4QEKA

Crystal structure of antigen 85c-s124a mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
281
structure length
281
Chain Sequence
SRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLAMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 107
structure length 281
sequence length 281
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qekA00
4K2AA 4EY5A 4W1PA 5JANA 3W2TA 5LZ9A 4MYSA 2CBGA 2X8BA 4BAUA 5IVDA 3G9XA 1LPMA 3DCNA 5DLPA 4CIBA 4NVRA 1BN6A 1T4MA 4A23A 3QH4A 2VT6A 4QDXA 5IVHA 5A7HA 1U65A 2ACKA 4UBKA 4H18A 5ALQA 3LLCA 3QYJA 4H7JA 2HA3A 3I28A 4C4ZA 5LZ2A 1L7RA 2ZSIA 3ESCA 1YASA 3H18A 4H7IA 3IUNA 2WHPA 1F8UA 2JIDA 2HIHA 3BE8A 1ZIXA 4N5HX 4Q3OA 4BVLA 2DSNA 1KU6A 1H22A 2XUQA 3KDAA 2ORYA 1WB5A 2VAXA 2XMGA 1CIJA 2DHEA 1XZIA 4BRSA 2WFMA 4S0XA 5LZ5A 2HU8A 1Y7HA 3ZWQA 1G5FA 2HFJA 4XVCA 5LP1A 5AM2A 1Q84A 2JGMA 2WHRA 4BCCA 5DYWA 4JEIA 4U2CA 4LYDA 1YCDA 3DL4A 3GZJA 2EEPA 1P0PA 2VJDA 5A62A 1D07A 3MGAA 4M0MA 4IH1A 1OCEA 4N8DA 2Y2VA 2XQIA 5F4ZA 1JJIA 2WQZA 1XZAA 5DYTA 2DQZA 5AKLA 3R3XA 4W9RA 4EHBA 3GELA 1OILA 1JI3A 3G9ZA 2ECFA 1VA5A 2WM2A 5K5EA 1XRMA 5ALWA 2QVBA 3WA7A 4CIAA 4QEKA 1YR2A 1XKTA 2OGZA 3ZV7A 2VJCA 1MO2A 2CJPA 5CRIA 1VKHA 1UKAA 2HA7A 3T52A 4FLEA 3H17A 3KSRA 3WKAA 1Z68A 5K3FB 4QE3A 3W06A 4MYDA 2OQVA 1A88A 3B12A 1GXSA 4UHCA 4FTWA 1P0MA 4GW3A 4JNCA 3I2KA 4KE9A 1QZ3A 3E1GA 4Q05A 2RHWA 4C01A 3G0IA 1ODCA 4PQEA 3WYNA 1N8SA 1WPXA 2Z8ZA 4BCDA 3D2AA 1VJ5A 5CBKA 4LHEA 5D3ZA 4FFVA 5JD6A 1QFSA 5AP9A 1WHTA 1EHYA 1VE6A 3U1TA 4X97A 1A8SA 2WJ3A 3N0TA 5IVKA 1LNSA 1ODTC 1WM1A 4OYYA 1CPYA 2ZJ6A 5ALKA 2XQGA 3H1AA 2V98A 2E3JA 1SFRA 3K6KA 1XLWA 4Z49A 1MNQA 2CEKA 4AXBA 4N8EA 2CB9A 4X91A 4FKBA 3O4JA 1XQVA 2XMZA 3OC0A 5HF6A 1GZ7A 1GGVA 2Z5GA 3RK4A 5A7FA 1CUHA 4OB8A 3DS8A 4FNGA 2WUEA 4OB6A 1MPXA 1NU6A 5HFAA 5A2GA 1E5TA 3WKEA 4WFKA 5AIBA 4TPKA 4OB7A 2AXEA 3TGLA 5CH3A 5BV7A 1QIJA 4G9GA 2HA6A 1UWCA 5ALIA 2R8BA 2G5PA 4OU4A 1PFQA 5JD5A 4J0HA 3UMJA 1XZCA 2WTNA 3DEAA 4RE5A 4UBMA 1E8MA 2HA2A 4G1FA 4UUQA 3WKDA 4G9EA 1AX9A 3NUZA 5LYYA 3FVTA 3UUFA 2HA0A 5AK4A 4X90A 3STVA 1VXOA 1CQWA 4K6GA 1M33A 4AZ3A 5JAOA 1AGYA 2R11A 3R3YA 2I3DA 4BAGA 1TCAA 3ZLUA 5YASA 2VJAA 1ETHA 4G4GA 5ALSA 1JU3A 5K3FA 3FYUC 3AIMA 4WFJA 2D5LA 3G0BA 1AMNA 2WUGA 4BVJA 4DNOA 2Z8XA 3TRDA 5ALOA 4Y2TA 3HEAA 1GKLA 1HDEA 4NZZA 3LIPA 2J4CA 3I2HA 4ARBA 1GQSA 2ACEA 2WJ6A 1XLVA 3ESDA 2GYWA 4BTLA 5ALPA 5CT6A 4MWTA 4CCYB 4GBGA 3FLAA 1N5RA 4G4IA 3WWDA 5BWBA 2BUBA 3I2GA 4L9AA 1DT5A 2OCKA 4BCBA 4PSCA 1AKNA 1GPNA 3H2JA 4H35A 4X71A 3R3UA 5T4BA 1CUJA 5CMLA 3D2CA 1MU0A 4FLMA 1WOMA 2XUDA 1XRNA 4C88A 1JT2A 5C8VA 4P93A 3S8YA 4E15A 1EDDA 1QONA 3G0GA 5JZSA 1ZD5A 2GBFA 4HVTA 2JGIA 4BTVA 2JEZA 1K8QA 3C43A 1DQYA 2WG2A 2XUJA 1CUGA 4H7HA 2V9ZA 2FX5A 3V1MA 5K3EA 3G8YA 2WJ4A 1XQWA 2BCEA 4P9NA 5I8PA 5JAHA 3I2JA 1EX9A 3FAKA 4GWLA 2ONCA 3H2GA 4MEAA 1QIKA 3B3QA 4UFOA 4MWSA 4PF1A 4ZV9A 1EK2A 4F5ZA 3A70A 1EVEA 4FOLA 4J03A 2ZSHA 4DNPA 1CUCA 1L7AA 4M0EA 5ESRA 5ALFA 2XMDA 2AJLI 5ALMA 3X3HA 3IUJA 3WJ1A 2WHQA 4J0JA 1UXOA 3C8HA 4L72A 4UBNA 5DTJA 3O4HA 4QLAA 3FBWA 5HKBA 4B9EA 4G8BA 2DHCA 1FSSA 4YX9A 3PFCA 4BVKA 1EB8A 2PKYX 2Q0XA 4Y2VA 2YYSA 5CXUA 1QE3A 1E89A 2I3ZA 2ROQA 5AKYA 1PJAA 5FPPA 2WKWA 2QTBA 3C6BA 5ALHA 3PFBA 4DIUA 4X95A 2XE4A 2JGKA 4FDMA 4Y2UA 1SCKA 4DNQA 3FYUB 2PVSA 2XMRA 1K4YA 4KYVA 3OPMA 1CUSA 4EB0A 3DDUA 4X94A 1ZIYA 3T4UA 1DT3A 2AJ8A 4WY8A 2H7XA 3IIIA 1I6WA 3SWWA 3AILA 4YK7A 3IURA 3FOBA 1AZWA 1XZKA 1UK6A 1VXRA 1BEEA 2P8SA 1CLEA 4A16A 1YA8A 2JGFA 3QMWA 4WJLA 5LZ4A 3BIXA 3H2HA 3CCBA 3WL6A 1XZDA 3KD2A 1A8QA 3Q8WA 4G8DA 2JGJA 1EVQA 5AKGA 3DLTA 1QIEA 5KWJA 1GPLA 3C70A 3IBTA 3KWJA 4HXGA 3A2LA 5BWCA 3WIOA 2XMSA 3ANSA 1UKBA 1W4LA 3WK9A 2PPLA 3FSGD 3QM1A 2HRQA 4AO7A 2XUKA 2XT0A 5LLSA 2HFKA 4P92A 2WFZA 4BATA 4C4XA 3AZQA 2WILA 1ACJA 3PE6A 1FJ2A 1IMJA 4BDSA 3W05A 2XLBA 4WY5A 3I2IA 1QIFA 1GPKA 2WG0A 2O2HA 4D9JA 1ZOIA 4MQMA 3DYVA 4X6UA 5CH5A 1TK3A 2WUDA 4ZRDA 5LKRA 5KBYA 5T4FA 4CI9A 1LBSA 2OXEA 5AI5A 1JJFA 5LZ8A 1VLQA 2XQJA 4Y7DA 4QNNA 4Y2SA 1ORVA 2GBGA 2LIPA 4PSUA 4GXNA 1QIGA 3EIOA 3H2IA 1E3QA 2DQYA 3C45A 5ALJA 3RARA 3P2MA 1BRTA 1ZD4A 2VSQA 3QPCA 3D7RA 5AI4A 3DQZA 3V9AA 1IUPA 2GZRA 3M3DA 5CW2A 2PU7A 1QIIA 4GI1A 3SC2A 1X70A 1QO7A 1H2ZA 1A7UA 3GBSA 1Y37A 4BC1A 1WB6A 2XUFA 3ANTA 3HLKA 1KEZA 4Q3KA 3QPAA 5EGNA 5D3KA 3F97A 4C4YA 5K3BA 4AZ0A 4BRZA 2EDCA 3VVLA 1F0NA 2XUOA 4H7KA 4B84A 3CXUA 4AB1A 3GA7A 3QVMA 3QMVA 1YAJA 2GZSA 5EI5A 4HRXA 1DWPA 2O7VA 1UOQA 4EZIA 1R4ZA 2BJHA 1UK9A 1W52X 4W1SA 2OQIA 2HDWA 1TCCA 4AMYA 4EUSA 4UPDA 2IITA 3AJAA 2ZYIA 1LPNA 1Q0ZA 1RP1A 4QDTA 1J2EA 3WKBA 3WK7A 2C58A 2CUTA 4J0KA 4KAFA 4FNMA 2ZYHA 3V1KA 1TIBA 2B9VA 5HK8A 4UBJA 5FPQA 1QFMA 2FJPA 2OG1A 2WU4A 3E3AA 4J7AA 5EIAA 3DD5A 2RGUA 4Y2XA 4DGQA 1CUDA 4MQLA 3CN7A 2QJRA 3WL5A 5AM3A 1XLUA 4H7FA 2D0DA 4C89A 4EY7A 1MAHA 1HBJA 5T4HA 2GBIA 1XRPA 1EA5A 4XWGA 2H7CA 4B81A 2IX9A 4F21A 1J1IA 1XKLA 2XDWA 5JARA 3DJYA 1QIDA 2HA5A 3IA2A 1CUBA 3GROA 5DTIA 2HU5A 2J3QA 1H23A 2NW6A 1DQZA 1BE0A 3VJLA 1UFOA 5HCUA 5EIHA 1QOZA 2C0QA 5DNWA 3NGMA 3QZUA 1USWA 5HQ3B 3CN9A 3H0CA 2BUCA 4Y2PA 4QLOA 5AM1A 1YS1X 2X76A 5A71A 4FWBA 1CUUA 5T4EA 2WIKA 4FHZA 2QOEA 4LXHA 5LZ7A 1YSCA 4UHFA 3I2FA 3ZI7A 3E0XA 3A2NA 3O9MA 3BJRA 5CURA 1EK1A 5AM0A 2VTVA 4AN1A 3WK6A 1F0PA 1H2XA 2B61A 1K6EA 3KWFA 1Q83A 4H7EA 1ACLA 5HK9A 4BE4A 5AOCA 3I1YA 4UFPA 3EF3A 5SYNA 2OLEA 3L1HA 4C87A 3ZLVA 1CRLA 5KREA 1LPOA 4B0OA 3G9UA 3KOOA 4CFSA 2W22A 3WQHA 5IH7A 2XLCA 5CT8A 1HPLA 4F0JA 5LIPA 1P0QA 3ICWA 4U2FA 1CFJA 2JGLA 4B83A 3G9TA 2PL5A 3WWEA 3HSSA 2Y2UA 2H7YA 2QZPA 1UKCA 3FNBA 1YB6A 3LIIA 5ISMA 2C7BA 2J3DA 2UZ0A 4BBZA 1GT6A 1W75A 3C8DA 3WMRA 1DINA 4HXFB 3V1LA 4U2GA 4TGLA 4ZREA 4NMWA 2DFPA 4DMHA 2VATA 2AJCA 1SCIA 4DSAA 1UOPA 4ZGBA 1IUNA 5FP0A 2BAGA 4EY6A 4PV7A 1WCYA 5D7BA 1VZ3A 3AFIA 4H0CA 1TCBA 4MJ3A 5AO9A 3TJMA 1ZI9A 3WLAA 3D4LA 4X92A 3PUIA 3AIOA 4PW0A 3WWCA 2AJBA 5AJHA 4CCYA 3WZLA 4DM7A 3WL8A 4OD0A 5CT4A 2PSFA 1NU8A 3JW8A 5ALUA 2QT9A 2HL6A 5J3JA 7YASA 3WZMA 3EQ7A 3FCXA 5ALYA 5E4JA 3PICA 4OSEA 6YASA 3K2IA 4QWWA 5JALA 3QBJA 2VQ6A 3EQ9A 4J0CA 3ZLTA 4HRYA 1TRHA 3IB3A 2WIDA 1XROA 3STWA 4HAIA 2X5XA 2PM8A 4J0GA 1W6RA 1KU0A 3BJMA 4AQDA 5JASA 3B5EA 2HADA 3F98A 3AIKA 1R9MA 3FYUA 1Q0RA 2QJWA 1DTEA 5E2IA 1E8DA 4Y2JA 4YASA 4GDMA 1YS2X 3W04A 4A5SA 1SOMA 4B6GA 1HLGA 2VAVA 5ALEA 5AKJA 4HZGA 4X7BA 3TEJA 2XUAA 2QM0A 1LPPA 1MX1A 5HQ3A 1CV2A 4HTAA 4G8CA 4B82A 3R3ZA 3FLEA 3WK5A 3JWEA 3IULA 2XMBA 4QWMA 3MVEA 3PUHA 3BDVA 5HF8A 2H9YA 4BZWA 4AO8A 3HABA 1BEZA 5EIEA 3O95A 3S2ZA 1BCRA 4GEGA 5ALVA 4I3FA 5ALDA 4DMCA 1ZD3A 4B7ZA 1ZI8A 4KRXA 1LZKA 1ZGBA 1H2YA 3SK0A 1UT6A 3BXPA 2DCMA 3O9VA 4Q34A 2HHAA 4RGYA 4PSDA 4KR0A 3E4DA 4H7DA 3MUOA 3BDIA 5AHXA 3FSGA 2WFLA 1ZI6A 2OAEA 5AKXA 1ISPA 3C5VA 3PF9A 1CUXA 2G63A 4ETWA 4K6HA 2GYVA 1FFEA 3EQ8A 4Q1VA 4X3CA 5AK6A 1HQDA 4Y2YA 1XRQA 4UHHA 4J0DA 5AKZA 4ITVA 5AI0A 2FJ0A 1YA4A 1IZ8A 2CMFA 2BFNA 3BF7A 3ED1A 4E14A 2WIGA 3R3WA 1EXWA 5AKIA 4QZVA 5AIAA 5EHXA 3RKSA 3WJ2A 5AKEA 4GLBA 4IQ4A 4IH4A 3STUA 1LBTA 2WFLB 3U0VA 1MX9A 2OPHA 4OPMA 2PX6A 4UHBA 2OGSA 4U2EA 2RONA 1XZGA 1QTRA 2C0PA 3HJUA 4OUKX 4HS9A 3FCYA 1W76A 3W9UA 5SYMA 4CG3A 5I9IA 4DMKA 3FVRA 4NS4A 3I6MA 5DNUA 3DKKA 3RLIA 4OYLA 1K63A 3H19A 2QXTA 4U2DA 5IKXA 1CUVA 1XRLA 2C5GA 3A2MA 4PO3X 5EHNA 1GQRA 1ZJ5A 5FV4A 4J3JA 4LYEA 2XQKA 3NWOA 2C5FA 1CUIA 3FYTA 3FLBA 1CQZA 5HZGA 3BIWA 1DX4A 4BB0A 2WG1A 2HRRA 5A6VA 3DL7A 2BGNA 4DLNA 3OURA 2XUPA 3FWHA 1ODSA 5ALXA 1R9NA 1U2EA 2ZJFA 4QA9A 5FLKA 1JMKC 5JZBA 5IVIA 5JIBA 4DSZA 4W63A 1SC9A 3ESBA 5C8ZA 2PSEA 3WWPA 4AX4A 1ZGCA 4KEAA 1R3DA 4UHDA 3IUQA 1IVYA 2QS9A 3DOIA 5C7YA 1AQLA 3WYDA 4B9AA 4EA6A 4LIPD 4BC0A 4WFIA 5JYCA 1N1MA 2WTMA 2XMCA 1B41A 2G5TA 4X85A 3M83A 1A8UA 5ALNA 3ILSA 1K5PA 2OAGA 1UOOA 2RHTA 1U4NA 3LP5A 1X2EA 5DJ5A 1XZMA 4L3WA 2GBCA 2FUKA 2O2GA 1MX5A 3DYIA 1OXMA 4B0PA 4KE7A 2WUFA 2WU3A 1NX9A 2QMQA 4CG2A 4N5IX 2XUGA 4ARAA 1XZHA 1QO9A 4FBLA 1AUOA 1XZJA 3IVMA 4WDQA 1G4HA 1MNAA 1W1IA 2HU7A 4KAJA 4EBBA 1TAHA 2JGEA 1QLWA 1BROA 3QMMA 4I4CA 3VJKA 1T2NA 4INZA 4M0FA 2CZQA 3F8SA 4X6XA 5AOBA 3HXKA 4L0CA 1B6GA 1BCSA 5ALGA 5DNVA 1THGA 2QXUA 1SCQA 1JU4A 5CT9A 4F60A 1TQHA 5JD4A 1ZJ4A 3AINA 4KJXA 4X6YA 1QJ4A 3IDAA 5HKAA 3Q0TA 1GKKA 3I1IA 4BDTA 3O0DA 3DNMA 1MAAA 2H1IA 4LXIA 3HZOA 5FUMA 1EINA 3PF8A 1UK8A 3OTQA 4Q3LA 3CCCA 2V96A 1FFDA 1C7JA 2QR5A 1QGED 5C81A 1DWOA 1IZ7A 2V97A 3V48A 1FFBA 4WCVA 3HI4A 4YPVA 5DYYA 2VT7A 5JAUA 1BN7A 1LPSA 1LZLA 4JYMA 4X00A 1R1DA 1RYYA 2WHPB 1R50A 5AI9A 1EDBA 5CH8A 4BE9A 1N5MA 4ZI5A 3D3NA 2OCGA 1PV1A 3AZPA 4N8SA 2XUHA 1LPBB 2AJDA 3HACA 1F6WA 3D59A 5FOQA 1XFDA 5D6OA 5K3CA 4PNZA 2PUJA 5E4YA 5C8XA 1VZ2A 1UZAA 1XZBA 1MJ5A 2BUAA 1XQYA 4O08A 2JEYA 2RI6A 4BZZA 4HXEB 3D5EA 4MEBA 3VKFA 5JATA 3MUNA 5E4TA 1Y7IA 1TKRA 2QUBA 1P0IA 5EHQA 4AO6A 3LCRA 5LKAA 1LLFA 5DWDA 1JMYA 1E8NA 5JZ9A 4BP9A 4CCWA 1QIMA 4OCZA 4DMFA 5EHZA 4C6HA 2QRUA 4ZWNA 5ALZA 3OM8A 3I6ZA 4WDRA 2VA9A 1QTIA 2WIJA 4Q82A 1WB4A 4JUIA 3R41A 3KXPA 3STYA 2PSHA 2JF0A 5AICA 3L1JA 2IIVA 1VE7A 4RNCA 3WWOA 4IH9A 4UFNA 2Y1KA 3HRHA 1CUYA 3VJMA 3EBLA 3L1IA 1UK7A 1HKHA 5AI8A 5AK5A 1JJBA 5JADA 2GYUA 1MTZA 3N2ZB 1DWQA 1VA4A 4E11A 1O6GA 1BS9A 5K3AA 3G02A 1CR6A 1YB7A 3K9BA 4KE8A 4B85A 5I7UA 1IUOA 1CVLA 3PI6A 3HYSA 3STTA 4XIIA 4JH0A 4BYMA 2EDAA 3F9CA 1MN6A 5AH0A 2I03A 3WK8A 1JFRA 4TVKA 3ZPXA 3WI7A 1X2BA 2ZYSA 3M82A 1H2WA 3GUUA 5EFZA 3YASA 3LS2A 1CEXA 4W1RA 4OU5A 3C87A 2HM7A 3C6XA 2OGTA 2Z3WA 5CXXA 1ZICA 3WL7A 4DNFA 2PSJA 4J0IA 5AKHA 1JKMA 1G66A 1CUFA 3V1NA 1EI9A 4KE6A 5CTAA 1MT3A 1XRRA 1AC5A 3BWXA 4BAZA 3BF8A 3G0DA 3UUEA 1R88A 4KACA 4EY8A 1ZD2P 4CG1A 4I19A 4X93A 3R0VA 4LKOA 4UBIA 3DOHA 2PU5A 3H04A 5JAPA 3DKRA 4RE6A 2QKYA 3NOXA 5HFNA 5ALLA 2VF2A 2VEOA 4AN0A 4LXGA 4IHAA 4QDOA 3O4GA 5AM5A 4G4JA 2Y6UA 5AI6A 2Z3ZA 2ZVDA 1CUAA 3RM3A 1QIHA 1S8OA 5AOAA 3R40A 2YH2A 4BP8A 3WK4A 4XJVA 3VDXA 4ZV7A 1XZLA 4KAAA 3HC7A 3AZOA 5ALTA 2O2IA 5H3HA 3SX4A 4MXDA 3G7NA 3QPDA 1VOTA 1WPRA 1YAHA 3OG9A 4IO0A 4FFWA 1J06A 2B20A 1G42A 2O7RA 4ROTA 4FLFA 4FBMA 1DX6A 2DHDA 2QUAA 4AMZA 3VVMA 4Y2QA 5CT5A 4UBLA 1XQXA 2YASA 3C6YA 1XZEA 4UHEA 2C4HA 1HL7A 5A7GA 4EY4A 2K2QB 3WKCA 3QITA 1BU8A 1WHSA 3A6ZA 3GFFA 3D0KA 3D2BA 5K3DA 3F67A 1LGYA 4P08A 3G0CA 5FRDA 4V2IA 4DYHA 4DTCA 5FKJA 2RIPA 4FMPA 1DU4A 2G4LA 3IUMA 2DR0A 1AURA 4H77A 2YXPX 2WIFA 4ZXFA 2J4FA 4W1QA 5ALRA 4Y2RA 3W9BA 2W6CX 2RAUA 1U8EA 4KRYA 5AK3A 3H2KA 1C7IA 3R3VA 1CUZA 5AKKA 4G5XA 3ESAA 4UBOA 2XI4A 1ORWA 4K6KA 5BOVA 2XMQA 3WA6A 2HA4A 2XB6A 5HF5A 1EDEA 2OCLA 3AUKA 3C5WP 1EH5A 3O4IA 2PBLA 4B80A 2WSLA 3STXA 1RWQA 3C6ZA 1EB9A 2BGRA 1C4XA 3WIBA 4XX1A 2BKLA 1E66A 5HF9A 3JYHA 3PDCA 4RPCA 1O6FA 2I78A 2WLSA 1L7QA 2ES4A 4QDZA 3M81A 1LPAB 4GHWA 1CUWA 2PUHA 2ZJ7A 3H1BA 4QDUA 5FXMA 5AM4A 3ICVA 3VISA 1XZFA 2VJBA 2XQFA 2B4KA 2XUIA 1FFCA 2Y6VA 2ZYRA 1FFAA 2CKMA 4Y9SA 3VXKA 2JBWA 4JYPA 3F96A 1THTA 4K5QA 4GECA 2PSDA 3OOSA 5FDFA 4U2BA 3I6YA 5KWIA 3BL8A 1CUEA 1J07A 2OCIA 4E46A
chains in the Genus database with same CATH superfamily
2Q41A 2J5XA 3UK2A 4B3HA 4KRFA 1NW3A 1Q92A 4LBWA 4ND2A 4AKGA 2CBGA 5AVYA 3RTGA 3H3JA 1R6DA 3QE4A 2I1QA 3QE2A 2OE2A 3QIAA 4O2LA 3KFVA 4WKCA 5IVDA 2XE8A 1SBNE 1Q50A 3VZSA 4IW3B 1XMVA 3EJ6A 3P27A 3B1VA 4Y6SA 1XE3A 3DCNA 5CHEA 2EW2A 3HJTA 4WBNA 2GAJA 5B6PA 2XCQA 5IVHA 1T4MA 4CKXA 3EA0A 5BNTA 4QBKA 5LOVF 4R2KA 3AHGA 3GX1A 2JJ2D 3NHKA 2ERCA 4GMGA 5A7HA 2WK1A 4BMCA 3UMFA 4BQOA 2ACKA 3KQVA 5JH7F 2XVXA 4LYGA 1BH2A 2YY7A 1KQ3A 3LLCA 4YAJA 4UULA 2AFIE 4TKVB 3T5GA 3BMCB 2WAXA 4GWGA 3QYJA 3R9KA 4TSRA 1KHHA 5F23A 5ELXA 4TMWA 2YKGA 2CNWD 3IT0A 2JA2A 2HA3A 4OQNA 3AI1A 3KQOA 4RYLA 5FOTA 1D7OA 4UCQA 4L9SA 5LZ2A 1QG6A 3E22A 3ZEIA 3WX0A 4XYEA 2Z4TA 3DEJA 3PCXA 4BQIA 4JP5A 3ROFA 1I01A 2OKCA 1NPYA 2VO1A 4H7IA 2V8OA 5ECGC 3ZXIA 1P2SA 4M8IA 5K8LA 1SXJC 3QFFA 2Y1FA 2C2XA 4UNIA 5LU8A 4IIBA 3SF8A 3F7TA 3QU9A 3U2QA 3KEOA 1EUDB 1WE2A 3DAPA 5CVJA 1I7LA 5KTOA 2IKSA 3ROTA 4KQEA 2BEWB 3WQBA 4DKXA 5JCOC 2HIHA 3BE8A 1OFTA 2OC4A 2P2CA 3CY6A 4FS3A 3ZWCA 4BNMA 2QE7D 4H4DA 5E3HA 3ECCA 3LZCA 2QTRA 3QUTA 4C7XA 1SXPA 1KRWA 2XUQA 3KDAA 3PGJA 2JFHA 3NYQA 5GIOE 1E79D 1UODA 2GZ3A 2HY7A 2XMGA 4R2JA 4P36A 2ASVA 3NC1C 1ZDMA 4E51A 1XZIA 2WFMA 2CLDX 3G88A 4IDAA 3Q72A 4KXYA 4S0XA 2F55A 3ZGYA 3ZJUA 1Y7HA 1G5FA 4NBUA 5AYVA 1CHNA 1CG6A 2HWYA 5LP1A 3DWFA 3K5HA 4EK9A 4P1ZA 1GD1O 1GUZA 1P1FA 3TG2A 2WHYA 2EBHX 1Z0IA 3S44A 3FMFA 4X64B 5AQ1A 3W7AA 3MWDA 4UXJA 3WV5A 4UD6A 4HH1A 1NNSA 1DARA 2PHZA 4D9EA 2NZXA 4FJ0A 2I65A 4CMIB 2XODA 3RVNA 1ZONA 2VDNB 5BR7A 1E58A 2O8CB 5CHYA 2K5UA 1DG1G 3GZJA 3R4VA 4D9FA 4W8OA 1VL0A 1PAUA 2HYDA 2QRQA 4H3VA 3BWMA 3EEOA 3EMKA 2VJDA 4LOJA 4CIDA 3URMA 2L17A 5A62A 1NBAA 1ONSA 1LA2A 1Z34A 4H6XA 4M0MA 3SYTA 1Z9BA 4A7PA 1GPJA 3VU8A 3KZXA 3OQBA 3ZY4A 1P62B 4PCAA 2WU0A 1GZ5A 3NGXA 1JKJA 4U9IS 4HDMA 1BYUA 1EFCA 1YGPA 2WJYA 4RFSB 2HJRA 3F6RA 4Z8XA 4HI0E 5DYTA 4EHBA 3ILVA 4BUJA 2RFLA 5BXYA 4KX3A 5E7MA 2WM2A 3O5AA 5TMPA 4D9HA 1NQ5A 2C2KA 5HX7A 4NK5A 1H6BA 1QAMA 4UU1A 5ALWA 2NTNA 2FH5B 4B1FA 2QM7A 3E23A 4FPXA 3MJDA 5E1DA 3JCZA 2YFKA 3FE2A 2QD5A 2OGZA 2QJTA 2I7CA 3KT8A 3QVWA 3ZV7A 1MO2A 1SXJD 4P0QB 3R9XB 5EMHA 1I0LA 3CTMA 3HKCA 3OMWA 4TZTA 3T52A 3Q9SA 3LTNC 4N5DA 1NW6A 3TZCA 1Y9JA 3H17A 4OQDA 5ENDA 3UJBA 1NQAO 2PT6A 4TMZA 4E6EA 3U56A 2HRDA 1PKXA 4QE3A 3O93A 4MYDA 1A88A 1U3VA 1X80A 2JHAA 1GXSA 2JRLA 3B9BA 4EG3A 2R7AA 4UHCA 5B1EA 4E7PA 1P0MA 1X14A 1I7QB 3OUTA 4GW3A 2DRIA 3I2KA 4JNCA 2CJYA 4IINA 5HCNA 1ULAA 3I01M 3T0GA 1N8KA 3L7JA 1LF5A 2CNLA 3MERA 1JR3E 3C48A 1ZIOA 2CLLB 3SF8B 1NTOA 1W35A 1YB4A 3ZY3A 3VVCA 4PIPA 1V6SA 4BB9A 1Y42X 3BORA 4PQEA 4U4AA 3WYNA 1E69A 1N8SA 4IZ6A 5AJZA 3M5DA 3MMNA 5DYIA 3L6OO 4BCDA 2QRMA 1VJ5A 3PU6A 2D06A 2HGSA 2WHXA 4JJ7A 4OBEA 3ML1A 5TGTA 3LZDA 4TMTA 3TKYA 3ZGOA 2EFCB 2Q0HA 5DO9A 1XP8A 3HCRA 1UMBA 3AFOA 4PZ0A 2XTAA 5TDHA 2YR0A 3V97A 1KQFA 1UP4A 1WHTA 1VKZA 5F1PA 3R0IA 4GI5A 3U80A 2R8XA 2OP0A 3DBLA 1SKAA 1Z3CA 1DIRA 1R15A 4FSDA 3U1TA 1KOGA 1DHTA 3OX2A 4RTJA 4R1SA 5A6SA 1JAHA 1MB0A 1QGAA 1MAWA 1EGVB 3E9ZA 3O1JC 1M8KA 3B20A 4XIJA 4ZIRB 2QI9F 1E7SA 2FWAA 3ENWA 4JGIA 2QDKA 5JAQA 3WSWA 1U0HC 4V0ME 4LXQA 4P3PA 1R0LA 1US8A 4HK4A 4I66A 3M4NA 3IDFA 3TNJA 5LOVA 1JHDA 3MBIA 4MS4B 3PQCA 4XD7A 3LQRA 4WBNF 2HGZA 2MCFA 5AMXA 1JXOA 3DEKA 3O47A 3RYHB 2IEAA 1RW4A 4NX2A 3RSSA 1D1SA 1ZGHA 1ZRNA 2QRVA 1CDZA 3CLUC 1A71A 3UJAA 2IU6A 1JPJA 4FKBA 1K4MA 2H7VA 4E5DA 1RRMA 2EX4A 2XIQA 5JWHA 3PQ3A 3GF4A 4LCBA 1KQOA 3OC0A 3S3TA 2ZWIA 1XAGA 3VAYA 3PGKA 2OBLA 1GGVA 1AG9A 2JW5A 2Z5GA 1T6BY 3UAGA 1Z2OX 5EMKA 1GG9A 1T8RA 3D6NB 3N8IA 5A7FA 3UWMA 4KVFA 2VWGA 4TKLA 2PKCA 4QELA 1Z4MA 1USGA 2QBYB 4GPD1 4DV6B 1KH1A 3RTDA 4AK9A 4OB6A 1Z82A 1Z4IA 1ZO8A 3RKRA 1Y3FE 1W2GA 3OEWA 2XBLA 3E70C 3E15A 1LTQA 2CNOA 4L6IA 1WWKA 3OE4A 4MKIA 1IBLB 1JWBB 3GLHA 4TOIA 4YV1A 4ZHSA 1G2IA 3N5KA 3ASYA 1Q12A 4MWOA 1IMOA 2BCJQ 3N8HA 3KPVA 3ZI4A 2REQA 3PUWA 1R3UA 4AL4A 2R8RA 3D4IA 4KV9A 5HJ5A 1N2IA 4ZEOA 5BV7A 3CTPA 3D02A 2CE2X 4IX9A 4MWDA 3QXGA 3VAZA 3ZKAA 4AT1A 2R2GA 2YOHA 3W1VA 2VDUE 1UWCA 1E62A 1FBTA 1CQXA 2R8BA 3DGEC 4KC0A 1A7KA 4FZVA 4ZVSA 3W2IA 1U1DA 3MGBA 2FWJA 3O3NB 2R4UA 4MS4A 2P2SA 4YRMA 3A28A 3EQZA 4J0HA 4OA8A 2DECA 1XZCA 4FT2A 1IEVA 1XI2A 3DEAA 1SQGA 2FR1A 1L7XA 4NF2A 1NRXA 2GT1A 3OT5A 1YQGA 3JALB 3DCJA 3FDZA 1P77A 4UBMA 1T3SA 4P7JA 3UFBA 2ZSDA 1Z33A 3DUFA 1ZNXA 4V03A 1JKXA 4ANFA 4QM6A 2X2FA 4FE4A 3WKDA 5K8TA 1Z63A 2M1XA 1BCRB 1V96A 3KHSA 1MIHA 1IK6A 3FPGA 2FZCA 3CYFA 4KQFA 2F62A 1GPUA 2AGVA 4RMNA 3FVTA 1PFYA 3UUFA 1U5BB 2HA0A 1CXZA 4KR6A 4NTZA 2Y92A 1KI2A 5L9AA 2IBSA 3Q6MA 3DUWA 4ZVLA 5SV2A 3TSOA 4U7JA 4R83A 4NCXA 1X3SA 2B94A 2N1BA 4C7MA 2Z09A 3CWQA 2BM1A 1GLGA 5I7OA 4IJWA 1G7CA 4OAQA 1L4UA 9MHTA 4I1YA 4F46A 4JI0B 2R11A 4FFSA 1J2YA 3Q7EA 2NVWA 1A9OA 2FYTA 3T12A 3CZ5A 4NHEA 1GU0A 2QW8A 4U0JA 3A04A 5BV8A 3ZLUA 4YLYA 3BGWA 1IEQA 2J6CA 5ITZA 2XVYA 4OXIA 3OZUA 1ETHA 1VL1A 2IXFA 5ALSA 3I72A 4IFEA 4L07A 2NNWB 2VS1A 4WVFA 1KYYA 2B1IA 4UXHA 4BNWA 1HT0A 2PX5A 3FBGA 3KLBA 4GKVA 4O5OA 4KXQA 3WNZA 1PVDA 1DV1A 4WFJA 3ZDRA 3ZWNA 1R0XA 3NV7A 3U48A 1KI4A 2WFAA 1EFVA 1DXQA 3CT4A 2ATIA 1Q77A 2K7FA 3QVLA 3LLVA 4M99A 3E9QA 2DP4E 4DNOA 4CT5A 5I45A 2IPAB 2VPYA 2NTVA 3GVXA 3Q11A 1IY1A 3I4LA 1OGJA 3K92A 3F1LA 1Z2PX 3TZKA 5HVNA 1VL2A 1AT1A 3D1JA 3LC0A 2BV3A 4DIBA 3JQEA 1AS0A 3I2HA 3LPLA 1TD9A 5KQPA 1NBMD 2VOJA 1PQYA 3JWHA 3NBAA 2VEDA 4HRVA 3V2GA 4DT1B 2AEEA 3K4PA 4HDQB 4YN3A 4XW2A 5CFLA 2DWOA 5DSXA 4MW2A 3SQMA 2O8DA 1H2AS 3ESDA 2GYWA 2RGWA 3V8BA 1OPRA 1UMKA 4QOGA 4QNMA 1AS3A 4ZT7A 3DLBA 3CRMA 2NG1A 2I4LA 2YW9A 4XEHA 5CT6A 1N9KA 3HBLA 5EP3A 4ASUA 3ILXA 4C78A 2AMYA 2IPOA 3ZN2A 4CCYB 3KO8A 2GZDA 3VNRA 1CZOA 1PW7A 5D00A 5HKLA 2IZ7A 2ZJ8A 3ESZA 3P5BA 1UJ6A 1FB5A 2YQ4A 3TIXB 2O8CA 4WLNA 5GVSA 1NN3A 3IBGA 2Q6OA 4G4IA 4RPJA 2JBAB 2B78A 4IF4A 4RY8A 2BUBA 5SZJA 3C3DA 1DQPA 1DT5A 4BCBA 4ITUA 4DANA 4WN3A 3EY4A 2PUWA 1AKNA 2Y76A 5FCDA 3G23A 1QB8A 3FDZB 2GOYA 4GKAA 3E27A 4E70A 4LWOA 4EZEA 5L3QA 2HJVA 4OG2A 1WD7A 4AY3A 3BM5A 1ZMTA 1G55A 1ZK4A 3D2CA 3N6XA 4L4SA 4D46A 3LCVB 3GRUA 4RKYA 5ESWA 3K9QO 3M6WA 5CFRA 4KW7A 4BLPA 1Y63A 1TYEB 2EFYA 2FXIA 3QOFA 4PN7A 1XRNA 4C88A 2VZ0A 1HRKA 3WKEA 4O2RA 1D1QA 1NY5A 5B58T 1V6AA 4CF6A 4YAFA 1DC5A 3S8YA 1S8NA 2C84A 4B6OA 4N39A 3D54D 2WRZA 3NTQA 3VO2A 1L4BA 3PWKA 5FLXA 1EWRA 3FSRA 3IVRA 4RHTA 1QONA 3ON5A 1KYWA 3W34A 2HCFA 4P4LA 4G0PA 4Q4HB 2JK0A 5GGXA 1SZJG 1YC5A 3M2TA 1DGQA 2IH2A 4CQMD 1UPTA 1TC2A 1GDDA 1W19A 2O3JA 5CJPA 4ZYUA 4BTVA 2GBLA 3NP9A 4P3KA 4Z53A 2W37A 4KOEC 4Z1OA 3PJGA 2JEZA 4F56A 2B30A 3SYKA 4MV6A 3UJ9A 1CT9A 3LCCA 1K8QA 1V16A 1Z45A 3L6RA 4FI3C 3C43A 5FO0A 4DWJA 1VJGA 4NG4A 3EXG1 4AY2A 3DBHB 2QVLA 2ISSD 1BD4A 5HS6A 4DIKA 3ADDA 2P27A 2QA5A 3UJHA 3GGGA 1V16B 1A9QA 2B1RA 1CUGA 2Q3JA 2X58A 3E2MA 3OPQA 4N5NA 4D56A 2BTEA 4JYCA 3H1GA 3TE7A 1GTMA 4D43A 3FPEA 4ZDIA 1RXUA 4AS3A 3TW0A 2C2MA 2KX7A 3V1MA 1HDIA 3HCAA 4KDCA 3WGHA 4Y0VA 1ATZA 2AV6A 2C3YA 1S2DA 2ON6A 4IDCA 1XQWA 3TD9A 2AW5A 4EBFA 1Y8QA 4QATA 1B2LA 4XXHA 5LDGA 4OF4A 5I8PA 3B5JA 4B7UA 2VDMB 4G1CA 2O1WA 3D8RA 2UXDB 4RZIA 2DY0A 3I2JA 1M6EX 3PGXA 4NDZA 4PC1A 5TVGA 4AF7A 4Q21A 1N7JA 2UZ1B 2Q5LA 4GWLA 1ZN8A 5DWVA 1NN0A 4QJ3A 5KYWA 1TOAA 4RFLA 2CHGA 3H2GA 4GOND 4LGYA 5KSWB 1T2DA 1O95A 1QIKA 2B9EA 3B3QA 2AI2A 1GZ6A 3OQPA 2IF2A 3I8XA 3QKIA 4WTOA 3E7PA 3LA8A 4UFOA 4B3IA 4MWSA 3CRZA 2ZIVB 3F6PA 2VHVA 3FDFA 1O9HA 3FWNA 3PG5A 1OREA 4KUEA 1EK2A 1FRZA 2C8KA 3H4VA 3LPMA 4C3ZA 4C7OA 1JH9A 1DRJA 5EP4A 4G5GA 1ESMA 3AESA 1N7HA 5SY6A 1H6AA 4F5ZA 2EG5A 2FEKA 4P6VF 4PEVA 2VHTA 1EEHA 3A0RB 3EFHA 4TTPA 1SM4A 4HNQA 5B3AA 5GP1A 1LC0A 4M3NA 1F60A 4INOA 4YTEA 3P0HA 2JFUA 2X5OA 1WQ1R 2YQ5A 4M0EA 2R9VA 1J1ZA 2CZCA 2ZI3A 2WWHA 2NU7A 1B42A 4KR7A 3IIKA 2FPMA 1EWVA 1PR5A 2AJLI 3EUWA 5ALMA 1A76A 3HDGA 1ZN2A 2QAGB 1CVIA 4FHCA 1D9XA 1XMXA 4IVRA 2Y9MB 4LBZA 1KAQA 4BN0A 5CXQA 4QEDA 2EHJA 1QP4A 4UOEA 3UOWA 1KYXA 3H0KA 3L3BA 4KLRA 4MWGA 1KXZA 3TBHA 3VKUA 1IM5A 5BN3B 2PUAA 2PUFA 4NSNA 1UXOA 2ZK7A 3C8HA 2BZSA 2PT9A 3HSKA 4NCBA 1JLSA 2B34A 2YXBA 2O0KA 3DG9A 3OA0A 2RJNA 4EJMA 3I9JA 1KR5A 4Z7JA 5TGZA 2FN3A 4WK4B 4F5DA 2CHUA 5IH3A 4B9EA 1G20E 3UY4A 1OMOA 3LOUA 1M74A 1WV0A 1GSAA 3NQ41 1LEHA 2Q5QA 3PFCA 2I2CA 2P67A 2YRFA 4FYKA 2BBOA 1B16A 3JYLA 4CNBA 3SZUA 1EB8A 4U9HS 2C3PA 2E37A 1SUWA 2Q0XA 1CNMA 3JQFC 3TQQA 1OD6A 4XQGA 1ZWLA 4Y0AA 5JDCA 1RS0A 2D5AA 5JCJD 2F9FA 2XBUA 4OXNA 4XD7D 2RG7A 1JNXX 2I3ZA 2PJZA 1KFKB 2ZUCA 2H2WA 2RMKA 3G5UA 3NPAA 1RYEA 2HREA 4M1EA 2VWQA 4UHKA 2LBPA 1PZNA 3ZGVA 1P2UA 3TUZC 3R9IA 3SFVA 3S29A 1E5DA 1I6KA 5IJ0B 3OFJA 1N3YA 3REQB 3QWIA 4JJ6A 4WNYA 2NXNA 1I5OA 2P78A 3A1TA 3C6MA 3ZK8A 3FVVA 1YZVA 4IX1A 4X95A 1U3DA 2XE4A 4COKA 3KXDA 4FDLA 2BDEA 2PXAA 4KWIA 4D57A 1JIUA 5KNDH 3QU7A 4FYVA 1XZPA 4NZYA 1W93A 1PCXA 1P2FA 1SCKA 3QJ5A 4DNQA 1EJ2A 2B1JA 3FYUB 1JNYA 2WINI 3GI1A 1J6UA 4K6FA 3PITA 2ISQA 2I8AA 1AK9A 2ZTVA 3U4GA 2Y4NA 3OPMA 2FSSA 5EHIA 3SYNA 2EZ4A 1AXGA 3A1NA 3C3EA 1Z2CA 4PRLA 4D8UA 3ZHYA 1CDDA 3WP0A 1QDUA 3GGPA 4HWSA 5I7AA 4AUEA 4S1PA 3BSFA 2AJ8A 3WYBA 2FKNA 1JTEA 3IIIA 2WC1A 3F4KA 4JEHA 7GPBA 1I6WA 3GPDG 4XWWA 3G5MA 2F7SA 3OZCA 4HQKA 3T7CA 3F0TA 3K32A 3FOBA 1T8YA 1AZWA 4PZPA 5KSOA 1XZKA 2OBNA 4ZJZA 1BEUB 5DSZA 3ZD8A 2C57A 1BEEA 2R7MA 4R0VA 3AF4A 1IBCA 1FPMA 2DTXA 1ZLYA 4JZYA 3IBSA 2D4HA 3LFHA 4A16A 4MJLA 3QYFA 3T3EA 1KFEB 3PR2B 1KEWA 1BAPA 1YCGA 2JAHA 2VJQA 4I55A 4FONA 3TNFA 3L9WA 3BIXA 2P3LA 5IAGA 5TT1A 3RVLA 3CCBA 4BQQA 3WL6A 2WMDA 1SKBA 1H66A 1L2TA 1AKTA 3Q3VA 2P3QA 4M1TA 1C81A 4MQFA 2ZBEA 1EVQA 3CMCO 3FHJA 4ILKA 3DLTA 5IUJC 4MA0A 3ZCXA 2IYSA 1XHLA 3M2PA 3C70A 5IHPA 1ZGJA 2RHOA 4GX2A 3U7FB 4WXMA 5CX4A 2ZTUA 2ZROA 2GK7A 4US1R 4F12A 2QK4A 4RU1A 1AQIA 5HZMA 1OF1A 2PWZA 1B26A 3K94A 4ZANA 4A6PA 1DMSA 1P91A 3ERCA 4YMWA 5KNCH 2C7GA 2CYBA 4JVOA 4NCIA 1YHYA 3AB7A 4ZAVA 1QH8A 3DBVO 5BUZA 2P9CA 5DW0A 1ZH6A 1N2OA 2GM3A 3ANMA 4WESB 3HUDA 4XPZA 4JVLA 3N7AA 3GN2A 3SY8A 1DAOA 2Q3HA 4DW8A 3TDNA 5JE8A 4IY1A 2GJKA 1HOXA 1RM0A 4NBKA 3OLYA 1V3VA 2CFSA 3TIIA 1C3XA 4KGZA 1G8GA 3AU9A 3KPYA 4EB3A 1N2EA 4ZI2A 5HM8A 1F5NA 1Y3BE 2WD9A 1V7CA 4O0LA 4WACA 4J3NA 4GMKA 1L1EA 2DAPA 1F5SA 3D2LA 4L95C 1MDBA 1TT7A 2R6FA 3NTUA 4MGYR 5AJUA 4OO3A 5ED0A 4ZVTA 3HUUA 4MPJA 3PE6A 3GG9A 2C5BA 1N6HA 1U3UA 4XLTA 3KCQA 2IE0A 3Q9UA 3JU3A 4OUDA 1QQTA 4WNAB 1YBFA 2I67A 2XLBA 1QIFA 1S3GA 1GPKA 1KEUA 1U0GA 2RGNA 2OD9A 4RKRA 4D9JA 2IHKA 5F3WB 1N77A 3RT1A 1IQ0A 1J2JA 4GBMA 4Q9JA 1UJBA 3ZX5A 3UMMA 4QVIA 2ASEA 3F6SA 2D54A 5ICCA 1L5LA 1Z22A 3WAJA 4LJRA 1F38A 3E18A 3L7BA 2CHFA 4DLLA 1FMTA 5L3QB 1H0RA 4E5VA 3NVKI 4E4YA 5LZ8A 3PQFA 1Q7RA 2WB2A 1E1NA 2IQ5A 2J9ZB 1O08A 3OE1A 3N2GB 4EPYA 2F3QA 4HJXA 4O3MA 4Y2SA 1C9MA 1G8YA 2HMWA 4CODB 2LIPA 2GBGA 1L3BA 4HFJA 3O7WA 3W5UA 4GXNA 3ZJVA 1L4NA 3PKJA 4OK5A 1ND6A 2DQYA 3BXXA 3K0FB 3TTSA 3CGWA 3LGSA 3CURA 4K7JA 5KYNA 2VUUA 3L4BA 1A04A 1L4LA 2Y4OA 2CCKA 3HA2A 3P2MA 1BRTA 1N0UA 1YR9A 2IE8A 4L16A 5INTA 3BSWA 3U4IA 2VIIA 2ZS9A 3LPNA 4KX5A 1I1OA 3BC1A 3DBRA 1R8XA 1UPBA 1KYVA 4NOMA 3WL3A 3DL0A 3B36A 3SKYA 3WLTA 2QTVA 4GL2A 3ABZA 1LI4A 4K6MA 1AMUA 3RIXA 3OCUA 2DUWA 3K30A 4EA9A 2I54A 1C0IA 2GZRA 3GGDA 1IWOA 1I51A 4DMUB 4EYKA 1X70A 5FWAA 5B4UA 3EJWA 3C15C 5CX1A 5CLJA 2VP2A 3GBSA 3INNA 3AHJA 4F3TA 1PS9A 1WB6A 2PQ6A 1CD5A 1WD5A 4WOPA 5T4BA 5C1BA 3O8OB 2Z3VA 3HLKA 2W43A 4K40A 2IK8A 2IEIA 1BW9A 3OWOA 2MYUA 4Q3KA 4Q24A 2SNIE 2XMPA 3O82A 1A95A 1RT9A 4LXUA 4DDKA 3SC2B 5AW1A 3D3WA 2D13A 2W58A 1FDRA 4FHGA 4LY0A 5D3KA 4XWOA 1S4QA 2E5LB 4C4YA 3TI9A 5EIWA 3UZUA 5F2EA 2DETA 2DBZA 3MXTA 1IEWA 1OIWA 3DT9A 4INAA 2ECOA 1YGYA 5CFMA 2PGNA 2FWNA 1R0RE 1BMQA 2XUOA 3VVLA 2DFTA 5D51S 1Z5WA 1T9AA 2B3DA 4Z9XA 4D99A 4ZI7A 3VU0A 3IPLA 5D3MB 5KHOC 2MMGA 2VXOA 3G13A 1AU9A 3QMVA 1YKFA 5ILGA 3R7WA 5I3CA 1LLDA 1LLQA 1N2CA 2HI0A 3FVQA 4AZ3B 1J00A 1OBFO 1FDSA 1L9XA 4FQ5A 2IOHA 3ISJA 3V4LA 4AWBA 2HWKA 4TMYA 2IP2A 2O7VA 2LPMA 3MN1A 4QAQA 4IIUA 4EZIA 3DYBA 1AQNA 3NHWA 2E0IA 3R8FA 3C1AA 1TI7A 1ECFA 1G3MA 1G5RA 1MORA 4PPGA 2O3UA 2Z4RA 3CLKA 2ZRAA 1FP2A 1XJ5A 3O1HB 4LGMA 2R6JA 3H5RA 4HQ0A 5H16A 3D64A 3TXAA 2O57A 3TS1A 2RH9B 2Q1WA 3HYTA 2FW9A 3KETA 3INTA 4D79A 1ZUD1 4JL6A 1VJCA 3AJAA 4K0RA 1OTXA 4DV3B 3PNSA 2I99A 3NOVA 2QMZA 4YQEA 3BXGA 5CLGA 3QSGA 3MZ0A 4H7PA 1YF3A 1QH0A 1J5XA 1OYWA 3GLFE 3ROQA 1NL3A 1SZDA 3GJZA 3UGQA 1ZHHA 3Q4GA 2Z2KA 4UAVA 1NVTA 2CUTA 3SQNA 1NVVQ 2AA3A 4Z0PA 4ZCTA 1ESZA 3KP1A 4HDNA 4MRSA 1OWMA 4IG4A 1AOXA 1ZQ9A 2H59A 2C82A 4M1ZA 1GPMA 3P2YA 3IHTA 1FU4A 3V1KA 2YINC 1KE1A 3Q5DA 1RYNA 3CX8A 3EWAA 1LD3A 1LJ8A 2HJHA 4KI7A 4LXYA 4YJKA 1B3BA 5CB4B 2WVAA 3FFXA 1IEXA 5FBZA 1VGVA 1XAIA 3RSLA 1M2WA 3EYAA 1O94A 4EJSB 2BI4A 1ZH4A 2YJ4A 3QFRA 5FPQA 3NI2A 5JV5A 3RNOA 3U4HA 2GSDA 2OG1A 1DL5A 1YJBA 1XTIA 3KUCA 2O23A 4IRXA 5BMVF 4PLZA 1JWLA 1DAPA 2J9YB 3K8ZA 5JBQA 4O63O 1LS6A 4BMXA 3DSRA 4HNHA 1OFVA 1TQ4A 1SHKA 4G0XA 1WETA 1F20A 3CSUA 4MQLA 1FW6A 3CGGA 1JEDA 4S1WA 4EWLA 3TB4A 3FOCA 1XLUA 2I1WA 2I4TA 4LJ8A 4WLEA 1E1CA 4AJPA 3G79A 3AB8A 1I94B 1H3EA 2QWXA 3TZLA 1QM5A 4FDTA 1ISSA 4I4LA 4B3CA 5T4HA 3GWGA 2AOTA 5EKSA 2ZZMA 2GBIA 4QU9A 2XOEA 2Y71A 3I9V1 3AKZA 2I8CA 2DMRA 4V2UA 1W8IA 2BFDA 3L8YA 2BTQA 4M9UA 4EAQA 5FA5A 5C5EA 5EJAA 3HJFA 1SCNE 1P7YA 1XKLA 3ZBTA 1JHRA 1JU9A 4I3GA 2AZMA 2BFBB 4BMDA 1GKYA 1WO8A 3CMMA 2IWRA 3LBFA 3L4EA 1N3IA 4ZP1A 2C5LA 2GEUA 4O3FA 3FYHA 3T0IA 2ZRHA 3TYXA 4EB8A 4E3ZA 5JWRA 1QIDA 4NENB 4G0MA 4L4XA 3ZWXA 5F7OA 1RDFA 4ZYXA 2XCRB 1ZGGA 5GQSA 2AXNA 1FLAA 3TPFA 2AF3C 2WLTA 1CUBA 4LI3X 3RTBA 1EGQA 1A9XB 2AC7A 3SZGA 1F2DA 4AIIA 3NNNA 1POWA 4GOKA 4I6JA 3VU9B 3O3MB 2Q45A 2OGWA 4ZI3A 1QVAA 1KEPA 4QRDA 5J58A 2VF8A 2VP4A 1UC5B 4GKBA 2XITA 3LAWA 1DAFA 2F4NA 1BE0A 4PAGA 1JLRA 1UFKA 1UFOA 4GF5A 1L5NA 3WP1B 2BSQA 1DELA 4O4LB 1DBPA 4ZZ2A 4G85A 3NGMA 1Q19A 2RB5A 4L1KA 3IE1A 2F9MA 1J42A 4HEA6 1QX4A 3B3FA 3OF3A 3UHOA 1IHDA 1X7ZB 4X5OA 1PDWA 2J9FB 4MUJA 1V3UA 4NCJA 2FFQA 4BVAA 4IVQA 4UM5A 1F3OA 3O8QA 2GVZC 2B92A 2C59A 1P8AA 2B82A 2RGAA 3DTVB 3HL0A 5BWOA 3IP8A 2X76A 2PAAA 1ZNWA 1GU1A 1LVUA 5A71A 5BNIA 1CUUA 4KXFB 5IYZB 5KMGB 4BFCA 4EZBA 4LHXA 1K92A 2V5UA 4X1KB 4TLLB 4B6SA 1P3JA 1QCYA 3TLEA 5LZ7A 4R81A 3PB3A 2BW0A 4JFAA 4ZVPA 1GGFA 5LQRA 1WCXA 4XDGA 1P9WA 1N0VC 2QZSA 4NBLA 1Z5VA 2H8KA 3EIQA 2O8NA 3JQBC 5KQLA 1PS0A 3A2NA 4EA7A 3GPBA 1RWPA 2X41A 3EIUA 3KM0A 2QY6A 4PE5B 4A0FA 9GPBA 3P45A 4WGFA 5TB5A 4E2XA 1SC4A 3OCXA 4XB2A 1A2KC 1JXAA 1OXSC 4NG5A 3WGOA 3WK6A 4F8EA 1F0PA 1H2XA 6NULA 3GLIA 1SNYA 2VNHA 1LX6A 3A9SA 5CM9C 5ESDA 3S27A 4DG9A 1KDZA 2D62A 1E98A 3B7WA 3KWFA 4H7EA 2R1ZA 3FUCA 4H6PA 5AOCA 4UFPA 4D5EA 1F51E 2KWIA 1PEYA 2APJA 5SYNA 1XTSA 3K9HA 2EJWA 2GO1A 3L1HA 3PPIA 5G1PA 3RU3A 2I1VB 3ZV6A 1CRLA 3HGTA 2VSFA 3WISA 3T5AA 5KREA 3ZWPA 2Q8NA 1LPOA 2OFXA 3BD7A 3QY0A 2J3MA 2J0SA 5BSHA 5FR1A 4G25A 1FP6A 4JI4B 1CJVC 1TMOA 3E61A 1RACA 2C1XA 4QOEA 5ELMA 5FNVB 5C5DA 1J97A 2W6ID 4KL8S 4KN6A 3R5TA 3BMNA 4NI5A 1RJEA 4DARA 2IZOA 1RI2A 4F0JA 1UXGA 1P0QA 2IF0A 3FMPB 4OA5A 5FUVA 4TQAA 2QQGA 2PTGA 3ICWA 4G0NA 4DUPA 1RPZA 3DR5A 3GLRA 3D9QX 4YO7A 3KJZA 3RS0A 4W9MC 1QOQB 9ATCA 1H9BA 2WTBA 2IKQA 3BXHA 4B83A 2EX0A 4ABTA 4ZPJA 3RSOA 4L8LA 5HNKA 1O95C 1NVWQ 1O89A 2PL5A 3HSSA 4IDGA 1CYDA 1TZBA 5BYAA 4R3WA 5DIFA 3T9BA 3LIIA 4CMIA 1NN1A 1M6YA 4IEIA 4TSFA 3IQIX 4RQTA 3C41J 2O2SA 1EK6A 1KH2A 2C7BA 2J3DA 3K72B 3AKDA 4RQUA 3RRZA 4BBZA 4E21A 1B0ZA 1W75A 4BXOA 3HFGA 3WHIA 5A0TA 3C8DA 4OH7A 2BP7B 4BFTA 4EUKA 1YU6A 3G5AA 4MP3A 3WMRA 1EUQA 2HW8A 2JIOA 2XSZA 3DBHA 4NYMR 3ACCA 2FW6A 3ZJ5A 4FCWA 2YRWA 4KLCA 1FNNA 4ZCLA 2Q50A 1SIOA 1DINA 1TMGE 5CW1A 3C2QA 3WAKA 4DBLC 4YRFA 3M6LA 2CLSA 2HMVA 4MJXA 1EZZA 4RIEA 1J56A 4TYPA 1XG5A 1EVIA 1V7PC 1TYDE 4HXFB 3V1LA 4MRMA 3WLOA 2M6SA 4MUNA 1M0SA 1O0CA 2EKZA 2Q1TA 3DFZA 1U3CA 5KVCA 4GR5A 4D9NA 5IDQA 2Q62A 4B6QA 1UOPA 3GUVA 4W99A 1KZ6A 2Y99A 4J4HA 2AXQA 4MUXA 5A9RA 1IUNA 2E2WA 1Z12A 2WJVA 5DNAA 1JX6A 2Q3EA 4HGQA 5E0OA 3DEIA 3SEFA 2XNSA 1RLUA 4U00A 1D2MA 1GQ2A 4PV7A 1USVA 3X1KA 4NQRA 3TQCA 4YBRA 4RVHA 3LXUX 3QVXA 1H69A 2P2NA 2Z8YA 3IP1A 2XYRA 4H0CA 5EJFA 4FIDA 2AK2A 3M4ZA 1ECBA 1Y9AA 2D1TA 5F51A 6Q21A 3UAXA 4MJ3A 3O3CA 1YT5A 5AO9A 5LQJA 1LW7A 4NKRA 3WLAA 2C83A 1DJMA 1BXRA 4X92A 3MNFA 4E4TA 4GMFA 1N34B 1DJPA 3AG5A 3KHTA 4Y9UA 1E1LA 3RSQA 1DAGA 3AP2A 1EVLA 4PW0A 1ZIDA 3FUXA 1R7RA 3OQNA 3HZRA 3NUGA 3PSHA 3ZDFA 4PTLA 5AJHA 2H2IA 1B8OA 4ND6A 2OFOA 4PFJA 5SZKB 2Y0CA 4M2LA 2BLLA 3WL8A 4OD0A 2LIVA 2QRVB 2ZBDA 4XGNA 2ZRBA 2VOEA 1FC0A 2OV4A 3LQKA 1J0EA 3QVVA 5CT4A 5A4AA 3L8HA 3JW8A 4FSXA 4QPNA 1N6PA 3MJCA 3RSFA 4Q19A 2V1XA 3FPKA 3UBMA 4ER7A 4RXTA 1Z0SA 3FWYA 3JZDA 2XZDA 4PHCA 4ZYTA 3PUVA 5K0BA 3KOUA 3UHJA 1NG1A 5FA8A 1M6WA 5BSMA 5K8JB 5J3JA 3WZMA 3EQ7A 3TNDA 1UJNA 3ZXSA 1V1RA 2ZJYA 4ZOBA 3O8LA 4CQNA 3GA5A 2M2IA 3ZV5A 2YRXA 2ZATA 2A58A 1I32A 1TJ5A 5DMHA 3I1FA 2CZGA 4HO1X 5F7JA 1X7YB 1NIPA 2VJOA 3HXTA 3EGCA 4QPPA 5JJ5A 3FOAA 5JALA 1V8FA 1JIQA 2I5PO 2WF8A 4M6WA 1Z8FA 2VQ6A 2PMEA 1CC1S 1SGWA 1Y80A 2VRCD 1Z4PX 1J8VA 2YWEA 3H5AA 3M7IA 3RD5A 1NRIA 1UBOS 4J0CA 3ZLTA 1HT1E 3L0BA 3ZHQA 4K9OA 3ROZA 2QU7A 4B2PA 2X5XA 2QG9A 5CFQA 1M3SA 2CKDA 2I6FA 2X5KO 3EXHC 2JG3A 3MD0A 5D87A 2AQHA 4MP6A 2PYDA 3F98A 4IEEA 2IVFA 4KQ2A 2G5CA 4BQFA 1R9MA 4IKPA 4KIUA 5KB3A 1T5DX 2NSYA 3WRYC 1SUAA 1W88B 4X54A 3H87A 1XEWY 4G23A 4AJ2A 1STOA 4NPAA 1H6DA 3TZHA 4CLHA 3VOBA 3QX8A 2BFMA 3H5OA 3PNPA 4DTIA 2QJWA 1HG1A 4UASA 3RREA 2GDJA 1PZGA 3HM2A 5E2IA 4EKYA 1E8DA 1TJNA 3NZEA 1C1HA 3QV1A 1ORTA 3PFKA 2JCBA 4GI7A 1E6UA 1RXSA 1QQ7A 1GZHB 4GDMA 1MQ8B 1SUCA 4RTSA 4II2A 4FCCA 5JCJA 4TWBA 1P80A 5L6LB 4K81B 1HLGA 3T7KA 4TYNA 1LU9A 5ALEA 1JG3A 5AKJA 3DKPA 4QBIA 3N2KA 1ZM3A 2GPNA 5D86A 2QL7A 2ETXA 4R4JA 4ZQFA 2P6MA 4HZGA 4DQVA 1E7QA 3PX3A 2YHUA 3AJRA 1UBFA 4LPKA 4X7BA 3RYFB 1N1GA 3ZVKA 3VOSA 3TEJA 1L5ZA 2R25B 1OWPA 2ZTMA 3CX7A 1SEPA 2B21A 2P0AA 3F9IA 4DA7A 3CRVA 3GWZA 3BN3A 2ZI4A 5HQ3A 4BUCA 4RLHA 4UPEA 2FWMX 5G02A 1G6HA 1Q95A 3QRWA 3AHEA 3ITDA 3DBOB 2V7TA 2AQIA 2VP3A 4I1RA 4YWHA 4EMUA 1HSOA 5E38A 1LFDB 3A6GA 2JPDA 3JWEA 1YB2A 4AKTA 1UBNA 2DWCA 3S6JA 2WNSA 3BDVA 3PUHA 5HF8A 2WSMA 1QF6A 1EQ2A 3JVUA 1PEKE 1MO6A 1WQ4A 4BZWA 3B78A 3QEKA 2I7DA 4OP2A 2ZUDA 1Q3KA 1ZM2A 3FA2A 3K0FA 3NJRA 1TIPA 1NLZA 3WADA 1BEZA 1LSSA 2AEMA 2ZIXA 5EWMA 1YTLA 3HEBA 5K0EA 5DYNA 3OTOB 3UMRA 1BCRA 1M2JA 2IYOA 3SD7A 3FHCB 3EPPA 2ORVA 1X94A 1RAIA 1XMSA 4JXZA 4B7ZA 1SU8A 1ZI8A 5LQMA 2BMVA 4ZCQA 1BCSB 1P1RA 4DBLE 1NI5A 1E9RA 1PK7A 3CEMA 5I8ZA 4DUGD 1JEYB 4BFXA 4Z4FA 1WUKS 1X7GA 5G4LA 1TMYA 4OGFA 1JQDA 3HN7A 3IQWA 1VG1A 4TV9A 4MO9A 4XGQA 3E4DA 2HLDA 3BQ9A 2QIPA 4GSLA 2O5EA 3MF4A 4OX9B 3GP5A 1U7OA 2P9TA 1JEAA 2PKRA 1Y5NA 2AX3A 3SJCA 1ZJZA 1EK5A 4OI4A 5AHXA 4F97A 4Z4HA 3ADCA 5J40A 2WABA 4YJ3A 1W46A 4DJFC 1JEQB 1T0UA 1PO7A 2YWXA 1OHHA 4IQ0A 2GJSA 2NU8A 2ZFUA 3U26A 3UHFA 3LT4A 3QTTA 1SKYB 4M38A 3RRJA 3O83A 1MUUA 2OAEA 3E9YA 1GCAA 3MA0A 1SKMA 1Q1QA 2HPZA 2O0JA 2FK7A 2W90A 4N3CA 4UM8B 4HVLA 2C54A 5C5IA 4GR9A 3S2GA 4DLVA 1CUXA 3C7DB 4FB4A 2DPGA 1T24A 2UVPB 3OTIA 1TCVA 1X42A 1O4VA 1WNTA 3E7DA 3SC6A 3U3MA 3V8RA 4BEJA 4UJ5A 4V0RA 4PNPA 4DS3A 3ND8A 5AK6A 3PR3A 3O8BA 4Y2YA 2AE2A 3SAJA 4URVR 3ZU5A 1ZOLA 1U28C 3KS9A 1LVGA 3GMDA 1H8EA 3JQAD 1NW4A 4PLPA 4OXRA 8ATCA 1NLUA 2JAXA 3P94A 2G9ZA 1E6CA 2ZR0A 1BOOA 1FMLA 1K7SN 2OLKA 4RS4A 5DNEA 5B3JA 4X0EA 4FE3A 2NZ8A 3L5KA 2RSLA 4EJFA 3EXAA 3JRNA 4B34A 2C31A 1DOZA 3BF7A 3IHKA 3ROEA 3AERB 3WYAA 3PPYA 1S7GA 1QMGA 3BQMB 2V0GA 5F3RA 3H75A 4WCFB 2YQZA 1NUAA 2DFVA 3W1WA 2C42A 3DXYA 3R3WA 4KYTA 2JLXA 3OEED 4C3UA 3C24A 1R5JA 4GYJA 3UQYS 3FFAA 2W6ZA 4GGMX 3A4YA 4DDTA 4HDSB 4CM5A 4GLBA 2XTMA 1CR1A 3IALA 1O54A 4WLOA 4YMTA 1OLSB 4IH4A 3STUA 1X38A 5TQ0A 3U7EB 4J0EA 3W1EA 1OROA 2JFWA 1WVIA 2A5GA 2J0EA 1B15A 1L4YA 3JTEA 3OKFA 2B4AA 5CDFA 3SNKA 3ZU2A 2PTHA 1L5HB 1XQ9A 5KTYA 1H9CA 3V1YA 3KVNA 2PX6A 3RU7A 3HFJA 2GVDC 3QKRA 4G26A 3NAZA 4OHRA 1XZGA 3KKQA 3TW4A 4HS4A 1E3SA 1SOWA 3IVAA 2YL2A 2A0UA 3CZRA 3QI2A 3TR6A 3K6SA 2ODQA 1ODLA 4M9ZA 2PY6A 3LDHA 1YS7A 1KI6A 2QUHA 3LHIA 1TUEA 3OZEA 1IJKA 3NC4A 3P97A 1NOKA 1W76A 3IAFA 1J7JA 4FEAA 2QZZA 2M6KA 1PN3A 2RIRA 5FWDA 2H2DA 2GPWA 3X2EA 4CG3A 3WGYA 1QZZA 5I9IA 1I2MA 2OBBA 2ZITA 4KLAA 1QAOA 3ZS9A 5DNUA 2G7ZA 2AFHE 4HQLA 4L74A 5KTKA 2BE9A 1JHZA 1U2TA 2BOVA 221PA 2X7HA 1IIRA 3GRFA 4EB6A 2CDAA 1XK6A 2AI3A 5E2BA 1YI0A 2F2TA 5IN5A 1GKIA 3IELA 5IKXA 5MHTA 2MSNA 4PZAA 3THXA 3WHPA 3U31A 1CUVA 2NTEA 3JATB 4KWEA 3VPGA 3CT6A 1HSZA 5JMWA 3I9FA 2X6RA 4I9GA 3SJZA 5BV2P 2YV1A 1HDCA 1M8JA 5EHNA 4YCJA 3ZHXA 1H2RS 3W2HA 4OGLA 5TMEA 3EPJA 5I6DA 3VNVA 4DDWA 3RT9A 3TVTA 4OHPA 4L2IB 1ZBDA 4ND4A 3DFFA 4GRIA 4QD3A 4CT4B 5ITZB 3K9FC 2ODEA 3I04A 3IPRA 4IIFA 3KOXA 1KZ4A 2YCLA 2QLMA 5HEKA 4Y7CA 3BIWA 1T43A 1E63A 1I5EA 2WG1A 5GOTA 5BR8B 4X60A 2FOLA 2IZ5A 3N87A 2BGNA 1NT4A 4P38A 4I50F 3UFXA 4AKEA 2XUPA 1GEGA 3C97A 4ERXA 2M98A 1OJ7A 3QLEA 4NYJR 3I30X 1R9NA 3ETGA 3CZ4A 1ZH8A 3PC3A 1V41E 4JROA 3E6AA 1CFZA 2AFIA 2ZI6A 2VHZA 3TOCA 1FEZA 2ZXFA 4PAQA 3TBFA 3AONB 2XD9A 2ZSEA 4HH0A 5AW7A 4YBZA 4PHGA 3AI3A 1JMKC 5JZBA 2VZ8A 5HQJA 1CS0A 1NGSA 2JATA 5E1BA 2O2CA 3DCIA 1O87A 3T7TA 5H8WA 1JDZA 1TTQB 3QVGA 4N5MA 3KTDA 5CVCA 1RC1A 2C9CA 4HFRA 4E94A 3TLKA 3PYLA 5KVAA 1T36B 1SC9A 2G17A 1DBIA 3D8SA 1HETA 1NFFA 2Z1MA 2AX4A 3ABQB 2ZB3A 4JXXA 4NZOA 2CSXA 4D45A 1QANA 1YDEA 4YRPA 3A1SA 4BCCA 4YFYA 4X7MA 2RHLA 4ZVQA 2WZCA 4R98A 3D0QA 2O1SA 3TTVA 3SIRA 3WMGA 1TX4B 2A5YB 1CRPA 1IPHA 1O77A 3TF5A 1BVYF 5C7YA 4DUGA 1Z18A 4AUKA 4IKEA 5HGXA 3WYDA 5H80A 4BC0A 1WUTA 2WMYA 4G8JA 2IOYA 2VDPB 3K1AB 1ZOOA 2WMOB 4FEYA 4Q9LA 1CRZA 2VVTA 5K0JA 2H3EA 2VJKA 4NCAA 5JYCA 2IW1A 3OE7A 5IAEA 2BGJA 2ZSFA 4P7FA 2QYSA 1S6YA 1G8KA 1X1QA 2XF2A 5EWLB 5TGDA 3RRFA 4BN4A 1TZ2A 1AMOA 1JDTA 1Y81A 3GUYA 3PXCX 3KSUA 1IAQA 4FHEA 2F3TA 1CEQA 3UMBA 3HBAA 1KNXA 4X85A 5DGCA 3PI7A 3NONA 3OM9A 4EH1A 3ZGNA 1EBFA 5JTUA 5CB4A 6LDHA 3IBCA 1FSPA 4PHFA 2C7PA 1D2EA 4L5IA 1ANKA 3VOTA 2EFEB 1KO8A 2VDVE 4PNHA 1KSGA 3S28A 4AS1A 4MJ7A 1U28A 4W4TA 2RI0A 1QV7A 2LCFA 4MPPA 5COAA 5THQA 3V8MA 4I81A 1T6YA 3EY9A 4KNVA 5ABPA 4ZYZA 2A57A 1COWD 3FR8A 4GE3A 5K8VA 4F3CA 2ORWA 1Q16A 2PQMA 2FR8A 3TO5A 4F4UA 3GAAA 3NTXA 2AE1A 3N8GA 4KBGA 4P35A 3RU9A 1W4ZA 3O31A 4DQLA 2FJUA 2WUFA 1XCGB 1BU5A 4RAQA 4HGNA 3PJRA 3OI7A 3DE7X 1PJZA 4L7QA 5LA6B 4TSFD 4DM3A 1SUBA 2ZRDA 3WLJA 1IM8A 3UG6A 5BQ3A 1T5BA 2CC2A 1OI3A 4V1CB 2XUGA 4ARAA 1XZHA 3JPWA 5BY2A 1RYDA 2VYVA 1OFUA 1C80A 3FPFA 2WU1A 4HPJB 3NRBA 1LDNA 2HU7A 3B85A 3I76A 4LHWA 4MKHA 1TAHA 3FSEA 5CM2Z 2JGEA 3EG9B 3EGXB 4EG4A 1O8CA 3K1TA 4LJKA 1HZZC 1TLFA 3QMMA 4L8GA 4U7WA 3VZCA 2O8FA 1DBRA 2W8BB 3S2FA 1D09A 3GH1A 4KKVA 4DMLA 1W5EA 2ZRIA 4QUDA 5A5FA 2CZQA 3HKCB 2Q5HA 5K9ZA 3QTBA 5FR2A 1PZHA 1DV2A 1PQWA 1PQUA 4BQSA 3KZOA 3PPXA 4QKQA 3QEMB 2FPKA 1ZW1A 1B6GA 1JWAB 3BBPA 3BILA 2OHVA 3E7WA 2BGTA 3D3KA 3HCPA 3OOJA 3Q87B 1QCDA 2WP8J 3IXMA 4HX2A 2IHVA 4F1WA 2Z56A 1TUGA 1E0KA 3IEUA 4YAKA 4YJGB 3S2EA 3AF2A 2CMDA 4EW6A 3T3GA 5CLFA 1VHLA 4JQCA 4PC3A 2QRZA 4NMLA 4M55A 5DGIA 4X6YA 4XYLA 3H5NA 1K8YB 4B73A 1RBQA 1JBEA 4KO3S 1Z8DA 5E8RA 2VP0A 3Q0TA 3VTFA 1YVPA 3GCDA 3I1IA 3BMNB 3U19A 3EXEA 4KDFA 2HO5A 5JSZA 2CDNA 3DNMA 2FDXA 2NN3C 2QR2A 4IFTA 4QGAA 4LXIA 1N6RA 1QC5A 3SF0A 4HMPA 5C80A 2J4DA 1YBAA 2WJPA 3CONA 2ZRGA 4ARZA 1EINA 3P2IA 3PF8A 5FBWB 4Q3LA 4DJJA 4TVBA 5CDSA 2WJHA 4RZUA 5CDGA 1Z6YA 3DF7A 4QXOA 4CL8A 2WF9A 5KPJA 8AT1A 1QGED 2XDQA 3A32A 1GFSA 3P4XA 4O4HA 4PVDA 4S2UA 1V5EA 1DWOA 1OIXA 3BL5A 4DMRA 3LK6A 3BMOA 4JXKA 1IRXA 1FFBA 1FDUA 3ZHRA 4DV1B 2Q3MA 4WCVA 1DO0A 1SVSA 1YKSA 2MSWA 4JT4A 2GUGA 4R1MA 2NVUB 3HI4A 5T57A 3HJGA 2YHBA 2CFIA 1XMIA 4ER6A 4BMOB 2AOVA 2HO4A 1GAWA 2PEYA 2PXCA 3OOEA 2EWVA 1HKUA 1M7HA 4EUNA 2P91A 4K6CA 5HQTA 4UMVA 4R9SA 3LCJA 1LPSA 3UIEA 4JYMA 3ZCRA 4X00A 4YJGA 1R1DA 5KQRA 1RADA 2RC6A 1KO4A 1KMHA 2OO5A 4LMRA 4MICA 4Q0MA 1VCNA 2H00A 4UU7A 3UXEA 4P53A 4X7PA 3AETA 5AI9A 3X1JA 5CH8A 4CJXA 1LVHA 2XH8A 3KNZA 2W6JA 2FV8A 1L4MA 1NMYA 1IHXA 4OOEA 2VBIA 1V11B 5JXHA 2YZ2A 4TN5A 3GJYA 3AM3A 2UUCB 2W6NA 5B12A 3DDWA 3O90A 3THWA 2HT6A 4IVPA 1MHTA 4MSUA 1L7VC 1CQJB 1N7IA 5AXCA 4XRGA 3QVSA 3EFOA 4UVHA 5FORA 4ZCPA 4OQEA 2GN2A 1NMQA 2X8AA 4GQIA 2ZQ5A 1G8HA 5FHRA 4K87A 2A84A 3H83A 3UJ3X 3VX4A 4EX7A 2UUAB 1C1XB 1LPBB 1GILA 2IEZA 1RBMA 3OQ1A 3UTDA 2ZB2A 4WT7A 1H5NA 2C4VA 2PNFA 3GJTA 4FEGA 4DSOA 1JXMA 4E09A 5FOQA 1WTAA 3R5FA 1W9MA 1YDMA 3COVA 4YH1A 3DF9A 4M54A 1JG2A 3RRNA 1PBNA 4GPEA 4NXMB 5CCDA 5BSVA 1NP3A 3QU4A 4RD2A 2CXUA 3ABOB 2ZJZA 5BUSA 1QZUA 2PD3A 4IRMA 3WMWA 1A3CA 2AWNA 3DEFA 2FPPA 3FFBA 3IT2A 5JQGA 2OO7A 1CJSA 1NMXA 2PXXA 2D0PB 1E3WB 2HXSA 5U1PA 5JS1A 2NP7A 1GRVA 3AMVA 3K15A 1MJ5A 3OA2A 4PQRA 4KPGA 1KFCB 2R62A 1VFPA 1Z0JA 1M2GA 3WGLA 4BZZA 4EF5A 3D5EA 4BV3A 1E3EA 1MT0A 4FDVA 5KNDA 1UBRS 4FX2A 1ZL2A 4LE1A 4BEBA 1YQ9A 2EZ9A 5EHQA 1M2VA 1O3YA 4IGAA 4U7FA 1RWKA 3ECSA 1NKVA 4JZKA 3HTXA 4M9XA 5DWDA 4UU0A 3M34A 4I6EA 4ALLA 2CL6X 4ZJYA 1M54A 1ADYA 1RYBA 4IIYA 1YR1A 4MGZR 1GY8A 2ZYAA 4ZXPA 3H11A 5TE9A 4AJ1A 1NQXA 4NOJA 4YC7A 1FXSA 1RWVA 2P90A 4FZ5A 4N6OA 4EVQA 1RRVA 3ELWA 4S1VA 2GF2A 2P6UA 1XEXB 3CZQA 2C3UA 4DMFA 2XRFA 3PD7A 2FUG6 3U44A 2QRUA 2BKUA 1QHHA 3KAPA 3QQPA 2BRUA 3C85A 2VA9A 1RI4A 1QB7A 1RWBA 1WKBA 3T7AA 4O2BF 3O03A 1WB9A 5DP2A 1GZVA 4Q82A 4MH0R 1B7GO 5FUXA 4CW7A 4BASA 1WB4A 2SKDA 4CMEC 2FQYA 1P7CA 1RMTA 4JUIA 3HLYA 1Y4SA 5ERYA 3CM0A 3V4OA 3R41A 2FLKA 2I4MA 2HQSA 4ZRNA 1F6DA 2CCJA 1GQOA 2X40A 1M8GA 4FFBB 2ZKIA 2JF0A 3D0RA 3EOZA 5AICA 3VR5A 5JYEA 1IC6A 1VE7A 3FI0A 3FB1A 2MTBA 5HJ2A 4KQKA 3PR1A 1H2EA 4QGHA 4XJSA 2RKBA 2ALJA 5ICFA 3MWKA 1SMKA 3NB0A 4MW1A 1CUYA 5CITA 4DLUA 5FO1A 3UJCA 5A1JA 2PRSA 4QJ5A 4AD8A 4TMXA 1E2MA 3SSAA 4CMGA 3JD0A 3PJFA 5K6AC 1N0WA 5CFNA 2EL7A 3MB5A 1AUXA 3FFWA 1BNCA 2JGDA 3HKDA 2GM4A 2GYUA 2O3TA 5KYUA 3GV0A 2QD3A 1LNZA 4I5GA 3MRSA 1ENOA 1VA4A 3HO1A 2VQSA 5K3AA 1P2BA 3L0CA 1WY7A 5LIRA 3X0DA 2GLXA 1XN1A 1Q7TA 5I7UA 3MCVA 1IUOA 1CVLA 1L8QA 1UUFA 3LSTA 3HYSA 4M0UA 1J0CA 2Z6VA 4PLYA 5EYPA 1WXWA 4JH0A 1XDZA 4MHOA 821PA 1J4AA 1RPTA 3NWEA 1SULA 2PRJA 5K4GA 5E0KB 3MAJA 2DC1A 1JQ5A 3EFOB 5A4IS 1TJPB 1W34A 1SCUA 2AR0A 1WUIS 2NLOA 1OX5A 1SHTX 1E1RD 3WBJA 5KKCA 1QK3A 4XOIA 2F1RA 2I7VA 3KPJA 1WW8A 1IATA 2FEPA 4PX2A 3JASA 3P5SA 1DEAA 2JLRA 4G63A 4ZEXA 3GUUA 1JE0A 3ORSA 5JT1A 3KKPA 3LS2A 4W1RA 1QKIA 3CF2A 3EGOA 1T1EA 3ZCTA 4OU5A 2IYLD 3USES 2ZDHA 3PA6A 2Z5LA 4LJLA 3MSXA 2FSVC 3C6XA 3ICPA 4WNIA 2BHSA 1AZSC 3EISA 2YJTD 4GPBA 1YQWA 1ZK0A 1NOIA 2O50A 2VJPA 4POAA 1FXWA 2YZNA 3MGKA 4UNSA 5E8JA 3WL7A 4FYHA 4DNFA 1SUIA 3KHKA 1U04A 3DXZA 1MJGA 1JKMA 4EITA 4KXWA 3ANYB 4RELA 3MIIA 1XKXA 1ZK2A 1RE0A 2G77B 5DBGA 5BWMA 5C8DA 3GEGA 4OYHA 3ZWAA 1W2WB 3H9QA 2OCPA 2ZVPX 3FPBA 1CJKC 3I0NA 3JARA 5CTAA 2CLOB 4UE3S 2ZRNA 4A2WA 3F2VA 1I8TA 2JGDB 5DGTA 3FRJA 3EDRA 5EPUA 4HMQA 3IUYA 2ZAOA 4I5DA 1R88A 1O9GA 1XNJA 2H5EA 2JIQA 1AHIA 2C0CA 2PMDA 4RF4A 5FBLB 3SBDA 4HD8A 1KYQA 5A06A 1NAHA 1WR8A 5C4IA 1URPA 4EVRA 5AESA 5JISA 4TMVA 1SVMA 2I55A 4LKOA 5BSFA 2RHDA 3R5SA 3LE8A 4DV7B 2VKTA 1F9AA 3FYDA 1ZP6A 4YPFA 1W1WA 3IV7A 1Z62A 4QODA 2ECQA 5J2TA 4PHHA 3CUVA 2FVYA 2ZTLA 2A1TR 3BGSA 4CM4A 3K20A 2I2BA 3BICA 4BQRA 1BFKA 2BM9A 2BMAA 2X42A 3OICA 3G2IA 3KT6A 4FOTA 3PQ5A 3HNPA 3CPEA 5A3VA 1WMEA 1E0DA 2EIXA 2GKGA 1BC5A 2VEOA 4AN0A 2P0EA 4LXGA 3N75A 1L4EA 4IHAA 2SCUA 4MPDA 4ZAYA 4RTRA 4RTKA 4QDOA 4QREA 4R2HA 1EAMA 4R8RA 1CR4A 3ZJ4A 3ENQA 4UEKA 4TL8A 1OT3A 2Z3ZA 4QU5A 4K9RA 1T1SA 2EZ8A 1MXFA 1KSFX 2XRZA 1ABFA 2R86A 2ZAMA 4RF2A 4RMGA 1FNBA 3R40A 4JC0A 1H1LA 4KU4A 2D3TA 2QM3A 1EDZA 4XDYA 2JD2A 2KBEA 2WW8A 3OAAA 4QXRA 3LXRA 1O5TA 5EIBC 4CUJA 5C18A 3NVAA 2YH2A 4BRWA 5JS8A 1FSFA 3U7QB 4XJVA 2OZKA 2VFAA 2DBYA 1XVVA 2E9SA 3GOQA 4YI3A 4ARVA 2FWPA 3AH8A 2Y8EA 5KC8A 3WXBA 3VOAA 3S70A 4B31A 3K4QA 3NTLA 1KJWA 1B6TA 2IZ6A 3VDXA 3C5CA 4ZV7A 3IOEA 3EW9A 3ND5A 4KAAA 4KPFC 3G6KA 3X43A 4BZXA 8LDHA 2ZIFA 4TYYA 4DR7B 4QVKA 1K5HA 721PA 4YRLA 1X7WA 4MQ4A 3T35A 1ZLXA 4YHHB 1XN4A 3IERA 5TF0A 2VG8A 3IOYA 4JKYA 8OHMA 3QPDA 2PN1A 3OG9A 1E1MA 1RCFA 4IO0A 3WMEA 4CXMA 2VQ3A 1KI8A 3G7UA 3Q10A 4KH1A 5HPYB 1S1MA 2I6UA 1AKQA 3QPVA 5IANA 2L82A 2O2EA 4IIJB 4K26A 1LV8A 4FBMA 4K9NA 4C7JA 4D9IA 1MBZA 3VR6H 3GEHA 4G5SA 4FYJA 1QYDA 2QUAA 2RARA 3EF1A 2VYND 4TWJA 4F4FA 1DIBA 1ENZA 2ZAGA 4W7SA 2Y0PA 1DJLA 1UAGA 4L51A 4DRXB 3CRQA 3TLJA 3WB9A 3K8YA 1OWOA 3JYPA 3WYEA 3OECA 4B35A 4L4RA 4Z99A 5T7BA 3OX4A 2C4NA 1KMMA 1AK2A 5DE3A 1TFUA 4RMJA 1HMYA 1VC2A 5A6SB 4BFVA 1B23P 2R7KA 2NP6A 1HL7A 2I3AA 4I7EA 3EQ2A 4NYIR 1NJ5A 3E81A 4J16C 4NEGA 5A7GA 3HNRA 3KTOA 2XZOA 1QH8B 2D7DA 2CYAA 3MWGA 3KQSA 3WKCA 2VKQA 2WYOA 2IXAA 2O3RA 2VPZA 2YFHA 3QITA 4LW8A 4F92B 2IRWA 3D2BA 5JAIA 4L4ZA 1P7WA 3OJCA 2Z57A 2EEZA 4E5SA 4XQEA 1UXIA 2B3TA 4P08A 3G0CA 2GFHA 2H5LA 3WTCA 1PZXA 1TKBA 1CKEA 1YJQA 5JZVA 3DHYA 2UUOA 4OJNA 4FW8A 5TIIA 4YJ3F 4FOPA 3L6BA 2RIPA 2FTKE 1PNOA 2W2KB 4MDHA 4LTDA 3IOBA 2YBDA 4D81A 3A6PC 5F1KA 4TZ6A 1YRYE 3HHPA 3NYIA 1QKKA 2DR0A 1H1DA 4HDRA 1KJ8A 5NULA 3ZXXA 3RK0A 1AURA 1DFHA 3PYMA 4AUNA 1P5HA 2NU9A 3F5DA 3JWGA 1X80B 3IR6A 2W8ZA 2YHSA 3EXIB 2F8LA 2P79A 4TV9F 2BF7A 2GD6A 2PZJA 4RIHA 3WAGA 3KAJA 4BLSA 5AVVA 1SUSA 5F73A 1VSQA 5JUWA 3W9BA 1FX0B 2RH8A 2XRYA 4RQBA 3DZBA 3RYFA 2RAUA 2PBZA 3GFPA 2J9XB 4FUTA 1TUIA 3IEIA 4PG5A 1U2DA 5A02A 5AK3A 1G4UR 5ES3A 2J59A 3H2KA 3R3VA 4MCJA 5IXJA 4KQ9A 5AKKA 3CEJA 5DX8A 3C14C 2IYXA 3M6AA 3KQNA 5ICMA 2G40A 4PYKA 4L2IA 2ZBRA 4D9KA 3M3HA 3WLQA 4HNVA 2XWSA 4GLJA 2RHGB 4X66B 1ORWA 4LRUA 2PBRA 3AUFA 2XMQA 4PINA 2D2VA 4ZODA 4M0KA 3KOZA 1W85A 4IKOA 2W2OA 2XB6A 1H85A 5EJ6A 3AVUA 2ZOSA 3DZ8A 2HC9A 2XE7A 4GVLA 3C5WP 2ZRJA 2EKDA 2FOIA 4JI3B 3V00A 1FS6A 4B80A 3A3KA 3FM9A 1LRKA 1TNDA 4FZ3A 3NHYA 3TTTA 1RKXA 3FOZA 4MITA 2WSLA 4JMPA 4M9SA 5IAJA 3INYA 3C6ZA 4CDGA 4YNBA 2HLPA 1ST2A 3RH0A 2HBQA 2CVHA 3H2YA 4EGAA 3DTNA 5HF9A 2GZHA 4RPCA 5G0TA 1O6FA 1ZR4A 1Y5MA 1P45A 2X1VA 4D1YA 5AVZA 3M81A 4DCGA 3ZDCA