4QEDA

Elxo y152f with nadph bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
b'MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILFGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ElxO
molecule tags Oxidoreductase
source organism Staphylococcus epidermidis
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
total genus 87
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qedA00
2VWPA 1R4NA 2PZJA 4GSKA 3I6QA 3H9UA 1DFIA 2DFVA 5KIAA 1T2AA 1P77A 1QORA 2EKLA 3E48A 1HXHA 2IODA 4FD3A 5EN4A 1ZK0A 4KDEA 3RJ9A 2BGKA 3HJAA 1HZJA 1T1RA 1VL0A 4TRMA 4KMSA 2VCYA 4XR9A 4WUVA 4ZQHA 5I9NA 3BMOA 5F5LA 1YL7A 1UAGA 4DIOA 3C8MA 2X5KO 4BL5A 4Q3BA 1T24A 1VJ1A 2PH3A 5JMPA 1LNQA 3GGGA 1U8FO 3WQRA 3FSRA 4XDYA 3ASVA 3DQPA 1VM6A 3H8VA 2FR8A 3ZWWA 4FOSA 3F1LA 4CLRB 3BMQA 3DC2A 3BXXA 3KV3O 5ILGA 3SC6A 3UF0A 1X0XA 1YB4A 3LC2O 1IPEA 2NNLD 3GT0A 1RM3A 2X8LA 4K1LA 3FWZA 1T25A 3RUEA 4AJ2A 3LQFA 4M1QA 4YJGA 5T64A 2OUIA 3GHYA 1OMOA 1V3UA 3OBBA 2E82A 2X5OA 3WBFA 4W7IA 1AXGA 4JJGA 2VN8A 2VZ0A 4HKTA 5IDYA 2WE8A 5JYEA 1T2DA 2WYWA 1EDZA 1V0JA 1LA2A 2RCYA 4E5NA 5A9RA 4CMHA 3KYBA 3WB9A 3FTNA 2VYND 3GQVA 2CVQA 1YL5A 4Q3CA 1PZEA 1M2WA 1MA0A 4BNFA 4XA8A 5K0ZA 4QQRA 4YXFA 2GN4A 3B1JA 3OQ6A 3UHAA 3VTFA 1UZMA 3NT2A 2Y0CA 4CQMD 2QRLA 2DUUA 1ADFA 1LDGA 3VKVA 1M6WA 4D3SA 4A73A 1I32A 3RUDA 1E1MA 4GPD1 4UREA 4CQLB 5JW6A 4BO5A 2Y1EA 1HETA 3QWAA 1E7SA 3IUPA 4UVDA 1Y5RA 5TGDA 4YEDA 3ZWNA 3L77A 4BO9A 2V6FA 4RPHA 1MB4A 3OM9A 1VI2A 2RH8A 3WQSB 5ITWA 3R1IA 1XYGA 5ADHA 1MXFA 4LK3A 2QRKA 4Q3AA 2WM3A 4UUMA 3GOHA 5JYDA 2JFHA 1YWGO 5DOZA 1PGJA 1YQGA 3EZYA 4NPCA 5AXAA 1HWYA 1X1EA 4AJIA 3SC4A 2B36A 3DFZA 3QVOA 1R15A 3RUCA 4E5KA 3RBVA 1UZLA 2HJSA 4CMKA 3INGA 1Z6ZA 4H3VA 4TMFA 1YO6A 3WIDA 1I5RA 3DTTA 3PRJA 4KP7A 3VAZA 5K6AA 3LSYA 5LCXA 3ZGYA 3R3JA 4JN6B 4B3IA 4Q3DA 1WVGA 3CH6A 4WK6A 2WEKA 5G0UA 3VDQA 2VTEA 4TRRA 2DTDA 4IBOA 2BF7A 3H9QA 4FC6A 1BRMA 2WDZA 3KYCB 2WTBA 1NM5A 4RQTA 3PJDA 3Q1LA 2RAFA 4IS2A 1U3TA 2JCVA 4IJUA 3W1VA 3E6AA 3W4JA 1XR3A 3WMWA 4BNZA 4NBUA 4RLSA 3HE3A 3GVCA 3BAZA 4IMPA 4XRRA 3PXXA 3GEGA 1CF2O 4NU6A 1TT5B 3GH3A 2GASA 3O4RA 4DXHA 2EV9A 2EW8A 1S7CA 2F1KA 4LCEA 1HSOA 1WW8A 3U3XA 4DA9A 2P68A 3E5RA 4B8WA 5U4QA 1VKOA 2TMGA 5A9TA 4JLWA 2PKQO 4E3ZA 4R41A 2FPPA 1XWFA 4WEOA 4I5EA 3N7UA 1YB5A 1VLLA 1U7TA 2AHRA 3F1KA 1V3TA 4LSWA 1ZK1A 1LQUA 1ISJA 1GEEA 1K6XA 4DC0A 4YJHB 1C1XB 1P3DA 2W2KA 3IKTA 4I5GA 2WSBA 2IRWA 2Y66A 4P38A 5CPBA 3I83A 3OEWA 5K6AC 5EINA 3VPSA 4JP2A 4XJSA 1PGPA 4R1NA 4BNWA 1LLUA 1WXDA 3IIEA 4CM7A 3RAJA 3WNVA 4FC7A 1K89A 2IZ0A 4WNIA 1ISGA 1DRUA 4ZU3A 4G81A 4ROSA 4D0RA 5CDYA 3FNFA 5IJZA 4XD2A 4GX1A 3F5QA 1AXEA 3AJRA 3KUXA 5TT1A 7MDHA 3QA9A 1X13A 3T4EA 5DBIA 1Z45A 4MVJE 2BKAA 3E1KA 4EI2A 4ESOA 2VHXA 5AVOA 1JA9A 3LT0A 1O5IA 1IOLA 2UAGA 2VUUA 4CLHA 1A27A 5EMHA 3ZHXA 4R5MA 2Y1GA 1YVEI 2POQX 2OP0A 3H3JA 3H65A 2Q50A 1B3RA 4QEDA 5B4VA 1PJTA 4PGFA 3U62A 4R69A 2C82A 4QXMA 3ROPA 3H7AA 3ZU5A 3GUCA 1YS4A 5IAAA 1MGOA 2HCTA 5JCJD 3FNEA 3ORFA 4RVSA 4C7JA 5GZ6A 1BG6A 1XQ1A 2ET6A 2JHFA 4DTIA 2UV8A 1U2DA 3WGQA 5A5EA 1R4MB 4IXWA 1QXSA 1Q2XA 4P4GA 2YHIB 4A5OA 3JQ6A 5A3JA 1Y6JA 3H9EO 3PEFA 4L8VA 4ZVVA 4A27A 3KM0A 3JQAB 4WCFA 4XQ9A 4HP8A 1PS8A 1A7AA 4XQGA 3WQQA 2HMVA 3AY6A 5CEEA 4U6SA 3HN2A 1ADGA 4E12A 2E37A 4CQMB 4PG8A 5KVCA 5TIIA 4Y6SA 4R1UA 1Z82A 3GK3A 3K96A 5C3MA 3RIHA 2X9GA 3RC9A 5THQA 5C7IO 5FYDA 3GZNB 1KOLA 2C5AA 4BNLA 2PKQP 3WYEA 5C7OO 4RF5A 4PLZA 1T4BA 5A06A 3JCZA 4UULA 4B79A 1MC4A 2O3TA 5HS4A 4NK5A 1Y8QB 3B20A 4J16A 3OICA 1P31A 3IC5A 4BOYA 4NJMB 3K6JA 1RYEA 1BMDA 4D3FA 4J1QA 3ENNA 1DXYA 1E7WA 1L7EA 5EESA 5I7EA 3E9QA 5JC8A 2PTGA 4XYEA 3WICA 4RVFA 5I7SA 2GO1A 4MVJH 1DC6A 3WGGA 1J4AA 3TL3A 1O0SA 4OSPA 1PGQA 1GPDG 1Y1PA 4BKOA 2Y0EA 2B0JA 4J7CA 4IJWA 3U4CA 1GPJA 1PJ2A 3ONFA 4R1TA 4A03A 3DAGA 4DLLA 4GKVA 4IINA 5B1YA 3AI1A 1LSSA 1QV7A 1A4IA 2JAPA 1DIGA 1KVSA 1ZSYA 2G76A 4RCVA 3QRWA 1UZNA 3MCVA 3TFOA 4G5HA 1XGKA 3WWZA 2PR2A 1L7DA 1WMAA 2DU8A 4YT8A 5I8ZA 4J1NA 2W2LD 2B4RO 2EWMA 2VT3A 3I3OA 1I0ZA 4OM8A 4YA6A 5TQVA 4AJLA 5AQ1A 5LDHA 4P4LA 1IHXA 3JTMA 2EEZA 3IOYA 4S3MA 3HNPA 1QYXA 4BO8A 1DFHA 1QLJA 2NU8A 3GDGA 2HAEA 3I9MA 4FOOA 3VZQA 3D7LA 2Q1WA 3AY7A 4CM4A 3AM4A 3GVXA 3PJFA 4CLOB 3NYWA 2A94A 4WOJA 1LDBA 1HTBA 1E7QA 4PG6A 1I33A 2EJVA 3WGHA 4DWVA 3JD3A 5T57A 5L51A 2VWHA 1B2LA 3NKLA 4BNKA 4R54A 4P22A 2FRDA 2FP4A 3OECA 2Q49A 4YVFA 5H82A 3FPCA 3RBXA 2X86A 1YQXA 2BFOA 4TRJA 1K0UA 1A9YA 3EY4A 3PHGA 3CIFA 3BHMA 4L74A 1VL8A 2O50A 4PLGA 5F5NA 1LBEA 3KBOA 3LK7A 4GVXA 1EVIA 1MG0A 5LDGA 3VH1A 1MXHA 4UVGA 5GZ3A 5A05A 3I9NA 1Z7EA 2VQ3A 3JQGB 3F5SA 3DHEA 5CPFA 1PGNA 3VZRA 4CL8A 1NVGA 1RKXA 1C1DB 4LSMA 3GG2A 4RPLA 4XB2A 4BUCA 5K9ZA 2B69A 3FNGA 3MTJA 3C7CB 1MC5A 5EQFA 1XCBA 1T1SA 2ZJ0A 1ZO8A 3O8QA 3GFBA 1ISHA 1NXQA 5DT9A 2GPTA 1ONPA 2FZEA 1B3BA 3D3WB 3I4CA 3JQDA 4JK3A 4ZQGA 3D4OA 2A35A 1BW9B 3AU9A 3VPGA 4AFNA 5JCXA 3PQEA 1JU9A 1TI7A 2X22A 2D3TA 3JQFA 3Q9NA 2O4CA 1D3AA 1E92A 4HX5A 2P9GA 4CMEA 5BNIA 2GN6A 4GI2A 5TF4A 1K5HA 4LCJA 1EVYA 1R4NB 1ULSA 3PDJA 1FDTA 4C7KA 4D7AA 4E2YA 3JQ9A 3K9QO 4BNIA 3KYCA 3WMXA 3JD2A 3FBGA 1SOVA 5BSEA 1YBMA 3EK2A 4O5OA 2H6EA 1KEVA 2WD8A 1CQIA 4JBGA 3ST7A 1BTOA 1ZXBA 3PIDA 3IQDB 3M1LA 3VPXA 3L6DA 5CEJA 1E6EA 5KJEA 1QG6A 4B4WA 2C0CA 4YAEA 4OAQA 3EW7A 1E1KA 1LLQA 2NU7A 2DC1A 2HK9A 5L45A 2BFPA 2WYVA 4MP3A 3ZI0A 2UYYA 4PZEA 2VUTA 4EDFA 3KSDO 3DB2A 2V6BA 3X2EA 2P4HX 4NR0A 4FFMA 3AY3A 1O89A 4IDGA 4LW8A 4FCCA 4RDIA 4ZRMA 2DKNA 4J7XA 4U0KA 2RHRA 3BIOA 3PWKA 4ALJA 3ETGA 2VNAA 4KUEA 1T2EA 3UOGA 1ZW1A 3BHJA 1H94A 4FSHA 4BO3A 4ALNA 3K2BA 2WJPA 4WECA 4PVDA 1A5ZA 1OBFO 4EGFA 3I5MA 1K6JA 1DAOA 5HS6A 4L76A 2Y1FA 1W0CA 2JHGA 3K31A 1CIVA 2HQ1A 1IYZA 5F3RA 4BKPA 2EHDA 4TROA 2LDBA 1RM5A 3HDQA 5JDCC 3SBOA 2AG5A 3SVTA 4J0FA 4MVJP 2R00A 3OJLA 4IIUA 4K26A 1JAXA 5JAMA 2O2SA 2J3IA 4E6PA 3QVTA 3H9GA 1O8CA 1WDKA 1Z75A 5FI5A 3I9JA 3PHIA 5JAQA 4XR4A 2I3GA 3GPDG 3K2EA 4CV1A 4UVEA 1E6WA 1NQTA 5I8WA 5JY6A 1RWBA 4E5PA 4FGSA 5AXCA 5IN5A 3GGPA 1U7HA 3EUWA 1LX6A 1ZSNA 2YFQA 2WMDA 3HG7A 1F17A 2P4QA 1H6DA 4GQAA 1B15A 1WZEA 4XJTA 1ZIDA 3B6ZA 2Q46A 4J9VA 3I4FA 3WG9A 4EITA 3OIFA 2P91A 3BTOA 5KJ1A 4FJ0A 3OQ1A 2PA3A 1ORRA 4X54A 3G3EA 3ZV6A 3NX4A 3MJ4A 5HWSA 4II3A 4YJDA 1F06A 4BQPA 4IZHA 2PNFA 1FDUA 4N7RA 3EMKA 4QO7A 3N74A 1P33A 3NTQA 1MFZA 1YRLA 3ONDA 2EXXA 4AJOA 4GMFA 2W98A 3H2ZA 5G0SA 4IMRA 1KBZA 2R2GA 4EJ0A 2H5LA 1JWAB 2BLLA 4EUEA 4YWJA 4XEHA 2C2YA 2CD9A 3DBHB 3TOZA 4JCOA 3COSA 1L1FA 1PGOA 2QZZA 5DZSA 4KTTE 2W8ZA 1Q0HA 1D1SA 3DZGA 3ZV3A 1GTMA 3RUHA 2NQ8A 3B1KA 5DBFA 2HMUA 1VE9A 5BSHA 2NU6A 4Z0TA 1BDMA 3FWNA 3SLKA 5CEFA 4RPKA 3WGYA 3JYQA 5A1TA 5BSFA 1ENOA 2H9IA 3TNLA 5C37A 5MGBA 1TVEA 2PD6A 3RJ5A 4BIIA 1E7MA 3R3SA 3GDOA 3HZZA 3DZHA 1HDCA 2OL4A 1O6ZA 3PGXA 1C1DA 3RASA 3BMCA 2CSUA 2Q4EA 4R68A 1HE2A 3NUGA 2FPIA 4IS3A 1IB6A 3EAGA 4EJMA 5DCYA 1U5CA 4M49A 4MIYA 1PS9A 2PFGA 4FPXA 1XHLA 1W6UA 4H15A 4BNHA 2EERA 4OSOA 1Z74A 3ADPA 3QHAA 3BTUA 4FIZA 5KJFA 4BO2A 1I3LA 1JQBA 3GRPA 2X9NA 5IG2A 1HDZA 3Q11A 2X6TA 2VWGA 5JBIA 1EFKA 4RVDA 3OIDA 3KEOA 1U9JA 2DFDA 4TZKA 1V9LA 2ZATA 4AJHA 3PI7A 1QYVA 3PFWO 3BMNB 3SX2A 5ITVA 4A0SA 4Z9FA 4DIFA 5TX7A 3IKVA 1J0XO 1E77A 1CETA 4DYDA 1DSSG 3QVWA 1NASA 3PHLA 1LSUA 2C07A 2IEDA 3JQAD 1BVRA 3KOUA 3A1NA 5U1PA 1PIWA 3VHRA 1ZMTA 1ADBA 1RYDA 3G1UA 4UVHA 1HYHA 3CMMA 1NPTO 3V2HA 3GF4A 2VRBA 5JO9A 4BNVA 4MPDA 2X7HA 3RROA 4KWHA 1I24A 1RJWA 4JNKA 1TB4A 3GZ4A 4NBWA 1M66A 4OXYA 3LVFO 4IDDA 3SJ7A 4TSKA 5GZ1A 1OFGA 1UDBA 1X7GA 3JQGA 4OMUA 1NP3A 1YOVB 4I8XA 1Y8QA 2D2IA 3JSAA 3TL2A 4O0LA 2DAPA 1ONOA 2GZ2A 4ZRNA 4M8SA 4XRGA 1DIHA 4PN3A 5CP8A 1HKUA 4KWIA 1YOVA 1X14A 3TZ6A 3AI3A 1C0IA 1K2WA 2GR9A 1YE3A 4EBFA 1K3TA 2NM0A 3ZHBA 2W2LA 4FB5A 1LUAA 4W4TA 1LC0A 1NTOA 2X4GA 3RQSA 1BXGA 5IN4A 4F45A 3S8MA 1MV8A 5KVSA 3WJ7A 1PU2A 3WTCA 1DJQA 5JLAA 1JTVA 1DC3A 4FDAA 3E03A 5BNFA 1LSJA 1WWKA 1ENYA 2VYVA 3RBZA 3PJEA 4ND1A 2UUOA 1NQAO 1XA0A 1LEHA 1NVMB 2I66A 4ZA2A 3CXRA 4ZQFA 3WYBA 3R6DA 4WASA 2Y1CA 2JKVA 2EG9A 1ZKMA 2V65A 3G17A 1E1LA 1UR5A 4Z3DA 4GMGA 2OORA 3ETDA 4QSMA 3WXBA 1MFPA 1DIRA 1GEGA 2CUKA 4R1SA 2AEMA 3OJOA 1VL6A 3CKYA 3AW9A 5T5QA 2PV7A 2ZK7A 4ITUA 4CMBA 2FN7A 3Q3CA 2GD1O 2BHLA 4YAIA 1C3VA 4TKMA 2AA3A 1X15A 1PL7A 2Q99A 4BB5A 4GLLA 5JAIA 1M75A 1P0CA 3DXFA 4CUJA 1GL3A 3GNTA 1F8FA 4O63O 2AG8A 4CMCA 1NWHA 3ANLA 3RKUA 3JQ9C 1YL6A 4PZDA 3W4IA 3L9XA 4KQWA 5DDIP 2IZZA 4FW8A 1WAMA 3GAFA 3DMTA 1EQUA 1Q7GA 3U4DA 4UUOA 4BO0A 3ABIA 3AUAA 4MVJG 3DZIA 1Y9EA 3IUSA 3QQPA 3NGLA 2QX7A 2AXQA 2YDXA 1D1TA 4IPTA 4OQZA 6ADHA 1YGYA 1JAYA 3WSVA 3DBVO 4GBJA 1EBFA 3QVXA 3DHNA 4GAEA 1I2ZA 1PX0A 2GCGA 3HB4X 4LMPA 3E5MA 2YFHA 1Z7BA 3DO5A 1PQUA 3CE6A 2P9CA 3O03A 3O9ZA 4MP8A 4WLOA 2ZB8A 3RKRA 1M6HA 4B7CA 2EKPA 2C2XA 2Q2QA 4J9UE 1G6KA 3RC7A 3ULKA 2O2YA 5JDIA 4WKGA 1ZCJA 4AL4A 1JKJA 1PWZA 2JFGA 1B8UA 1IL0A 5G4KB 4ALKA 1CYDA 4IQ0A 3UGKA 1AUPA 5C7LO 4LVCA 1PJSA 4I1IA 5F1OA 4J90A 3RUAA 3ZWCA 2Q2WA 3AM3A 4A7PA 2V7PA 3S55A 3TSCA 4MP6A 1R4MA 2BRUA 1VPDA 2DPGA 1DHRA 2G1UA 4HFMA 4M87A 2I67A 2GLXA 4B4VA 2EGHA 5ER6A 3FTPA 5A4DA 2ZQZA 3JYNA 4CUZA 4BO1A 5B12A 4OKNA 4QT0A 3FBTA 2X1HA 1JVSA 2AEFA 3WWYA 4ALLA 1PR3A 4MKRA 5HTOA 1U3UA 2YV3A 1R12A 2R00C 3TRIA 3PZBA 1UH5A 3OJEA 1WNTA 3IP3A 4K6CA 3DMYA 1C14A 3HFSA 2OXIA 3LZ6A 1D7OA 3ZV4A 2NTNA 5J23A 2CDAA 1MP0A 5L95A 3QW2A 4Q9NA 1QMGA 2FOIA 5G0TA 3DZKA 3UAGA 1ZJYA 2JJYA 4B8ZA 2R6JA 1KC1A 3A9WA 5TRTA 4MVJI 4PLPA 3NDJA 3WLFA 1TEHA 2FR0A 1HSZA 3ZCXA 2BGLA 1LLDA 2QRJA 1C0LA 3OA2A 4JXKA 1P1HA 4BKQA 4I5FA 4NJMA 4ZGWA 3F47A 1J49A 1B7GO 2G0TA 3A14A 3GZNA 3MEQA 1ZZEA 4RO0A 4NQZA 1V6AA 1SO8A 3EHEA 2GRAA 4N54A 2DLDA 1T2CA 4E2XA 3GLQA 4U0JA 4BGIA 3PQDA 4LN1A 4FFOA 4RQUA 2JAHA 3I9KA 4MINA 4QECA 4ZHSA 2OP1A 3F9IA 3WS7A 1IZ0A 3C1TA 1I2CA 2DBRA 5L4NA 4BGUA 3E9NA 4XCVA 3PPIA 5COQA 3DMTC 3E18A 3JQ7A 2YZ7A 3KXDA 3FHLA 4OXKA 3IAHA 5JMWA 2E4AA 3K73O 3QE3A 5L7WA 4QFDA 1F12A 1PJCA 1LDMA 5CDSA 1ZVMA 2B4QA 1SB9A 3BA1A 3IL2A 3RU9A 5A5FA 2EP7A 2NU9A 3T7CA 1CRWG 4WGGA 3BHIA 1C0PA 2CDBA 4CMIB 3GN1A 2D4AA 3F6YA 5FEUA 2NV6A 4CMJA 4DPKA 2FZWA 1Y81A 1LC3A 4HBGA 4HV4A 9LDTA 1U5AA 4BMVA 3UCEA 1MUUA 2VRCA 1WPQA 2QZ9A 4M54A 3ZWYA 2BI7A 1J6UA 3FF4A 1E3IA 3IP1A 3MZ0A 2GGSA 1LI4A 3KVOA 1GYPA 3GC6A 4LGVA 4TVBA 1XSEA 3KTDA 1ONNA 4PFJA 1KVTA 1N2SA 3LC1O 2XAAA 2Q1UA 2PGDA 3G1TA 1DHTA 2Q2VA 4TVOA 3PTZA 1U2GA 3PYMA 5C5IA 1GYRA 2Q3EA 4HNGA 3RFTA 2DQ4A 2WD7A 3ZWBA 4WE3A 5T8KA 3WFJA 4YYZA 2ZB3A 3TOXA 3RSHA 4R01A 4AVYA 4BMSA 1PSDA 2FSSA 2J5RA 3F46A 1YBAA 1ENPA 2TMDA 4L75A 4CM9D 3GNQA 4F46A 2Q1TA 2G5CA 3DBLA 4EZBA 1BGVA 1ZNQO 4K6FA 2O3RA 3H5AA 4YQYA 1ML3A 3W6UA 1XKQA 3GRKA 4DMMA 3CMCO 1EMDA 1LXCA 3QY9A 4GLOA 3WOHA 4KDFA 4XB1A 4FFLA 1I8TA 3OSUA 2E6UX 2Q45A 2VYNA 1YXMA 3KSUA 3PLNA 2OGUA 3UFXA 1DBVO 5G4LA 4E30A 1RM4A 3D5TA 5JC1A 2ZTUA 3GA0A 4DBZA 3E8XA 1KEUA 4PLHA 4DL9A 3F3SA 5KWEA 3JV7A 4J3FA 4DIBA 1DLIA 3DAPA 1V8BA 1E3WA 4J91A 4JBIA 2NUAA 2CY0A 2OMEA 4XYMA 2X0JA 4IJVA 5FWNA 4HFJA 2DPHA 3D3WA 4XQEA 4XX0A 3GMDA 3ZH2A 1PS0A 3C24A 1E1NA 1GQ2A 3WX0A 1WDLA 3RVDA 2AQHA 2VHWA 4DPLA 3W6ZA 4PIVA 3DR3A 2VRCD 2OOSA 1QR6A 1EBUA 1GR0A 3FCOA 2Q1SA 1UXGA 1GD1O 5IDXA 4AICA 2IE0A 5AXBA 4L4XA 3TZHA 5THKA 1H9AA 1HE5A 3DZFA 5DP2A 3A06A 3VH2A 3V2UA 5JDCA 3UXYA 3ZNPA 5I9MA 1NFFA 2HRZA 3DL2A 4WLFA 4I08A 4TRNA 2X5JO 3SLGA 2GF2A 4LRSB 4XYGA 4F6CA 3OP4A 1NHWA 4J2HA 2X9VA 1SC6A 3GG9A 4NK4A 1VSVA 4R51A 2C7VA 1HE3A 1FXSA 1PZFA 4IGEA 4PRLA 4RPGA 4WEQA 5EIOA 4D46A 2ZTLA 3KYDB 5I7FA 5FFFA 3RCBA 2OBYA 5B37A 1JDJA 3E82A 2AEJA 1TT5A 1YH3A 2E48A 2ZYDA 2AMFA 2P5YA 2RBEA 1KS9A 3AUUA 3H9JA 1QSGA 2EIHA 4E31A 4E2WA 1R16A 1P44A 3VPFA 2C20A 4FFNA 3QWBA 5COAA 1RPNA 3Q6IA 1NR7A 2BELA 1KEPA 1VJ0A 3S2FA 4J4HA 3Q2IA 2HMTA 3X2FA 1YBVA 3W4KA 3JYPA 5JS6A 1HDYA 4ALIA 3WYCA 1EK5A 2Y1DA 4YT5A 1IE3A 1NWCA 3DWFA 4KUHA 4J6FA 3GFGA 2OBNA 5BNTA 1ZK4A 3PYLA 3UUWA 3WNQA 4B7XA 4JIGA 2D1YA 3TZQA 4ZQBA 1H9BA 1G0NA 4Y8VA 4YCAA 1SPXA 1I10A 4MKZA 2ILTA 3AI2A 4AJPA 4CV2A 3DHYA 2XPCA 1ZMOA 4AJNA 1QP8A 1LDEA 2H63A 4DUPA 2BH9A 3M1AA 2VZ8A 1KVRA 2B4TO 1CQJA 3O8QB 3O26A 4ZJUA 2VOJA 1U3VA 4BS9A 1E3JA 3ZU4A 3HDJA 3JQ8B 1UUFA 1P74A 2HK7A 1JWBB 2NSDA 1GADO 2OZPA 3ON5A 1A72A 2IYOA 3DBHA 3WTBA 4DRYA 3LT4A 2GNAA 1EUDA 3NV9A 2OHXA 2ZYAA 4QO8A 1IY8A 5H83A 4N18A 2Y05A 1HL3A 1E7RA 1UXIA 4IXTA 4Y6PA 1X1TA 3TJRA 4CV3A 1NBOA 1Y7TA 3NT4A 4BGEA 4D41A 1Q1NA 2YYYA 1R0LA 3HADA 2I5PO 1EFLA 3W8DA 3UN1A 5JCJA 4I9HA 4MVJD 4CM1A 2O3QA 3D4PA 3UVEA 4IUYA 4J4TA 4RF3A 4CMEC 2D0IA 1VKNA 3LLVA 1DB3A 1OAAA 3PDUA 3PWZA 3LYLA 2DBQA 1I36A 4PLYA 5TJHA 4UEJA 2GN8A 2AQIA 3VVCA 4XIJA 5JFOA 1R6DA 4NH4A 5KKAA 2PK3A 2XXBA 4GX5A 2DTEA 1NQOA 2YHUA 3AUSA 5MDHA 3GUYA 1Z73A 4UVIA 4CQLA 3BZUA 2JFFA 4GGPA 5DNAA 1F14A 1NFRA 5G2OA 1UXJA 3AFMA 3AUTA 3QLJA 3QWHA 4XGNA 1JKFA 1U3WA 4BNYA 1B26A 4JBHA 2ZB7A 2HUNA 3AOGA 4S1VA 2J3HA 1CDOA 4LISA 1WMBA 1N8KA 4Z0HO 1Q0LA 5IZCC 4KUGA 4NJOA 1ZFNA 4C4OA 5I7VA 4M55A 4INAA 3DFUA 3NEPX 3Q2KA 1H93A 4MVJM 4CLEA 1R66A 1BW9A 4R5HA 2Y1OA 3S2IA 5HA5A 1SNYA 3GVHA 3KRTA 3JQEA 3LF1A 4IDCA 1GUFA 4L9RA 1OC4A 4IDEA 4IGFA 2J3JA 2VTDA 3LLSA 4IM7A 3MJSA 1GCUA 3TN7A 5EPOA 3DTYA 3HDYA 3UW3A 4J1SA 3ZNOA 4YQZA 4QFCA 2AQKA 2CF6A 3UCFA 5IDQA 3VH4A 5ES3A 1J5PA 3JYOA 1R0KA 2VNSA 1A7KA 3U5TA 1HDOA 1S6YA 2YUTA 1NAHA 2NACA 2X0NA 3TF5A 2J3KA 4D44A 1O95A 3KO8A 2FY8A 1U8XX 3W8EA 4ALMA 4BO4A 4KZPA 4CLDA 4Y6RA 4CLXA 1UDCA 4ZN6A 3A4VA 3CSDA 1SOWA 3AOEA 3OFSA 1ZEJA 2C7GA 3HDHA 1OOEA 3ZW8A 3JQBA 4WLNA 4HXYA 3WLEA 1UP4A 3QIVA 4ID9A 3WFIA 1P1RA 4LRTB 3PHJA 4E33A 2PH5A 2PLAA 3OJFA 1BVUA 1KIFA 3GEMA 4HWKA 4TWRA 3ZWPA 1HEUA 1E3LA 4IIVA 4R16A 4I5DA 5DULA 4PVCA 1SZJG 2B5WA 1E3SA 5IZCA 5A9SA 4W9NA 3BYZA 3H6KA 3FNHA 4JJFA 4XIYA 2ZJ1A 4N5MA 3MJEA 4J7UA 2I9PA 2EKQA 2EW2A 4BB6A 5CG1A 4BMNA 2Z95A 1E6UA 2RIRA 5L7YA 3P2OA 3RUIA 4JX8A 2ZIZA 5IXYA 3NJ8A 1XG5A 4K28A 3D0OA 3HWRA 5ILOA 4WLUA 8ADHA 4YAJA 3ADOA 3AM5A 4RDHA 3DDNA 4EEZA 4EEXA 2JD1A 4DYVA 1P1JA 4OH1A 4LVUA 3ZHZA 5HRUA 1GAEO 3EZLA 8LDHA 3KHUA 2G17A 5TT0A 4CL3A 3DOOA 4GWKA 4ND5A 5BR7A 4L4SA 5IZ4A 3QJ5A 4U7WA 3RWBA 3JD4A 3Q0EA 2IXBA 3H5RA 5DCUA 4E5YA 1FK8A 4HNHA 2X23A 1N9GA 3EYWA 1V3VA 4NBTA 3QV1A 4CMAA 2QQ5A 3FR7A 2YQ5A 3I52A 2GSDA 3A28A 3WJAA 3HQ4O 2QW8A 5DBGA 1N9GB 3P5SA 4R3NA 4UAGA 3MTGA 5CHEA 3WGTA 3ROQA 4AJKA 2W90A 1ULUA 2CZCA 2GN9A 3DOJA 3DONA 3L4SO 5F1KA 4BO7A 4GVLA 3E9MA 5DN9A 4AJJA 3PJGA 1BXKA 4GX2A 1Q7CA 3BMQB 3UH1A 4J0EA 1QRRA 1IZ9A 1WZIA 3KETA 1KC3A 1EZ4A 1FDSA 2BFAA 1EUZA 3MWEB 4BKRA 2Y93A 5KJ6A 4XDZA 3V2GA 5DF1A 3GMSA 1D4FA 2OFPA 5DOVA 4ZQEA 3AU8A 3JQAA 4D45A 1JKIA 1ADCA 1KETA 5TNXA 4FBGA 3C1OA 3GN2A 1LRKA 4HFNA 5AYVA 3NDIA 4I9UA 1PJLA 6LDHA 3CINA 3JQBC 1EVJA 3U49A 3C85A 1XQ6A 4D42A 1DFGA 3OH8A 2D8AA 1N1GA 4RPJA 3OMLA 3VC7A 4U8GA 1YDWA 1SB8A 2EP5A 1HRDA 3PLRA 4WJZA 4PCVA 1ZSVA 3HB5X 3L4BC 1DDOA 2RH4A 2XOXA 3DBLB 4ND2A 2BMAA 1QYCA 5AOVA 1MLDA 4IDFA 3BTSA 2AE2A 4AG3A 1X7DA 4YR9A 4CM5A 3JQCA 4N5LA 5ENVA 4PG4A 4YRBA 2HSDA 1P9LA 3WGZA 4UEKA 4XGIA 2FMUA 3SJUA 4Q39A 3KLPX 2ZTMA 4R9SA 1VJTA 4BNJA 1PJQA 4OXNA 1B14A 1DRVA 3LDHA 4DLBA 1CEQA 1HYEA 4E32A 4MIOA 1TA4A 2Y67A 1YKFA 4GX0A 1HLDA 4Y9DA 5CDUA 2VHYA 1XDWA 3RC2A 3TDKA 2CFCA 2ZB4A 4F6LA 1H6AA 1LDNA 2NVUA 5TLSA 3IJPA 2Z5LA 4OOFA 1N92A 5A9SB 1T4DA 4IDBA 5T6BA 4EUHA 2QYTA 3L07A 3RI3A 1PJ4A 4O1MA 3GR6A 1QKIA 3BMCB 4ZD6A 2WD7B 3U4IA 5AXDA 5A3VA 4B4OA 4EJ6A 1GCOA 2SCUA 3PZRA 5CAEA 2OO5A 4O6VA 4YJFB 4LMRA 5TJ9A 3K92A 1DC5A 3TZCA 4BNGA 4J1TA 4L73A 1ENZA 3S2EA 1KYQA 1H0KA 1ZH8A 4YAGA 1SBYA 3QP9A 4ILKA 5JE8A 2D5AA 1B0AA 4YPOA 4FQ8A 2DBVO 4NBVA 4NHEA 3ZDFA 1EE9A 4HY3A 3RC1A 3C7DB 3D4NA 2FHSA 4AJ4A 1Y9AA 1ZBQA 1I3NA 1GDHA 2CVZA 2HMWA 1V35A 3ICCA 1UXHA 4P4NA 3SEFA 4RJTA 2EF1A 5GMOA 3PYXA 2NVWA 1ARZA 1TXGA 1SEPA 2BFMA 1NX6A 5BT9A 1E5QA 4W7HA 1W73A 1BXZA 3D5QA 4NZ9A 3HUDA 2X58A 2YHIA 5A03A 3D64A 1FF9A 4YDRA 4CPDA 4RLHA 1OI7A 5KVVA 1OZAA 3QSGA 4URFA 3VTZA 5TSDA 3S2GA 4PLWA 1U1IA 3CPSA 4PZCA 3VOSA 1AN9A 4AJ1A 1PJ3A 4D0SA 4OQYA 2VWQA 3OQBA 4QTZA 2IZ1A 4D3DA 4YJHA 1JLLA 3UICA 1CJCA 3ZU2A 1PQPA 1ZEMA 4NFYA 1LRLA 4CM9A 4II2A 2VZ9A 3CEAA 1JVBA 3CTMA 1I30A 1LSOA 4GKBA 3DBRB 2FWMX 5L4LA 3PFFA 4BVAA 1C1XA 1JW9B 1A9ZA 4XYLA 4XGKA 5IXSA 3HSKA 3INTA 4YACA 3ZNNA 1KY4A 4JJIA 4FJ1A 2DM6A 4A26A 1TT7A 1NFQA 3OEYA 4OOEA 3TZKA 2XF8A 2NADA 3IMFA 2ZQYA 4CM8B 3HN7A 3ASUA 4IY1A 4KOAA 1QLHA 5L3ZA 1B8VA 5BSGA 4PLTA 1FJHA 2ZYGA 1YJ8A 2CDCA 5ER9A 4BO6A 4PLVA 1BWSA 3VZSA 1P45A 3ZWOA 2GERA 3L6OO 1EK6A 2HJRA 3KYDA 4H7PA 2QIOA 1KY5A 4U6QA 3JD0A 3BMOB 3PVZA 4XYBA 4G2NA 5H81A 2H1SA 2PD3A 2X0RA 5B4UA 2EJWA 4R3WA 4RF2A 4NDNE 3WSWA 4E5MA 1PL6A 3F4BA 4TQGA 4DGSA 3G0OA 2C54A 3MJVA 4BHTA 3PWSA 4WNCA 3G49A 3ZWAA 2VHZA 2J5KA 4Z6KA 2HK8A 1GQYA 2I6TA 4WCFB 4PLFA 1PTJA 3RU7A 5JSFA 4Z9YA 2JD2A 1Y8RB 3DAFA 3WGOA 1DIBA 3AOEC 1HDRA 1E3WB 5L4SA 2NLOA 2A4KA 1H6BA 2YJZA 2WYUA 1DO8A 3CUKA 3GY0A 1NAIA 1DIAA 3S1LA 4NU5A 3AFNA 4W99A 1FMCA 5T67A 4BNMA 3VVBA 4BNXA 2QYSA 4RZHA 2QHXA 4W82A 2FSVA 1Q0QA 4DVJA 3PQFA 2DTXA 3LT2A 4M89A 4D79A 1T2FA 4WLVA 4W6ZA 2J5QA 3B70A 3OETA 1DC4A 3ITDA 2PGLA 1IUKA 3GNSA 4F3YA 5HM8A 5U9CA 1GZ4A 5KJCA 4NFSA 1HYGA 4OHUA 3VPHA 5L53A 4FFPA 1EEHA 1H2HA 4MJLA 4JGBA 3ONEA 4OYRA 4E21A 3FR8A 2CF5A 4GL4A 4R4JA 1XLTA 4J49A 4BNNA 4Y98A 1ISMA 3NT5A 5G0VA 2Z1NA 4CUKA 1T26A 2PKRA 4DBVO 2JL1A 3RFVA 1AGNA 2A9FA 3G79A 1G0OA 2YDYA 1KVQA 4CR6A 3DOCA 3WGIA 4NFHA 4YT2A 4L0QA 4IQGA 3EVNA 2HLPA 4WCFC 1ISFA 2JD0A 3V1YA 5COBA 3R0IA 4PLCA 2O3JA 1NHGA 3ICPA 4L4RA 1EUCA 1PL8A 4RVUA 3MJTA 4BQRA 1G1AA 5IDWA 4B3JA 3H4VA 3C3XA 3CZMA 4CM3A 4EYEA 5KKCA 2BGMA 5GY7A 1UP6A 3OA0A 2Y99A 2PWZA 4B4UA 3KZVA 5CDTA 1AE1A 1Q7BA 3ZHYA 1LJ8A 3ETEA 3I6IA 3FN4A 3BTVA 4PG5A 1QYWA 3C1AA 3U4HA 3MWDB 2X0IA 1ISIA 3DBRA 4RV9A 4DREA 1XU7A 1GU7A 3VZPA 1BHSA 2Q4BA 2XXJA 4D43A 1YB1A 5TC4A 2C29D 3M2PA 4BKUA 2NQTA 1YJQA 3GPIA 3ANNA 4MIEA 1DOHA 2JCYA 5EJ2A 4IJKA 2PD4A 5FI3A 4YAKA 5L7TA 2NTVA 1N7HA 4MKXA 4XZ3A 1PEDA 5JNLA 2O4UX 2HO5A 2GDZA 1A4UA 2BI8A 3IDSA 3OHSX 2GUGA 4Z9XA 4J4BA 4CM6A 3NGXA 3NTOA 5KCZA 2V6GA 3PP8A 1ZUD1 2VUSA 1E0DA 4MVJA 3FRJA 3LU1A 5B4TA 3P7MA 1H6CA 1SCUA 5KVQA 5DP1A 1E7YA 1EQ2A 2LDXA 4Z0PA 2Z1MA 4OIMA 2FR1A 5TS3A 1W4ZA 3LT1A 4I9NA 5ICMA 2GZ1A 1DJNA 4CLOA 2DVMA 4FR5A 3ZNQA 4OJNA 4DQXA 2CVOA 4YT4A 1K6IA 1LQTA 3P2YA 2NVUB 3U0BA 4DMLA 4PG7A 1GZ6A 5L9AA 1B16A 5IFLA 1KERA 1B8PA 1SMKA 3FPLA 1N5DA 3V1UA 2PZKA 1GZ3A 5DCWA 5ICSA 4KQXA 1GFSA 3TFQA 1P1FA 1GUYA 4IQ8A 4EW6A 3UCXA 4YJFA 2YW9A 3FI9A 1HT0A 3HFGA 5KNLA 2VHVA 3P19A 1DEHA 3INRA 4R9RA 3V1TC 1QV6A 3F4LA 4GSLA 3ROMA 4BGVA 4CMGA 2Y68A 5G0WA 2DUWA 3RFXA 3GDFA 4Z3KA 1XU9A 2HMSA 5G4KA 1O9BA 1H2BA 2VT2A 3BMNA 3N58A 3M2TA 3NDRA 4Y67A 5JY1A 4RVGA 4CM4B 1KEWA 4P8RA 4JROA 4RVHA 1XEAA 4OGWA 3D1LA 3ROKA 2WWRA 4CLRA 4ZICA 5CDGA 1PWXA 4CODB 4BNUA 1YDEA 1HF3A 4XKJA 2YY7A 3OF2A 4YRAA 1N1EA 3ZWXA 2YV1A 1ZJZA 3GVIA 3ITKA 4Q3EA 4YJGB 3I9LA 1NVTA 4A10A 3ZU3A 3L0DA 2O7SA 2D5CA 1YQDA 3KSZO 1PR9A 4GWGA 1I3MA 2P9EA 1E3EA 3RD5A 1WLYA 2AQ8A 3CZRA 4XWYA 1HZZA 1EVZA 2IXAA 4YRDA 4GGOA 1AHIA 1DPGA 3JQ7B 4W9NC 5JXWA 3ZWMA 4MVJF 3LF2A 2W4QA 2B83A 2HDHA 4AJEA 1R37A 3V5NA 3H3FA 4MDHA 9LDBA 4BNTA 1WDMA 3DZJA 4TKLA 4UUNA 3TQHA 1IHYA 3ZN2A 1HLPA 4CR8A 3L9WA 1AHHA 2DT5A 2A92A 3D3EA 4YB8A 1EE2A 4N5NA 2O3SA 3H5NA 3NJ4A 1DAPA 3EVTA 1GQQA 1ID1A 4E4YA 3PGJA 2W2KB 1FDVA 1R0SA 4K9DA 2UVDA 3KLMX 3UKOA 2NTJA 4U5QA 2BD0A 1NPDA 2B35A 1NPYA 2C59A 2DBZA 1NYTA 2RHCA 3LC7O 4JP3A 4MO2A 4UEOA 5HBRA 5KTKA 3EDMA 1MG5A 2VYVD 1U28A 4OO3A 4QUKA 5JO0A 1UJMA 3QWFA 4FS3A 3JQ8A 4WCDA 5ENDA 1QYDA 2CMDA 3NTRA 4ND3A 2FPGA 3GAZA 4DC1A 4YTEA 4ND4A 4CV0A 2B37A 3K30A 3GVPA 1NR1A 3MJCA 2G82A 4RORA 3ZW9A 1LDYA 2NWQA 1E5LA 2AW5A 3PHHA 3GEDA 1DRWA 2O3UA 1EDOA 1NNUA 4HUJA 2I76A 1X7HA 1D8AA 3B1FA 1M76A 4NIMA 3WBBA 1ZK2A 3AK4A 4HADA 1DLJA 5CG2A 2PZMA 2VOEA 3ZWVA 1UDAA 3K5PA 5T8KC 3AWDA 4CM8A 3JYLA 1ZXLA 1TLTA 1P0FA 1U4SA 3K8ZA 3T4XA 4GH5A 5BQFA 1XELA 4NG5A 1FDWA 1VC2A 3VDRA 2EGGA 5A04A 4WLEA 2I65A 4EUFA 4QX6A 3WIEA 3ENKA 3ZV5A 4CJXA 5F21A 3GGOA 4A2CA 4TZTA 3I9OA 4DQVA 3OJ0A 2ZKLA 4WPGA 2WE7A 4HFRA 3QVSA 2J6IA 2ZCVA 2GZ3A 3TWOA 3VH3A 3EC7A 3ZZNA 1VSUA 4OKIA 3PIIA 5JDIC 5CFZA 5LC1A 3PK0A 2P5UA 2D59A 1N7GA 2Y0DA 1UXKA 4KTVE 2HKIA 2IDZA 3FD8A 5EERA 1LU9A 3W8FA 3JQFC 1IULA 3U09A 7ADHA 1UP7A 3DZBA 3I23A 4DQUA 1HDGO 4OL9A 3O38A 4RGBA 2UDPA 2AE1A 1Y8RA 4Q3NA 2O7QA 5KOIA 3Q9UA 3STHA 1SAYA 3NAQA 1H5QA 4IZIA 3VKUA 3HHPA 1X0VA 5JAZA 1RM0A 2NVBA 1VRWA 3NRCA 1BXGB 1BDBA 1OC2A 1IPFA 2E49A 4E13A 5FF9A 2PZLA 2I3AA 1M67A 1XIVA 1GYQA 2UUPA 3U9LA 2V6MA 3DEYX 1UAYA 4FJ2A 4BV9A 1I2BA 4NNJA 2YV2A 1SEVA 5EL0A 1F8GA 1ZK3A 1F0YA 1I3KA 2O23A 2PY6A 3SXPA 1JN0A 4IDAA 3QWIA 1MX3A 4RF4A 5A02A 1P1KA 2P2SA 3KB6A 3KEQA 4RZIA 4UUPA 5I9LA 4XQCA 5JPIA 3TPCA 3JD1A 2IYPA 5EQDA 4DLAA 1LRJA 2F00A 3IS3A 2ZCUA 2IEBA 3H2SA 4G65A 2JCXA 1YONA 4DPMA 4NI5A 2J8ZA 4E0BA 4JQCA 1GV0A 4FN4A 2ZTVA 2I99A 1HE4A 3L6EA 3WR5A 1Y5MA 1GV1A 2HRBA 3OIGA 4PRKA 1P1IA 4MOWA 3V8BA 3I1JA 4M86A 4YBZA 2HU2A 3IJRA 4FGWA 4ONEA 1PZGA 4CR7A 5IF3A 2B5VA 2PGJA 4B7UA 2GYYA 1BSVA 3ANMA 1CWUA 3RUFA 4NBRA 2YQ4A 4H16A 4O59O 1HDXA 1WP4A 1I01A 1GY8A 4CMIA 1LLCA 1W8DA 1GUZA 3T7EA 3MOIA 1PJBA 1A71A 3C7AA 4RL6A 2O48X 4BV8A 1PZHA 1U4OA 1O94A 3WDSA 1PQWA 2CNBA 3EGOA 4J43A 4CQMA 2QG4A 3MOGA 1KVUA 2C5EA 1C0KA 4B3HA 5L40A 4E2ZA 1NQ5A 3GHHA 3L4BA 4J2OA 4NMHA 4FFRA 3M6IA 5F1PA 1LTHR 1CERA 4WOKA
chains in the Genus database with same CATH superfamily
1K66A 2JIMA 3D2LA 3GJSA 4NARA 5I7WA 2HHLA 3H19A 1R4NA 3THRA 2OD7A 3ZE7A 2NSYA 1QH9A 2AYXA 1L1QA 2O2CA 3BRQA 3H9BA 1EXVA 5KO2A 2QX8A 3HL0A 4G41A 3HUTA 1DWOA 4O29A 4L08A 1CR4A 1QORA 2PCLA 4A8JB 2PT6A 3NO4A 3E48A 2IODA 3G2PA 5EN4A 5T41A 4KVFA 2WA1A 1KO8A 3JAKB 2AJLI 2A5FA 5GOTA 2GLUA 2PAFA 3HJAA 3MFYA 4IVQA 1GLVA 1ND5A 4ZT3A 2X2PA 4WUVA 5JROA 1OFHA 3GX1A 3AEKA 1S3IA 1QGAA 3I01A 4DIOA 1BN7A 5F98A 1X7YA 1MEOA 2X5KO 4YLEA 4BL5A 3ZDQA 3C16C 4Q3BA 1Q12A 1VJ1A 5K0JA 2QRUA 3GGGA 2C4WA 2OBFA 4I81A 5E6SB 3AR9A 4ZAVA 3WQRA 5CD1A 5LLSA 3QBJA 4JI2B 1O4VA 3KAKA 2AKEA 3DQPA 1VM6A 1T3ZA 2FR8A 3ZWWA 3DGEC 3GJZA 2I4NA 4EGAA 1JSCA 3SFVA 4GBMA 1BQ4A 2CZGA 4B0PA 1KYXA 2IYFA 4MNTA 6GPBA 5AW6A 1U80A 1YB4A 3O73A 4YUAA 1KRWA 2WG0A 1RM3A 2P6UA 4GECA 3FWZA 1I5EA 3DMGA 1V2HE 5FOVA 1M34A 2GRUA 2Z8XA 2OUIA 5T64A 3W9UA 4BKMA 4BXOA 1V3UA 3A0RB 3OBBA 1FU8A 4OATA 2P9ZA 5K0CA 3WBFA 1EPUA 4ZCLA 5K0TA 2VN8A 3G85A 2ANBA 2PIDA 1JQ3A 4NYIQ 2GD6A 4YMTA 4KNWA 2PXHA 1SVOA 2AW3A 3CCFA 1YI8A 5FTNA 1WD5A 1T2DA 1XRRA 2WYWA 3AF3A 2RCYA 3L7MA 4KYTA 4CCWA 1G64A 3N9IA 2AK2A 5HCUA 5A9RA 1GNSA 2ADMA 2CVQA 2G1KA 4QLAA 1WULS 3V8VA 5K0ZA 4JL5A 4TSFA 4XA8A 1CE8B 2NUBA 1T0JB 2GN4A 4NTZA 4AIIA 2AK3A 4ZQCB 2G9NA 4F2DA 3NT2A 4KR0A 1Q0UA 1XZHA 2YVUA 2Q4TA 4CQMD 1L1RA 1XYVA 3MWYW 4BCCA 5KX5B 3NBZC 1M6WA 3REGA 1E1MA 4CQLB 4UREA 5F4ZA 4A6EA 3WAGA 5EAIA 4BO5A 4KE7A 5AFSA 1O77A 3NHSA 1C7FA 4UVDA 4EHNA 1ORTA 1RTTA 1Y5RA 2FH5B 5B6IA 3ZWNA 3DYVA 3QELB 2V6FA 4FSDA 2RHLA 4Q15A 2WKWA 4BO9A 3DUWA 4L16A 1MB4A 5CW1A 1VI2A 2RH8A 1NW3A 2G4VA 3CRMA 3WQSB 4ZVOA 2ZSJA 5EHXA 4BFLA 2IH5A 5ADHA 3N2IA 2JI6A 2ZQ5A 4Q3AA 1RC0A 4WZAE 1SH7A 5IT4A 1FJXA 2PBZA 3I2HA 2KSQA 5HIJA 1YQGA 3KVYA 4FYWA 3OD1A 4NPCA 3UG7A 3VOTA 4LG1A 3PFGA 2D2XA 1PR4A 5AXAA 1JR3D 2OAEA 3RF6A 1H0SA 1QJCA 5H02A 1JDBC 5JXGA 3WRXA 1R15A 3KQVA 3A58B 4E5KA 5DYTA 2J3LA 1PK7A 1C7EA 2H2FA 3PC8C 4CMKA 1ZRSA 3NZEA 5JNSA 1WCV1 1YO6A 1OT3A 1V9SA 4G5QA 1KU0A 3N0VA 1I5RA 1GPNA 3HJNA 3LCJA 4AMUA 1QZTA 2VJLA 4IV8A 2IU0A 3SBDA 3VAZA 5LCXA 5BV0A 3R3JA 1ZIYA 2JJ2A 1RJDA 4TTIA 1KEZA 5ELLA 3MK31 3W5IA 4BX3A 4B3IA 4WBNF 4L4YA 5FOUA 3U7JA 1DCKA 2GARA 2WEKA 5FBKA 1QVZA 4J94A 2ODPA 4ETIA 2YFKA 3R0QA 5AUQA 3GEIA 2AI3A 4L8FA 2OGWA 1G6Q1 4QXPA 1EIZA 1Q83A 2JGDB 3KYCB 4RQTA 2HTEA 3QJGA 4M7RA 4MQEB 1KMHA 2NZJA 3KU4A 4IS2A 3I5XA 4RC9A 1QLWA 3RIXA 5DWDA 4MMYB 4JB3A 4R7GA 4NBUA 5D8DA 2CVHA 3F90A 4C76A 1FW6A 1EWYA 2ATVA 3EVBA 2HQRA 3TMAA 2CJWA 5AESA 3K0FB 4CDRA 3GEGA 3QF4B 1KYIA 4CTJA 5IAGA 4NU6A 4WINA 4K6HA 4O4LA 3EVGA 1KPGA 1JT9A 1RQXA 4DXHA 1YK0A 4LCEA 3FOFC 5A7GA 3U3XA 4MH0R 4DA9A 2P68A 3ABSB 1UMCA 2AG0A 1VKOA 1W25A 2TMGA 1D0SA 1OKKA 1Q19A 4FN5A 4GD3Q 2F9MA 1RRKA 2HLDA 4LJKA 1RLJA 1XWFA 3PUWA 4J16C 3I5AA 3MGBA 1UFOA 4K9PA 5GGXA 1EWRA 4DHEA 4JU8A 2AHRA 2PUJA 4LZLA 3I04M 3AVWA 2AVDA 3GIWA 1A8SA 1W9MA 2LTAA 2ORYA 3CBGA 3SS9X 1SKUA 4BLRA 3A7DA 1P2GA 1XTZA 3LXUX 3VTAA 4DLVA 1XTVA 1DQYA 1MBZA 1JAZA 1P3DA 4YJHB 5HQJA 2P35A 2IOQA 4GKAA 1L9XA 4IQ4A 3Q12A 1NN0A 1TK3A 4YQEA 5TGTA 5I48A 5ITZA 2D1RA 2K4MA 5CPBA 4HGZA 4KBGA 1UXOA 4HL6A 4OKSA 3D7SA 4GOND 4Q9IA 2GF9A 1U9IC 3OZGA 3ZHTA 1EP2B 3KDSE 2H59A 2R79A 5ILQA 4NS1A 3X1MA 4BNWA 4G23A 4AUMA 3G0IA 3RS2A 4FQ7A 3X3HA 4FC7A 1DWPA 4FGZA 4WNIA 3IP5A 1DRUA 4D0RA 5F5XA 1RACA 4KK4A 1HKHA 3SF8A 2P9TA 2I55A 1BIFA 4GX1A 3F5QA 3AJRA 3EVZA 2VS1A 1Z56C 5J2UB 5TT1A 4B6OA 5C9ZA 5L3VA 3T4EA 1XJCA 3UAWA 4MVJE 1N2CA 1TQ4A 2QG6A 2ZUCA 1EYZA 1U99A 1T8TA 2I2BA 4DCNA 3JZMA 3THYA 1JA9A 3FZEA 1CIPA 4NMMA 4YHHB 2YN4A 3P97A 1KIAA 1FVFA 2YXNA 5KNCH 4CEJB 2ZAYA 1WKCA 1X19A 1YI1A 2OP0A 3H65A 2X7JA 1MR3F 3QKSA 4R8RA 2YZKA 1BE6A 1MJGM 2C82A 5BWLA 3H7AA 3H99A 5G4KA 1EJBA 2HIGA 3BB3A 1G6HA 3ZU5A 3B53X 4R84A 4COOA 1NONA 5IAAA 3EEIA 1FJGB 2A2ZA 3WHLA 3ORFA 5JCJD 1NVWQ 3N2NA 4ILEA 4KXFB 1LBIA 5AW5A 1QIMA 4DTIA 3ZCPA 4WN9B 1L5RA 1R4MB 3D2AA 3RJZA 1KK1A 3ZDZB 2B8NA 4P4GA 1QO0D 4OQQA 1FSSA 3U3DA 3W77A 3LBFA 1GFIA 3FB1A 3M8KA 3CZ5A 3OJXA 4EQZA 3HCBA 1NG9A 3GQBB 4B43A 5C7YA 4LJ7A 5B7GA 3REQB 2XKJE 4XQ9A 1VYTA 4AF8A 4EJSC 1VQ1A 1PBNA 3KZKA 2BEUA 4C5BA 1A7AA 1OR8A 3FGPA 5J9FA 2HMVA 5D7BA 1RCFA 5DW0A 3HN2A 1ADGA 4HAWA 4K2AA 5EIBD 2X0EA 5AUPB 2IPMA 4LBVA 1XD8A 1F5SA 2KQUA 2BR5A 2X0KA 2IKQA 1WM1A 4CQMB 5T3UA 2NN3C 3CNEA 2QPAA 4R1UA 1SFRA 5SV2A 1F4VA 3V9AA 2I1VB 4BQEA 3FPHA 1RLMA 1CE8A 5C3MA 1NMXA 2FV8A 2R7MA 2ZSEA 3Q3IA 4JJ6A 4S35A 5E2AA 4BN4A 3Q0IA 3RC9A 3L1HA 5C7IO 1NC1A 2FEOA 2BZ0A 5FYDA 4OHOA 1KOLA 1QQ7A 1FP4B 1SA0A 1YACA 2PKQP 3WYEA 5CFOA 1GTRA 2XBMA 2ZI4A 4ZZ2A 4UULA 4B79A 3N2GA 2VDRB 1Q91A 4D4KA 1FPMA 3FNRA 4UBNA 4J16A 4U2GA 1E9DA 1R8QA 2B78A 1MU0A 1Z6YA 2W83A 3SU8A 2NSJA 4EFMA 3K6JA 1TDJA 2WABA 4IIJF 4PSUA 4S24A 1RYEA 3I6MA 1H42A 2CK3A 4POOA 3VZCA 4BBAA 2BDUA 2WVJA 1UWLA 2Q28A 3ENNA 4L7QA 4MQEA 3HMKA 3IEPA 2PTGA 2Y9PB 1F2UB 3QE4A 5KDLA 3G8CA 4XYEA 1Z17A 1BKDR 2YMQA 1AZWA 1JKJB 1VG9B 1WDWB 2H4FA 3KV1A 1A8IA 3B3QA 4RVFA 5IJAA 4MVJH 2R11A 1DC6A 3H04A 2VSNA 3TL3A 2I34A 3N07A 5JXHA 1W9HA 2PJUA 1HLGA 3BULA 3PC6A 4OSPA 1GPDG 1Y1PA 2NYVA 4N1AA 2Y0EA 1VP9A 4PAMA 4J7CA 2QXUA 3ESXA 4BKOA 4DG5A 1CJTC 2H16A 3G7UA 3HZOA 4LECA 2OV2A 3D59A 4NS4A 4X90A 4A03A 1F6DA 3OKAA 2OV6A 2ZRQA 4BLWA 3KZ1E 4Q0MA 4DLWA 1A4IA 4FQ5A 3LYAA 1QDUA 4FNAA 1P4JA 4RCVA 5GJBA 5UKDA 1Y1KE 4OFWA 3SYNA 3T4UA 3TLZA 3PDHA 4FDUA 1PDWA 2VDLB 1W36C 2PR2A 1HEYA 1CQPA 1NOKA 5J63A 5JVDB 5I8ZA 1OIXA 3JAWB 1K3UB 1O5OA 1ZL0A 4OM8A 5AQ1A 5LDHA 3BXZA 4S3MA 4TT3D 2WNHA 1CT9A 3HNPA 5CIQA 2QLNA 1U63A 1MAAA 1R6TA 3GDGA 1P7CA 3I9MA 3QPAA 4U7JA 3D7LA 3LXMA 1NBAA 3ZIAA 2JIRA 4JEUA 3I0MA 3THWB 1Z2DA 4NY1A 4CLOB 1XRQA 1U8EA 1M1YA 1LDBA 1HTBA 1WABA 4RKFA 5L51A 1I6KA 1IQPA 3L7CA 2WLSA 4WN9A 3E2IA 4R54A 4BNKA 2WNIA 3I1IA 3OECA 2Q49A 2UZAA 3FPCA 3RBXA 5IH7A 3ZKWB 4HWSA 3RSFA 2VP9A 2XA9A 5IWCA 4ZPJA 1JNXX 1QYRA 2PVCA 3LGXA 5F7OA 2C4TA 4IIJA 3ZY6A 2O50A 4I5IA 1R8XA 4LVOA 3KBOA 3DLBA 3E27A 5HQ3B 4EJSA 4TUYF 1Z7EA 3LUAA 1U7WA 1Z4NA 2O8VA 5HFNA 4NAVA 1H66A 5JV5A 1QDLB 4YLGA 1JJBA 2WOJA 1H2WA 1BMFA 3OPYA 3VZRA 1RKXA 3L7IA 2V7GA 3IVMA 4AP6A 1YRQA 1C1DB 3HU5A 3P71T 4MKIA 4FYPA 5EJ4A 4OXXA 3JYHA 3C7CB 1MC5A 4GP9A 1XCBA 2ZBRA 2PYZA 2ZJ0A 3GFBA 3KQOA 5KOJA 3FROA 2GXAA 1WP9A 4MVXA 2HA6A 3EG9A 5TE9A 1ONPA 1C1YA 1DQRA 1R4AA 3F4KA 2FZEA 4JI0B 2PKWA 3D3WB 2VG8A 1SQGA 3LKZA 3ZG6A 4RANA 4BNDA 1J9ZA 1BW9B 1SC4A 1W5FA 3TIXB 3ZJ4A 3VPGA 2ZR0A 5HIKA 2VAMA 3HI6A 5DI3A 2I8CA 2D3TA 3JQFA 4CF5A 1I4LD 2PNJA 4EHAA 5JCPA 1E92A 4H6XA 5CLGA 1PYDA 1N5RA 4Z4CA 1V5IA 4LCJA 1EVYA 1R4NB 1KNXA 1SUBA 1Y3AA 3K9QO 4NF2A 3LQRA 1CFJA 1BHO1 3LT5A 1BE0A 1Y1QA 1FW8A 3JD2A 1TCVA 1UM8A 4PPNA 2OFXA 1O6CA 3LVQE 4DJTA 4UNIA 2H6EA 2REOA 2JFVA 3MQ2A 4JBGA 4I9FA 4Y1GA 1BTOA 3LVBA 3M1LA 4LC9A 3QOYA 1T9HA 3U7QA 5CEJA 4I4CA 1E6EA 5B2FA 2C7PA 2X42A 1R27A 1QHGA 4URUR 5KVAA 1IEQA 2XGSA 4YAEA 2OQRA 3T3DA 4BLPA 1JJIA 2NU7A 5L45A 3OCCA 1KJZA 3L6BA 2UVPA 3PFNA 2EFYA 3QPCA 3BD7A 1A3CA 1WCYA 4LF6B 2B61A 3EXEA 3EXFB 1I13A 3AEQA 4F7WA 1XPUA 4YMGA 4OAPA 4DIDA 3L0ZA 1N5JA 1OX5A 1XZDA 4KN9S 5J2TA 4QLOA 4IDGA 2VH2A 2X7XA 5CGZA 5AKLA 1KK2A 4RDIA 2DKNA 4ZRMA 4W5RA 2RHRA 3G0CA 3ECSA 3IX7A 4E46A 4JYBA 1M34B 2QMEA 4E7OA 2YJGA 1T2EA 2P7HA 1D03A 1DT3A 5CB6A 4BXOB 4DY6A 4WK0B 3BHJA 1GRNA 1H94A 2A3NA 3KEGA 4KN6A 4XJXA 4BO3A 1ABEA 2PX0A 2WJPA 3JASB 3V34A 1GPH1 1XVIA 5CU7A 4JI3B 1WXQA 3R0ZA 3Q7PA 4OHXA 4L76A 3FDIA 2W22A 1G8FA 2ONKA 1XZAA 4NATA 3G02A 5E7IA 3UKJA 1ZN2A 3U4QA 1QTRA 3DVRX 2EHDA 3AIKA 4LOLA 1MORA 4JC4A 1YZNA 1BEZA 1QM5A 4GMDA 1MAVA 4HEA1 1MJ5A 1WCIA 2CHFA 3BRWA 5JJIA 1S2NA 2FEAA 4J0FA 4XLZA 3M4ZA 4LDAA 5HDQA 3FIUA 3T1NA 3CW8X 3INNA 4IH1A 2V7WA 4LXHA 4M9CA 2ZIWB 3OUTA 4FGUA 1UPUA 1EP9A 1SJ9A 1GL9B 3JAWA 4RPIA 5EQTA 4HDKA 4KB5A 1Z08A 3N0XA 3ZHUA 4I1PA 4JASB 3EPLA 4FZ5A 4U9IS 3DQQA 2F8TA 4IG9A 1FSGA 3RU2A 3RTAA 2WG2A 3K2EA 3TJMA 2BMFA 3TVTA 1BWQA 2A1TR 1PLLA 2BGWA 1N9ZA 2E5FA 3HCRA 4EA7A 1XRNA 5B3JA 2VYCA 4DUGA 1M6NA 2EARA 3EYAA 1QF9A 2RKOA 3G9XA 3ZEIA 3UPUA 5KQMA 3I73A 4H7DA 1H6DA 4IRXA 4ZI2A 5F23A 1B15A 3FWYA 1ZIDA 4UM8B 4J9VA 1Z6XA 3WG9A 2W00A 1QZ3A 1KZ9A 1XL1A 5FB3A 4A3SA 4CKCB 1ORRA 1BCSB 3ZV6A 3HTXA 4DKXA 4BRSA 4XAQA 5HWSA 2GAOA 1NN5A 3QV2A 1JG4A 4TWBA 2GOYA 3EFEA 2UUBB 1FQOA 3SSMA 4IZHA 4K6KA 1G21A 3O3MB 4WERA 2PKCA 2XYRA 3VX3A 3EMKA 5B2EA 5HR5A 1HFEL 2ZAGA 2I29A 4ZCPA 4G0ZA 1K3FA 1NURA 1U8CB 3JTEA 4AJOA 9ABPA 4GMFA 1PDOA 4M0MA 4HNUA 1GG5A 3NIBA 2OK8A 4EYKA 1KBZA 2R2GA 2EBUA 4RTSA 4HYQA 1CJSA 2BLLA 4PHHA 5IANA 2QRPA 2CD9A 3DEHA 3TOZA 1L7QA 4ND7A 3BQ9A 4KBFA 1A9RA 4W5QA 2QZZA 2FR8C 2W8ZA 2VRWA 2ZI5A 4ENQA 2NO9A 2NQ8A 4BMDA 5DBFA 1D09A 1N5IA 2M1ZA 1VE9A 3AF6A 3OZSA 1L0BA 3ESZA 1UZUA 4JELA 3SLKA 4JLDA 5CEFA 4RPKA 3JYQA 1ENOA 1UMBA 2FW0A 3TNLA 1CFZA 1AKEA 3RJ5A 1E7MA 3FY4A 3LUFA 3WHIA 4IHAA 3TLJA 5K8IA 4WFQA 3DZHA 3MAAC 3SAJA 3GLKA 2Q5CA 1D9ZA 3NG1A 3TUIC 2Q4EA 1WA5A 4MKHA 3KKQA 4FZ3A 4QUDA 4JZKA 4MHOA 5JMOA 2DFPA 1Y3HA 2EAUA 2XTAA 3AW8A 4MIYA 4A82A 2I22A 1PS9A 2FA9A 2RI6A 3B85A 2J0VA 2HRCA 2HQBA 4FPXA 1KF0A 2D0PB 3P9XA 4YALA 1JDZA 1ZD2P 3LCMA 5LZ8A 2B25A 5BUZA 2AN9A 1OH8A 1NVKA 4OSOA 1Z74A 4ZHQA 3IR6A 4ZYLA 4QOGA 4RBNA 3ADPA 5JWHA 3ILHA 1P4SA 4FIZA 1LX7A 5KJFA 4BO2A 4HLDA 1Y3CE 4XFJA 3GRPA 1BXRB 2JGMA 5I9BA 4EL0A 5IYZA 3DPSA 2UVPB 5IG2A 2WP8J 5CJ2A 2C5LA 2X6TA 3PXCX 2PT9A 3K35A 2VWGA 2C00A 4I55A 4MSUA 4QWMA 1Y33E 1W76A 3OIDA 1QPZA 4Q47A 2Q8PA 2ZATA 4ZV7A 3WLRA 3PI7A 1QYVA 3PFWO 4JLOA 1AKRA 4DNOA 1ZGGA 1OFVA 2Z3ZA 3L0CA 2YZNA 2P2DA 2EIXA 4JUIA 5TX7A 3C8UA 3OQMA 1SBNE 4DYDA 1DSSG 1RTKA 3QVWA 3PHLA 1LSUA 3JQAD 4AMZA 1P0PA 3K16A 4E09A 1CUIA 5JNTA 2CLHB 3EFHA 1BVRA 3NANA 4EW3A 4X0EA 2Z8ZA 3KOUA 5EFOA 2B2CA 1FDRA 5DHUA 5U1PA 5ADWA 3NAZA 4Z1MA 2LVBA 2YJ4A 5IBRA 1TQ2A 3PC8A 2FU5C 1WD7A 1QJ4A 3M9LA 5AW8A 3F9CA 1NPTO 1XLWA 3WA6A 1JR3A 1MNAA 3B6JA 3OPYI 4BU0A 3S6JA 1DDIA 2GZMA 1Y7LA 4WY2A 1Y4AE 4Q7JB 1HRKA 4UXHA 1ZUHA 3HUEA 2R48A 3N7AA 4Z2YA 3O92A 3RROA 1VMEA 4BBPA 4X92A 1HM5A 1ZJWA 5DGDA 1MC1A 2FSVC 5E3IA 2BHNA 2Q62A 4XE5A 1JDVA 4M0LA 3X44A 2AR0A 1IOZA 5LR6A 2RHBA 4A0FA 3TTXA 3QOFA 3IAM1 4C4YA 3AUFA 3C45A 1LVHA 3LVFO 4KJZA 4JI6B 2ZYIA 5EZYB 5BMVB 4TTQA 1K9VF 1UDBA 3JQGA 4PU0A 3HPQA 2VSFA 4FVTA 3O4JA 4I8XA 1F20A 5IH3A 2D2IA 4QTYA 3I1YA 1GVNB 1RLOA 4ZRNA 5AKHA 2QYOA 5MHTA 4N8SA 1A5SB 5CP8A 1L5MA 2ZBGA 2QL5A 3H5WA 4H6PA 3WDLA 4BFZA 1GU0A 2ZIEA 2CNKA 2OG1A 3AI3A 1RWPA 1YE3A 3MUEA 3Q5DA 4MS4B 4ADSG 5IAOA 4KR2A 2W2LA 4D8XA 4WBNA 4FB5A 5LWHA 1R6UA 5K0FA 3RS7A 2ZRKA 2A0XA 2Q6KA 3I72A 3ZE9A 3HCPA 2XLCA 4LQLA 2H8GA 1M74A 3UUGA 1G4HA 1I9GA 2AH5A 5F12A 2BY4A 4QASA 5DLYA 3WJ7A 3IE1A 1U0GA 3V8QA 2UZ0A 2VF2A 5JLAA 2C7BA 2IOFA 4UHCA 1GNVA 4C3UA 1T9AA 3CLTD 5CCXA 4W9MC 4Y9RA 3AR6A 2WSIA 2QGZA 5EJFA 2R6R1 3LQKA 3IMEA 4G1EB 4QGBA 1FQWA 4BQOA 5IXJA 2JIZD 4PCLA 5EPUA 1MAHA 4KPUA 3CLUC 1AZLA 1XA0A 2VBCA 1LEHA 4RVNA 1CTQA 3A6EA 2Q5JA 5D3MB 4ZQFA 2JW5A 1GG2A 4YBRA 3LPDA 2CT8A 2V65A 1IWPB 5ESDA 1SULA 2BFDA 3G17A 4ZZIA 1E1LA 1UR5A 1LD3A 2O8DB 4NPHA 1VECA 2IUSA 2G0NA 1U7XA 1XE3A 3P9RA 1J09A 4GMGA 3LX5A 1AKNA 2OORA 2PZ8A 3TQTA 4TKVA 1MOPA 4W7SA 1BCSA 2Q07A 2ZYVX 2VEOA 5I9TA 4MUAA 4ITUA 4CMBA 2FN7A 4WA8A 5JZVA 3Q3CA 4YJKA 2RB5A 4K5QA 2BHLA 5IMBA 5I7OA 2Q99A 1QC5A 4GLLA 3VR6A 3ETLA 4BB5A 4UDOA 1RD4A 5JAIA 4Z4EA 1XDSA 1DG1G 3DXFA 2WJHA 1F8FA 1XRSB 3R6WA 2JIZA 3F7TA 4O63O 4Y1EA 2WAYA 3ANLA 4CMCA 3WZLA 2HDWA 2MYNA 4RWEA 3V2IA 3W4IA 3P0IA 4GFDA 4P7FA 4OLHA 4DR4B 1IJKA 4KYIB 4UFPA 3WRVA 2GEKA 4LRWA 5CB0A 1Q74A 3B1VA 1Z4KA 3T6KA 4A1OA 2IZZA 2YYZA 3AG5A 1T91A 3DMTA 1EQUA 2V4MA 3BKXA 4FX2A 2R7LA 4G0VA 3DZIA 4PBTA 2JEOA 3BL5A 1IY9A 4MS1A 3T95A 1Z0SA 1BJRE 2AXQA 6ADHA 1YB6A 5CVUA 5EE9A 5HUQA 3WSVA 4FBMA 4GBJA 4JMLA 1EBFA 1I6LA 3NUQA 3KE9A 2M9MA 4RXUA 5EFZA 3OLCX 1NKVA 1OQAA 1COWD 1PX0A 4B2LA 2XWSA 1Q1EA 4FR0A 2ONJA 1QE3A 3VJMA 3D6NB 1JSZA 4GM0A 3S70A 1D2CA 1TUBA 3E5MA 4HRYA 3CE6A 2GHIA 1V37A 3SIWA 3EPRA 2ZB8A 1XF9A 3ADKA 1M6HA 4D2IA 2G5GX 4B7CA 1SUAA 2BV3A 1MF7A 2EL9A 2OO5C 3FOCA 3IPAA 3JSXA 4WKGA 5CVDA 4B6EA 1PWZA 2JFGA 4YUVA 3HHEA 1ECFA 3FRIA 1HFWA 4PCUA 4ALKA 1M72A 1CYDA 1FFAA 3EMBA 4QTXA 4IJQA 4IQ0A 2CV2A 5TR9A 1TYZA 1BD4A 2B30A 3FDFA 4HAUA 2FFRA 3ZWCA 2UKDA 2DGDA 4Q37A 2V7PA 4YJ2F 3TSCA 4EX7A 4I14A 4OJMX 5BYAA 1SBQA 1PI3A 1OT5A 1VPDA 3AB8A 3QVKA 2G1UA 4HFMA 3WVNA 1RQGA 3RREA 2VL7A 1T6YA 1C8VB 4B4VA 2RHTA 2EGHA 4OUDB 4AWAA 3QFSA 3JYNA 3KXIA 4QNMA 1SBCA 1LZKA 4CUZA 3NHLA 4KAJA 1N6KA 5DNUA 2I8AA 2AEFA 4QICA 1G3IA 5HTOA 3Q88A 1Q0SA 2C78A 1U3UA 4L95C 2NPOA 4HGQA 5FKJA 1U9IA 3TRIA 3HVJA 1UH5A 3O93A 5K8UA 3A3NA 4MPJA 3IP3A 5HCIA 5FORA 2OXIA 3D7KA 1MA3A 3ZV4A 2FSFA 3IOEA 4PPFA 4CDGA 5L95A 1A9XA 4GYWA 3KWMA 4BFTA 3MHTA 2WPNA 2PMKA 1VFNA 1UDWA 5G0TA 3DZKA 3UAGA 5IBQA 3V46A 5H8WA 1KC1A 2NU6B 3A9WA 1XKTA 2W6QA 5TRTA 3U1VA 5JS2A 4TX1A 5A7FA 4PLPA 3NDJA 4M3NA 2J41A 4AKTA 4YMIA 4ZYXA 4ZVUA 2FR0A 1DT5A 3NP9A 1VPWA 3PS9A 1HSZA 1Z6PA 4GZ5A 1VA4A 4D82A 1RHKA 5K4GA 3G5TA 4DR7B 3SR0A 3KKEA 1P1HA 3F78A 1DBSA 1ST3A 4FD2A 2BFEB 4JP8A 4ZGWA 4L5IA 2V8BA 4CG0A 1PLJA 1QDEA 2VBIA 1T8WA 1TW2A 2XT6A 3ZIUA 5BQ3A 1OX4B 4BU1A 1KI6B 3EHEA 2GRAA 3L84A 2XDYA 4HO1X 1U2EA 3GLQA 4N54A 2O2HA 4KMRA 4U0JA 5DW3A 4BGIA 4DEXA 3G9ZA 2CXXA 2AG1A 4K40A 4IL5A 4MINA 5AW2A 1KI7A 1FTNA 2XIQA 4NBNA 2VQSA 4RW0A 5AVKA 3SF0A 1IZ0A 1OBOA 3E9NA 4KRYA 5COQA 3DMTC 1JHQA 3QHPA 5BXYA 1JQDA 1V5EA 3IIMA 3NOVA 4GRDA 3P9ZA 3FHLA 3EXAA 3RTDA 3C70A 5M29A 5TEVA 1EG2A 1ML4A 3CXUA 3L06A 3R3WA 2WTUA 1SUCA 2CNWA 3TINA 2HCRA 3B36A 3BWEA 2DQKA 1ZVMA 2CUTA 1JU4A 4AF7A 4BVHA 1J07A 3U60B 3BHIA 4TSRA 1XEXB 2ERYA 3FYCA 3COPA 1YGPA 2D4AA 2C1EA 1XRJA 5L6LB 2XWBF 4KXNA 1QK3A 4K9OA 3N2KB 9LDTA 5IKEA 4IZ6A 5CDHA 2VRCA 3L6CA 3W9BA 4EFLA 3STVA 3HYTA 1SXPA 4CHGA 3FAKA 1M1ZA 2Q6OA 4O2BB 1OU4A 1SU6A 1YQQA 5LQCA 2BCGY 4LGVA 8OHMA 3U4MA 2EYQA 3HKCA 1RWNA 1M7BA 2C4MA 3GLVA 3KTDA 1L5NA 3FF1A 4PFJA 2MYUA 2QVLA 3KFLA 1N2SA 2MCFA 1KKUA 2N1BA 1F3LA 4M1OA 2BWJA 3CURA 4NYIR 4RQBA 5FBVB 1U2GA 1EFAA 5JFGA 1JIQA 2JZCA 4CIAA 1GYRA 2Q3EA 4DDKA 1IXKA 5TB5A 2OXTA 4YYZA 1XZBA 2DQZA 3FDZB 3KB1A 4UBIA 4R01A 4JHLA 3RSHA 1SVWA 1YI0A 2O8NA 2OM2A 1ZI9A 3QNWA 2Q5FA 1CUYA 1E2UA 2BBTA 1ENPA 3GW8A 4L75A 1NIPA 4O2AA 2IS2A 3ONVA 2KPOA 2Q1TA 1USGA 3S40A 4AECA 5FX2A 4WZBE 4NAHA 4CDNA 2LGJA 4UD2A 1F0KA 2K7FA 1ZNQO 4WH0A 4D96A 2O3RA 3H5AA 1KMNA 1GSHA 1F2TB 1OXUA 3NC1C 4YQYA 3KTAB 3NHWA 1XKQA 4LWQA 5LQNA 4Y1RB 4L5YA 4KDFA 2HJVA 2HSJA 1P4HA 2FPLA 1WE2A 2P3SA 3FFWA 4D3YA 4NCAA 1X9IA 4K3VA 4C0SA 4K2HA 2J85A 3PLNA 5J5AA 2FX2A 2OGUA 5SY9A 4UAJA 3S1AA 2ESRA 3PICA 4E30A 1ESZA 4E70A 4WGFA 5JC1A 2ZTUA 4M1ZA 1NUHA 2ORIA 3EZ9A 5L6MB 2BGIA 4HPXB 4IEFB 3CEHA 4NECA 4RQAA 1M1YE 3F3SA 1VKZA 5AJTA 4EPRA 3IL2A 2RGCA 2XZLA 3R2JA 1TOAA 4F3RA 1Z25A 3A10A 3CONA 1ESDA 3TI7A 2CY0A 2JZOA 2JVKA 3JXEA 2X0JA 3QI2A 4XYMA 1KY2A 1E5XA 3NHJA 4BLVA 1RI1A 1UPAA 4HFJA 2DPHA 5AWFC 5SYNA 3T94A 4XX0A 1EFDN 4GI1A 3ZH2A 3T52A 1QRDA 1PS0A 1PT9A 4GWLA 3C24A 1GQ2A 5JSUA 3HN6A 3WX0A 3G59A 3IE2A 4DV7B 4V2IA 3RVDA 3BXOA 5TDHA 2AQHA 4G8JA 3FLBA 4QU5A 2Z6AA 2IYEA 3CW2A 4XUCA 4H60A 2Z83A 5ED0A 4LDJA 4I55F 1J8VA 1E94E 2PBRA 2VYQA 1UXGA 1CP3A 4P34A 4LXUA 5IDXA 4EG6A 5K20A 4I8DA 2EQ5A 2IE0A 3ZS8A 2IP1A 3DLAA 1G3RA 1E58A 3TZHA 1GUDA 1RXSA 1C3OA 1PK9A 3A06A 5DP2A 4CKWA 1UMDB 3OF5A 4FMCF 4HEJA 2RGBA 5CNMA 5JSYA 1DX6A 2O7RA 3GFRA 4N8EA 4WLFA 1E9SA 2WJIA 3OBIA 5EXPA 1AKMA 4Z3OA 2J4FA 3AHJA 4P3KA 4XLTA 1T36A 2YWXA 5G40A 4DCJA 3Q9SA 1RHRA 5JAUA 3H0KA 2KLBA 2RDMA 4XTRA 1P3Y1 2XRMA 2AOWA 3KP1A 1H23A 4YUZA 1VSVA 4R51A 1QIJA 1X92A 2VAWA 1LBTA 3GMIA 5DRYA 5B3JC 3IKJA 1HE3A 3DD5A 3TSOA 1OYWA 3IDQA 2OUKA 1Z6TA 2QTZA 2ZTLA 4M9ZA 3SXUB 4E51A 4OI0A 3INYA 1JHRA 2G4CA 1NJ6A 3LUCA 2OBYA 3UA4A 3ZI4A 4NZPA 2AEJA 1TT5A 2WJAA 3VNUA 4GP6A 2P5YA 2ZYDA 4HN4B 1KS9A 2FXVA 2EIHA 5F2OA 1FXWF 4E31A 1VCHA 2C20A 4D98A 5C32A 1RPNA 1L4BA 2LCFA 2QJTA 3MLAA 4DLSA 2I1LA 2BELA 2ZVPX 1UDRA 2XVAA 4WMLA 5DHFA 5LOVB 2BHSA 4DEVA 1VJ0A 2ZEJA 2V6JA 1ID8A 1SK9A 3ZIDA 1SKMA 1EX6A 3KZCA 1QU3A 2P7IA 3HU1A 2C2WA 1JIVA 2OILA 5IVIA 2PUVA 4DLXA 3LX8A 1J23A 3WYCA 3OEED 5BSKA 2EQBA 3HBLA 4B3CA 3EXHA 3F6CA 4X1YB 3MG9A 5DHTA 4ZI7B 1U0HC 1XVAA 2QU8A 4YT5A 2Z6UA 2CSXA 4UAUA 3QEMB 1G21E 4KUHA 4J6FA 2P9HA 4O2BA 4R1LA 3UUWA 3R20A 3WNQA 2R8XA 1RRGA 3R4CA 2AR9A 2PL5A 4DNQA 4QOIA 4JIGA 3TZQA 1NVAA 3K4QA 1KWGA 2CXSA 2WAAA 2ZS9A 3UH0A 1H9BA 2Q7OE 1E2PA 1H1LA 1VXOA 2I8LA 3DBIA 4XOIA 4Y8VA 4YCAA 4J0DA 2F4VB 3PTLA 1T6XA 4HQ0A 3C8DA 2RGRA 2E89A 3A1TA 3OZTA 1O4WA 3UQYS 3M6UA 3LFTA 1HDIA 3OZIA 5H16A 3LUDA 2ILTA 1P2DA 2PKXA 4QGHA 1RIIA 1DEXA 3PUZA 2FKNA 4RXTA 1R0CA 4UDNA 4UHBA 3DT9A 5G02A 3VR1A 3AEZA 3CEJA 4DUPA 5DI3B 1Y6GA 2BFWA 1JLHA 2VZ8A 1U81A 1KVRA 3FNIA 3V7UA 3E5NA 2JHCA 4DRXB 3BQMB 1CZLA 1U3VA 1JQLB 4KSBA 3LL4A 5IVHA 4WZBA 1RKVA 5JZOA 2FUEA 1BKYA 1Z7YA 4QQ8A 5CJJA 4F1WA 1UPXA 1X1QA 1IH8A 1C4WA 3H1BA 1NUUA 3MXOA 5CYGA 1KORA 4NZOA 1I14A 2W6NA 5I3CA 4JUAA 1LB1B 2R6GA 4W63A 121PA 2Z8YA 1SHZA 1IY8A 4QO8A 5H83A 2D00A 5NLLA 5JECA 3H13A 5JANA 3O1IC 1C3OB 4PQFA 5IVDA 4Y6PA 4IAOA 1L7BA 4D41A 1Q1NA 5KTPA 3VR4A 1YHYA 4II7A 1IK6A 4RHFA 5KYXA 2FWPA 2RK6A 5JCJA 4K88A 2QG9A 4M8LA 3KALA 4LI0A 5ED4A 4FEAA 4DCPA 2P79A 2ZIUB 2PT7A 3E61A 5CLIA 5IFKA 4AS1A 4W8HA 3FUVA 4AS2A 5KOHA 4D5GA 2OB2A 1E1QD 3PDUA 3PWZA 1WSBA 4A8PA 5A71A 4D0LB 3LYLA 1VL5A 5TJHA 1K6EA 1PFVA 4UEJA 1C2YA 2AQIA 3P9QA 4OMCA 4RTNA 1OI2A 2WU3A 5EOVA 3KVRA 3W5VA 3ZZMA 2NTEA 1KKMA 3NBXX 5KTSA 1XC7A 5JR3A 2DETA 3M70A 1WZUA 1TIBA 2FJ0A 1XRPA 4TLDA 1OI4A 4Y2PA 5GM1A 3M5CA 3WLQA 4C14A 5AJZA 3B5EA 4CQLA 4GGPA 2Q27A 1IZ7A 1Z0AA 2ZJ2A 2RKWA 2JLBA 5DNAA 4B81A 2XMCA 4TVKA 2PZFA 4HZUA 5KHLB 1EBBA 3GIDA 1IRIA 1PNTA 3IAS1 1W85B 1KPHA 1GKLA 3KJZA 1JKFA 1V4BA 2CFIA 5EVJA 3EDCA 4M1WA 2ZB7A 2HUNA 2Y0BA 4EB0A 4S1VA 1OLUA 1YQTA 3B9QA 1CDOA 5TQ0A 3BT7A 3KFXA 1KAOA 4KUGA 4O3MA 5EKDA 1N2EA 3L46A 4M55A 3L7BA 4MWGA 2V9CA 3EMVA 5E3HA 5LUBA 1H93A 3VHXA 4HNTA 3WRYA 2ZJYA 4CLEA 3HDVA 1X3LA 1BW9A 1SVMA 3WQHA 4MQUA 3WYAA 4E5DA 2X1VA 2Y1OA 3NBYC 1SNYA 2DHEA 1WBDA 5D5HA 4CL2A 3M82A 1D4AA 2PDAA 3WZ2A 5JJLA 3V97A 2RG1A 4A0QA 1OC4A 3SJAA 1E1RA 4D74A 1P2TA 2XD4A 1KE1A 1OH5A 4IM7A 1INLA 2Y1LA 3MJSA 4I50F 1J0AA 4AM8A 5EPOA 1CY6A 1I7SB 5CFQA 3HDYA 4JODA 3Q7RA 3UW3A 4J1SA 5HW0A 3ZNOA 5KPDA 3UCFA 2CF6A 1FFSA 2ECKA 3GFVA 1RJEA 2I62A 2PJDA 3MPOA 4TLAA 3SC2B 3DZCA 4D8UA 3D8RA 2VNSA 3HR8A 4N7JA 4RABA 1HDOA 2Q4RA 1GDDA 1W5TA 2NACA 1XP5A 2YUTA 3GJXC 3HYCA 4G8DA 4ZOCA 7AT1A 3TKLA 4J7AA 3KO8A 3WLPA 1ZCZA 1I7PA 3QJYA 2O5CA 3K0CA 3A4VA 2A5LA 1ZM9A 1SOWA 2GAFA 3GA5A 3OFSA 2XXAB 1YJ5A 2F62A 2NZWA 4NWIA 2C7GA 3HDHA 2F6RA 1OOEA 2WJ4A 3U31A 4PSAA 1NOJA 4U2FA 4HXYA 3WLEA 3M9XA 1KDYA 2QOEA 3ZI7A 4AXBA 1W59A 3O4VA 4PNEA 4Z4FA 3OJFA 5BURA 1KR5A 3NM4A 1L5VA 4HWKA 3PCTA 1HEUA 1E3LA 3OTGA 4FMDF 1IG0A 4IIXA 3FLEA 1X74A 1CEEA 3MRSA 4YCCA 3EIWA 4PYNA 2REXB 4UDYX 1EB9A 4GF5A 1BQ3A 2C2BA 2LPMA 2GDJA 1E3SA 2QAJA 5IZCA 3O94A 1Y7PA 2RBGA 4W9NA 3H6KA 3RVSA 1XP8A 5JSHA 3ZVNA 3VX4A 1C7RA 1XDGA 1YS9A 5B55A 1YJCA 4B76A 1ZQ1A 1PCXA 4GI7A 1ODIA 4MYDA 3A9UA 3GDWA 3MUOA 3NCTA 3VYWA 4N7BA 4LYAA 1T5BA 2Z95A 4F2WA 1QH1A 3OCXA 5CRIA 1KQPA 2RIRA 3LPNA 1FSPA 1G7TA 3H5VA 3IOCA 2OO3A 2ZIZA 4QSHA 3RUIA 5KQSA 1XG5A 4CG3A 4HCJA 5A3QA 3KSRA 1FFBA 4PPYA 5LD2B 2GBPA 2UVQA 4UZFA 3D0OA 3HWRA 5ILOA 4WLUA 1UKEA 3HVRA 8ADHA 3ADOA 3AM5A 3CF0A 4X93A 4XVQA 3R7WA 2CYAA 4EEZA 1P1JA 3ZHZA 4RTKA 3EQ7A 5D5QA 3EZLA 2N0SA