4QEDA

Elxo y152f with nadph bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
b'MKKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILFGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ElxO
publication title Substrate Specificity of the Lanthipeptide Peptidase ElxP and the Oxidoreductase ElxO.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qedA00
3FN4A 3A28A 3RUIA 3FWNA 1ENOA 3JQAB 1SZJG 2FPPA 2QHXA 5F21A 4FS3A 5A9SB 5JDCA 1KOLA 2OZPA 5GMOA 2VWPA 3JQBC 5HA5A 2C82A 4JLWA 3JTMA 4DIOA 3VVCA 4A03A 3AI1A 4ZQFA 3TPCA 4CQLB 3C1AA 1JLLA 1ZK3A 2FHSA 2QW8A 4DVJA 4UUMA 4Z0PA 4OHUA 2Q2WA 1DC6A 3DZKA 3BHJA 4RVSA 4N54A 2OHXA 1U3UA 3OFSA 3OJLA 2X0NA 1ZK4A 3DEYX 1MG5A 3RSHA 1HL3A 2PKQO 1R66A 2CDCA 1GZ4A 2GCGA 3ZGYA 3RUAA 3G49A 4PZEA 2Y93A 2P68A 4IDDA 1GR0A 3AM3A 2DM6A 2YW9A 3AOGA 3JQFA 4U6QA 4B3JA 5TQVA 2HKIA 2W90A 5C5IA 1YB5A 5BSHA 5JS6A 4LGVA 1HLPA 2NUAA 4RQTA 2ZTMA 1ENPA 4XGNA 4ZQEA 3I9JA 4J0EA 4WGGA 5IJZA 2EKLA 1NQ5A 1EDOA 4L4RA 1AHIA 1EZ4A 4TVOA 1L1FA 3HQ4O 1PJ3A 3I9KA 3EVNA 4GKVA 2HMSA 4I9NA 4YAJA 5ENDA 1U4SA 2EF1A 4KZPA 3F47A 3S1LA 1F06A 1LSJA 3DZHA 2GSDA 3V1YA 3LYLA 4J2OA 4XGIA 4DLAA 2VWGA 2DTDA 3ZNNA 4BL5A 4Y9DA 3ZV4A 4CLOB 3K2EA 4UVGA 4YJGA 5ITWA 4ZGWA 2C59A 3WGQA 4NK5A 3U4CA 2ZB3A 3FPCA 4R69A 2WYWA 1TT5A 2HU2A 5JLAA 1SPXA 3OQ1A 2G82A 4KWIA 4K9DA 2Y1CA 3WGGA 1QLHA 4P8RA 5A06A 3DHNA 3OEYA 5EJ2A 4XQCA 1PTJA 4IMPA 1UUFA 3DMYA 5KNLA 1W0CA 2B4QA 3JD4A 4GKBA 3OA0A 3ZU3A 1D1TA 4QEDA 5C7IO 3FNEA 3OICA 3JQ9A 5A5EA 3E5MA 3HB4X 4CR7A 3FR7A 2EGGA 4MJLA 1V3TA 3DBHB 4XJSA 2AMFA 3G3EA 3I23A 1NFRA 2AG8A 1H2HA 1I3LA 2CVQA 4AJ1A 1H93A 2FSSA 3M1AA 1NAIA 3ZWVA 1KVTA 1LLCA 3EZLA 2EW8A 4IBOA 2I3AA 1NP3A 5DCUA 4C7JA 4HNGA 4MKZA 5F1OA 1Z74A 1DO8A 4JP2A 4TROA 3WWZA 2CFCA 1BVUA 4UVEA 1PL7A 2E37A 2ZKLA 1H9AA 2HRZA 3AK4A 4XYBA 5JMPA 1SMKA 1N7GA 1WNTA 1ML3A 3DOCA 2DPGA 4XZ3A 3EYWA 4BMVA 4KUEA 1R4MA 4TZTA 1AXEA 3GEGA 5CPFA 1OI7A 4NU5A 4AJHA 2ZJ1A 2GRAA 1EDZA 2I65A 2ZTVA 5TLSA 3TRIA 4URFA 5JC8A 4MKRA 4KQWA 3JYOA 3MWDB 3O4RA 1FMCA 3VZRA 1T26A 1B3BA 1HYEA 2RHCA 3BHIA 3RBXA 3ULKA 3WMWA 2D2IA 1P31A 1NASA 1OMOA 1AXGA 3NTQA 4PLYA 4IIUA 2Q99A 1XA0A 2I6TA 6LDHA 3IMFA 4XKJA 4DQVA 4W7IA 2FR0A 2PLAA 3WR5A 3O9ZA 1DIAA 2EERA 1ZUD1 1DC5A 3E18A 4IDEA 3RUFA 5A04A 3GVCA 2GERA 3GDGA 4YBZA 3WG9A 1IPEA 3TWOA 1LX6A 1SB9A 1MC4A 3PPIA 4PG5A 1HSOA 1NPTO 2V7PA 4A0SA 2DFDA 5C7LO 5IZ4A 1HXHA 3C7DB 1VSUA 4A73A 1TEHA 4RF2A 4RZHA 5BNTA 3WGYA 1C3VA 3ZWOA 1I33A 4E2ZA 1LLUA 4F6LA 4CLRA 1ZIDA 3V1UA 3MJTA 4WJZA 2HK7A 3ENKA 2YDYA 2IODA 4E6PA 5A5FA 4NHEA 4YXFA 2Y1GA 4BO1A 2OO5A 4ZJUA 2WD8A 4BNGA 4GH5A 1XU9A 3R0IA 3U3XA 5B1YA 5KJEA 1EQUA 1T2AA 3B1FA 3O03A 4FJ2A 1FDVA 3GGGA 3MJVA 1V6AA 1R0KA 4OSPA 4KMSA 2Y0DA 1AE1A 4BKPA 2DBVO 1RKXA 2BF7A 4IMRA 2UV8A 3TFQA 3QWIA 1H5QA 1XHLA 4R54A 4CMKA 1E3EA 3A1NA 5FWNA 4ND3A 4IPTA 4DPLA 1AHHA 2HK9A 3MWEB 3GZ4A 4CMJA 2AQIA 1LC3A 3CIFA 2O7QA 2YQ4A 3AY6A 1VL8A 2FN7A 1U8XX 2EP7A 2O48X 3IIEA 3QWFA 2O50A 3GY0A 3OIFA 5G0SA 4CPDA 4DMLA 1P1RA 1Q0QA 1XELA 4NBUA 4XD2A 3GFGA 4LCJA 3KSUA 5CG1A 1CDOA 4CM7A 4YTEA 4Y6SA 4W7HA 2W2KB 2O3RA 3DBLA 1A7KA 4B79A 2A94A 1ZK0A 2HAEA 1X7HA 1FDUA 1H0KA 1P33A 2XOXA 1IHXA 1MXHA 1P74A 4YJHB 3JQFC 3OIGA 1H2BA 3ZU2A 2H63A 4DIFA 1VKOA 1ZEMA 4CM3A 2BRUA 3RFXA 1YL6A 4DL9A 1BHSA 1UXKA 2HMTA 3FI9A 4L0QA 3KBOA 1UAYA 2HJRA 3D3WB 1S7CA 2BI8A 4NQZA 5IXYA 3PRJA 1P45A 2BKAA 3Q9NA 1ZFNA 1M66A 4YVFA 2HQ1A 4I5DA 4B4UA 4YAEA 5KWEA 4OXKA 4RVFA 4DMMA 4XA8A 4YJFA 4QO7A 2Q3EA 1CWUA 3TNLA 1J4AA 1U28A 4XYLA 3DONA 1UJMA 1QV7A 4IGEA 3AI3A 1QYWA 1GEGA 3KSDO 3JQEA 4NK4A 3OJOA 1PR3A 3GZNA 2O3SA 4DWVA 3GNTA 4PLVA 5JMWA 3FPLA 1HYHA 4LMPA 5JYEA 4B7XA 1LA2A 2FRDA 3JSAA 4AL4A 1RM5A 5ER6A 1R12A 5DP1A 1ULSA 3ICPA 2PZJA 1JU9A 4DC1A 4CMCA 2J3JA 2GN6A 1ISHA 1KC3A 1SB8A 1Y81A 3RFVA 1KY4A 1D1SA 1SCUA 5DNAA 4OM8A 2B0JA 3TDKA 3LF2A 1A5ZA 1U5AA 4FOSA 2E4AA 3S8MA 1E7YA 2O23A 3WNVA 1R6DA 3WLFA 3LT1A 1U2GA 4TSKA 2JD0A 1I24A 2AG5A 3D3EA 2QRKA 2W4QA 3AU9A 3H5NA 2IEDA 2DAPA 3RFTA 4G81A 3V5NA 1E0DA 4K6FA 3UN1A 1O6ZA 3ZWNA 1WDMA 1VC2A 4O1MA 2Z5LA 4G2NA 2ZK7A 3VH4A 1DJNA 1A9ZA 3SBOA 2O3UA 1M76A 1DBVO 3KYCB 5L4SA 4GVLA 3CZMA 3HADA 1ZVMA 3TZHA 4CJXA 5JAMA 1BRMA 1WWKA 2V6MA 1IE3A 4TRNA 3F5QA 1RPNA 3VKVA 4A27A 1R16A 4OJNA 1RYEA 2I9PA 1UZNA 3TJRA 1V8BA 3JQGB 4YA6A 3SVTA 1SAYA 1XU7A 5JCJA 3SJUA 3FWZA 1ONOA 2EW2A 2PFGA 1ULUA 1ADGA 2CD9A 3GN1A 3UHAA 4K6CA 1MGOA 1GZ6A 1GUFA 1GD1O 3GPDG 5A03A 4MVJA 1X0XA 1I3MA 4NBTA 4NDNE 4Q3DA 1V3UA 4MINA 3GVIA 4MIEA 3S55A 3DO5A 1YKFA 3JQDA 5A9SA 4WECA 2VYND 3DZIA 2VOEA 1KVRA 3ZV3A 1YXMA 3QIVA 3GR6A 4YPOA 1OOEA 1U8FO 4JJIA 3R6DA 4CMBA 1J5PA 5L4LA 5L3ZA 4MIOA 5KJCA 1PGNA 5ICMA 3GUYA 4E2YA 2E48A 4OYRA 1X7DA 3GAFA 3MZ0A 4K26A 3E82A 1DRVA 3GRKA 2QZ9A 2ZIZA 4IJVA 5EQFA 1NNUA 1UP7A 4WKGA 4ALIA 5CHEA 3ZV6A 2FWMX 1K2WA 2NQ8A 4BGEA 4FFPA 1ZMTA 4IDGA 2CF6A 2GO1A 4Q3NA 2WSBA 3B1KA 5TC4A 3NT2A 1NHGA 2W2LA 4CMIA 3DAGA 5A1TA 4E5YA 4WLVA 3RUEA 4Z9YA 3BZUA 1PGPA 1ADFA 1NTOA 2Q46A 3U0BA 4H3VA 1K6JA 2XXBA 3ZHYA 4PRKA 2D59A 3UW3A 8ADHA 1VJ0A 3TFOA 3KLMX 1PR9A 4GMFA 1P1FA 1GEEA 1O94A 1PEDA 3NT5A 4J0FA 2DPHA 2VRBA 1IULA 3FTNA 1P0CA 4CLOA 5L9AA 4YT2A 1H6BA 2X9GA 4QSMA 4XWYA 1Q1NA 5BNFA 3ZNPA 1GYRA 1PWXA 4NNJA 4BNLA 5F1PA 5T5QA 2BGLA 3JQ6A 4UUNA 1DHTA 1ZJYA 4Z9FA 3RJ5A 3A4VA 1O9BA 3JD1A 2DC1A 4D3SA 4D45A 4U6SA 4EITA 3AFMA 1PJCA 1SBYA 2X23A 3DL2A 3KXDA 4BNWA 4DYVA 4DXHA 4EUHA 4R1UA 1ISFA 4YYZA 4L8VA 3LF1A 4FC7A 4XB2A 1G0NA 5JW6A 5HM8A 4BS9A 3V2GA 2R00C 2O3QA 1I2ZA 1I32A 1P9LA 1PS0A 4RL6A 1UDCA 3WSWA 5I7EA 2Y68A 4E5KA 1PL6A 1Z7EA 4HX5A 1L7DA 4M55A 1ZK1A 4ZU3A 2HDHA 4HADA 1X13A 3X2EA 2NVUB 4G65A 4KTTE 4YR9A 3I4FA 4S1VA 4J1NA 2BGMA 2EJWA 3M2PA 3PGJA 1C1DB 2QRLA 3RBZA 1IHYA 3PK0A 3SJ7A 3ANLA 2CZCA 4J7XA 3MTGA 4WPGA 3GVXA 4O5OA 3GRPA 1RM0A 3Q9UA 1Q0LA 1CF2O 3I52A 1WAMA 2HK8A 1ZMOA 4JQCA 1D8AA 4LW8A 5IZCA 3BYZA 1EE2A 3ITKA 1T2EA 2FZWA 3BMCB 4FR5A 1ADBA 1EVIA 3GG9A 1ISGA 1Q7GA 2DUWA 4B3IA 5TJ9A 4IJUA 1PS9A 3FRJA 1U4OA 5G0WA 1NX6A 4FJ1A 3WIDA 3ONDA 3RC9A 5FFFA 3RIHA 3F9IA 1YH3A 3PQEA 1R4NB 4DLLA 2P9GA 1U5CA 2BH9A 3HE3A 4Q3AA 4FBGA 2V6GA 3GNQA 4NPCA 1MUUA 4M86A 1N1EA 2NU7A 3ETEA 4BNXA 4GMGA 3QLJA 3HG7A 4J4HA 2IZ0A 4XDZA 6ADHA 1CJCA 2I3GA 5KKAA 4ZVVA 4A5OA 1ZNQO 4DREA 2ZYAA 4CLHA 3F1KA 4RLSA 3OETA 5CDYA 3ZHXA 4IZIA 2Y99A 4CM9D 3LDHA 4J1QA 3P5SA 2QIOA 1FDWA 4NBWA 4KOAA 4M49A 4FJ0A 4MP6A 4AJEA 1X15A 3HDHA 1O89A 2OP1A 1HLDA 1KERA 1OFGA 5DBIA 3GN2A 5I7VA 1PU2A 2PZLA 1E6EA 2JHGA 4AJPA 4XRRA 4JBHA 1LDGA 3OIDA 1MC5A 3L9WA 4CQMD 2XAAA 1F8GA 1LEHA 1KIFA 2H6EA 2IXBA 1KEPA 4C7KA 3L6DA 2O4UX 3OHSX 4NH4A 3SLKA 2P9EA 2A9FA 2GDZA 4KTVE 4RLHA 1YBVA 5KTKA 1Q7CA 1QG6A 4ZQBA 1HDGO 5G0UA 3NGLA 3U49A 1Y8QA 3GGPA 2I76A 3KHUA 3RJ9A 3S2IA 5I7SA 2WYVA 3VPSA 4MVJI 4BO4A 3SC6A 1LDYA 2X6TA 2B5VA 1YE3A 1NR7A 2Y1EA 2W2KA 3PJFA 4PG8A 3LC2O 2IEBA 4QECA 1T1SA 4YACA 3N7UA 3S2EA 2J5QA 3PHJA 1LDNA 4W9NA 4XX0A 5EINA 3VVBA 2BI7A 2NWQA 3FBTA 2FPGA 4EJ0A 1NXQA 3JQ8A 4PG4A 4QFDA 3BMOA 4LSWA 4U8GA 3HDQA 4CMAA 1WZIA 1VM6A 3LC1O 1Y1PA 1M6HA 2W8ZA 3PTZA 3SLGA 1UZLA 3EW7A 1MA0A 1P1KA 3D3WA 2Q1SA 4BKRA 3WQRA 5HS6A 3QW2A 2EIHA 3QVTA 3VH2A 4R01A 1U7TA 2OL4A 4J4TA 4L4SA 1N2SA 4BO9A 3DR3A 1Z73A 5JBIA 3M2TA 1MXFA 4XEHA 4DGSA 3QVOA 1C0LA 3IQDB 3KSZO 4JBIA 3DOOA 2G76A 5U4QA 2WD7B 1DC3A 1E3JA 3NJ4A 3U4IA 3I4CA 5IAAA 4QFCA 1G1AA 2X9NA 2VNSA 4XB1A 3EC7A 1HDOA 2AQKA 5JAQA 3O38A 1W6UA 3W8DA 1A27A 1F14A 5F5LA 1GQYA 3RROA 5IN4A 2ET6A 2Y0EA 2ZQYA 1DFHA 4RPGA 1TA4A 4A26A 1A71A 1E1NA 4KUGA 2NSDA 3UKOA 5IDQA 4BO8A 3JV7A 1PGQA 2BMAA 1MV8A 1BXGB 3C8MA 4BQRA 1P0FA 4RPKA 1HE4A 3BTUA 3ONFA 3GPIA 1A4UA 2X4GA 4R3NA 4IDCA 4DTIA 4CL8A 1E1KA 3DAFA 1AGNA 2D5AA 1ID1A 4M89A 4I9HA 4Q3BA 3FTPA 2IZ1A 1ZSNA 3KVOA 3M6IA 3ST7A 1ORRA 3L6EA 4GQAA 1EVYA 1GAEO 2D4AA 1LRLA 4LVCA 1A7AA 2VN8A 3VZQA 1JKFA 4PN3A 3D0OA 2PGJA 1GCOA 2OP0A 4D79A 1MFPA 3H5RA 5B4TA 3K30A 5K0ZA 1DLIA 1XR3A 2AHRA 3FD8A 4ZA2A 3DWFA 3PWZA 5CDGA 1EUDA 4J16A 4LRSB 4MOWA 1T2FA 4R4JA 3BTVA 4BMNA 1TB4A 3PZBA 1B0AA 1WPQA 1LLDA 4INAA 3WGOA 1DHRA 3OQBA 5IZCC 1WP4A 3KYCA 1YS4A 2EP5A 2XXJA 3KEOA 4YJDA 1W4ZA 4RF3A 3WYEA 2DBZA 2OOSA 3D4NA 4W82A 3JCZA 5COQA 3V2UA 1IUKA 3KEQA 1TXGA 2IXAA 2UDPA 4MO2A 4ONEA 4RVDA 1JQBA 4YQYA 3QE3A 4CLXA 4X54A 4R9SA 4GLOA 3JQGA 2ZYGA 5KVCA 2VUSA 3K2BA 3EDMA 2HSDA 3PQDA 1WXDA 4CUKA 2EGHA 1J49A 3CE6A 3LZ6A 5JAIA 3ADPA 5JE8A 3VPFA 3RWBA 4FGSA 4FFNA 3E8XA 4PLFA 4DBVO 4F46A 1PX0A 5IDYA 1LXCA 3RAJA 3GC6A 1EK5A 2ZJ0A 3ASUA 3DOJA 3TZKA 4S3MA 1PJSA 3I5MA 4CODB 1LDBA 4RORA 1ENZA 4MVJP 4D41A 2VUTA 3L9XA 3W8EA 1I01A 3O8QB 4RZIA 2CSUA 4OOFA 1KVUA 3ZHZA 1K3TA 3ETDA 3H4VA 5JCJD 5A9TA 2GASA 5GZ3A 3HSKA 3H5AA 5JO0A 2UAGA 2PK3A 3FR8A 2VQ3A 4WCDA 1VL6A 2A92A 2JKVA 4EBFA 2ILTA 1KS9A 4IS2A 5LC1A 4MVJD 4TRMA 3DDNA 4BNVA 1YO6A 3ZNOA 5GZ1A 4YCAA 1EBFA 5KVVA 3LT0A 4PG6A 4W6ZA 3NUGA 3E03A 1IOLA 1ZJZA 2Y0CA 4H16A 3RUDA 1GUZA 3WX0A 2HLPA 3RC7A 4IDFA 3MCVA 3VH3A 5JDIA 3WB9A 4ZQGA 5EPOA 1TT7A 4WLFA 1UZMA 2Q45A 3W4IA 2PR2A 5ILGA 4EJ6A 1DRWA 1PSDA 4OAQA 3PLRA 4XQEA 3ANMA 1EVZA 2IZZA 3I9MA 1HDZA 3CMMA 4JBGA 1HDRA 3QY9A 3MJEA 1YONA 4E13A 4R51A 4CM6A 2FP4A 4MP8A 1P1HA 4E4YA 3SX2A 4W4TA 2Y1FA 3IUSA 5A3VA 1HETA 4U5QA 5JY6A 4HFNA 4F6CA 3MTJA 1LLQA 4W9NC 4BNZA 1PJLA 5IDWA 2P91A 2UUPA 2PZKA 1UXJA 3EY4A 1IY8A 2W2LD 5JXWA 5EQDA 4L9RA 3QWBA 5B12A 1T4DA 1IZ9A 5L7YA 4EEZA 3ZU5A 3VZPA 2YHIA 4WASA 1KYQA 4BO5A 3CZRA 3ICCA 1HE5A 4MKXA 5CPBA 1H6AA 3D7LA 3K6JA 3SC4A 2IRWA 1LNQA 4GAEA 5G4KB 1NHWA 2ZCUA 3BMNA 1E3SA 1R15A 4IY1A 4A2CA 4BNTA 4NMHA 5I9NA 4E30A 4NIMA 4NBRA 4BOYA 2VYVA 1ENYA 3HN2A 1E5QA 5A02A 4R16A 2BHLA 3KTDA 4JROA 1ZEJA 1JKJA 3QVSA 3BIOA 2H1SA 4YT4A 2NVUA 3VTFA 2QG4A 5T57A 2F00A 2X1HA 1PZFA 1DIGA 1EK6A 1MP0A 4BGUA 1VE9A 3CEAA 5TSDA 4BVAA 4DPKA 4AJ2A 4WNIA 5IFLA 3TSCA 2A4KA 5BR7A 1VSVA 3NTRA 1OAAA 4JP3A 3PQFA 4YRAA 4Y8VA 1GL3A 3HZZA 1SNYA 4AFNA 3D5QA 3OM9A 3WTCA 1CYDA 4RDHA 1YDWA 4B3HA 4L75A 2AE1A 4DUPA 3T7EA 3DBRB 2EKPA 2LDXA 3BMCA 1H6DA 1N7HA 2JJYA 1B8UA 3PFWO 4IJKA 4IDBA 3ROKA 1NQTA 4PLWA 2O2SA 4CM8A 1U7HA 2JCXA 3K96A 4BMSA 1BW9A 3B1JA 3DQPA 2R00A 3VPGA 3HDJA 3BXXA 1I3KA 2DUUA 3L0DA 4XR9A 2NTNA 3FBGA 4HFRA 4FPXA 3HUDA 1F0YA 1N9GB 5DCWA 4BNNA 2TMGA 1GQ2A 2AE2A 2DTXA 4ZRMA 3KYDA 2XPCA 2HJSA 4DLBA 4EI2A 3MOGA 5THQA 3WGHA 1ISJA 1WMAA 5JPIA 2QYSA 4BO6A 2CVZA 2Z1NA 1LU9A 4IUYA 1C0PA 2DQ4A 2X8LA 2YV3A 3FNGA 3RBVA 3GA0A 3DZJA 5THKA 1LI4A 4GI2A 4OOEA 3ZWBA 3F4BA 5ER9A 1QKIA 4L74A 4TRJA 2Y1OA 1GADO 3OBBA 1DRUA 3L77A 2PV7A 3GNSA 1V9LA 1Y5RA 1X1EA 4Z3DA 1PQPA 2OXIA 1DSSG 3L4SO 5KIAA 3AM4A 5DBFA 2E82A 4GGPA 4CV3A 4JIGA 2Z1MA 4W99A 5L40A 2OFPA 1ZKMA 4NJMB 1QMGA 2VZ0A 2CVOA 4BHTA 1HE2A 2ZB8A 2VHVA 1JAXA 3ITDA 4PRLA 3ORFA 1RYDA 1MB4A 3ONEA 5F5NA 2UVDA 4P38A 1CERA 4CV1A 1ISMA 1XLTA 3LSYA 2ZATA 3ZWXA 2C5AA 2O7SA 4UUOA 3FF4A 1YBAA 4I1IA 4JN6B 4RV9A 1XEAA 1HF3A 1SEPA 4R1SA 3ADOA 4I8XA 1E7SA 2PY6A 1TT5B 1LRJA 3QRWA 1FK8A 3DTTA 1HDYA 3E9MA 4OIMA 1NFQA 4PVCA 4J7UA 5DULA 1JA9A 2R6JA 4RF5A 1YRLA 2X7HA 1K5HA 2PA3A 4YAGA 1NM5A 4EGFA 3RKUA 2IE0A 4YEDA 5ENVA 4NFHA 3WLEA 4A7PA 1VLLA 2G5CA 2GGSA 3K92A 1R37A 4YDRA 2C54A 4WLUA 1ZH8A 4ILKA 5AQ1A 1ISIA 2ZCVA 2VRCA 4DC0A 4Q3EA 3UAGA 3CUKA 2C0CA 3KETA 1DIHA 1UXGA 3FHLA 3JQAA 5JDIC 4ROSA 4O59O 3QA9A 1V35A 4NG5A 5A05A 1F17A 1P44A 3GF4A 1HRDA 2EKQA 2NU8A 1I30A 2D5CA 5JAZA 3RD5A 2P4QA 2VZ9A 1NPYA 4CQLA 1Z6ZA 4WUVA 2X22A 2X5JO 4ZRNA 3BHMA 2GUGA 4UEOA 1HWYA 4RVHA 1E7QA 2CDBA 4DRYA 1A4IA 4E5PA 1QLJA 4LCEA 3FSRA 1XSEA 3DFZA 3G79A 3GMSA 3D5TA 1Q2XA 4RPJA 4E32A 2EHDA 4PFJA 5I8ZA 2D0IA 4IGFA 2CUKA 2RIRA 1BXZA 2AQHA 5K9ZA 1R4MB 1QSGA 3H8VA 4ALKA 1E3WB 3JYPA 3NV9A 2GR9A 3Q2IA 3AOEA 1R0LA 1PJBA 1UP6A 3PWKA 5IG2A 1OC4A 3F46A 1BXGA 1NBOA 5EN4A 2D8AA 3DXFA 5HTOA 4GX0A 1GY8A 1P77A 2Q50A 3AWDA 2Q49A 4ZQHA 1DAPA 3UGKA 3QHAA 3IOYA 2AEMA 3ENNA 4GGOA 4J3FA 3NKLA 1QORA 4F3YA 5C37A 1M2WA 1GPDG 3AY7A 4EUFA 4XQGA 1BDBA 2NVBA 3E9QA 5T6BA 4L76A 5BSFA 3JQ7B 4CQMB 4XJTA 4TKMA 3EGOA 1IPFA 4OMUA 4RPLA 3T4XA 2OORA 1DEHA 2HO5A 1DAOA 1QYDA 1LRKA 2YZ7A 4J43A 3OP4A 1JAYA 2I66A 1WLYA 4WLEA 3ZCXA 3CH6A 4IM7A 2RHRA 3JQCA 1GQQA 4I5FA 3U09A 5JFOA 4O0LA 4MPDA 3ZWWA 5ES3A 4CLRB 4OL9A 3RUCA 4RJTA 2WMDA 3WGZA 4NZ9A 2PD6A 2WE8A 4GSKA 4GVXA 2C5EA 5IN5A 7MDHA 5AOVA 4IZHA 3KZVA 3V8BA 3GAZA 2YJZA 2YYYA 4BO3A 4D42A 1IZ0A 2CMDA 3G0OA 5JY1A 4D3FA 3I9LA 1QV6A 3K73O 3SEFA 4DPMA 3CSDA 1MFZA 3DBHA 3VPHA 2GZ3A 3VDRA 2C2YA 4I9UA 5HRUA 2X5OA 3IKVA 4TZKA 2TMDA 2JFGA 1JWAB 4Y6PA 5LDHA 1UDBA 3S2FA 2X0IA 4GPD1 1X1TA 4PZDA 3IKTA 4J1SA 4OSOA 3TOXA 3T4EA 5IF3A 4J9UE 2Q4EA 3C3XA 4TQGA 2J5RA 5MGBA 4RQUA 2RCYA 1E3LA 3GT0A 1W73A 4GX1A 5I9MA 1PGOA 4UEKA 2B37A 2PKQP 5TS3A 2E49A 2ZB4A 4QO8A 4GBJA 3GEMA 3O8QA 1CETA 3PGXA 2Y66A 1D3AA 4Z3KA 3FNFA 1ZZEA 5DZSA 2WJPA 4RO0A 5L7WA 4BB6A 3P7MA 5I9LA 2EV9A 3PVZA 3E5RA 4EYEA 2JFFA 5A9RA 4AG3A 5JC1A 1Y7TA 4IIVA 3M1LA 4UAGA 3ZV5A 2BELA 3NGXA 3STHA 4ALMA 2C7GA 2ZTLA 3UVEA 4LMRA 4IS3A 1YGYA 3NTOA 5ADHA 4BKQA 3PFFA 1UAGA 5EL0A 2EWMA 2AXQA 3GUCA 3W6ZA 3I6QA 3LVFO 3L4BA 2JHFA 2YQ5A 4UVDA 3AW9A 4CM1A 1DIRA 2J3IA 4FFLA 2BD0A 4YJFB 1QP8A 3Q6IA 3AUTA 1VJ1A 4EZBA 4JJFA 3GVHA 4FFOA 1I5RA 3ZWPA 2AA3A 3GMDA 3VDQA 5G4LA 2C7VA 4LN1A 4ZICA 2Y1DA 4MVJM 1YBMA 4HY3A 4HV4A 4ND4A 1NYTA 2X0RA 3GZNB 1GV0A 3E6AA 4I08A 2BFPA 1CQIA 1QYCA 3HJAA 4KUHA 5HBRA 2FY8A 3IJPA 3OEWA 1B7GO 1JWBB 5KVQA 4CL3A 3OSUA 3A06A 2YHUA 3UICA 5L4NA 2UUOA 1YQGA 2G0TA 3PXXA 3DMTC 3WICA 2Y67A 3NT4A 3PHIA 3A14A 4XYEA 2POQX 2YV1A 4FQ8A 4HNHA 3EUWA 4AJNA 4D46A 1EFLA 4Q39A 2NTVA 1O0SA 2Q1WA 4D0RA 4YQZA 3F1LA 2HRBA 1ONPA 5HWSA 3ZI0A 1HTBA 3HWRA 1G0OA 4WCFB 3AJRA 2NACA 1LUAA 3TZCA 4K28A 1GTMA 4XYMA 3WWYA 1DC4A 2DU8A 3CKYA 5G4KA 5L53A 5TRTA 3QWAA 4ALLA 4II3A 4Y6RA 2Q2VA 5KCZA 4CM4B 3KB6A 1V3VA 1E1MA 2B4TO 3ON5A 1UXHA 5TT0A 1FJHA 2GZ1A 3OJFA 1SO8A 4GX2A 1U3WA 3WMXA 5COAA 3E48A 3AU8A 2WDZA 3JYLA 3UOGA 4OQZA 4WNCA 4YJHA 1VRWA 4NFYA 3JYQA 3B70A 1TLTA 2VHYA 1DOHA 3AOEC 4J91A 3VH1A 4NI5A 3QVWA 4J6FA 4TKLA 2DTEA 2YV2A 4G5HA 2G1UA 3WJ7A 1JN0A 1QXSA 3F4LA 3VPXA 3INRA 3C7CB 5CG2A 3TL3A 3GOHA 4RF4A 2PNFA 1X0VA 1YDEA 3H65A 1BWSA 4H15A 1EFKA 4WE3A 3VTZA 1E77A 1LSUA 5AXCA 5ICSA 3N74A 4CUZA 3CINA 2BGKA 1LSSA 3KV3O 3LC7O 3U4DA 1C14A 3JD2A 2V6FA 4CR8A 4OKNA 4HFJA 1N9GA 4BB5A 1V0JA 2BFOA 3HN7A 3F3SA 4J1TA 4OKIA 3ZW9A 1T2CA 1C1XB 3GEDA 4TWRA 4JCOA 5FYDA 1VI2A 4Z0HO 4QQRA 1GPJA 4R41A 1PWZA 1I3NA 2ZTUA 4HBGA 4FDAA 1HT0A 1PJ2A 4RCVA 3SXPA 4B4WA 4N5LA 4HXYA 2PZMA 4Z0TA 4N5NA 4CV2A 3HFSA 3PJDA 5A3JA 2EXXA 3ABIA 3IC5A 4K1LA 2P5UA 3PJEA 3ZNQA 1AUPA 3QVXA 2P5YA 3D4PA 4WOJA 5DOVA 2I67A 2RH4A 3C7AA 4ALNA 4BGVA 3ASVA 3EZYA 4R1NA 3EHEA 4HUJA 5JCXA 3V2HA 1LTHR 4B4VA 4M87A 4OQYA 1NVTA 3E1KA 3TF5A 3INTA 4P22A 1XQ1A 1YOVB 1PQUA 4YWJA 4Z6KA 3GLQA 1CIVA 1ZSYA 3OA2A 5G0TA 3O26A 2NADA 2OGUA 2YY7A 4J2HA 3WOHA 2W98A 1PL8A 4DYDA 1N5DA 1E3IA 2I5PO 2J3KA 1PJ4A 3X2FA 1IB6A 2NLOA 4NJMA 4CMIB 1M6WA 1UXIA 4MVJH 3Q1LA 2WEKA 4AJ4A 4CLEA 2H5LA 1YVEI 2Z95A 3MEQA 3DZGA 3OH8A 4HKTA 3H9JA 1N8KA 2JD1A 1YL7A 2B36A 3Q11A 5JSFA 3PP8A 1DFGA 1MLDA 3U4HA 2E6UX 5GY7A 4D3DA 4JNKA 4GWKA 3LT2A 2WWRA 3P2OA 3PEFA 1K6XA 1U9JA 2YUTA 4BNUA 1HZZA 4MDHA 3NDRA 5I8WA 3H9EO 1VPDA 1EQ2A 1XIVA 2J5KA 4UULA 1LQUA 4BQPA 3RC2A 1YQDA 4OO3A 3WDSA 4F45A 2IDZA 5COBA 2DBQA 2P9CA 3CXRA 3PZRA 5DCYA 4E33A 3WFJA 1DIBA 5T8KA 2VT3A 3NEPX 2J3HA 3K8ZA 1NPDA 1NWHA 2VTEA 5BQFA 2Q1UA 1Y8RB 3UCFA 1WVGA 3H9UA 3L4BC 4ZN6A 4XIYA 1HDXA 1I36A 2RH8A 4ID9A 2VUUA 1HE3A 4EDFA 5HS4A 1QRRA 3IP3A 4FFRA 4MIYA 1DPGA 3A9WA 1EUZA 1K0UA 4R1TA 3ZN2A 2OBYA 4BIIA 1B15A 1K89A 2HCTA 2YFQA 1PZGA 4HWKA 4WEOA 2B35A 2PD3A 4WK6A 1A72A 2WTBA 1WZEA 4YB8A 4Z9XA 2R2GA 5KOIA 3WGTA 4IQ0A 2O2YA 2GPTA 5KKCA 1BMDA 4RVGA 3OECA 1EVJA 1XGKA 3TN7A 2X9VA 2PGDA 4JXKA 4AJIA 4NR0A 3RU9A 1LDMA 3D4OA 3EK2A 1Y6JA 2VRCD 3FNHA 4BGIA 4E3ZA 1NQOA 5T64A 3DC2A 3HFGA 2HUNA 3KRTA 3JQAD 3COSA 3WYBA 1E3WA 1U2DA 2NVWA 4FC6A 4DBZA 1E6UA 4E0BA 4ND2A 2Q1TA 1BXKA 1NVGA 4FOOA 3VKUA 2VHWA 5G0VA 3IL2A 4CM9A 2DVMA 3GG2A 2JD2A 1FDSA 1E7RA 3BA1A 4HFMA 5B37A 3GGOA 4BNIA 1E1LA 2FPIA 4UVHA 4E2XA 1EUCA 4R5MA 3GFBA 4QTZA 2EJVA 2C07A 1HYGA 2F1KA 1LJ8A 2VOJA 1WDLA 2VHXA 3QV1A 1KVQA 4BO7A 1WW8A 1U1IA 3C24A 3NJ8A 1F12A 4JJGA 5J23A 1LC0A 3JQ7A 3KLPX 3NRCA 4CQMA 4PGFA 4DA9A 1YB4A 2PTGA 1SC6A 1RJWA 4OGWA 4PIVA 3H3JA 1KC1A 5TT1A 3IS3A 2AEJA 1YJ8A 4DQUA 3OF2A 3KO8A 1YJQA 5TGDA 4AJJA 2YDXA 4E12A 3RQSA 1UH5A 3RC1A 5TF4A 3VHRA 3P19A 4LISA 5IDXA 4ESOA 3LT4A 4PLGA 3TZQA 4LSMA 5I7FA 1MG0A 1I2BA 3DB2A 1LQTA 4O6VA 5C7OO 3VC7A 2NNLD 1GV1A 3LLVA 4QX6A 4LRTB 5DOZA 4GWGA 1I8TA 1XYGA 3W4KA 4CM5A 4XR4A 1O8CA 3PHHA 5B4VA 2LDBA 3JD0A 4NJOA 4BNKA 2H9IA 3MJCA 3S2GA 8LDHA 5LCXA 3PYLA 4UVIA 3EVTA 5JDCC 1Y8QB 4BNJA 1L7EA 3PYXA 1C1DA 4D7AA 5CP8A 3R3JA 4RPHA 2VNAA 1CEQA 4MP3A 2WM3A 2FOIA 4PLZA 1ZW1A 1E92A 5EESA 1JVSA 5F3RA 3ZHBA 3PHLA 4O63O 3VZSA 2DLDA 3RU7A 4CMEA 4YT5A 1PQWA 3LQFA 3IDSA 4TRRA 5ILOA 5FEUA 3G1TA 1PGJA 4KDFA 2X0JA 5L51A 1HSZA 3ZH2A 4U0KA 3INGA 1SOVA 1KEVA 3ZDFA 3AUAA 5CFZA 1YWGO 2UYYA 1RWBA 1B16A 3DZFA 3WFIA 4TMFA 1DLJA 4EW6A 3IAHA 1LBEA 2QZZA 1VL0A 3I1JA 3I83A 4R3WA 3JQ8B 3BMQB 3UF0A 3UH1A 3BMOB 4LK3A 2PGLA 3WQQA 2B5WA 3MJSA 4AJOA 4FIZA 1R4NA 1UR5A 1G6KA 1BGVA 5BSGA 3GDOA 4WLNA 4OXYA 3L6OO 3PJGA 1EE9A 4RVUA 2HMUA 2QYTA 2O4CA 3FCOA 3HB5X 2B4RO 1Z82A 4R9RA 4EEXA 2NV6A 1M67A 1MX3A 2IYPA 9LDBA 3TQHA 3TZ6A 4IXTA 3VOSA 5F1KA 3U62A 4OXNA 4NBVA 3AY3A 1SEVA 3DTYA 3Q0EA 3ROPA 2X86A 2X5KO 3Q2KA 4IINA 4Y98A 5AYVA 1LDEA 2VT2A 4KP7A 3PHGA 1P3DA 4C4OA 1B26A 1ZXLA 4KWHA 4BKOA 4GSLA 4D0SA 1H94A 4CMGA 2GLXA 2PWZA 1DJQA 4BO0A 1B3RA 1GUYA 5T8KC 3WGIA 1XDWA 3H2SA 4M54A 1B8PA 1BDMA 4B7UA 1PIWA 1YL5A 2HMVA 4BV8A 3PI7A 1XCBA 4BNHA 3PWSA 4E5MA 3PDJA 4RGBA 5LDGA 2SCUA 4BNFA 2BLLA 3QJ5A 3K9QO 3U5TA 1PZHA 2NU6A 3JQ9C 3RUHA 2OBNA 3C85A 4P4NA 4WCFA 4CR6A 3ETGA 2VZ8A 3ZWMA 1NR1A 4IQ8A 3F6YA 3H6KA 2QRJA 5H82A 1O5IA 4DIBA 4YAIA 4PCVA 3BTSA 3CPSA 5CDTA 7ADHA 3KM0A 2GD1O 3PIIA 4Q9NA 1VKNA 4XDYA 1GFSA 1ZBQA 3NDIA 3I9OA 3G17A 5DF1A 4YJGB 5CAEA 2GNAA 4CM4A 3H9GA 3BAZA 4MVJE 4OH1A 3RKRA 4EUEA 4E5NA 3OQ6A 1U3TA 3T7CA 4MVJF 1EMDA 5CEFA 1I10A 1T25A 3AUSA 1J6UA 3IP1A 5B4UA 1HEUA 4FB5A 3AUUA 1DXYA 5JYDA 1SOWA 3JYNA 4MVJG 1NFFA 3DMTA 3UFXA 3WBFA 2VWQA 3H2ZA 5DBGA 3PYMA 2EEZA 4A10A 2C29D 5KJ6A 1LSOA 5AXAA 1D4FA 3QSGA 4AICA 3ZWAA 3GK3A 2GZ2A 3WBBA 3ZZNA 1H6CA 1T4BA 1XKQA 3W8FA 3PDUA 1C0IA 1X7GA 2DFVA 3WXBA 4BV9A 5L45A 1NVMB 3F5SA 5L7TA 4FW8A 5CDSA 3DHYA 4J90A 3DFUA 1PJTA 1HKUA 1M75A 2WD7A 4UEJA 1C0KA 3WQSB 4IQGA 3I3OA 1ADCA 1WDKA 3ROMA 3TOZA 3RCBA 2PH3A 1C1XA 1JVBA 4ZHSA 3MJ4A 2NQTA 2ZQZA 5C3MA 2GN8A 3UUWA 3H7AA 3WS7A 1KVSA 3N58A 3ROQA 5G2OA 1T24A 3GH3A 3GQVA 1ZSVA 1E6WA 2VWHA 4NFSA 1A9YA 3H9QA 1KBZA 4P4LA 4BNYA 4CV0A 3W4JA 1DB3A 3GHYA 5K6AA 2GF2A 4UUPA 4XGKA 1UDAA 3W6UA 1WMBA 4QXMA 4PLCA 3WSVA 3UXYA 5T67A 4D44A 3RVDA 1KETA 3WIEA 4B8WA 1YOVA 4YRBA 1GZ3A 1Z7BA 4KQXA 1W8DA 4J7CA 3WTBA 3UCXA 4ND1A 3WJAA 3OMLA 2AW5A 1OBFO 4FN4A 2B83A 1U3VA 2DKNA 2JAPA 1JKIA 3DAPA 2RAFA 1JW9B 1UP4A 3QWHA 9LDTA 5U9CA 2JCVA 1FXSA 3ZW8A 5ITVA 2WE7A 4XYGA 3LLSA 4FGWA 1AN9A 1EEHA 3JQBA 1O95A 2FSVA 3JD3A 2GYYA 1IYZA 5KJ1A 1B14A 1PZEA 1D7OA 4CMEC 2OMEA 5AVOA 1QR6A 4FFMA 2FZEA 2DT5A 3GDFA 3AM5A 4ITUA 3B6ZA 4EJMA 1BVRA 3Q3CA 3HDYA 4QT0A 2ZYDA 1HZJA 2Q4BA 4LVUA 5DP2A 2VCYA 1ZO8A 4B7CA 1Q7BA 3IJRA 4M8SA 3K31A 1GYQA 1KY5A 3NAQA 4DQXA 4NU6A 3UCEA 1XG5A 3B20A 3BTOA 4U0JA 1F8FA 4PVDA 4N5MA 1OC2A 2YHIB 5CEEA 1ONNA 2B69A 4N18A 1Y8RA 4YRDA 4FD3A 3W1VA 2FMUA 3QQPA 4I5GA 4GLLA 3ZU4A 4E21A 3EMKA 1OZAA 1N1GA 3BMNB 3OJEA 1ZCJA 4FCCA 5DN9A 5TX7A 2WYUA 4FSHA 2DBRA 1DDOA 4R68A 2P4HX 2P2SA 1NQAO 2Y05A 2PD4A 3NDJA 4J9VA 4BUCA 1KEUA 3QP9A 3HNPA 2QQ5A 2X58A 2CNBA 4M1QA 1QYVA 2GN9A 3DBLB 2XF8A 1B2LA 1XWFA 1GCUA 2JCYA 5KJFA 4J4BA 4BKUA 3D1LA 2I99A 4YT8A 1Y9EA 2FR8A 5H81A 3RI3A 5U1PA 5EERA 1FDTA 4UREA 3WYCA 3L07A 1Y9AA 1TVEA 5JNLA 4IDAA 3C1OA 1P1JA 2EG9A 4I5EA 5MDHA 4BNMA 4Q3CA 2BFAA 3ZWCA 1PS8A 3LU1A 3D64A 1ZK2A 2CY0A 1P1IA 1EBUA 1X14A 4PZCA 1DFIA 5FI5A 4PLPA 2ZB7A 3OJ0A 2YFHA 2CDAA 5DDIP 4CLDA 4CUJA 3GVPA 2NTJA 3G1UA 3I9NA 4D43A 4JGBA 5FF9A 2RBEA 2AEFA 3NYWA 2HMWA 1BTOA 3E9NA 4WCFC 4CM8B 1BW9B 2V65A 3C1TA 4GX5A 4WLOA 4XCVA 3KUXA 2CF5A 1GU7A 4WEQA 3RASA 1RM3A 1R0SA 3H3FA 4L4XA 4ZD6A 2PH5A 3MOIA 4IXWA 2D3TA 3V1TC 4E31A 1BSVA 1YB1A 1S6YA 1TI7A 4PLHA 1FF9A 3WNQA 1PJQA 2J8ZA 1Z75A 4WOKA 2C20A 3KYDB 5CDUA 4R5HA 1NAHA 5L95A 1GYPA 5BNIA 4JK3A 1XQ6A 1Z45A 1Y5MA 3DZBA 4PLTA 4L73A 1JDJA 5BSEA 3AI2A 3P2YA 1I2CA 1K6IA 5A4DA 1E5LA 5TJHA 3CTMA 4CMHA 5CEJA 3R1IA 1GDHA 3TL2A 2FR1A 4B8ZA 1N92A 2NU9A 2JAHA 4Y67A 3EAGA 1CQJA 4XQ9A 2BFMA 4XRGA 3DHEA 2JFHA 1JTVA 3I6IA 1J0XO 3NX4A 4ND5A 3ANNA 4GL4A 4IJWA 4H7PA 1NWCA 3KYBA 2J6IA 4N7RA 3PLNA 2V6BA 3VAZA 1I0ZA 4P4GA 2OUIA 5IXSA 4U7WA 3PIDA 4J49A 1E7MA 5FI3A 4XIJA 5BT9A 2G17A 4AJKA 2NM0A 1RM4A 3KOUA 2QX7A 2GN4A 3ZWYA 1VJTA 4BO2A 2Q2QA 5TNXA 2JL1A 5KVSA 3DBVO 4HP8A 4KDEA 2O3TA 1ARZA 2IYOA 4B4OA 2C2XA 4ALJA 4E2WA 5EIOA 4RDIA 2VTDA 1E7WA 1KEWA 3LK7A 4AVYA 5H83A 2VYNA 2PKRA 5DT9A 5AXBA 4YAKA 5K6AC 1QYXA 3K5PA 4TVBA 3HHPA 3GHHA 3IUPA 4JX8A 1ZXBA 4QUKA 1IL0A 3AFNA 3DBRA 3CMCO 2O3JA 2AQ8A 5EMHA 5AXDA 1YQXA 1CRWG 4II2A 3U9LA 2VYVD 3R3SA 1T2DA 1HDCA 5TIIA 5GZ6A 5JO9A 4AJLA 1Q0HA 1T1RA 3BMQA 1B8VA 1BG6A 2D1YA 1H9BA 2VHZA 4PG7A 2A35A
chains in the Genus database with same CATH superfamily
3R7BA 4RCYA 3IUBA 2X1VA 2H2IA 2W42A 1QRSA 3FWNA 1ENOA 5BSWA 2PKWA 3JQAB 1XPUA 2AZ4A 2HX1A 1DQRA 1KGSA 5KQGA 1B76A 1UMKA 3D8HA 5I4KA 5JAOA 5LVAA 2OZPA 2VWPA 4AS3A 2NU8B 3REFA 4QARA 4AO8A 1FQKA 4AW9A 3JQBC 4DLXA 1O95C 2C82A 3QKSB 3JTMA 4KO4S 3EJWA 1NMQA 4ZOLA 1A2QA 1L5HB 3TPCA 4R7GA 1ZK3A 1CLEA 3KOMA 4W8GA 3PDIA 1DC6A 5CJ2A 3QMPA 3X1MA 4KX3A 1U0JA 3GJTA 2OHXA 5YASA 5ADUS 3D6NB 4J2TA 4RTRA 1EA5A 1ZK4A 2QN8A 3EFOA 1MG5A 1GFZA 2PKQO 3DEKA 5IJ0A 1L5LA 3I9V1 1AHPA 3SEAA 2GH1A 4PR0A 1FP6A 2FQ1A 2GCGA 2GF0A 3A2LA 3G5TA 4ZVMA 5T4BA 1Y1TA 3ELUA 2EQBA 2SNIE 3D8TA 1ZUIA 3KJIA 4PZEA 2P67A 4HQRA 2Y93A 2P68A 3HVHA 4IDDA 1GR0A 2AFHB 2YW9A 3AOGA 1XDZA 3JQFA 1WE2A 3L43A 5F64A 3U3OA 4B3JA 3BXFA 5C5IA 3G5MA 3CLSD 4RD3A 1YS1X 3RTAA 2CFOA 1VCHA 1HLPA 3BH6A 3KPWA 3BGDA 4LGVA 3SYNA 3WKDA 1B6TA 4RQTA 4JASB 4O2LA 2ZTMA 3UBTA 1ENPA 1YS2X 2R48A 4IMIB 1U2PA 3LWDA 4MV7A 2NO6A 1MJ5A 3NVDA 4Q1FA 5E6UB 2G4VA 5IJZA 1KDRA 2IBTA 1NQ5A 1E9RA 2V7TA 1AHIA 1EZ4A 5DE3A 5JCZA 3HQ4O 2FWIA 4MW5A 3I9KA 2ZWMA 1OLUB 3T6KA 2E85A 5LLTA 1U4SA 2I4IA 1YR9A 3RS9A 4KZPA 4NZPA 1F06A 3ZCQA 2ZJ5A 4J2OA 1GLGA 2VWGA 1AS2A 2ZLBA 1VE1A 1R6UA 4Y9DA 4GLBA 3RSZA 3ZV4A 4ZI7A 3FW1A 5I6DA 4JFAA 4QGSA 5BPFA 1RQ2A 5B2ZA 4O4LA 3NHKA 1XMVA 2BGUA 4LG1A 4UVGA 2O19A 2C59A 3WGQA 2ZB3A 5L6MB 5CFNA 3K09A 2HU2A 3E0XA 1EP1B 2BFWA 2XUOA 3OQ1A 1E2EA 4HDRB 5CDFA 4K9DA 4ZC1A 2IHYA 3KSMA 1PK8A 3WGGA 1Q0ZA 2A57A 4P8RA 4OHYA 5A06A 5L3QA 1YJBA 5G1OA 4ND7A 5EJ2A 5JWHA 1UMDB 1QFSA 3IJEB 4XQCA 3KUUA 3UB3A 1GQSA 1UUFA 4F12A 1CUBA 4KGDA 3NXKA 3VDMA 1C7JA 1XVLA 4GI7A 1LTQA 2OE2A 4B40A 3DGFC 3HV0A 5J58A 1E9AA 4G5QA 1E4YA 4G01B 2BH2A 3FNEA 3OICA 4MX8A 3OZXA 3JQ9A 4QHSA 4C6SA 3EQ7A 3FR7A 2G4CA 2NN3C 1VXOA 1D2MA 4L27A 4MJLA 4Q9DA 5EHGA 2XUHA 3KOYA 3B7PA 1PNVA 3GCZA 3OLQA 3HRKA 2I6SA 4P5DA 2HSJA 5CVVA 3SF8A 4AY5A 1H2HA 1I3LA 2ZITA 4MV3A 1D7AA 3V1KA 4EGQA 1FPMA 2ZXFA 4JI7B 2FSSA 3M1AA 4L08A 3LCRA 5FUWA 2ZRIA 3EZLA 1LLCA 3QYAA 2H06A 2YWBA 4ZK2A 3MINB 3PC2A 2JGFA 3P71T 4TROA 3OLXA 4JP2A 3H0EA 3WWZA 2RHTA 1LVUA 4IOKA 5KTMA 2XMZA 1BVUA 2O2GA 2P1RA 1WW2A 2HRZA 3FWYA 3IVGA 1P18A 4Q47A 4X1KA 5LIPA 4XB6B 1QP0A 2PKCA 1G291 2VBIA 4QAJA 2DPGA 1JLMA 2BBSA 4XZ3A 5E6SB 1F38A 1R4MA 1RXEA 1RDFA 1YQ9A 3GEGA 4QBIA 4TZTA 4P4SA 5LQKA 4UCFA 4NU5A 3QV2A 2WT4A 3L02A 4KSBA 5JANA 1QF9A 1EDZA 3M6VA 1GSIA 1N6LA 3RH0A 3PUKA 4WSOA 2P35A 2E0IA 3HBNA 3VZSA 2CXNA 4KB5A 4MKRA 5KYWA 4O2BF 2O6LA 1MA3A 2R44A 3VZRA 3S1SA 1THTA 3B3QA 2RHCA 2AKAB 4M8KA 2I6QA 2QD3A 4QBHA 1P31A 1OMOA 3BJEA 4IIUA 2Q99A 4XKJA 4X61A 4TM7A 4YJ3B 5E1MA 5EVCA 3EY9A 3WFZA 2W2MA 1YDHA 3O9ZA 5AM2A 1DIAA 621PA 1DBSA 1QO0A 4FOPA 4WZAB 2IH2A 3E18A 1Z6QA 3LC0A 5A04A 3OTWA 4BBJA 1RWOA 3GDGA 1QHXA 1VYUA 4GYKA 3L3BA 3OLWA 4NCXA 5AKXA 1KTVA 3USCS 1LX6A 1U8EA 2YIMA 3TRKA 3PPIA 4PG5A 5CTJA 4KCGA 1BS2A 5EI5A 1SU6A 3DV2A 2DQZA 1EE1A 4A0SA 1C9NA 1GZ5A 1NJ2A 4KVAA 4EKGA 1TEHA 3OQOA 2Y2VA 3VBEA 3SZLA 4PNEA 3TGPA 2P78A 2R1TA 3QVVA 3WGYA 1ONSA 3P2KA 4B3FX 1YB6A 1CQIB 4CLRA 1FYEA 3BXEA 3GROA 4X9XA 5HDQA 4O2BA 2GHIA 3TX6A 5KOJB 1PJZA 4NG4A 5AJTA 4BE7B 1KI7A 2B4YA 4DV7B 3FDZA 3LDAA 1WJGA 1YJCA 2OO5A 4YGXB 3UJHA 3VGJA 4BO1A 4BNGA 3L7OA 3A6ZA 2FETA 4BAGA 3U3XA 1TF7A 1NUSA 2FQWA 1Z0ZA 2BI4A 2WYHA 3B1FA 3P45A 2B6HA 4RDCA 3LXMA 5KJEA 1FDVA 4EL5A 2VSFA 4ZVPA 3GGGA 1X1AA 4OSPA 2WU3A 4KE7A 2Z8YM 1ZI6A 1D2NA 1SIUA 4KMSA 3ZXSA 2RGYA 3P32A 4OHMA 4BKPA 4JSTA 1RKXA 1SQFA 4FOTA 8AT1A 4LYYA 2BMJA 1S5PA 2BF7A 2EJTA 3AEQB 3F9IA 3G7NA 3R23A 1E6MA 2YJ4A 4IMRA 4X60A 1X1CA 2HEIA 3L4EA 2XTZA 3LRPA 3A1NA 4GZLA 4KWEA 4GXQA 5FWXB 1SRQA 4WK0B 1NI3A 3C8DA 5JQWA 2HK9A 1NDHA 3MWEB 3HFJA 3TCXB 3RYTC 1LC3A 3RGGA 2O7QA 1GUBA 4GR9A 3WHKA 3CVUA 2SKCA 2ASVA 2DJIA 2FN7A 2JFPA 3JZFA 2QS9A 1CXZA 3OWOA 1SG6A 2OGSA 3KZ1E 4FGUA 4YS6A 1EGVB 3ZGNA 4CPDA 4XD2A 3WKBA 4JLOA 3AESA 3VYSB 3KSUA 3BL8A 2RHMA 5CG1A 1TECE 1CDOA 4CM7A 2YN4A 3QBTA 2YWDA 2W2KB 3K0KA 2BZGA 2O3RA 2XGMA 3DBLA 4KHZA 4Q02A 1NONA 3SXUA 4CEIA 4HJRA 3RTGA 3PE3A 1SJ9A 5DO9A 2HAEA 4U02A 4ZOQI 1QF6A 7MHTA 5EP1A 1ZVVA 4V3BA 2BTQA 2NZ2A 1M2HA 4XX0B 1P33A 1M7GA 3FDIA 3FI0A 4H2DA 1IHXA 1P74A 1Q95A 3MC1A 3OZUA 3JQFC 4I55B 4YJHB 1HQYE 3ZU2A 4P0QB 3EXG1 4P7KA 1VKOA 4A15A 2ZG6A 3IBGA 2WWYA 1BXRB 2XCSB 1YA8A 1UXKA 3HM9A 5DVZA 3KBOA 2HJRA 2A9VA 1K7SN 2XCTB 1QPZA 1S7CA 2BI8A 3PITA 3PRJA 2PJZA 2BKAA 5ALQA 2ECFA 2OHOA 3T3MB 2CC2A 3EMDA 1Q0TA 1UM8A 4KO2S 3DZDA 3EWNA 4HNRA 2HQ1A 1OVMA 3UTCA 1HYBA 3PKIA 3SYTA 5J2TB 4OXKA 4UUQA 1UM9A 1JKXA 4DMMA 2VSQA 2G3YA 2WFLB 2I33A 4IHKA 2FWNA 1EFPB 2YXBA 3BXOA 2FZLA 3ET4A 2X4IA 4RKEA 2A33A 3T94A 1I2MA 3MFQA 3VPCA 1G17A 3AI3A 2CLIB 3QTLA 1ACLA 1P39A 3IX7A 5IWCA 1GEGA 1VHLA 3P9NA 4XGQA 3R3WA 2V7QA 1Y4SA 2O8FA 1Z28A 4NMLA 3OJOA 5F9FA 1PR3A 2JI4A 3TLGA 3D5EA 2O3SA 3VKFA 2XVZA 4DWVA 3GNTA 4PLVA 3X1XA 4PZ9A 3K09C 3FZEA 2MCFA 5LL6P 3U7QB 5JMWA 4TYWA 2TSYB 1GNRA 4J16C 2FQYA 1ZC4A 1V7ZA 4RESA 3RG8A 5JYEA 2GS9A 3ZTTA 4NXMB 2WU1A 3CW8X 4RTJA 3ILSA 3CT4A 3PX2A 3JWPA 1GPWB 1TQ8A 5DP1A 1T3SA 2QTTA 4EIWA 4CTMA 4MQFB 1XTQA 3PC8A 1AOXA 4MB2A 3TFWA 5JNTA 3GQBB 1Y4DE 3Q3HA 1K8YB 4DR5B 1SXJD 5AKKA 1XDGA 1Y81A 1Q7RA 4BX3A 2NO9A 2ZYTX 2B0JA 2LPMA 1A5ZA 2OM6A 4IF4A 4OBXA 4B0OA 2O57A 3S29A 4CN9A 5AVRA 2ZIXB 5I9SA 4FOSA 1A1VA 3ET5A 3FNRA 3QFSA 5I7AA 4EELA 1TU4A 4TTRA 5J5VA 1XF9A 4G9BA 3SKXA 4QGFA 2BKXA 4OQPA 3C48A 4HLNA 3IR5A 4TSKA 5TGZA 2X42A 3FOCA 3GLIE 1RJFA 2W4MA 4I4CA 4IRUB 3I1FA 4G0OA 4ZO7A 3VU9B 2QRKA 1L5MA 5FFNA 2IV7A 2FDCA 4RZXA 4EUSA 2PXHA 4V0OA 4AU1A 1X9IA 1XAIA 4ZYVA 821PA 1TIKA 1WEHA 3QF4A 2YBEA 5BN4B 3I28A 5B2EA 1VC2A 2AR7A 3VV2A 3I9FA 4G2NA 1EUDB 1ISSA 2JLYA 1WCV1 4OJKA 2CV1A 2X2FA 3IB6A 1A9ZA 3RTDA 4M1SA 2P2NA 3Q9SA 3IUMA 4Q1VA 3VUEA 4D9EA 3CRNA 1QZUA 4QBTA 5IF9A 2PMCA 2Q3BA 2WC1A 5LZ5A 3PGMA 3W6PA 4ZAVA 2DETA 4HQOA 1N5MA 3VZDA 1ZVMA 4TL7A 2FOXA 3TZHA 3CEMA 5JHHB 5CURA 2BFBB 5JAMA 3W2IA 4MR8B 1WWKA 2PRSA 3QJGA 3WL8A 1ZRNA 1G20E 3CEHA 4A27A 4OJNA 1CG6A 2I9PA 2YHBA 3RU3A 3TJRA 2RH5A 3G8DA 1H2FA 3IUQA 1NW5A 5EPEA 4C4AA 3JALB 2C9BA 3LSTA 3O75A 3V33A 3TE6A 1F2TB 3IAAA 1AS3A 1SZDA 3FWZA 1ANKA 2LCFA 2EW2A 2PFGA 2EBHX 2MYTA 1ULUA 2VJYA 2XMQA 3RTBA 3UHAA 4FD2A 3F5MA 3A6DA 3IHLA 3NP7A 1GZ6A 5EJ8A 1AO0A 4LFCB 5A03A 3C7TA 1X0XA 3RO7A 5HZHA 1T8TA 3ND7A 3QXSA 4NBTA 1CUEA 1G5QA 2XQKA 3F5FA 2ZWVA 3IDFA 4O3FA 3UA3A 4F4DA 1YZYA 2CN1A 2XYGA 1NG9A 5SY6A 4MIEA 1CVLA 1D6MA 3S55A 4TTVA 3MFYA 1XTIA 2BSAA 4WECA 4KH1A 5I3CA 2VOEA 1LD3A 5BQ5A 4BU1A 5LR6A 4JYZA 3IAS6 2HL6A 1T6YA 2ZIGA 2WWGA 4LXQA 3QIVA 4O08A 3S1AA 1OOEA 1RFLA 5ALHA 9MHTA 5JXHA 1SVKA 1F4PA 4CMBA 3R3UA 4P7FA 5EJIA 4A2WA 1RKQA 3NYRA 4D9KA 4AX8A 5K6RA 2O2JA 2XE8A 5KJCA 1PGNA 4M0CA 1IAVA 3SMVA 5LJIA 1X7DA 2OO5C 2I6FA 2QU8A 1GPBA 2KLHA 3DA8A 4LE1A 3DNMA 1Z39A 2FF7A 2QZ9A 3OEEA 3Q40A 1KJWA 3CVXA 3AV0B 4RKRA 3EDQA 1UP7A 1FVOA 3EVGA 4BEBA 2Q3LA 3WLKX 3WYDA 5JPCA 5A0TA 5E7MA 4ALIA 3DP9A 2AMVA 3BFKA 5IC4A 5J1SB 1M3SA 3UAXA 4A16A 1K2WA 4KPGA 4IIJB 1ZM2A 4BCDA 1QQBA 3L8YA 1DX9A 1G1MA 2ZKIA 5TC4A 2WSBA 1CYEA 3NT2A 2FUEA 2W2LA 2OO3A 2MDTA 2VDWA 3H2GA 4E5YA 3JY6A 2NSJA 3QQ5A 1W5BA 2C88A 2Q46A 3U0BA 2PUDA 1NI4A 2PUVA 1CR1A 1NXVA 4G0ZA 4ZDJA 4WKPA 3IJ5A 3HSSA 8ADHA 3KX2A 3UXHA 1VJ0A 1P0PA 1MBZA 2QM8A 4GEKA 1JHRA 2QN2A 2DF8A 3O4FA 1PEDA 1GEEA 1O94A 3K6RA 3NT5A 2I2XB 2V1XA 3JZAA 2DPHA 5AJUA 3GUZA 1M83A 3FTNA 1P0CA 4MW9A 4RMNA 2XGSA 3FGZA 4P98A 4CLOA 3HTXA 1RNLA 1JHDA 2QM3A 4Y2JA 3X1WA 2ZJ6A 3RFVA 1L4FA 5BORA 5CFMA 2QY6A 4CKZA 3C3JA 3HU1A 3DL7A 2QQEA 4MYTA 3ZNPA 4LF8B 1OXVA 1GYRA 1QIFA 4Y2YA 2AR0A 4BNLA 1CY4A 1I7QB 1UJ6A 1RAIA 1ESNA 5B1HA 4OX9B 1VXRA 4Z9FA 1WB5A 3GRAA 1V6CA 2HDOA 4DCCA 1KAQA 3BSFA 2XECA 3H16A 1L8AA 1A8UA 3V7WA 1M1UA 4PXYA 2H7VA 1UBCA 4M0FA 3AFMA 1SBYA 2HEGA 3KIPA 4DXHA 1K06A 5F9MA 4HVCA 2QD5A 4X7RA 1SBZA 1W1UA 4L22A 5DTRA 3LF1A 4YYZA 3LWBA 3C4VA 4TX1A 1G0NA 2V54A 5JW6A 5HM8A 3PQ3A 5SYMA 2B25A 3U7GA 4RNDB 2BISA 4GVPA 2VBGA 2RSLA 2R00C 3N1UA 4LZOA 3MSCA 1P9LA 1UDCA 3CLTC 1YR8A 2E4UA 1W88B 1CFJA 4M55A 1L7DA 2FVYA 3KYIB 2PL3A 1ZP6A 3AH8A 2HDHA 1DUIA 3EGIA 4TLCA 3DL4A 5EC8A 2ZI3A 3ND8A 1N3BA 1RRCA 1BIFA 5FBVB 1GRQA 1T43A 2BGMA 2JFQA 3OQIB 3KVNA 3M2PA 1QH8B 2ODPA 4FBMA 3O92A 1ATIA 3UGTA 1Q16A 2ZSJA 3MXOA 1NUPA 3Q85A 2B8WA 1LBQA 3ZLTA 4OP2A 2W70A 2C3YA 3NVMB 3M6MD 3VNQA 2V97A 1NMZA 4DCMA 1BA2A 1XLWA 3Q9UA 3UV3A 1KZ6A 3K0HA 1WAMA 1XLUA 3OAAD 3T99A 1D8AA 2R6CA 4N40A 4ZGBA 2B1JA 3BYZA 1EE2A 1EDBA 3MB8A 5AUPB 2CLCX 5C5DA 3T3OA 2YNMA 4LY6A 4ZI2A 1M1NA 1EVIA 1WQ1R 1AGPA 3LCJA 4OD0A 4DV4B 3DJYA 2GLTA 2O2DA 2QM0A 3IP6A 3OWXA 4O4IA 3QU9A 2GVZC 1ECGA 1R0YA 2TYSB 3LHFA 2YWGA 4FSXA 1GHTA 4FJ1A 1LZLA 1QFZA 4C03A 4ZVKA 1F6WA 4TTTS 3RC9A 4BVKA 3ADKA 1IU9A 5FFFA 2ZCJA 2FTKE 2V96A 1YF3A 3DS8A 2V0GA 2QZSA 3HXLA 4YO8A 4BUZA 4M9CA 4RMHA 2W9XA 1V5IA 4DSAA 1COZA 1N1DA 3QIAA 2REOA 2P9GA 3QUTA 5D01A 4EMBA 1U5CA 5F9HA 1HNXB 2Q5JA 1CF9A 1RAFA 5JASA 1SIWA 1SFRA 2V6GA 3GNQA 3JVDA 3ETEA 2B3TA 4MULA 4Q4LA 6ADHA 1JLKA 1IEVA 1W2WB 4QOGA 3FE2A 3JR7A 3HYSA 1OA1A 2GJ8A 4FBLA 2ZYAA 1G18A 1N6PA 3X1DA 3Q3GE 2X6RA 5CDYA 2JH3A 1BGXT 3PRKE 3A11A 2CNNA 5K0CA 3MT8A 3LDHA 2O8DA 4RZSA 2QIOA 2XZPA 4K2HA 2J5XA 4NBWA 4DMKA 1XP5A 2JBAB 3SX4A 2Z5FA 2FMHA 2MSWA 3FOBA 4S1TA 4Y2PA 3VJMA 5ITZA 1KERA 5DBIA 5JSQA 3GN2A 1W49A 1PU2A 4UM7A 2PZLA 3CPEA 1Q91A 3RUPA 1I7LA 2XI4A 1BU5A 3WL5A 5MFPA 2UVPA 3IPXA 4TN1A 4JBHA 1KI1A 1SCIA 1WMSA 3PFGA 4B4KA 5JXIA 1DS6A 4KNWA 5AI6A 1MC5A 2QMZA 3L9WA 4CQMD 1XU4A 4K8OA 4UARA 2GM5A 1WY7A 2JW5A 1KIFA 3QH4A 4EECA 3GLGB 2H1OA 2O4UX 5D3MA 1UZAA 2GDZA 2O2CA 1WPRA 1YBVA 5KTKA 1Q7CA 4DSTA 1QG6A 1BCRA 4ZQBA 1E2JA 3VI4B 4C21A 1NBMA 2Z8XA 3R8CA 1IDN1 3UYKA 1X7ZB 5LLDA 2W6ZA 1UBMS 2QW0X 2RBKA 4AN4A 5JI3E 4CKBB 2H52A 1EQAA 4TL9A 4HZUA 4S1NA 4EAQA 3UMSA 1JYEA 3U7IA 2X6TA 2B5VA 2DUMA 5EHNA 3QM1A 1NDUA 5EG5A 1NR7A 4PG8A 1RI5A 2IEBA 4RH3A 2OYRA 5LKAA 3FOAA 3N7UA 3S2EA 2YY5A 3PHJA 3UWKA 1GTSA 4W9NA 1V11B 5M34A 1U90A 1ZGBA 3T5TA 1J2TA 5AHRA 1E18A 3EQ6A 3FBTA 3T38A 3CRRA 1D0IA 4Q82A 2XDQA 4Y9SA 1G55A 2IPXA 4JR0A 3HYCA 3OWHA 5IANA 1PEKE 4U8GA 3HDQA 3O1LA 2WZBA 5DU2A 3LC1O 3OE7D 1Y1PA 1M6HA 4Y30A 2DGDA 4HAZA 2XOKD 4AN0A 1E2DA 5HS6A 1UEXC 1JEEA 5IYZB 2AKEA 2OL4A 5BYJA 4B6JA 4BC0A 4BO9A 2VHCA 1SVOA 5JBIA 3M2TA 1MOZA 3FKSD 1UZUA 3WXMA 1G9SA 2EU8A 1ZD9A 4QBKA 4QJ3A 2EATA 2WG2A 3NYQA 1WXWA 4MW0A 3GRVA 3N5KA 1EM6A 3SS8A 2VTVA 3I4CA 2D5IA 4KITB 1C3OA 3A0UA 2W2NA 2OGWA 1L9KA 1Y1QA 2HTFA 2I4RA 3FUTA 2XRZA 3THYB 3OLVA 1B8OA 5JAQA 3ZLVA 1YMQA 3FMPB 3IELA 4LDQA 5CLHA 1F14A 1YDMA 4FI3F 2V3VA 2R79A 2ET6A 2Y0EA 1JDBB 4IIEA 5CT4A 5FWDA 1JQ3A 4FIDA 3DCIA 4Q34A 4CMKA 4EHNA 4B2PA 4OFZA 2XTAA 2BM0A 1OB2A 1OHHA 3TEMA 4I1SA 4GP9A 2NSDA 2B1GA 3MTDA 721PA 1Q1ZA 3M9XA 2BMAA 1MV8A 2W4IA 2YJ3A 2BE7A 5AQEA 5DSTA 5JR3A 4FR2A 3OE1A 1P0FA 2X4LA 4I1RA 1HE4A 3BTUA 1DKLA 4AP6A 2CL6X 3P0HA 1A4UA 4D4HA 2ALJA 2ZS9A 4Y2QA 3H1PA 4Q9LA 4DTIA 4LHZA 2D5AA 2EBFX 2GVDC 2BW0A 2IZ1A 1JPNA 4EYKA 3WLTA 1UINA 2C5LA 2IPLA 4RADA 2CJYA 2M98A 4LOHA 2D1RA 3HVJA 1C2YA 1LRLA 1Z5VA 3Q7PA 1H5NA 1A7AA 3KOOA 2VN8A 3VHLB 1JKFA 5H9WA 3CKMA 2IFTA 4D79A 1GCOA 2JI9A 4Q6WA 1CEEA 1TJPB 1TEZA 1HT2E 3H5RA 1W9MA 3D7KA 4QUBA 2L19A 1SUAA 3K30A 5HYVA 1VGQA 4JI3B 1GZHB 1XZEA 4JJEA 4KR2A 1RMTA 3PFNA 4B34A 4EYQA 2FSFA 3A3OA 4JC0A 3GW8A 5E9QA 3TO5A 4MOWA 1Y7HA 4KN6A 4BGDA 4R4JA 3BTVA 5GAJA 3BSYA 1H22A 3TM4A 4PGGA 5JS7A 1RRFA 2VRNA 4INAA 2XV1A 3TR0A 5AW4A 1WP4A 1OKKD 1R6TA 2OBXA 3Q5EA 4MUNA 4Z4QA 1W36D 2EP5A 2YNMC 3DF7A 1XD8A 4CIVA 4HG2A 4MARA 1W4ZA 3WYEA 3IKLA 1QV9A 3D4NA 3EZNA 3OC6A 1IUKA 3PPWA 1J39A 2UDPA 4L1KA 5FV7A 5K99A 4NCAA 1ELOA 4ZYTA 5F7OA 4YQYA 5C1DA 4ZRDA 4GLOA 3JQGA 2RHDA 3LMKA 3TQCA 5KVCA 1UPTA 2EQAA 1AU9A 3OZCA 4RK1A 4GYJA 2LVBA 3WHLA 3QPCA 4DSNA 1YFZA 3CLUD 4EGCB 1EIZA 2CMHA 2QXTA 3LZ6A 3RVJA 1PEAA 4ML3A 4QWWA 3PSAA 3DMNA 3VR6D 1KJ8A 4A2QA 3PJRA 4FGSA 2NO5A 1PX0A 2RI1A 1VG1A 3GC6A 4NOLA 3VKHA 1UWCA 3FY4A 1EK5A 3U9SA 2ZJ0A 2X9QA 4IO0A 1HBJA 1P4RA 2CV0A 4S3MA 2GCOA 1UBGA 4Z4IA 1LQ2A 3VR5D 1M6YA 3LIIA 1ESZA 2QUAA 3S8YA 2VUTA 3CVJA 3L9XA 4A0FA 1DBQA 4R2IA 3RG2A 1SHLA 3LHDA 3KELA 4IVPA 3ZCRA 3K0FA 1RLOA 3EIQA 4NDZA 1PD1A 4OOFA 1T4MA 2RH9B 1K3TA 3ETDA 4EY7A 2YASA 4EB8A 3TDMA 2XD9A 3E2PA 2WKQA 3B13B 3RBZA 2GASA 4KAJA 4I3HA 3I2GA 2JJ2D 3HSKA 1NYLA 3H5AA 5L3RA 1XMOB 5EZ6B 4B45A 4ARIA 2ONKA 3RPEA 4PZ0A 1J5XA 3SSMA 4BPRA 4MS1A 2VBCA 3P5BA 4EBFA 1KS9A 3VSBA 1MT0A 1WXIA 4MR9B 3LY9A 3SIXA 2QAIA 2NXCA 1EBFA 2WJIA 3IEUA 4PG6A 4W6ZA 1ZJZA 3F3KA 3D8SA 4H16A 2SHKA 1GUZA 5AVWA 3TSAA 3S8EA 4CCYB 3MCVA 1X1BA 1A8PA 2BMVA 2VSNA 3IXQA 1N4DA 1TT7A 4OMDA 2IYRA 4WLFA 4F71A 3ZI7A 4X6LA 3T9DA 1OH7A 3EXFA 3ABOB 4R31A 5IKEA 1J07A 1WNFA 1G41A 4KYTA 4MTLA 4B6FA 2QV0A 2ARKA 4JL8A 2IZZA 2MT9A 2WP0A 1WBDA 4B75A 1U0BB 1I3OA 4LOAA 4O4HF 4FYIA 1V5FA 3MJEA 3OCXA 4ND8B 5C3UA 5KBYA 2OBBA 3KKLA 1WTCA 1M2KA 2HJVA 4J3NA 3VMFA 4MP8A 2QRUA 4F21A 2ZR9A 3SX2A 1T0UA 1DBPA 1V2HE 4W4TA 3IUSA 3UJAA 3O31A 3UMJA 4EHDA 2AKYA 3LG2A 2G9QA 1JI3A 3LBNA 2ZRFA 3MTJA 1O97D 1PFYA 1RFGE 4W9NC 4QA9A 2HCRA 4MRSA 5IDWA 5KEIA 2XUQA 3TAHA 1EAYA 1WP9A 4JB2A 5LYJA 3G23A 1U7DA 1UXJA 3HRHA 1HOTA 1T3GA 3UB4A 4TQ9A 5GP1A 2EFJA 3FPGA 3TW8A 2PR7A 2ZJOA 2IP1A 3TKYA 3FZNA 3FPEA 2MSNA 3ZDCA 4HPXB 4HL6A 5B12A 5GJCA 3M4XA 5C53B 4X97A 3ILVA 2QAGA 1TK3A 3CG4A 5L7YA 2J09A 5FPTA 3A9RA 1O95D 1KL7A 1KYQA 4WASA 4EO7A 2MR6A 3KU1A 5GOZA 1J24A 3ICCA 1H6AA 1SA0A 4Q18A 4LKRA 5BN5A 1QONA 3CF6R 1A4XA 3O2NA 3HVUA 4JBLA 5T3UA 1XKTA 2M32A 2YWRA 5DN6A 3LD9A 3CRVA 2CK3A 4B3XA 4M38A 1X3LA 1RBMA 3QEOA 2HPVA 1LB1B 1LCIA 2ZWAA 2GO7A 1BEEA 2CB9A 1W75A 5A02A 1GKIA 1OIXA 4XPIB 1AG9A 4NBNA 3V7NA 1W0KD 4JROA 1LTKA 1ZEJA 5JYBA 3BKXA 3K9BA 3BIOA 1XNHA 2H1SA 2ZRNA 2Y3IA 5DTEA 5LOVF 2VHEA 2FPWA 2OPBA 1EGHA 3DTNA 5KHAA 3VTFA 3LCCA 3GBPA 4LPKA 3E3OA 3FETA 5AVVA 4DNPA 2X1HA 2ZE6A 1DIGA 3W3AA 2ZSDA 1MP0A 4JS0A 2QYHA 1EP3B 5TSDA 4BVAA 5E7IA 4Y2XA 2PZ8A 5IFLA 1O5TA 5ICFA 3TSCA 1OLXB 4DM3A 2DFKB 2WVHA 2WZQA 4LYGA 4YRAA 5DWQA 1JIJA 1UC5B 4POOA 3HZZA 4M2LA 3C6XA 3D5QA 3TTYA 2GFQA 2V7EA 3KQLA 3ICVA 3GMIA 3D4BA 1OXXK 2HHJA 1U94A 3TTTA 4BDSA 1LX7A 3DBRB 3Q10A 2EKPA 3T7EA 3A2KA 2YN0A 1B8UA 5SYAA 2D2FA 1Y3CE 1QKJA 3CF2A 4IDBA 4KRGA 4D2IA 3B6EA 2HLHA 2OLEA 2IEIA 2ZYRA 1QZ3A 3QVKA 3BIFA 4G0MA 5EHIA 1GA1A 4W5QA 1TU0A 5PGMA 521PA 3K96A 1RD4A 3UMCA 1HLGA 4PAOA 4DDWA 1AUVA 4ZYZA 3NKVA 4IRXA 3BXXA 2J9ZB 3U44B 1H3FA 1M2NA 2DUUA 4FR0A 4XR9A 2H8GA 1IK6A 2QVXX 1ZN8A 3S5UA 3TK1A 1PR6A 6NULA 4HFRA 5HKAA 1XCGB 2RARA 1MORA 2X3FA 3LQQA 1H8HD 1RQGA 1UPFA 1V41E 1XRNA 1SD1A 3DR5A 3GJYA 1EFRA 1UADA 4GOKA 1T8WA 4RGYA 5DCWA 5ICGA 2A4MA 1IBKB 2H51A 3AC0A 3QENA 4HPWA 4OXXA 4OU4A 3SDBA 5BR4A 4OM7A 1RTTA 1PI3A 1KAEA 4M1KA 2OQIA 1E1RA 4DLBA 4EI2A 4F38A 3KG2A 4IHQA 3M5PA 5EFOA 3WGHA 1ISJA 2QUBA 1VG8A 2QYSA 3J7TA 4PZLA 1B6SA 4CNBA 2MSCB 2J9FA 4N7MA 1UPAA 1LU9A 2X3YA 4IUYA 4ZOLB 1V26A 4PC6A 4U39A 3T34A 1KE2A 5BPHA 5KNDH 2Q5CA 3DZJA 4GI2A 3G59A 1RXVA 2WB4A 4GSYA 3U3RA 2BYTA 2C2HA 4M1OA 3D4IA 5REQA 4G5XA 3OKFA 5HM6A 3EFOB 1KJ9A 1DRUA 1IJBA 1TMOA 3HBFA 1JU3A 1M2EA 3DCNA 3NR2A 1FQOA 3E22B 4K6OA 1V9LA 4G8CA 1E79D 5JVDB 2IEYA 1OZFA 1X6VA 1RZRA 1PQPA 5BRJA 1JZTA 2HB6A 2QNIA 3W1WA 4QDUA 1Z4OA 2H1VA 1DSSG 1QH9A 2EFDB 2YV4A 3GI1A 4PS0A 3RF6A 2R7LA 3IPLA 3BRCA 4GGPA 2ZSFA 2OD7A 4H08A 1OTHA 5DBFA 3P0EA 5GPBA 3H7IA 4CV3A 5K8CA 3AONB 3SK0A 4L4YA 3QPUA 1RADA 5L40A 1YB2A 4I1YA 4RFSB 3MIIA 3RRYA 3UB2A 1G4HA 3BF7A 4Q37A 2ZB8A 3RSFA 2GTIA 5F7XA 1R10A 4A4DA 2H5EA 2G04A 4L5CA 4HX9A 5M04A 4G4SO 1XZKA 3SKYA 3ONEA 3T9BA 1R6VA 1ISMA 4OJMX 3LSYA 2DOKA 3OE5A 4FE3A 4KL8S 1FTYA 3IP7A 1CDEA 2C5AA 5BUCA 3AKZA 3AVXA 3FF4A 2JIZD 2L18A 1X9GA 3NWOA 1VIMA 2WJAA 3EIHA 4ZI7B 2PL1A 2XCUA 1OFHA 1MJGM 1Z4KA 2Q3DA 3FJOA 3N2NA 4PANA 5GZ1A 3L7NA 1QC5A 3HHEA 5DBHX 1HF3A 4O4LB 5J63A 4OQMA 4JI1B 3O73A 3E15A 4E5VA 5CX1A 3UKDA 1EUQA 3LH5A 4KLCA 3LA8A 3AZOA 3CSUA 1RPJA 1UMCB 3T1TA 1T6BY 1T0JB 5C1PA 3L6UA 5GTDA 2QD2A 2QYOA 2WOOA 4KE6A 3CF0A 4MI6A 1VLJA 3VR2D 3HP1A 4A8HA 4AI6A 2KHZA 3HCPA 1YRLA 3K2QA 3MHPA 4YAGA 5K0JA 1SC3A 2A6PA 2IE0A 4FGZA 5ENVA 4HO1X 4NFHA 5T3YA 4ETIA 4FWIB 4GKKB 1VLLA 2GGSA 3EIUA 3H86A 5A7FA 2C54A 4PFKA 4WLUA 2JLCA 4I8DA 1I14A 4QOIA 3CZAA 3S0JA 2C0CA 5AVTA 4A6PA 3CR8A 1SU7A 2EX0A 2Q4OA 1D2CA 2F9LA 4KI0A 4L3OA 1WL8A 1P0MA 4NG5A 5LZ2A 3RRXA 1P44A 3GF4A 1Z83A 3B85A 1HRDA 3QVMA 4OX9Y 1OYOA 1Y7IA 3N6XA 2O0HA 2UZAA 3CWZA 2WT8A 2WICA 4N5HX 2ID7A 2QTMA 3BGVA 3ICOA 3K0AB 2X5JO 1KDYA 3ZGXA 1KE1A 1A04A 1G20A 3BHMA 4DZRA 1HWYA 5AK3A 3DTVB 3OFJA 1TK2A 221PA 1E7QA 1KOJA 3V1LA 4ARVA 2ATXA 1KEKA 3BGSA 4BQEA 1FSPA 3L92A 3FSJX 3B48A 4LCEA 1DMRA 5AHOA 5BV8A 3FSRA 4JJZA 4KXXA 4DJDC 1RBQA 3GMSA 3L6BA 1Q2XA 1TVKA 4E32A 1SVMA 1RR6A 3G8YA 4PHCA 3V8EA 1VE5A 5DX8A 1BXZA 5GIPE 5DPMA 1TA9A 1W76A 1EP2B 1R4MB 2R4QA 4I19A 1GUAA 3MTQA 4MRMA 1Y3AA 4P4SB 5ECYA 4MMZB 1L4HA 4JLSA 3R6WA 1JDVA 1SWWA 4IJ6A 2QAGC 5IKPA 3AOEA 1R0LA 2HV9A 4MDYA 1PJBA 2FA9A 2F64A 1ZNYA 5EIEA 1TUIA 3L8DA 1G9TA 1NBOA 2JI8A 4KO3S 1A3CA 2A1TS 3E3MA 5KYWB 1GY8A 4N01A 4HYEA 4PPNA 1RZUA 2I6UA 2XCRB 3UJDA 1DAPA 5EJ5A 2FW1A 4LTNA 3IUYA 4M9UA 4CCSA 3HYLA 3PNOA 4J3FA 3DEFA 4RYDA 2EX4A 3WIBA 2FI1A 2O2XA 4WN9B 3HUTA 4YRGA 3KB2A 3AY7A 1UQUA 1Q57A 2UZIR 1RHRA 5BSFA 3JQ7B 3KJXA 4XJTA 1C7IA 4TKMA 2R96A 3EGOA 5C4IA 1JH9A 1E9VA 1GR1A 1IPFA 1MV5A 1DKQA 3GJ8A 1WIWA 2O5VA 3NNSA 4OMUA 3T4XA 1UBJS 1T34A 3N70A 1QYDA 4B7AA 4F4HA 3EPHA 3TBFA 5JH7F 1JAYA 1UPBA 3E2IA 4WLEA 3U60B 4LJ6A 3CH6A 4TPKA 3KQHA 4ID3A 3JQCA 2ZJYA 3HMQA 4J0JA 4NEQA 5JFOA 4MPDA 2R1TB 1W4AA 4X44A 4CLRB 4IUBS 2IKQA 2ZYUX 2B9VA 1GZSA 3EA5A 3HABA 2QY9A 1I13A 3FDZB 1ZWLA 2AJLI 5SZIA 1SUBA 4MJ3A 4GVXA 4UNPA 4C2BA 5SZHB 4CT5A 5IMBA 3M3DA 4F96A 2PHZA 2Z2IA 4K5QA 4BO3A 1XMXA 1ODJA 3TTXA 5JXJA 4OQLA 3I9LA 4LVOA 1RWWA 3V4OA 3WLHA 5GIOE 1MFZA 3O8DA 4P0TA 3DBHA 1S8NA 4GE0A 5H3HA 4CIDA 2X5OA 2XCLA 3PQ8A 4TZKA 4YCCA 1R3UA 2TMDA 5A2GA 2JFGA 1JWAB 4Y6PA 5F3WB 5LDHA 3LX8A 1UDBA 2GOYA 3QPWA 5F4BA 2X0IA 4JR1A 4BATA 5JH7A 1QKKA 2VF4X 5M3BA 4RTLA 4J8PA 2PA0A 2FMKA 3RVQA 5F51A 1ZGCA 2W7TA 2XUAA 3PR1A 2RCYA 3WLMA 2XE7A 1J20A 1G5RA 1ODSA 3GT0A 1W73A 2PS1A 1PGOA 1O4VA 5FAXA 2PKQP 3TE7A 1R6AA 2NZVG 2ZB4A 4NFLA 4RH1A 2FW0A 2QUHA 4GBJA 2OCLA 3VRHA 4W5RA 4C5CA 4QASA 1WEKA 1NN5A 2Y66A 3SXUB 3QTTA 1W5FA 1MB9A 5KB3A 1SBTA 1ZZEA 1N2EA 5KYNA 3FWKA 4UE2A 1TCAA 2F1HA 1A0OA 2IW3A 2BTQB 3P7MA 3TLXA 3W5SA 1YKSA 2IYWA 1IZYA 3Q12A 4GDFA 5A9RA 4YRCA 2IHZA 4OB8A 4DBLE 3NNDA 4JJ7A 4QUGA 5KX5A 1VLVA 1U99A 1N7IA 2VPIA 2DY0A 2JANA 2ZIFA 3M1LA 1CR4A 1ESMA 4KACA 5ECGC 3SDZA 1E8MA 3NGXA 4ALMA 1GTVA 1KZ7B 2ZTLA 5C8XA 3B78A 2P7IA 4LMRA 4JGGA 1P6QA 1IXKA 3NTOA 2OYSA 4UD2A 1G3QA 2IL1A 3DULA 2ZZNA 3SD7A 1QGAA 1ZGZA 1KMNA 1F48A 1G6OA 2YXDA 4JEMA 2HM7A 2D1TA 3RVMA 2NP6A 4EPYA 1L7QA 4CM1A 1UM9B 3QGMA 1DIRA 1GG5A 2FW8A 4LQLA 1FDRA 2BD0A 4ON9A 3MGGA 2G4LA 2WF7A 1QP8A 3Q6IA 1JTFA 1MO2A 4WZZA 2KX7A 5DKFA 2IW1A 3NDPA 3PUIA 3HCAA 5BSVA 1VLZA 4FYMA 1JFTA 1I7PA 5AWFC 3BA6A 4LN1A 5G4LA 3D6MA 1MRZA 2Y1DA 3H2IA 5EZYF 2O59A 3NIGB 5GM2A 5KAPA 3VO9A 4HY3A 4E5DA 1A9XA 4FOLA 2BT4A 2W2PA 4P2GA 5K0EA 5LD2C 3N28A 4C0BA 3EIXA 5DGCA 2EBUA 1HEIA 2CJWA 2O1SA 1WXEA 4UTXA 2HBRA 4LY0A 4FHGA 4B84A 4FWBA 1JWBB 4LWOA 3RQIA 4WCVA 4C4TA 3OSUA 1QAMA 3FTEA 2ZJFA 3UICA 1ZD1A 2G0TA 5KS2A 3WICA 1Z4MA 1OB5A 2Z98A 2YV1A 4FHEA 2I34A 3MJDA 4EVRA 4XGRA 3EUWA 3CCBA 1EFLA 3CLRC 1U6IA 4BB9A 3ASYA 5AIBA 2OV4A 2HJHA 4RD4A