXA 2VT3A 4B47A 2XTAA 4BMSA 1ECPA 2CMHA 2J6HA 1F17A 3B12A 3IE0A 4MIOA 2MR6A 1SWVA 5HKBA 4L4YA 3WV4A 4JC8A 2YNMC 1NTRA 3UCEA 2B69A 1W9HA 3B1FA 2Y77A 2P40A 3QENA 4M22A 4R5HA 1VE1A 4W5HA 4ZC8A 4GNRA 1NW4A 3EDYA 3I72A 4TMKA 1WJGA 5TQ0A 3ZDQA 4F9TA 3CVYA 2YCLA 3H0CA 1PEKE 1YZKA 1ZBQA 3G2JA 3R7DA 4ZICA 1IZ8A 4A8JB 1QX4A 3CLTC 3CA8A 5ALZA 4C7BA 1PJSA 1G17A 1EGVB 2HDWA 3WIVA 4BQIA 4L8WB 4U7FA 3VH3A 5HUJA 1U9ZA 2QP4A 1UPTA 3QLUC 3T3OA 1I2ZA 1Q11A 3HUDA 2FVXA 3T9AA 5CBPA 3D6VA 3PUHA 2VXCA 1DBWA 2NYUA 3TR6A 1NG9A 2JZOA 4D4LA 3I9NA 1P1RA 4IYRA 4N54A 4NPHA 1QH0A 1VBNA 2WM9B 1FFSA 4GVLA 3K1ZA 5D6OA 3TINA 3VMFA 3ZKWA 5JS7A 4E11A 2GZMA 1E6CA 3KEFA 1M1NB 1KP2A 4R69A 1MO3A 3UHAA 2DPXA 2AOXA 1OJ7A 5L3SA 1U5CA 2R1VA 2HT1A 1H2AS 2PX4A 2ZM6B 1FYXA 1GQFA 1PKXA 3OA2A 3FNRA 3QU7A 3DEIA 2OHJA 1HYQA 4R83A 2HMVA 3PNKA 2GERA 2VDWB 1C3XA 4KXWA 5K2OA 2NLOA 3HC7A 2WUFA 2IA5A 4M0DA 5BN5A 4GEKA 4OHYA 1PLKA 4C6SA 5LKRA 4N65A 1GPUA 1DOHA 2BCJQ 4Z7JA 3DE4X 1NN5A 3EFOB 1PS8A 3H1AA 1ESMA 3L6OO 4IP0A 4I4IA 2CXOA 4HLCA 3FOBA 2C3MA 2BHSA 4I1IA 4WMLA 4B3JA 4UUNA 2QZZA 2YR0A 3DAGA 4ZEWA 1GOTA 2GO7A 3H5WA 3GMTA 3KO8A 5EL0A 1KQNA 2OXEA 1OBFO 3X2FA 1UXGA 4GX0A 5JZOA 2HADA 2UYCA 3IQGX 2ORWA 2X15A 4GEGA 2JVJA 5JVDA 1Q7BA 2FE1A 5FIUA 4XJSA 4R01A 1OXBB 3UFBA 5HPYB 5KX5F 1MBZA 3KKOA 1F6BA 1UJ4A 3KZNA 5EP4A 2IUSA 2OTCA 2Y1KA 3DMNA 5EE9A 4B40A 2BSQA 2QTRA 1B8UA 3B5IA 2I2CA 4B3DA 5M5BA 3BT7A 4PZPA 3U44B 4G25A 5FPHA 3A8TA 2YUTA 3TVYA 3LQ4A 5AFSA 3E22B 1IUOA 5FOXA 1MABB 2MCFA 2FSSA 5GADl 1W0KA 3U3DA 2AIRA 2FZ5A 3JR7A 1ZD1A 3GRUA 2IHUA 3BQ9A 3NHBA 3MT9A 4O2AB 3TMYA 1TEXA 3PEUA 4D4GA 1HGXA 1KP3A 2DWCA 4NBTA 4RYDA 1VYVA 2D54A 4RMHA 2GKGA 2PGAA 4BFSA 4LY6A 4BU0A 4FOLA 4TYMA 2I2WA 2QTFA 1E60A 4CM9D 3ZHXA 1XDDA 2B34A 1U98A 1R37A 3QBEA 2ZYRA 1K0UA 2VH5R 1WTAA 1C7RA 3GELA 4IJUA 1LRLA 4RGQA 4IXNA 4X63A 3USZA 1MN6A 1M1XB 6Q21A 3NUQA 4FCWA 3ZHCA 1X3LA 1J9ZA 2FSHA 2R4QA 3GRCA 4Q37A 4UULA 4EI7A 1A95A 4Z0HO 3L7JA 1WTCA 1WV0A 4QWWA 3DD5A 3A0RB 4MLCA 1RRVA 4KACA 3V4SA 5DASA 1GY8A 1OZFA 1N8KA 1NFFA 2R44A 2XZTA 4R6XA 1JECA 4J16C 4ZO6A 4BO9A 3JVUA 3MOGA 3L02A 4BMCA 2HRDA 3L0DA 4GH5A 3SC2B 2DERA 1FTNA 3IJRA 4IGAA 2QXUA 1PF7E 5JBQA 2VP6A 3DOOA 1G60A 4D41A 5CVJA 2JVKA 2C4WA 3NOXA 1WMSA 2VDOB 4G0NA 3K35A 4I5DA 4IIUA 2XB2A 4HLUA 1ETHA 3E82A 2JLAA 3AZQA 3ORQA 4IXDA 4O33A 2AXNA 4KGXA 4OYYA 3RC3A 2V3WA 1KORA 3J7TA 2XUQA 4IDHA 4L3VA 2CLHB 3ECSA 3URMA 5HFJA 2WAAA 2GM3A 3HCDA 3TLGA 1PT9A 5AMXA 3D8RA 3IQIX 2R6HA 2EZ8A 2XVAA 1FFBA 4OF4A 5EXPA 3WDSA 3GLFE 1KBZA 2X9LA 1HYGA 3GUHA 3OTGA 4JU9A 1JKMA 4FWTA 2HCJB 3BXHA 1F8UA 2PLNA 3AX6A 3A32A 2B8EA 4DEXA 1PFYA 1QDLB 4MVJF 1J00A 1UPXA 5TPZD 2O54A 5HJ2A 1V45E 4DM7A 1UM9A 2Q9UA 5BR4A 1II0A 3H5IA 4TLCA 5CXXA 1RPNA 3LT2A 1XEFA 1DEXA 4LWZA 1P8AA 3AR5A 3UKDA 3ODPA 2AJLI 1QG4A 1E1CA 4B3XA 2FMKA 4POAA 2XQIA 4HDMA 4Q16A 2BKAA 4QO8A 2M9MA 2CYCA 3S2YA 5LZ4A 1QV9A 3N6VA 3ZJ4A 4AJOA 4GUDA 4NMXB 2LD4A 4ZAXA 2HSWA 4MQ5A 4N40A 3PD0A 4REOA 4X85A 3RYIA 4B3HA 4ACAA 3AL0C 3CG4A 4EYSA 4LDQA 2BR3A 1Z5PA 2EFCB 2OT3B 1ZM7A 3IMKA 4UCFA 4EZIA 5JRZA 2N0SA 1T1RA 4D4IA 4EELA 1Z7YA 4I1SA 3PDIB 2ZVDA 2YIDA 4J1NA 1J5EB 1F9EA 5LZ9A 2BSXA 2HMUA 4FHGA 2FSUA 4ES6A 4JYBA 4YMHA 1N6NA 2ZE6A 5E95A 1HE8B 2Q5FA 1U9IC 4BFTA 1N1EA 3HNOA 4WHMA 3ETGA 2OO5A 5LQRA 1MQAA 4ER6A 1T3HA 2OYSA 1Z4KA 2XMPA 1PR1A 3IO5A 3BWCA 1SIBE 1GPBA 2P0AA 4JD5A 4M1EA 5JMTA 3W3AD 4TM8A 3EVZA 1C5KA 1EQ2A 1WCYA 2FPUA 3FKSD 4JP3A 4GRAA 5EJ8A 5HOQA 4D98A 1MABA 5EYPA 5ALOA 1J5PA 4YP7A 1Z2EA 1XP5A 5IAOA 5HCNA 4KQWA 5AK4A 4RZQA 2J9FA 3HU1A 2I6SA 1T3GA 3VC1A 1BCSB 1I2DA 1DTSA 5BORA 4E5VA 3BCSA 1J2UA 4MP8A 4W9NA 4EJSB 1YFKA 4HPJB 3NCTA 5K3FB 3RK4A 4CNQA 2XTNA 3QWBA 3MT7A 2O57A 1P80A 4I5EA 2B7LA 5FNZA 2VP9A 5B5SA 5CFNA 2WJAA 3RROA 5KEIA 2QE7D 5CK5A 1W47A 4UZSA 2UZ0A 1DXQA 1D8TA 1ZN8A 3CE6A 3MBOA 3R3WA 4MCJA 3NYWA 5AK5A 5EIXA 1HYHA 4LQCA 1XN4A 2NTNA 2Z9CA 5HTOA 2AFHE 1U1FA 2CDAA 1Z6TA 4TN5A 1E9VA 1J22A 1V1MA 1X80B 2HRQA 4MYUA 1QRAA 3OEED 5E7IA 2C5GA 4DAOA 5FPKA 1OB2A 3W1EA 3FTCA 1S3IA 3PGXA 3TQOA 5EUBA 3PXCX 3D5EA 4NX2A 1GZ6A 5B1IA 3WLQA 1RZVA 1W2WB 4MWTA 3DGFC 2Y68A 4BGVA 3C7AA 2HX1A 3MGKA 1YASA 4D0RA 1FP1D 4HAZA 5I4KA 2CLLB 4LXHA 3S40A 1FDUA 5JZ9A 2B2XA 2H2FA 2W98A 3H87A 4E70A 1H1DA 5LP1A 1N2CB 2OBNA 1XD8A 3TBHA 2FFAA 2FGJA 4FN4A 3CUEF 3STVA 1NSYA 3M34A 5IT4A 3AVWA 3Q3GE 3OFND 1W5SA 2PKXA 3O8OB 4H1TA 3S99A 4BBAA 4HMPA 4MVJG 3OZBA 3KB1A 4RJLA 4K9SA 4BZPA 3UXMA 1L4NA 1P9WA 2XZDA 4MW1A 4YJ3B 3RVRA 3VVMA 2GXUA 3WNDA 2R0QC 3KVRA 4EPYA 3WQQA 4NCJA 3GNLA 2IP2A 1XVVA 1U0JA 3AF1A 4OAOA 1NR1A 1GG8A 2XSZD 3JVIA 3TUJC 2C82A 4ER7A 1UR5A 1FQKA 1XAHA 3BF7A 3BQNB 4FE7A 4GECA 1QTNA 4PPYA 1JH9A 3DBRB 2XD9A 4O4HF 4WCFA 5CM9C 4TTPA 4C4OA 1QOPB 4LJKA 3PQEA 4REQA 3BZUA 4E14A 2KYRA 1N3BA 2ODAA 4G81A 3A6ZA 4OU5A 4DV1B 2BKVA 2Y1FA 2H0QA 1M7GA 2COUA 4MQUA 1H6CA 4Z0NA 4CI9A 1N77A 1P0IA 3ZV7A 4Y1RA 2AW5A 2Y2VA 4OHUA 5LOVB 3VJRA 1P3DA 3MCUA 1BXRA 4BWGA 4CL8A 1X74A 1WV1A 2I6UA 3ORRA 2QD5A 1XA3A 1QMGA 5ALPA 3VC2A 4XB6B 5C8YF 4BVEA 2OXIA 1GRVA 1WF3A 1U2GA 1JUDA 2A1UA 2ET6A 2YY5A 3ZDCA 2RFLA 2P4HX 1AKRA 5LBIA 3UG6A 2FI1A 5THQA 1N2JA 4E1AA 5J3JA 3ZCSA 2ECFA 4FNAA 2QUAA 1T10A 1UZNA 1I30A 3IUBA 1KI8A 4I1UA 3OLQA 4DCPA 4F96A 4AXBA 2SCUA 5DHSA 5BQXA 3T5AA 1OWLA 2NUTB 4ZRNA 1I3KA 2J7KA 3PNQA 4BGUA 4JMLA 3ER9A 3WSWA 1H65A 4QAJA 5AW9A 4BEVA 3LO5A 4H3VA 3IIJA 3CEMA 2JIDA 1PUIA 5LIPA 4JLSA 1FQWA 2ZETA 5GM2A 2YYZA 4QDZA 3MJVA 4Q3NA 3Q12A 3PNBA 3ACCA 3OX4A 4OMDA 3RUHA 3TS1A 1GTRA 2QTWB 4TYPA 3UJ8A 5DOVA 2FUKA 1Z2DA 3PDCA 4AP6A 2RGAA 4UFPA 1I1HA 3PC6A 4KNWA 4MQFA 1FVXA 4LDNA 3Q3IA 3EXHB 1OGJA 3FKJA 3S2FA 1P3JA 2PZKA 1D03A 4YI3A 3F90A 1TA4A 2G0TA 3LXXA 4NE2A 1L1FA 5A9RA 1A9XA 2HF7A 1WULS 4NC9A 4YBZA 2IU6A 2IGBA 4DG5A 2C2BA 3UWOA 3HHPA 3QPWA 2QV7A 1QNLA 3VFDA 3B9BA 1M8FA 1DJMA 3VU0A 2VHZA 3DT6A 3HFJA 3RKRA 4MOWA 1ZI8A 3PP8A 3HA5A 4MV8A 2VP4A 2VWGA 4M7WA 5TQ2A 2JASA 3UMMA 3OD1A 3NV7A 3W34A 4CQJA 5FJIA 4N7RA 5FNVB 5CGZA 1M8KA 3HNPA 1E18A 3KHKA 4TMVA 1KARA 5G3ZA 4EHIA 2FOXA 2WAMA 1JEQA 3KOMA 1UJ2A 3Q8MA 1US8B 1ZVKA 2GJKA 4RIGA 1IOWA 4G0OA 3FNFA 3DZJA 5F12A 4Z9AA 4KPUB 5AOCA 6REQB 2BVNA 4TROA 5JG7A 1ESNA 2JGMA 2NSYA 6ADHA 5CB4F 3I9V6 5F2OA 1G1MA 3RR2A 3RK0A 4XEHA 5G3YA 5IT5A 5KB3A 1Y1TA 3H5AA 4RHCA 2IYZA 1UFKA 4JH0A 3T15A 1UZMA 2X4IA 4PLTA 4L75A 1L9KA 2IP4A 3EGXB 3QVOA 4BX9A 4TN1A 1PL7A 4C6HA 5DPMA 3DKIA 1HUQA 3I0NA 3KYIB 5IJAA 5KJ6A 4OQYA 2BBSA 2JFYA 1DO2A 2HEGA 4IVPA 5HJ5A 3W5CA 2Q9AA 5BNWA 1E3WB 3C5CA 3A2LA 1FTSA 3F4KA 4LSMA 1FZQA 2R2GA 4DREA 4DQ0A 2BKUA 3B51X 4NLLA 4WZAA 3GVHA 4Q4DA 2EZUA 3RC2A 1C30B 2F9MA 1NI4A 4UC0A 1WDTA 2O2ZA 3BD7A 2YZNA 3Q0EA 2JH9A 4LHSA 2XMDA 3UA3A 4F4IA 4P2BA 2FDCA 3PC2A 3GEDA 2VK8A 4KXUA 4DLYA 3C1TA 2IYXA 2CHFA 2KLBA 2PNFA 4EX7A 1EP1B 3JD0A 2K2WA 3LCMA 1GWNA 2R7LA 3REQB 4EHKA 4BCDA 2YVLA 3X43A 5JTTA 3OY2A 3TLXA 3U7QA 4AW9A 3QKUA 1QOQB 3RAFC 1XZGA 3ROTA 3W8FA 3BFKA 1UK8A 4HRVA 1Q0SA 2A1TR 3NHKA 4IV8A 1QTQA 2DHCA 4PC6A 4CKYA 4OXNA 4BLUA 3EMKA 4YV0A 1V7QA 1K8YB 4DJFC 1T4MA 1UFQA 2LDXA 3KRTA 1G18A 1KMMA 2AG1A 1UIMA 5T41A 1AHPA 1P4AA 5JDIA 4LJYA 2OM6A 2AG8A 3NW9A 4TVKA 3RE1A 1EM8B 5HK8A 1OLUA 1QBKC 1DWPA 3AOGA 3P9YA 2R8OA 3F47A 3T3HA 1CC1S 2VAVA 4RGBA 3HKBA 1M2GA 1G6OA 1VLMA 1WNFA 4FEGA 3QKSB 3RC8A 4ZEVA 2POQX 1I3NA 4PBSA 1TKCA 3V8NA 1FXUA 5E0OA 5BSEA 2PZAA 3H7IA 4FX2A 4MGEA 2H6EA 4RMGA 4HEHA 4CIYA 2QLFA 1A2KC 3V4FA 4WRRA 3DOIA 1EHCA 2J85A 1C8KA 2JCVA 3F0TA 4CL2A 4ZARA 2VQ3A 3EXHA 4HN9A 3SFZA 1RJ9A 2RI0A 5IF9A 1Z5VA 1Z35A 1B3BA 4K28A 1TMKA 4M83A 4EFKA 1Q22A 4G6ZA 4KN9S 1XQ1A 4K26A 1GKLA 2FFJA 2X7HA 2R48A 5HA5A 1IJBA 4XX0B 5B2FA 3C3WA 5MF6A 3TQHA 3T3IA 2ZRCA 2O3JA 4EVQA 1ICIA 2E4UA 5DYYA 1E9AA 2OVBA 4KWCA 4O2RA 3W78A 3PGJA 1OXUA 4WJLA 2VSOA 5F7ZA 3W90A 2ZTMA 4O2LA 5M34A 3B60A 4DLWA 2HZ7A 1JIXA 5FL7D 3GLGA 4NAUA 5T3YA 5IEBA 1DOZA 3PPIA 1MOPA 3K6JA 3UB3A 1OI3A 3QA3E 5G4LA 2TMGA 2D0PB 2O7VA 1JU9A 1WZCA 2HM7A 4EA7A 4CEHB 3NTQA 3AKEA 5KHAA 3D4LA 5IK2D 4TUYF 1JEJA 2I6FA 3ENZA 3K6SA 5A4MS 1BOFA 1L3CA 1P7PA 1SVLA 3L7YA 1DEAA 1NL3A 3CRQA 3JQ8B 3P26A 4LXXA 4A7PA 1XUOA 1X2EA 4MRAA 4YYZA 1JWLA 5A4IS 1WY5A 3CW9A 4Q1DA 4N6OA 3UYKA 4V0LA 1BU8A 1MV8A 4BNLA 3AVVA 2AMVA 1V9SA 3FM9A 1I4WA 3N28A 2P2YA 4G1EB 3ZKAA 4ADSG 4B3CA 1FJXA 3GRZA 4EY8A 3MHTA 3HB5X 2GD1O 4DIMA 1L4GA 3N2KA 3RQSA 3C0KA 4F1WA 4FK8A 5L4LA 4GLJA 2NVUA 2WINI 1VFNA 1F2TB 4UBMA 2VCHA 1Y8QB 3TW6A 2C98A 4MUXA 1SIOA 1CUDA 1GYPA 1JALA 1QCCA 1ST2A 2ZAIA 3OKPA 4OJQA 4RHYA 2FB9A 2IOQA 1MEJA 1A0OA 1YS7A 3F5FA 4EBBA 3DO6A 4EPRA 1XL0A 3OZGA 3ESBA 4M21A 3RS2A 1N5OX 2IEYA 1M5TA 2VTDA 3ETNA 3V1MA 4FDTA 1GPKA 3MIZA 1CU1A 4RHTA 1PEAA 3HKCA 4QD3A 1PGNA 5AXBA 4TKUA 1BW9A 1XROA 2E89A 2WJ4A 1ACJA 5DF1A 4CV0A 5I45A 2H51A 4JSTA 3VC7A 1S2NA 5A6SA 1UQRA 2ZJ8A 2VNHA 1OAKA 1CF4A 1P6XA 3S2GA 1W93A 1LBQA 2FPOA 4GGOA 1JZSA 4JB3A 4IIGA 4LZZA 1BKDR 2W2PA 4YCJA 3USCS 3WO0A 5C1BA 1L5QA 5B3JA 3BEDA 3L07A 4RXMA 3TXXA 4QFMA 2QY9A 4B4UA 5ARDA 4WEOA 1X7YA 1NJSA 2WLTA 2ZCJA 4Y2VA 1U5AA 2C0PA 3IAXA 3VPCA 3G9UA 1K5PA 2O50A 4FOPA 4MULA 1E2EA 1ZW6A 2WHPB 3JQ6A 3NWPA 2HLDD 2IDKA 3BBLA 5A5VA 5C1PA 1TU4A 2ID4A 3C5VA 5JCXA 5KTRA 2B92A 4BAGA 4ZMSA 3D8BA 2D62A 1A82A 2PWYA 4OJYA 2Y0EA 1TKAA 4EL5A 1W34A 1O9GA 1E69A 2JGIA 2PGXA 2QN2A 5AKLA 3ZNOA 5DM60 2GRUA 3QBDA 3RSGA 1L7QA 2AR9A 1JDBC 3I6BA 3FTEA 4M1YA 5JAIA 1Y1LA 2X5NA 2ACVA 1RAEA 2PBFA 1ISJA 3K0BA 4QOFA 3RTGA 4HH0A 4PSCA 1LSUA 4V0NA 2JCYA 4MUAA 5HF8A 3NUZA 1XZPA 1U2ZA 4KFRA 2WIFA 5C4IA 9ATCA 4FYVA 5JJIA 1DKPA 3TD9A 1ZNQO 4ZOLF 5INTA 5TV2A 3GPLA 1Z74A 5AT1A 4PAWA 5AUNB 2G76A 1BVYF 4EG4A 1AURA 2IYSA 3ROPA 3W9BA 3K70C 3KZCA 3E5NA 1MB2A 4DGSA 4ZOAA 2CLIB 3QG1A 1KE1A 3ZLTA 1O58A 3KDPA 3FTPA 4HDQB 3FH0A 5DX1A 4OLBA 2HHLA 2F3QA 3C39A 2A9QA 2I87A 3OA0A 1V16B 4ZT6A 4JUBA 5DLEA 5LMCA 4JB8A 2P67A 4R3UC 2HGZA 4X97A 2DTDA 1UF9A 4QUEA 1RYEA 4RFSB 5KTNA 3O2SB 1W48A 3H13A 1ZGBA 3QVSA 6NULA 2IUFA 1E3LA 2ZBUA 1ZLYA 5MHTA 5EJ4A 4ZGGA 2GXQA 1VKOA 1QIIA 1EGHA 2PFSA 3D4IA 4MQ6A 4BQNA 3IEMA 1VCMA 4PCVA 1M34E 4WQMA 3ELBA 3M6MD 2GPBA 1CSEE 1RW4A 3A1FA 3FROA 3I04M 3KHSA 5BURA 4G0WA 1VA4A 5C0OE 5JDIC 1N0VC 1CUSA 1A9YA 3NHPA 3MS4A 3WGKA 2QW0X 4ZIRA 1A1SA 3W9SA 2JH8A 1PGJA 4RV5A 4EKGA 2EERA 5EMJA 2IV7A 1XLWA 1WOMA 1JIVA 4I50F 3VHQA 3OMXA 4E5PA 2FOIA 1TUBB 1GYQA 1Y6RA 1TM2A 3CT4A 4ETWA 3GLHE 2JS7A 5JU6A 3C1OA 3T9CA 1SVSA 3KFLA 4KW7A 2CV1A 1SQ5A 3AB3A 1Z5WA 3WKBA 5DHAA 4BHTA 3DC2A 4IOJA 3QV1A 3GFFA 4MZDA 3EXAA 1VE5A 3R7SA 3S1LA 4D92A 1UK9A 2Q5IA 4Y18A 3UCFA 4Q9AA 5K3AA 2R87A 4PANA 5LA6A 1AK9A 2OGWA 2XQGA 3UB4A 2Q1TA 1MENA 1KZ7B 3LDFA 4YHBA 4CIDA 2ODPA 2C92A 1P0CA 1Q50A 2O5RA 3H1PA 3CH4B 3IFSA 4NYJR 4AZ0A 3PQ3A 4DKXA 3IDZA 3KXIA 4D6YA 3O83A 3RGGA 3JAWA 5JS6A 3PU6A 3QFCA 4AD8A 1Z0UA 1M1YB 1M83A 3VZRA 2EG9A 1GZ5A 5KNCD 1NMSA 1VBFA 2B37A 4OLHA 3ZCQA 3VM6A 2IHYA 2Q5CA 5L3SB 1FFXA 1E7YA 2GPTA 3PRJA 3L6UA 3P2IA 3QUSA 3VPXA 3UGJA 4MHSA 1GGHA 1P5JA 2RHDA 4TWJA 2P9BA 3SR0A 4KLNA 1V2GA 4D42A 1N75A 2RHHA 3EHDA 4YRBA 1R10A 4Q9NA 3A37A 4L02A 3NAQA 1DIOB 1OC2A 1X7WA 1SVMA 2PSHA 4EF6A 1GAJA 5MN5A 2RHLA 3T5GA 2E1PA 4GM4A 4V0QA 3SHWA 1E66A 4NBRA 1L8XA 3UKOA 1GKUB 4R41A 5CURA 1KYXA 3S28A 4X65B 2QYOA 2IK8A 4Q24A 1QFXA 2YV4A 3LS2A 1PG2A 3HI6A 1CUWA 4DCTA 1JHXA 4MWBA 1E61A 2RGXA 1WQ3A 4IH1A 2CJWA 3QX8A 1H9AA 2WFLB 2QTZA 4XW2A 4EB8A 3HKEA 1DT5A 5HSGA 5I4IA 1JLLA 2FN7A 3B6JA 4POOA 4Q9IA 2QHXA 5DIZA 3BD9A 1HZZC 2EQ5A 2J3QA 3FOEC 4S24A 5DX0A 3LW8A 4W7SA 2CLCX 5B57C 1G20E 2RGNA 1EXWA 2RAUA 3MJCA 3UOGA 3BB3A 2HPVA 4RQTA 2X0EA 2IPMA 4FEYA 1GAXA 2BELA 5FBKA 5A03A 1I1QB 3M89A 2GTPA 5F5LA 2C5BA 4P80A 3F6SA 4ND5A 3EXEA 1B7GO 1DC3A 1Z4NA 2WLSA 2X41A 4YALA 1UT5A 3PC4A 1XZBA 4JGBA 4UHJA 2VHQA 1M2FA 3PGMA 4Y6LA 1FYWA 3H2ZA 5FLEX 3TOVA 2JFUA 1BWQA 1II8B 5SICE 1A9OA 3TOCA 1HL7A 4BNUA 3OZUA 5DW3A 3X1WA 1QG2A 4B35A 1PJ2A 4UKDA 4CMBA 2ACEA 1C7EA 3R24A 4LVOA 3ANNA 4J3FA 1GN9A 3NX4A 4E51A 1Y82A 2XUOA 4YJHA 3U81A 1JSRA 4HWSA 2Y05A 1U2GC 3R23A 4QDKA 4C0KA 3O94A 4Z49A 5T4BA 2XB4A 5BN5B 1YS9A 4CVNA 4D5GA 1LDGA 3L2OB 2O06A 2YIVX 1U0GA 4M8LA 1YRAA 4RV9A 1GVHA 2QMZA 2VWQA 1K27A 3M2PA 4EHLA 3VPFA 1RXUA 4D79A 2ZUFA 3U3RA 3TIXB 3L0YA 5BUSA 3PXEA 5KQMA 4WOPA 4MWCA 1Z3CA 4LF5B 5DTIA 2OZVA 4I5GA 4CT0A 3THXA 3B2QA 4MK4A 2O0MA 4AP5A 4CEIB 4P6VF 1BH6A 2AC4A 3O75A 3SYTA 5C9ZA 1YDWA 2ZRJA 5U9CA 1WBBA 1JLRA 4YJFB 1IAQA 2G8LA 3F6RA 4P9NA 1OF1A 5H9VA 3E9YA 3JYOA 4IFTA 3SSAA 1EHIA 3LXMA 1UXIA 2C54A 2D1SA 2PSJA 3DPSA 4JBWA 5F9MA 3KKZA 4R1MA 4PYOA 1FNNA 3OUTA 3KS9A 4QBFA 1Z8DA 3WLEA 1DIRA 1OWMA 2W6NA 3COWA 4RMNA 3Q11A 2XODA 3T3EA 1TA0A 3P20A 3KQQA 4FD3A 1IBRA 1L1QA 2ZJYA 4J2HA 2C9CA 1J7KA 4YN3A 5JWRA 3EEOA 5D51S 3LQFA 4JXZA 1NAHA 2M1ZA 4OTZA 1PT7A 4G4IA 4CL3A 4TVOA 4NQZA 4RZXA 1FFXB 4OD0A 3I8OA 1F8FA 3ENVA 1NVFA 3ZC3A 5IP5A 3DV0B 3P9XA 2FMUA 3AY3A 4L22A 4IMPA 1NF8A 1YCDA 2XCQA 5CAEB 3EGXA 5KU7A 1DKMA 2H5IA 2R47A 2FLWA 4UNQA 4CT4B 1W581 4KO2S 3TL2A 3G5TA 4LDRA 5KMGB 4I4NA 4NDZA 5G2OA 1W5AA 2HQ1A 2IZ1A 3DHNA 3HNRA 3WYAA 4DM4A 1ZESA 2QUIA 3GFTA 4WN9A 1RZRD 2RH4A 4N3GA 1KRXA 3CRMA 1U65A 4BRUA 4DV3B 5EEGA 3VR4D 4YJ3F 4A6EA 1KFCB 3N53A 2V6BA 2BCEA 2J46A 3ED1A 5JEEA 1OASA 2IHVA 3CWCA 4K6KA 1NQUA 2ZVJA 5CCBA 1SB8A 2KM1A 3EOAI 4PQEA 3LV8A 4WXPA 1T1EA 1PU2A 1SURA 4IH4A 1QQBA 2F3SA 4Z2AA 3EIQA 3VX3A 3B6KA 2WD7B 2GDZA 3O47A 5KI6A 3U3ZA 4EB3A 1AY0A 1I7DA 4NYIR 5REQA 4GOJA 5BSTA 1GO2A 1JSCA 5ALRA 3EBPA 5JLJA 3PC3A 3NATA 1AS0A 5E2BA 4YRGA 3ZZ1A 4RK0A 1SOWA 1SOUA 2ANBA 3NHLA 1W4LA 3C8MA 1JDPA 2YDYA 4BVBA 4DUGA 4NCBA 1K97A 1LLQA 1EM8A 2A5YB 3KSRA 1VPWA 3RTCA 1ZWKA 1Z2OX 2OD2A 3RDPA 2C2HA 1P72A 2PQMA 4BMNA 2HJSA 4ZFNA 5CLLA 3AV3A 5BN1A 1XP8A 1SEPA 3LHDA 3SIWA 2XLCA 2CV0A 3GK3A 2VPYA 3R0VA 1N5IA 1YZGA 1SPXA 4TZTA 1MGPA 4YRZA 4H2DA 4ZC1A 1BJRE 1GT6A 3KTAB 2D0OB 3D3EA 1CHNA 3ICOA 3WMEA 3AYZB 3NXKA 4U7GA 2O2HA 5JARA 3LGAA 4Q4LA 3FDZB 1QXSA 3LOPA 3WRWA 4Z86A 2O4CA 2GK3A 1JEOA 1NRWA 3L9XA 3ZE0B 5FBRB 2WM3A 1R50A 3IHTA 3W06A 1UEXC 1L4MA 2PWZA 1G5FA 2NQTA 3OE4A 2QPAA 5K1ZA 2R6R1 3FNIA 3A6LA 4UW9A 2CJFA 2FZEA 4PTLA 4B6QA 4ZU6X 1SC3A 2Q3CA 3SN6A 4QQFA 1R0LA 3F6PA 3OX3A 1LSOA 4EEKA 4GAEA 3KT3A 2B7BA 2K7ZA 3FCAA 3HA3A 3L0BA 3NHYA 2X42A 4TMYA 1VE7A 2FSFA 4LZWA 1Z06A 8AT1A 2GZ1A 2A92A 2PFKA 3O0TA 1IEXA 1ODFA 1MT0A 4RJIA 3AF5A 2B36A 3IYLW 4FFSA 3BJEA 4KZPA 1JAYA 1NT4A 4M8SA 4MUKA 3T0GA 4ED9A 3NBMA 2HF9A 2IPAB 3D1JA 2OBBA 3JASB 1SVNA 3EGCA 1IUNA 4M55A 4UTXA 2C1EA 3NBZC 1VPDA 2B82A 3D7MA 3JZFA 4RNCA 1KK1A 1STOA 5H59A 3SAJA 2J31A 3L49A 4TTIA 4AJ2A 5TGZA 1KC1A 4G86A 3HG7A 4YX9A 4Z6KA 5B4TA 1S02A 1NJFA 2JFQA 5IDWA 3SZMA 5EKUA 4B6PA 1TAHA 1XKLA 2I33A 5I8PA 2XCLA 3LRTA 3U1TA 3BXEA 2VXYA 3VZCA 2F6RA 3WWOA 4KYVA 3PIDA 3PXGA 1ZC4A 1SG0A 3ES9A 5KTYA 3NHFA 4OQZA 4LZPA 4ZDKA 1BROA 8OHMA 1TLTA 1T1SA 3AHDA 3N2KB 3WFZA 3OURA 3WYBA 1VSUA 4L74A 1RZUA 4QUHA 4MJXA 3M3DA 2IZ5A 3MTAA 4DPLA 2BFPA 1QLHA 2VSXA 2B35A 3UJNA 1H2FA 5DK6A 2NIPA 3IDQA 2PUFA 1H1LA 1PSDA 4AJEA 1GFWA 4KV7A 2C7RA 3P9RA 1LRJA 3WZ2A 2RH8A 4MS3B 1H66A 2X1MA 1DIHA 4PG7A 1ZR4A 3DMFA 2OZEA 2SECE 3L0PA 2K5UA 4HQFA 1CRZA 2WW8A 4TVBA 3LCCA 4U63A 1OLOA 4CQNA 5C1OA 1P9RA 3NGMA 1L7PA 1J1ZA 3OU6A 3PGKA 4I4TA 4MUBA 1KAEA 2XX3A 2P6PA 1XTQA 1EVQA 2J5KA 3NWOA 4EDHA 3E2PA 3KAQA 1Y5LA 3QF4A 2XZPA 3U7EB 3Q3CA 2PQ2A 4R0VA 5AIAA 1R4MB 1ZIPA 1IDN1 4D3FA 4ENSA 3Q7SA 2IODA 1GGEA 3B82A 4C04A 3MAAC 4D99A 3HP1A 3AUFA 4ZV4A 2QN9A 1RJDA 4OB8A 3KKMA 3HJCA 3N2IA 1MB4A 4Y0AA 3UJ7A 4RV4A 2GLUA 1SBTA 2P9TA 4JJ6A 4LF9B 3HO8A 5DWDA 2F48A 1NPYA 3PFKA 3S4YA 4ENVA 5A62A 4G1UC 1E1RD 5IUKC 2D13A 1NBMA 2C97A 1GM5A 3O6VA 3WYNA 4LK3A 4N76A 2CYAA 4F5DA 4AXXA 3R6WA 2ZKIA 1C4KA 1QGOA 1Z75A 1OFIA 3MA0A 3E4DA 5DYGA 4U4AA 3HO6A 3DNFA 4QDUA 3EVTA 4QJ3A 2FUG6 3MCVA 4TRJA 5FADA 1PX2A 4FFRA 4Q1BA 5F4BA 4AY6A 4K81B 4AJHA 1PYOA 1NOIA 3CPEA 4MROA 1DJOA 1XDBA 2XTJA 4K03A 4COOA 1E6MA 4ENPA 2FMTA 4L50A 4EY6A 2JI6A 4HC4A 5ECGC 4E03A 4ITVA 4LFBB 2GJSA 2HMTA 4WESA 1DLIA 4ON9A 3KTDA 4ZT7A 8ADHA 4RD2A 1ZDMA 4L5AA 1O5OA 2QPTA 2Q27A 1S3SA 5TDHA 1JNYA 1TU3A 2B4KA 1V7ZA 4HHEA 2V0NA 2EU8A 3C7TA 1DVRA 3CE9A 3HHEA 4A8HA 4UTNA 3FFXA 3PTAA 3GXOA 5HKAA 1TMYA 3GLFA 3CF6R 1YTUA 1WXHA 2KWIA 4CU2A 5CFRA 4CZ2A 2JJMA 3DE0X 3ZD8A 1F06A 5ES4B 2GK7A 1P2FA 2VLIA 2BKLA 2FJUA 3MPUA 4BQPA 4DSUA 5JS1A 1M2VB 4N8EA 1Z8FA 1WP9A 2Y0CA 3HY6A 4RS3A 3OOSA 3CX7A 5DNDA 1NLUA 2YZ7A 2WABA 3KQYA 2I66A 3FFBA 4K9PA 2CVHA 1E94E 3NEJA 3DLBA 1O96B 3OX2A 5JJBA 1NBOA 1GZSA 2VDNB 4X3CA 3I64A 1DLJA 3EDCA 5CUQA 3TNDA 2VQFB 3K6RA 3WL3A 1EFTA 2Z6UA 4IDDA 2OD7A 3TDMA 1TJ3A 2PL3A 2Q3JA 4CT5A 5BOSA 3ZDAA 3DULA 1KZ9A 3FAZA 1BS9A 2W8BA 3N6RA 2DPLA 4MJ3A 3V7UA 1RU3A 4BY9E 3HYCA 3QLUA 3KFXA 3BXPA 4A4DA 2B9VA 2JZNA 3L6EA 4H77A 1R16A 1F0YA 1CP2A 1Z25A 1F2DA 3S2UA 3VKHA 1SA0A 3B1YA 2ZB4A 2ZQ5A 1O95D 3B7PA 4F04A 4US2R 4PGHA 4BIIA 1MTOA 3E5HA 5A9SA 5J4KA 1WR8A 3ZE6A 4B3BA 1RVDA 5A3RA 2V7VA 5ALTA 2WAOA 1CJVC 3X1KA 1YFJA 1VHLA 1ZD2P 3LP6A 2IU0A 1G7SA 4NZYA 1E2GA 1K4YA 4XWTA 2IHTA 4WLVA 1QTRA 2AFIB 4JVNA 1BMQA 3A6KA 1I7NA 1Z0DA 1PJ8A 3PXBA 3LIPA 5F2KA 5FF9A 4C30A 1E62A 1O0BA 4KK3A 3WL7A 3ZDYB 2JFXA 3P71T 2H54A 3T4EA 4P4NA 3D6HA 4NS4A 1SKAA 3PIRA 4Z3KA 3ETHA 1ZGJA 2H5EA 4MW5A 3U3KA 5EPEA 1Z56C 4C6RA 3F7MA 4JP2A 3EVNA 4LYGA 5CNMA 3RPEA 4DIDA 1FIUA 4ZEOA 1MDFA 3B5JA 3GEPA 4D9EA 1S6YA 4PFSA 4IAOA 1LBHA 1GT91 3SJZA 3LRPA 4M38A 2C5SA 3T3NA 2XUDA 1FLNA 4IICA 1FJHA 3QTTA 1TJNA 4DCMA 4D3DA 5BYAA 3DFFA 5K4GA 2Q4EA 1WS6A 3IUSA 4OQFA 1KZ4A 4OREX 5SZJA 3OOEA 4A1FA 4JOSA 1P62B 3AIKA 1PKEA 2RGCA 5FLXA 1FSSA 1DX4A 1OLXB 4XCQA 3GCXA 5CBKA 2Z2XA 3SEFA 1QIGA 2HK8A 1DNPA 5AHOA 4LPKA 3LUJA 1T2EA 1ZL2A 4W1SA 3V8QA 3DE3X 4RHFA 3DTTA 3VPBA 3IERA 1L4EA 4UAGA 5LZ2A 2CJWB 1AXGA 4OU4A 3VU9A 3SM9A 7YASA 2O59A 4EZBA 2O8FB 1QRRA 2POCA 4MCIA 3HN2A 5K0GA 2YTZA 2QJWA 2Z56A 1A4RA 5J1SB 1DELA 2XBUA 3CPHA 3V1TC 3K09C 1SUCA 5KIAA 2QRUA 2BM0A 3IR7A 3IRUA 1DAHA 5C7LO 4LYHA 2PANA 2QMUA 3RBVA 1GRNA 3RS7A 1UBSB 1AN0A 1TK3A 3DCNA 1D6MA 1VC2A 2INGX