4QFMA

The structure of aif2gamma subunit d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title The structure of aIF2gamma subunit D152A from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qfmA01
3K0CA 4PO1A 5L3VA 1RRFA 4B73A 4UQOA 1JBKA 1LS6A 2C99A 3W5HA 1G5TA 3UIEA 821PA 3EPHA 4JSYA 2VH5R 4HATA 3SFZA 1OIXA 4N3GA 3LBHA 3T1OA 1EWRA 4MGIR 4ACBA 1FNMA 4W5WA 3WP0A 3B1ZA 2HXYA 3JVVA 3THYB 5FPKA 2IX3A 1E9RA 5KDLA 3WBJA 1IB0A 2ZRLA 2QRZA 1E9SA 2B7CA 1QHYA 1DAHA 1M7GA 3KQLA 4HLDA 1QH0A 3BD9A 1VG1A 2ZANA 3TE6A 1U94A 4AKHA 3ASZA 2P5SA 1KO4A 3C16C 3NVAA 4RZXA 2EFEB 4O3MA 3G71B 3CRQA 3CRMA 2OG2A 2AN9A 2Z43A 4RD2A 1ZW6A 1XFAA 2D4HA 4HZUA 2W00A 2WWWA 3K0AB 4TWZA 1NBMA 1JPJA 1KSJA 3F3YA 3IBGA 1L4YA 2QPOA 1VG0B 3SEAA 4A82A 3H86A 2EFCB 1KI7A 4LY6A 3QFSA 3IHLA 3WMEA 3DEFA 4I1OA 4ZGQB 2RGDA 1WBDA 3SYKA 1Y3AA 2ZROA 3FE2A 3OFND 4ERNA 1EFRA 2ANCA 1WQ1R 2EU8A 2PMKA 4QBFA 5JLJA 3T1VA 3S1AA 2F3TA 1VECA 2JLRA 4H1UA 1YR6A 1BYUA 4JYCA 1S96A 4BEJA 1HT1E 5FUXA 2ZRIA 3K9GA 4UNSA 1XEXB 2IYUA 2VP9A 3LX8A 4OHVA 1NN1A 4D4LA 5CDFE 5DO9A 2XXAA 5EE5B 4OI0A 3U4QB 2JGNA 1E4VA 4AI6A 1RZ3A 5KSOA 1XEWX 4XVUA 1OW3B 4ACAA 4EPWA 5B64A 3WP1B 4RZ3A 2BBTA 3RC8A 521PA 4NBSA 1Z22A 1XZPA 2ZRAA 1CR0A 1UEIA 1A8PA 1SVWA 3K70C 5HKKA 3AVWA 4LBYA 2KWIA 4G5GA 3SJAA 3BS4A 5KDDA 2QTFA 1RIFA 2WWGA 1D2NA 3N70A 4QM6A 1FZQA 2FU5C 2GXQA 4BLTA 5AWFC 5E7JA 3QI2A 4NYJR 1IN5A 1RC8A 4TSFD 2C8VA 3OZXA 3HU3A 3OF5A 2VYQA 2V1XA 3VNVA 4YDHB 3UMRA 1JJ7A 2O8CA 1G9XA 4DUGD 1MV5A 1CLUA 2D74A 1F3OA 4KFRA 2CLCX 1JXMA 2JDID 2ZRDA 4OQMA 5FFMA 5LD2C 3FHTA 1LV7A 1LNZA 1YU9A 1OFIA 3CLVA 1Q1EA 3CCQB 3CX6A 2ZJZA 2G9NA 3NXSA 4Q9IA 1Z6TA 2NO0A 2W83A 3WBKA 1E2GA 2GF9A 3U3KA 4TYYA 1W44A 3SNHA 5BYKA 3W5UA 3KXIA 5HR5A 4ZDIA 3K9LA 2XSZA 3T34A 3P32A 2WHXA 1G8HA 2WIAA 2PL3A 2EQBA 2Q3FA 4PQFA 3CB4A 4DHEA 4HUTA 3CH4B 5D3MB 2YWHA 4YHBA 3CC7B 2RGNC 1G5RA 3DMDA 4QNRA 4IXNA 3K09A 2A2ZA 2Q9CA 1ZM4A 3AVXA 2X2FA 3BGWA 5FL7D 2OTLB 1AQYA 1AK2A 1PUJA 2VNIA 1OYYA 3C41J 2PBRA 2Q3HA 5GJWC 3PITA 2QGNA 5EE1A 4QJ4A 4WZAE 1J8MF 3MJRA 4ZDJA 1E96A 1R0XA 2F43B 3AKYA 3NBXX 3ZVLA 4YALA 5DISB 2G88A 2YOHA 4LHVA 1LB1B 1E0AA 2I4IA 3SFVA 5THXA 1XTKA 2CEAA 3IEVA 1XD2B 1ZCAA 3L0PA 3NG1A 1IOZA 1CR4A 3SDZA 3CMEB 1ZJ6A 2X8AA 2GDJA 1OXXK 3BOSA 1T0JB 1ZYUA 3UG7A 1BX1A 1ZIOA 4BGDA 1XE1A 2FSGA 4DSNA 4IHQA 1T9HA 4TQAA 1KO5A 4W9MC 2ZJYA 5AK0A 4PC1A 2ZJOA 1ZUHA 3TK1A 3CUEF 3VR4A 4DT1A 2NOAA 3AKEA 1SVSA 3R9WA 3AKCA 3N2IA 2UVQA 2ZM5A 3UMFA 2GCOB 3PUXA 4BLOA 4DDWA 1VMAA 2VHUA 3AV0B 2B21A 3C14C 1MT0A 3FKQA 2QBYB 1W46A 2VP5A 2NPFA 2GJKA 2LWIA 3RS4A 4B3BA 4V03A 1YVDA 3HPRA 3KKMA 3KKNA 1OIVA 2GEUA 1TAGA 1HA3A 1GSIA 2BKUA 4G0NA 4MUBA 3BIFA 4HYYA 5B58C 1FTNA 4OQNA 1E79A 1E2FA 4NYMR 2ZYVX 2R6CA 1JJVA 1GL6A 4KHZA 2OUKA 1CP2A 2JJ1A 5GADl 2QZ4A 2ZR9A 1KK3A 2GILA 1N5LA 1P9RA 5C4MA 5F9FA 4B44A 4HZUB 4JLBA 4XJXA 1XTIA 4LHYA 2BCGY 3OJWA 3OEHD 4LWZA 3P27A 1TU3A 4HB0A 5JWRA 3I5YA 1E0SA 4DRZA 1GKIA 2ZUDA 1E94E 2VF7A 4A4DA 3ZC3A 2F6RA 2ZREA 1SVMA 1NSTA 1ONBA 1UBCA 4UXIA 3CF0A 5DHAA 4WA7A 2JLUA 4KAXA 3U7FB 2WICA 4LI0A 3ZVNA 2ZJBA 2YWGA 2AFIE 2QL6A 2H57A 2J7PD 4BFXA 2XGJA 2BOVA 1CQXA 5FPYA 4JVLA 2GEVA 4KCGA 5KSPA 3S1AB 2YWFA 4TLCA 2QA4B 1MOZA 2H18A 4CT5A 1P72A 2AK2A 2IXEA 2OFOA 1IXRC 4CRWB 3UWKA 3TR0A 1N5KA 3RRMA 5FOSA 1A5TA 1D5CA 4KFUA 2XB4A 2GJAA 3MAAC 4B3FX 3DKVA 2J0UA 3OAAA 3UK6A 3ZJYA 1BOFA 4GL2A 1MO5A 4LPSA 5F9HA 2CJWA 4M1OA 2CCGA 1GAWA 2W0MA 4A9AA 1G64A 2X2EA 4QJ3A 2PCLA 2GJ8A 1NLYA 2H17A 3BB1A 3K9HA 3R8FA 4A0RA 1VIAA 5EUMA 5IRCD 4B33A 1J99A 1W47A 3CRRA 3L0OA 2G1KA 3Q5EA 1KY3A 2ERYA 5E7IA 1NN3A 1RE0A 2ODEA 2CXXA 2QORA 4HB4A 2G83A 3R7WA 4MDFA 3FB4A 3QFTA 4ARZA 1IXZA 1PV4A 2VZLA 3K0EA 2QPTA 4GZMA 2O8CB 4KSCA 2X3UA 4DSOA 2FWRA 1QVRA 3AVUA 4IOLA 1W4AA 2A30A 3EC1A 4A0FA 2GBLC 1P5ZB 5KNDA 2FGKA 1XTJA 2D2FA 4ZDKA 3G4SB 2BIFA 3SHWA 1II9A 2CK3D 2WKPA 3LNCA 3RRZA 3W5JA 4IEIA 4EQ6A 4Q1CA 4FCWA 4O25A 2FFHA 4KVGA 4BASA 3CC2B 1IJFA 1KI1A 3L0IB 1XTRA 2YINC 1E6CA 3M4YA 2IBMA 1G41A 1P62B 3KJEA 3A6PC 2WSMA 1N0UA 1EWYA 3I4LA 4Q4JA 4TZ6A 4UJ3A 4NMMA 4EJSC 1KOFA 4TMWA 1KI6B 2QG6A 1F48A 2AXPA 3MGCA 1GRQA 3QG1A 1BIFA 3TH5A 3SR0A 1TNDA 4YLGA 4JVMA 1YIJB 3HJNA 1MRNA 2ZU0C 3GQBA 3K0SA 1VCIA 4NTZA 4GZLA 1NI3A 1UBGA 3LX5A 5B30A 2J41A 4Q9LA 4M21A 3CR8A 4DLVA 1U98A 2MSEB 4OI4A 2F1RA 4DB4A 1GITA 1SKYB 5HZKA 1BO6A 1W2HA 4LJ7A 4FINA 4MYHA 3QFRA 1E9DA 4PHHA 5JI3E 1L7VC 2MMCA 4US0R 4AKEA 4JSTA 3TBKA 3CNLA 3FKSA 4GDFA 2B6HA 4DC9A 4L16A 1ZM3A 2N46A 2J59A 1Z28A 1YI2B 2REBA 3RVBA 1HYQA 4DBLC 1JAHA 2XNSA 1P2VA 2QMHA 3QPUA 1KO7A 4D25A 3CWZA 1NG9A 4TL9A 2QI9C 2QP4A 1XDBA 1CNFA 1BX0A 1NJFA 3KQHA 4GT1A 3RRYA 1J90A 4FCTA 1HY3A 1AN0A 4CDGA 5GV7A 4XD7A 2RH5A 1W36D 3SBEA 3FWYA 2YNMA 2ZYWX 3WHLA 3X1XA 3EPJA 1JB9A 3CRZA 3LH5A 3ZIAD 4LJ9A 3AF2A 4AYXA 1Q3TA 2D2EA 4LHXA 3RANA 4WZ6A 1QUEA 2J46A 1VIYA 1GNQA 5HXBA 1NJID 4V0MA 3JQQA 1JEEA 3U61B 1R2QA 4HDCA 4U7DA 3THXA 5KPDA 2GRJA 4OHXA 2YHSA 5FUVA 3ZZUA 2PZEA 5JHGB 2ZS9A 3PV0A 1KQSB 2R9VA 4WAUA 2ASEA 2YZ2A 1JR3E 1SXJA 3VHXA 3B78A 1NMZA 1Z29A 2A5YB 4M9ZA 4JT2A 1GRNA 3U7GA 2FH5B 2N1BA 3GFTA 4JL5A 2JAQA 2O0JA 2OXRA 3OEED 4A8JA 1HUQA 4AG5A 1NKTA 1OXVA 4GPTA 3HYTA 2VHCA 4Q7JB 1WRBA 1AKYA 2BMJA 5E4FA 4CGZA 1PJRA 4YAWA 4II7A 2YWEA 1YZLA 2O5VA 4TYPA 4TMKA 1W0JD 2QMUA 1HE1C 3P1JA 2IHBA 3IIJA 3KQUA 1T4GA 4CVNA 5KTYA 2QRNA 2A5FA 4AC9A 2WJYA 4ABYA 1JJ2B 1OFTA 2J5XA 2C77A 4B2PA 3THWA 2IF0A 1ZU5A 1COWA 1N6OA 1VQKB 3T15A 3I5XA 4KJZA 1QHGA 1T6NA 2C5LA 3KDSE 1BKDR 4I1VA 2IEYA 3L2OB 3V76A 4E03A 4PR0A 2GETA 1XPRA 2FOLA 3EZ2A 4JJKA 2BM0A 3WRYC 3ZVMA 1K6MA 2WPDA 5EJEA 3NBFA 4NKRA 2FGJA 5LDDC 5G3ZA 4DVGA 3VMFA 1TPZA 3V9PA 3Q7QA 5EXTA 1R0WA 1E63A 2CJWB 4F4IA 3FDIA 2A5GA 2PH1A 1Z2AA 2KBFA 3DZDA 3GLFA 1UBEA 3GLHE 5JWHA 4ZIRB 5DIFA 2W2XA 1ZBDA 3QENA 4DSUA 1L2TA 2WM9B 1O87A 4C0QC 3IKJA 4TZ0A 4UXHA 5JS7A 1G18A 2H92A 2R2AA 5BYJA 2J45A 2EFHB 4F92B 1SM4A 5CM8B 3TUZC 1YZGA 3OIWA 1KDOA 5FR2A 2OCPA 4QBIA 4PGOA 3W2FA 5JSZA 3IILA 3ZBTA 2QT0A 1QG2A 2H1LA 1VQ8B 1Q1QA 3VKHA 4ZGNB 3T5DA 3DZ8A 2GZDA 4WZBE 1I4LD 3QF4A 3PENA 1QGYA 3QQ5A 1TVCA 3SC3A 1GZSA 2B92A 2ZJ2A 3NEJA 4QNMA 4EQ6B 1G7TA 3SBDA 5BWMA 4MYUA 3B9PA 3LW8A 4OHWA 3ICEA 5AJYA 1S3SA 2ZETA 4S2EA 1VHTA 1E2MA 1KDTA 3WHKA 5H68A 4Q4JB 2HDNB 1G20E 3ONWA 1Q12A 3R9XA 4WXPA 3B1XA 3QXSA 2FSFA 1PUIA 4N0EA 5KU1A 4XSHA 4D26A 4B2LA 1IN4A 3NTUA 4IW3B 1YITB 4URXR 2ZIAA 5TR9A 4UNNA 3OIUA 5CIWA 2W2TA 2K5UA 4LPKA 1U0JA 2FA9A 4ZCIA 1EWQA 2P65A 2QP3A 4YAFA 2W6JA 4FMDF 1FUUA 1N0VC 3AVQA 3B9QA 8OHMA 3KXLA 4ILEA 4LYJA 3CC4B 3OFNA 1E2KA 3T5GA 1II8A 1Z0DA 3CKLA 2KBEA 1FW6A 2R6DA 1DG3A 4DLZA 4E5UA 3QF7A 4F4CA 4GFDA 1FMLA 2ZVQX 2C95A 4QBHA 3K0FB 3BXZA 1E3MA 1P73A 1Q3HA 2HCBA 2WJGA 2BMWA 1UBFA 1E1QA 4P0TA 4IJMA 1ETUA 2XJ9A 1QVFB 3F0TA 4I4LA 1UM8A 2OLJA 2FPLA 4D81A 1NJGA 3VNUA 2NG1A 5CYOA 2ZU6A 2Z0MA 2ZRFA 4BWYA 4FCVA 2A9KA 4C2UA 1E2NA 1M34E 3U3JA 4FD2A 1NVVR 4TSFA 1T0HB 4JL8A 4BFTA 1U8ZA 3BK7A 3VR6A 4DUGA 4FXPA 2JDIA 5CB8A 2VIIA 3TGPA 2OO7A 1LY1A 2OV2A 5J5CA 3GLGA 2DETA 2ZJ8A 5L3QB 3AGQA 4Z1MD 4A1FA 3KTAA 5JS8A 2IL1A 1SXJB 2P6NA 1Z8FA 3RABA 2BVNA 3HU2A 1E2JA 2IC5A 1JR6A 4A8JB 1KJYA 2GNOA 1ZC3A 5J4YA 4G1VA 4LK2A 5JWOA 2RCNA 3F5FA 1N2CE 1AIPA 1Z06A 1YHQB 3CO5A 5SZJA 3FMIA 4FW9A 3PEUA 2JLYA 3SS8A 3P20A 1QFYA 2ZI6A 1CULC 4EH1A 2GZHA 2HYDA 3T1QA 4A0GA 4CIDA 3QSYA 4ASUD 2OBMA 5SZHB 4DLRA 4I81A 1XP8A 2GBLA 1JB1A 4B6FA 2AWOA 5EXPA 3A4LA 1ZCBA 1EFHA 1OGJA 3MFYA 4DIDA 5AUOB 2O8DA 2H5EA 2AHOA 3WNCA 3LBIA 3TSOA 3ZH9B 2DFTA 3GJ3A 3T12A 1GTVA 1GG2A 4PO9A 1GOTA 4DCTA 4A2WA 4KYIB 3HWSA 5JFGA 2V3CC 1FP7A 4P32A 5G53C 1Z5ZA 4EJSA 2EIXA 3QXJA 4LHZA 1EXMA 3I8SA 4BECA 1D9ZA 4NCNA 3GLFB 1CRPA 2WOJA 1XXHB 2ZE8A 1K5DA 4G1UC 3LVRE 3K70D 4EUNA 1G1MA 2WKQA 3VO1A 1A1VA 3EC2A 2IXGA 2I1QA 3MWLA 4AD8A 1F20A 2ZR0A 1FUKA 2C98A 2OILA 1KO1A 2F1JA 1KZGB 3WYGA 4BPRA 4FN5A 4Q7LA 3KFVA 3QVUA 3R20A 4LGMA 3LO5A 5KHOC 4JL6A 4DDUA 1RPZA 3I1FA 1H8HD 3I72A 3BH7A 2QROA 1QG4A 5AJZA 1YZKA 2IHYA 1RRCA 3QEJA 4W7SA 1G291 1M1KD 2R6FA 2QP9X 5K8UA 5DI3B 4TL8A 1MR3F 2ZS8A 3LY5A 1UFQA 3NWJA 5FUYA 2QAGB 4L9WA 3VQTA 2XB2A 1VQ5B 1U90A 1Z2CA 3DOEA 4TTPA 1N6LA 3KKOA 1Z0FA 3NDBB 3UANA 2CRVA 2CNWD 2YC4C 3W8RA 5JMTA 5JRJA 2XEXA 4PHFA 4PPFA 4BLQA 2FPMA 4C0HA 2FE4A 1CJTC 1IM2A 1S8FA 3TMKA 3GLIB 2IYYA 1LVGA 1R0ZA 3GFOA 5TVKA 2DFKB 1RYFA 3ZLJA 2G6BA 5B57C 4XOIA 3AVYA 1JQJC 1R5OA 2XNCA 2ZI3A 3OEHA 4LJ4A 4R9UC 4ZCMA 3WRXC 2Q9AA 3PQCA 1A7JA 3QXHA 4C7OA 1EESA 1X8JA 3BB3A 1E62A 3TJZA 4TLBA 1W4BA 3LXXA 4HZIA 5FPTA 2JIZD 4V02A 3V00A 1GAJA 1II8B 2J7PA 2VL7A 1FQKA 4YMUA 1W87A 1E9AA 1GRRA 3E70C 4Q00A 4CYMA 1AJEA 1CJVC 2DWOA 1EFTA 1E4YA 2CVHA 4U00A 2RHMA 3EWAA 4JVNA 4DLWA 3MCAA 2QEQA 4FIDA 4F38A 1M7BA 1FQJA 4JBYA 4R2HA 1A2KC 1G8PA 3A1VA 3K1JA 5LBIA 1T5IA 1E2EA 4BZPA 3NHAA 3QKTA 1E2LA 1UADA 1N6HA 3QOFA 5JJIA 2GQFA 4HE6A 1OE0A 1SVIA 4TLEA 2RC6A 1XU4A 4NE2A 2BBSA 3G6EB 4WBSA 1J8YF 1XB2A 4HAYA 4IXMA 2SHKA 5FOXA 2ODWA 3TSWA 3BFKA 1F2UA 2J1LA 1E2QA 1UKYA 5KUTA 2EWVA 1CS4C 1NDHA 4DIEA 5TY0A 2BBWA 3Q72A 4Y0VA 3AKDA 4Q4HA 1JA1A 3B5JA 3GLGB 3EA5A 4MYTA 3KTAB 3Q7PA 4Q03A 1GUAA 4Q7MB 4AWXA 5EP4A 2OTJB 3WY9A 4Q47A 1F2TB 1DE0A 4RFSB 4GBMA 3FPKA 3OZUA 3BFXA 1DOAA 4PSKA 1KTVA 1EG7A 3W34A 3AVVA 1YJWB 4V0NA 4B32A 4B71A 1M6NA 3GJ8A 4BE7B 1KYIA 3CCJB 4BPBA 2ZTSA 4LRWA 2C04A 4JBXA 4QGHA 2GHIA 2IUUA 1CJKC 4OHZA 2DY1A 1HQCA 3CCEB 1QGAA 1FL9A 1ZNWA 4TT3D 3RSLA 1U99A 2REXB 3NEYA 4URUR 1F5NA 1Z6AA 2AK3A 4ZKEA 4GP7A 4RKEA 4EFNA 3L8ZA 4DLUA 1KC8D 1GNPA 3RNLA 4D2IA 4DLXA 2Z83A 2O8DB 3EARA 5FBQB 1MO3A 1EX6A 3M1IA 1N3BA 2IK8A 2P3SA 2PJZA 3TIFA 1Z47A 4PFSA 4KV9A 5C2JB 2A3RA 1FX0B 4X8OA 2PIAA 1ELOA 3DPUA 2RGEA 2IUTA 1N5JA 3QG5A 4Q4AA 721PA 2EFGA 4B4DA 2FFBA 3B1YA 1E2HA 1M74A 1ZU4A 4PZYA 1FDRA 2NMVA 3VKGA 1K8AD 4YC7A 3TNFA 4BFSA 3CPWB 1UF9A 4OQFA 4A15A 1Z63A 4PANA 1A82A 4JKIA 4TYWA 4HLUA 2ONJA 4ZI3A 1DAMA 4LC0A 4HAVA 4TQUS 1NRJB 1S0UA 1XBTA 3ADBA 1IBRA 1OH7A 4KBGA 4M4SA 1K8RA 3C7KA 2DCUA 1DDGA 1UDXA 4Q19A 1T3SA 1VCMA 3QEOA 1RKBA 1FNCA 1N6PA 1IXSB 1V5WA 3PXGA 4C0KA 2F55A 2CVFA 3QPVA 3ZIAA 3G82C 1I4TD 2Z4SA 4NONA 1IJEA 4ZO4A 3U44A 4IEEA 3FJOA 3RS7A 1W7AA 4RSGA 4D4MA 3VHLB 4QHTA 1EFCA 3NBZC 1KI2A 2RGGA 1WMSA 2RGBA 3FMPB 4V0LA 4E22A 1AZTA 2XZPA 2P6UA 4OKSA 2PLFA 3LVBA 3BC1A 2R8RA 3ETLA 4X8HA 4KXFB 1W5TA 4IOKA 5FTNA 2PT5A 2ZE5A 4OQXA 2RMKA 1F6BA 5G41A 2GEDA 3OEEA 2QN6A 3ZS8A 5FL3A 4ESHA 5TMPA 1QFJA 1T5LA 3QXXA 1G4AE 2DBYA 4JZKA 2ZAMA 4BLPA 4M53A 3RS5A 1WBBA 1P4SA 1OH6A 5C18A 3CCSB 5JEDA 1OYWA 4B3CA 1W0JA 4TMZA 1T3HA 1TEXA 3J81k 5JBQA 3EG5A 5DE3A 4XWOA 3KUCA 4C7OB 3ZS9A 3ES9A 3H1TA 2D7CA 2QDXA 2ECKA 4FMCF 5CK4A 4AURA 1NG1A 1SVLA 1GM5A 1KJWA 1GL7A 2IS2A 3SJZA 1XEFA 4I1SA 4FMDB 5BW8A 2GTPA 2X77A 2ZRGA 2XZLA 4LHWA 1QZXA 4A0HA 4MRSA 2QSZA 4Z8XA 4RZ2A 2C96A 4LJ5A 4OJQA 2IXFA 5H8WA 3FFAA 4URWR 4IVRA 4PX9A 1R5NA 5ANRB 4BFUA 1PVOA 3N2EA 4PC2A 1TX4B 4J0QA 3UG6A 4NZYA 2ZRKA 2EYQA 2ORVA 2A7QA 2BBOA 2P2LA 3SJCA 1G6HA 3PUVA 3KL4A 4D0NA 1J9ZA 1DO2A 2CHVA 1SVOA 1UKEA 5FTJA 4YMTA 2REOA 1I7PA 4M8NE 3B1WA 1JAIA 4RD3A 2ZR7A 1P6XA 2W0SA 1GFIA 4QJ5A 5IK2D 3FVQA 4M1KA 1ZRHA 4KITB 3PVSA 2GAOA 4P4TA 3GCGA 3H2YA 3VR5A 4EFMA 4M0LA 1CXZA 4JJZA 1QUFA 2GJ9A 4Q4HB 5J4LA 2WJJA 5DNYB 5AN9A 4E09A 2ZRBA 1U9IC 2DWPA 4YAOA 1W4RA 2NQ2C 4DKXA 3DVLA 4PAMA 1OFUX 2FSIA 1KDPA 1DAIA 2ZQ5A 2YVUA 1JXOA 3AF3A 5DYGA 2XXAB 1CNEA 2ZSEA 1SKYE 4DDTA 1G3UA 1YRAA 2NZ8A 4NYIR 2WOOA 4NYMQ 3IPYA 4O2LA 4HAUA 4FWIB 3RAPR 1PLLA 3EZFA 2ZSAA 2ZSFA 4QFMA 4KODA 3B85A 1G3QA 5JCZA 3T06B 4Q1BA 3Q85A 3QPWA 5KSWB 1Q7YD 4RZUA 4URZR 4CW7A 4DDVA 5L3SA 3LD9A 1BYIA 3BFVA 3H0KA 4H1VA 5DLQC 1EP3B 3RWMB 2VHTA 3MWJA 3SZRA 2ZI9A 2WJVA 1KI4A 2JATA 3W3ZB 4RY2A 4PAOA 3LBNA 1UAAA 3E5HA 1VQOB 4MITA 5HTKA 2RGXA 2F1IA 1H8ED 2RHDA 3IHWA 2WSSD 5F98A 3CIOA 1NVUQ 2OFXA 3PR1A 2ZRPA 3FMOB 2LKCA 3IGFA 4PC3A 1BQEA 1US8A 5KSZA 3C8UA 4Q4LA 3EZ6A 5HE9A 2QMOA 1OKKD 3KKPA 3O8CA 1KIMA 3KB1A 1BMFD 1P9WA 2J3EA 2VLIA 2W6ID 4KBFA 1VHLA 4DJTA 3FPAA 5SZKB 3FYHA 1DAKA 5GVSA 1KHTA 1YR7A 3MJHA 5B2ZA 4EAQA 4DEXA 1Q82D 3SYNA 3DMNA 2IA5A 1RW4A 4OI2A 4F93B 3U44B 1IY2A 3AH8A 4MGYR 4GMDA 5HE8A 5KPJA 4QBGB 3N5CA 5IT5A 2DEUA 3WMGA 1S72B 1GWNA 2O52A 1G3MA 1OHHD 4PPQA 4Z1MA 1YZUA 4MRVA 1KD1D 4M1MA 3O8RA 5ELXA 1CIPA 1ZNYA 2WWXA 1ZM9A 5JCPA 1OJLA 4QOSA 5EXXA 1T3LA 3WNDA 4P31A 5G40A 1IAQA 1GL9B 1KMHA 3GJ7A 1X3SA 4GI7A 3W5IA 2GAAA 1Z0JA 2AWNA 3PEVA 4UXJA 4BZQA 1VYTA 2F9LA 2PEZA 2CLDX 1JPNA 4POAA 5P21A 3PG5A 4I1UA 2ODNA 2OAQ1 4A6PA 1XMIA 1XZQA 4Q7KA 4HSEA 1G7RA 1TL7C 1P2TA 5FPSA 3SI7A 5LB2A 1HEIA 2D62A 2YOGA 4ASUA 1SHZA 2FZ4A 1X8LA 2P5TB 4M1YA 3ADCA 1ZC4A 5SZIA 1QVGB 1R8QA 4DT1B 2A5DA 3I73A 3WMFA 1G7CA 4ON9A 1U2RA 2GCPA 2ZI5A 4V0OA 4DLYA 2D7DA 1ODFA 3ZD6A 1RJ9A 2O8BA 2XNDD 2OFWA 3C5CA 1YZNA 2ORIA 2AXNA 2ZPTX 3I8XA 1YR8A 1GNRA 4BFWA 4M2LA 2GVZC 1QDEA 2R65A 3DOFA 4M9QA 1VYVA 4BLSA 2IF2A 1I4DD 4N3NA 1K73D 4Q21A 2ZVPX 4MA4A 5EUQB 5H5JA 4F7DA 1R6BX 2CCKA 2QY9A 1XPUA 2FSHA 1DVRA 4IOJA 2ATVA 1VTKA 2OT3B 3QKRA 4LV5B 4D4KA 5FBVB 1ZM2A 3C15C 2HUPA 4MKGA 1OH5A 2PMDA 1KI8A 3W5VA 2JEOA 1CRQA 2WJHA 3K0CC 1OXSC 1VQ7B 1R7RA 2ZUCA 4OHYA 1YZQA 4FI3C 1WCV1 4TLAA 1KAGA 3G5UA 2OEPA 2OCAA 1OF1A 1E2IA 3QNUA 1XD8A 2ZYUX 5BQ5A 3QKUA 1R8SA 4BQSA 3K9NA 3MMPA 5AJXA 2ZI4A 1QHIA 1FFHA 1XTSA 4KLNA 1GVHA 2DR3A 4PC6A 1GDDA 4HUQA 2DB3A 2CNWA 3L82B 3KZ1E 3BRWD 3M0EA 5EQTA 2WMNB 3W6PA 2WTUA 2VNJA 1VQLB 1VCNA 1W0KD 1YJ5A 2Q6TA 3TAUA 2JLXA 3W2GA 2J0UB 3CZQA 4B74A 4CEHA 1WF3A 2RGNA 2XOKD 1TADA 1KJZA 3CPJB 4B34A 2BMDA 5CB6A 1MRSA 4F7WA 3B1VA 2HF9A 3D6TB 1E64A 2Q21A 4C9BA 3LQQA 1CTQA 3GFPA 1DEKA 3CF6R 4IDQA 1ANKA 1DDIA 4ZPXA 5GJBA 2OESA 3A1TA 2WMOB 1X1SA 3TUIC 3GMTA 1XMJA 3R7WB 3VR1A 2HV8A 2JIZA 3SJBA 4ARZB 1DAEA 5KO2A 1N6NA 1J7KA 4UNQA 1D2EA 2IT1A 2WWFA 4Q18A 3KQKA 2G1JA 3DO6A 1IONA 1ZD9A 1FOEB 2Q9BA 4IRUB 2NPIA 2ERXA 1GVNB 2HJVA 1ZM7A 2QTHA 1W2BB 2RB4A 1NIPA 4NL4H 3CRW1 1II0A 1RFLA 3B60A 2C9CA 3VX4A 3BAFA 3W3AA 5HCNA 5EE3A 1Z6YA 3IPXA 4XVRA 4V0ME 2HYIC 2P67A 1NLFA 2JJ2D 3OW2B 2GK7A 3HYRA 2IS6A 3EW9A 4B3DA 4U5XA 3LFUA 4BFYA 3L43A 4PQRA 4RCZA 2F1HA 1QHHA 1SXJE 4C4PA 4N0DA 5DH9A 5J40A 4NH0A 1W34A 1XMVA 1RVDA 4PQYA 2CE7A 2OE2A 5CM9C 4N1AA 3GJ4A 2XJ4A 1X1RA 3HP1A 3SN6A 1V43A 4QGGA 4MUAA 4M9SA 4IDPA 3REFA 2UZIR 3F8TA 3KXKA 3ZYCA 3PCRB 4G5SA 4DCSA 4JT4A 5F2EA 1Z3IX 5CITA 4CEJA 1FRQA 4K81B 3Q5DA 3ZBUA 1G8YA 5DN6D 2BEKA 3VX3A 2O0KA 4AG6A 2V8OA 1GILA 2NIPA 3U3MA 4BZXA 2BMFA 3A8TA 1XRJA 1I2MA 3AUXA 2PCJA 1HV8A 1TTTA 1W1WA 4JLDA 3THOA 1J70A 4L5BA 2WAYA 3B2EA 3RRNA 4TT3A 4DSTA 2TMKA 3PUWA 1E32A 1JR3D 1JECA 1NMYA 3TVDA 4AIIA 3O8BA 5FI0B 1XXHE 3GLFE 3THYA 3AUYA 4FMCB 3NH9A 2IWHA 1VQNB 1OPXA 3U6KA 1KSHA 3QY0A 1QRAA 2CMKA 3RWOA 4EDHA 2CNDA 1Q22A 3MWKA 1UKZA 1UDWA 1XTQA 4AYWA 1RJ9B 1YKSA 3W6NA 3ADDA 2VP2A 1Z0KA 2CHGA 5EP2A 1KNQA 3THXB 4Q5IA 2IYLD 2IW3A 1E69A 4XIGS 3RDPA 1X6VA 2BC9A 4OQLA 4UNRA 4US2R 4JLPA 5KNCA 2ATXA 4IDHA 3K70B 1FNNA 2E1RA 4YMSA 2CL0X 4DB2A 1JI0A 3TKLA 1GIAA 1G3IA 2VSXA 2HLDD 5H59A 1KAOA 4Q66C 1OFHA 1LTQA 1OXUA 1R10A 1JNYA 4GOKA 5FI1B 2J0QA 3PUZA 5LD2B 3RS0A 4MQBA 4KSBA 1AA9A 3E1YE 3JVUA 3GLIE 5FL7A 2XNJA 2C2HA 3THWB 3VFDA 4IVPA 1LF0A 3ZQJA 1NN0A 5BN3A 5L8VA 2ZRHA 2B8TA 4BRWA 5JJLA 1U0HC 5FPHA 2IUSA 1LF5A 4HUQB 4ZI2A 2IYTA 2CL6X 2IS1A 4FWTA 2V9PA 4JBWA 4YMWA 1GO2A 1Z0AA 4F4JA 4I99A 1SULA 4LV6A 4EKDA 2VP0A 2BF4A 1YHNA 4NHOA 2E9SA 4D4JA 2ZAOA 1N0WA 1KI9A 1VYUA 2GXAA 5EP3A 3Q3JB 2B7BA 2BGIA 5FR1A 4A92A 4D0GA 3ASYA 1KSGA 1OV4A 4LJ6A 5FTMA 2OXCA 1G4UR 4L15A 4YQFA 2OCYC 4B48A 4OBEA 4RD0A 2BJVA 2NTYC 4UKDA 4WIAA 1HTWA 3U7EB 1OB5A 2FV8A 1AGPA 4V0KA 1IQPA 4OYHA 1DELA 5TB5A 1Q81D 5JSZB 1MH1A 3CM0A 3AVPA 3IO3A 4XWAA 3EPLA 1N5IA 2BKEA 3QF4B 1KK2A 1OXTA 1GAQA 2V4ZA 1E9EA 3RC3A 1XX6A 4DQKA 3EZ7A 2Q0HA 1VQ6B 3O47A 4QC2A 4Y9RA 2EVWX 1D6JA 4DEYA 2CBZA 4RJLA 1TEVA 4C0AC 3BH6A 3LQRA 5EZ6B 4LJAA 5AUQA 5FTKA 2WWHA 3GJ6A 5JEEA 3GLGE 3HR8A 2V7QD 1PZNA 3PEYA 1QHHB 1ZINA 1OSNA 2UZ3A 1FNDA 4MH0R 4IFBA 5HZHA 2QA5A 1TQDA 4WW0A 3KX2A 5CK5A 1ESNA 1WB9A 3OIYA 5IK2A 4TMTA 4R71A 3LRPA 4CF7A 3K53A 5CDFA 4RFVA 4JYBA 3EAQA 1Y63A 3OE7D 3RS3A 2QM8A 4AF7A 2F43A 5EE0A 1UKVY 3BERA 5FBRB 4HEJA 4B75A 4B76A 1XJ0A 3HR7A 2OBLA 4O2RA 3NC0C 3ND8A 3JQRA 1UEJA 1E98A 1G19A 3CNOA 2NGRA 5A0FA 3WYAA 1F60A 5CYPA 2IS4A 4WQMA 1Q1ZA 4KO8A 4URYR 1XD2A 2FX3A 2DHRA 4AYTA 4FK8A 3U6BA 4EPVA 2XTMA 1BH2A 2WBLC 1M2OB 3QVVA 2NO1A 4MKFA 1PLJA 4IDNA 5H1YA 4EFLA 2R44A 1HT2E 3TR5A 3TW8B 4AY2A 5JZVA 2WJIA 4XSGA 2FG5A 1L4UA 4QKQA 1KK1A 3PFIA 1RYHA 1DAFA 2MSDB 5C4GB 2KE5A 3X1YA 3TLXA 4C0LA 2AFHE 2Q3MA 3NC1C 4LZZA 1NP6A 4US1R 3DL0A 1HQYE 2Z4RA 1NY6A 1NVWQ 1QGZA 2JA1A 1K9MD 1N6KA 3FTQA 3MLEA 3ZZTA 1Q21A 4RD1A 5FA6A 2GCOA 1RRPA 3SYLA 2XZOA 5K8LA 4HDOB 1XJQA 2ZITA 5M04A 4QGFA 2QBYA 3B7GA 1KRHA 4QL3A 1EP1B 121PA 4Q1EA 2QGZA 1DO0A 2GXUA 1JALA 2IYXA 3E20A 3AF4A 2AKYA 2KSQA 3A37A 4C0SA 4QXAA 1P7CA 3A1WA 4GMXA 4QGAA 1HH4A 1H8EA 4M22A 1T91A 2MSCB 2QU8A 2WSSA 4HB3A 1KZ7B 4D80A 2CE2X 5KSYA 1E1RD 1P2UA 2CK3A 1CR1A 4URVR 3AM1A 1X8KA 3CZPA 3X1ZA 2QNRA 4PZZA 5FOVA 3I61A 1DAGA 1T8TA 3OJXA 2VYFA 3DM9B 4NCHA 5FUWA 2LKDA 1OKKA 4UJ5A 1BJKA 3ZQ6A 1BMFA 2RAPA 2W6IA 2ZXUA 1P3JA 3U3RA 4MRPA 5FH9A 2W6JD 1QG0A 1AS3A 4R2IA 2NO9A 3NBYC 2J87A 3P4XA 4P33A 1HE8B 4KYUA 3QE0A 1U8YA 1G6OA 1D8TA 2QMEA 1OLOA 4BFZA 5BXQC 2WWYA 1NNEA 4Y7CA 1AKEA 1OT3A 1J2JA 2J7KA 2FMXA 4EIWA 2IYSA 2G0NA 5GJVC 2PEYA 1KGDA 3D31A 1TF7A 4Z51A 1B2RA 2HEIA 4O0MA 4MRNA 1OHHA 1R0YA 2I1VB 1C9KA 1G21E 5AJVB 3I56B 4UNPA 3TUJC 1E1QD 3SU8A 2HJGA 1Z0IA 2C78A 3CCLB 4Q9JA 1AS0A 3AQ4A 4EJSB 2OHFA 4G5RA 1SXJC 1ZUNB 2PLRA 2ZYTX 3A1SA 3IIMA 4BUJA 3EASA 4RCYA 1Q86D 1ESMA 1VG8A 3ND9A 1G17A 1TQ4A 2D06A 2C9YA 2R6AA 2R6GA 4A8JC 2H16A 3PJRA 1XJCA 1TU4A 4P4SA 2JLZA 1P9NA 3V4FA 5DI9A 3TAHA 1G8GA 1KY2A 2MMGA 2PX0A 4X8LA 1KKLA 3A1UA 1K5GA 4OK5A 4XH9B 4Q48A 3LDAA 5K8IA 4K1XA 1TLLA 4KFTA 1LFDB 4LYAA 2OM2A 1QFZA 1MO6A 4WOPA 1CJUC 3UXMA 2D3WA 1SZPA 4JLKA 3OESA 1DG1G 2GXSA 2O8EA 3P26A 1NLZA 2BEJA 3P4YA 5EXSA 2QPAA 2VF8A 1A2BA 4NYJQ 1R5BA 3Q9LA 2XNDA 3IEUA 2OZEA 5GJCA 1NBME 4DZZA 2R6HA 2BN4A 1QX4A 6Q21A 1VKJA 2OK8A 2DERA 4LYHA 5KNBA 1Z83A 3FOZA 4LOAA 3TQFA 1KI6A 1CJMA 2BGJA 2L0XA 1A4RA 1KK0A 4IFEA 5EMNA 2GA8A 4DWJA 3CXCB 2DWQA 2AR7A 2PT7A 1AM4D 5FBLB 3X2SA 5AUNB 1GJRA 4C30A 5FBWB 2ZSDA 5TV2A 2LCFA 2FJUA 2QUZA 2ZRJA 3RSOA 1KKMA 5TDHA 1SQ5A 5E3HA 1ZD8A 2N42A 3EIEA 4C0JA 2O0HA 3W2IA 3JZAA 2FNAA 2VHJA 5UKDA 2VP4A 1YR9A 2G77B 1XWIA 1W2GA 4PO8A 4PHGA 4DXAA 2Z6VA 3CNNA 4NU0A 1Z6GA 5JHHB 4LBWA 4GP6A 3W90A 1DBSA 2J0VA 2YV5A 2CHQA 4JKYA 2QAGC 1P60A 2IWRA 4B35A 1H42A 3LAWA 4TN1A 1W0KA 2AL7A 3B82A 5FOUA 4YXWD 3I92A 2VSFA 3VR2A 4PZLA 5J4KA 1XCPA 3MHPA 1M90D 2XOKA 3GD7A 2P6RA 1OGIA 3UPUA 1KNXA 1NL3A 5CLQA 1AGRA 3DDCA 3X1DA 3L8YA 4P4UA 3CF2A 4K8OA 4M1TA 2RGCA 2WAXA 5KDOA 1SGWA 1JQLB 2QE7D 4DQLA 4JVSB 5CJPA 4L4UA 4NDZA 1EGAA 4TMVA 4QM7A 2ZS7A 3LVQE 4HB2A 2IYZA 4KVAA 4MGKR 5JECA 1F2UB 2W58A 1DADA 1XD9A 2B8WA 3BORA 2HMAA 1FMJA 1YRBA 3ADKA 1E9BA 1D1NA 1BS1A 4LJYA 4PPNA 4TTRA 2OCBA 1E0JA 4JMPA 5IF9A 3WXMA 2VEDA 1TQ2A 4XWKA 5TXGA 4A2PA 1VQMB 2YOFA 4B47A 4GSYA 4BLRA 1CF4A 1XCGB 2VQSA 1QHNA 2AX4A 4DCVA 3U7HB 1G7SA 2F9MA 2UKDA 3K8YA 1W48A 3UATA 4YAUA 4B43A 5CJ2A 3SOPA 4W5HA 4PAQA 2ORWA 4G01B 1S9DA 4BRUA 1E0KA 2XAUA 4X8MA 1Q44A 2KB0A 2XTNA 4UAJA 2JJ2A 3CCMB 3QKSA 1ZP6A 4Q02A 3JZMA 1WDTA 5D3QA 2YJTD 3NH6A 5FOTA 3E1SA 2V6IA 3GEIA 1FTSA 2OK7A 2ONKA 1KI3A 4Y9UA 3MUFA 3A4MA 1E9CA 2BSAA 2QENA 4CT4B 4IVQA 1VDZA 1AMOA 4A6XA 4B2IA 4TMXA 3UKDA 2F7SA 3AF1A 3TW4A 1EX7A 2IYRA 2QEXB 2XTZA 4L8GA 2BCJQ 3D8BA 3DKPA 4NCJA 3IBYA 4CEIA 4Q4AB 2QM7A 5TARA 4LV8B 3SQXA 1FNBA 4MKIA 5DN6A 1XPOA 4ZIRA 1TF5A 1KSFX 1G8FA 3EWSA 3NIBA 4K46A 4WVFA 3CRVA 1M1YE 2KI5A 3FMFA 4HDQB 4D6PA 1GP2A 2CLSA 4P4SB 3T35A 3IIKA 5E95A 4R98A 5IDVA 3UMSA 2OSBA 1NBMD 2FEOA 4NYIQ 1MO4A 2O8FA 1TUEA 1ZMXA 2C9OA 2JJ8A 3GPLA 2VNHA 1C4OA 1DS6A 2ODBA 1JR3A 2NZJA 1QHSA 4OJKA 1W36B 1LS1A 1O3YA 4A36A 4LBZA 1WP9A 2FFAA 3KJGA 3QE2A 1YZTA 1W5SA 1KDRA 4MKHA 1EFRD 1E2PA 3EPKA 1NKSA 2GWHA 2O8EB 1FRNA 1AZSC 3TVTA 3MD0A 1U81A 4GNKA 4PXAA 3EX7C 1P61B 3VAAA 1M7HA 3FHCB 2BJWA 4C43A 2QT1A 4RD6A 2QSYA 4ZDWA 1D2MA 2ZRCA 3BBPA 1Q1BA 5KOYA 3GP8A 4EPXA 2QTZA 4HAZA 4U02A 3W2HA 2DYKA 3NDPA 3CWQA 4AF6A 1YE8A 1CKEA 3L0SA 4A2QA 2A5JA 2BM1A 1UJ2A 1I2DA 2RKOA 1U8AA 2VBCA 2HLDA 2G3YA 4HE5A 5HKKD 1CBUA 2GJSA 1WXQA 5J4HA 4WXRA 1H85A 4G5QA 1OB2A 3QXCA 5J47A 3IQWA 2ZJAA 4H9GA 1H65A 221PA 3T1TA 2X19A 4F91B 5C1BA 5F3WB 5DHFA 5H70A 3X1WA 3BJIC 2NO7A 3GLHA 4TQ9A 2KJQA 4C2TA 2VP6A 4HLQB 1Z07A 1N6IA 3GJXC 3OHMA 3K0FA 1T8UA 1JEDA 4GRAA 2BMEA 1IY1A 2FPKA 2XSZD 3KQNA 4GOJA 1WA5A 1IN6A 4EPYA 1S1MA 1FPMA 1EFUA 1EK0A 2XITA 2XX3A 2ZSBA 4TLDA 3QFCA 4LYFA 4MGZR 1FP6A 4B3GA 2ZE7A 3ICQB 5EZ5A 4JLOA 1OIWA 2AD5A 4DLTA 3RHFA 2H8KA 4G1BA 2HXSA 1N6RA 1U0LA 4YONB 3WYFA 1NN5A 1H8HA 3MSXA 5BN5A 5JI2E 4QG7A 421PA 5DGXA 3B6EA 4KLZA 5L3QA 1GKUB 3U3OA 4LJ8A 4C3ZA 4LCBA 3CPHA 3LLMA 2VSOA 3GEHA 2HF8A 3LWNA 3AVOA 2W2VA 2JLWA 1E2DA 2YC2C 2BV3A 3TQCA 4LDJA 1N8RD 1MABA 1S4QA 1Z08A 3B13B 4B3XA 1IN7A 3D3QA 3LW7A 2RC5A 2EW1A 1DPFA 4U9UA 1N25A 1YQTA 3E2IA 3IQXA 3ZZ0A 1QBKC 4E07A 3EXAA 3ZVRA 4TYQA 3QKSB 4CZ2A 3PEWA 1IN8A 1XF9A 2AD1A 2V7QA 2V1UA 2NO6A 5EE9A 3QIAA 3EZ9A 4LSGA 5KYKA 1UPTA 4L9SA 3NKVA 4TL7A 1KO8A 2V6JA 4GOXA 1LW7A 4HAWA 3VO2A 1ZNXA 1QHXA 3TSZA 2FF7A 1GKYA 2JLSA 4TL6A 5DSZA 3OE7A 3DM5A 4HLCA 5L3SB 3CX8A 1CR2A 5K8TA 2ZI7A 3GJ5A 4IKEA 5HCIA 4DLSA 4FMBB 3CR7A 3R8CA 3CMAB 1NVXQ 2CL7X 3KFXA 2IYQA 4JLJA 1QF9A 2V54A 1M8PA 3BE4A 2BWJA 4CEIB 4AKGA 1XXHA 2EFDB 5FOWA 1E79D 3KJHA 2GF0A 3AP1A 3ECCA 3QBVA 3KJIA 2AKAB 2JJ1D 5G3YA 1GR1A 4JLVA 3UWOA 3SE0A 3AEZA 2DPXA 4OL0A 1US8B 5J4VA 2FZLA 4KU4A 2ZJ5A 2OAP1 5AJWA 2Z5FA 4QHSA 2O8FB 3W8NA 4JLMA 3M6AA 1UMKA 1XMSA 2GPJA 2DFNA 1CEEA 2WZQA 1ZVQA 1G3RA 4XTRA 2YYZA 3EIHA 3LXRA 5DI3A 1WE2A 3AVTA 4B6EA 4Z8YA 2WVJA 4ITRC 1ZD1A 3BB4A 1R4AA 4Q1FA 4W5JA 4QHYA 2QAGA 2VRWA 4PPGA 3VU9A 3U2QA 1AS2A 2QQ0A 5AR1A 3CCVB 1AQUA 3MRSA 4DCNA 5IHPA 2FFQA 3A36A 3CH5A 2PZGA 3I32A 3MG9A 4G3XA 1VPLA 3OAAD 3CCRB 3GLIA 1NY5A 1CU1A 1ZNZA 2BDTA 2EWWA 3RS2A 5AUPB 1IY0A 1E1RA 2FEMA 4Q1DA 3AP3A 2CDNA 4YMVA 2OBNA 1EP2B 4HI0E 1KMHB 2GVDC 4MRRA 2BPOA 4C0BA 1DARA 3BWDD 2OLKA 2ZEJA 2R62A 3IUYA 2EYUA 2GKSA 3LA6A 4Z54A 2QAJA 1VQPB 2GZAA 2WWIA 1S1CA 3C5HA 4HLUC 1TMKA 4OI1A 2IYVA 2DFLA 2QTVB 2V55B 2QQEA 4KI0A 1PLKA 5HPYB 5CIQA 1S2MA 3AB3A 3CONA 1W36C 3GLHB 1U9IA 3B8HA 4AKIA 3K09C 4Q9HA 2GCNA 1HURA 2J9RA 1S9HA 3FFBA 4Q01A 2JCSA 1NIJA 1ZUIA 3QUSA 4LC1A 3U60B 1Z6XA 2JLVA 3H84A 4PC7A 2ZRNA 2O8BB 3KB2A 4S35A 4HAXA 1NF3A 4XTCS 3HDTA 1E9FA 3WNBA 3GEEA 4BEBA 4DCUA 4TYNA 1X86B 1S3GA 1RRGA 1Q0UA 2E87A 4P6VF 2ZRMA 5LPNA 1XCMA 3CBQA 3U5ZB 4QRHA 4NP6A 1YJNB 3CW2A 3I55B 4BFVA 5E7MA 1TF2A 3Q8XB 3K0AA 3QKRB 4D82A 4IOMA 2JLQA 3VTKA 4EPRA 4R7ZA 4MYCA 3DHWC 3OZWA 1TUIA 2C03A 2VO1A 2H7VA 1NSFA 4PSVA 4RKFA 3GJ0A 3LV8A 2X1VA 1W49A 1B23P 4LUCA 3HPQA 1B0UA 3OIVA 2ANBA 3CD6B 1E99A 1G5PA 2I3BA 3AF0A 3MWYW 3O8DA 4JS0A 5DYIA 1F2TA 5A5GA 4RFSA 3FKSD 1NVVQ 4ZCLA 4PSAA 1KMQA 2WKRA 3REGA 3SQWA 2VHQA 1C1YA 1MABB 2WV9A 4PHTA 1XEXA 4JLNA 4OK3A 2WIBA 1W4CA 3I3SR 3SHFA 3T61A 3U4QA 2HCJB 4YDSA 3V4RA 3FHOA 1OH8A 4CEHB 4P3YA 1ZAKA 2P0EA 3A4NA 3CCUB 4XD7D 4EPTA 3AP2A 2FDCA 3G0HA 2YKGA 1XNJA 4AK9A 2VA8A 3C4JA 5JJKA 3W6OA 2QTLA 2G0TA 4JIMA 4Q1AA 4OK6A 4ESVA 1G16A 1VCOA 2ZE6A 3BH0A 4Q9KA 4M1WA 621PA 2VNKA 3RLFA 3LO8A 3OZVA 2Y8EA 3KUDA 5JRZA 1TQ6A 5C46F 1P2SA 1QVAA 1P75A 4KFSA 1ZIPA 2A78A 4Y0AA 1FX0A 3EIQA 2F3RA 3TRFA 4XVQA 3QBTA 2IYWA 3W2EA 1YJ9B 2PX3A 4RVCA 5LB4A 1VQ9B 1SXJD 2CCJA 2BHRA 2RGAA 4RD4A 1Q57A 2ZUBA 3R9IA 2PZFA 3VR3A 4NPHA 3QJYA 4YXWA 1JA0A 5EP1A 3PIRA 3LLUA 1VG9B 3PUYA 5GVRA 3CPEA 2GESA 3JQPA 3ZGXA 1D9XA 2B5OA 4TTQA 4G5OA 4LX0A 1DTSA 5D3MA 2JASA 3A58B 4M9XA 5A4JA 3HU1A 2VPPA 3IO5A 2QE7A 3RYTC 4NCIA 1XEWY 4PTLA 1COWD 2IEZA 3I62A 1Q20A 5CLLA 3VU9B 1SKQA 4D0LB 1NMXA 1L8QA 3VKWA 3CX7A 4M1SA 1IHUA 2WPDD 1MKYA 2PJRA 3KKQA 5L3RA 3D7MA 3H4MA 1SVKA 5BN4A 3ZD7A 4LBVA 4ZKDA 3W9YA 3IDQA 4CEJB 4NCKA 1W35A 2J0SA 4IDOA 2FN4A 4ZV4A 1SHKA 2HT6A 3FGNA 4MDEA 2VTKA 5GV8A 2HT1A 3AGPA 2GK6A 5FTLA 1VQ4B 3ZDQA 3EA0A 4JLAA 3NHBA
chains in the Genus database with same CATH superfamily
2EHDA 1S6YA 1SIBE 1RWVA 1CJCA 4CHGA 1JBKA 1LS6A 1UKCA 5BWOA 3GU3A 3EPRA 3EZGA 4PBSA 4EL5A 2A1TS 2VA9A 3T1OA 3W1WA 8GPBA 2G7ZA 4E4TA 3FYCA 5LP6B 3IHTA 4JI8B 1Z0UA 3G5TA 4CNBA 1FNMA 3FY4A 3WP0A 3JVVA 3PRYA 2M6LA 1EE2A 1RAIA 1RI5A 2VXCA 3P4UA 2PZMA 4JB3A 2IX3A 3OLCX 1IB0A 3IEPA 1DO8A 2IW1A 3N8HA 3TQTA 3S29A 1Y8ZA 1O8BA 5DULA 2FCRA 2X9LA 4EB0A 2Y93A 1RP1A 3PYLA 3K30A 1RTTA 2ZANA 3Q7TA 1U94A 3T3IA 1H6AA 1XQ1A 4YWJA 2GD6A 2CMGA 3C16C 4OO3A 2NXNA 4WY8A 5EAIA 4D9JA 2HDHA 3I5UA 3RLIA 2IXTA 2NZYA 3TLZA 3VI3B 4ZZ3A 3HO6A 2OG2A 3PRJA 5K6TA 4WXYB 2Z43A 4JP8A 4EM6A 4JUDX 1JNXX 2LRHA 1M10A 2I9KA 3L0ZA 2IZ7A 3NAGA 4FEGA 4DBLE 2HA2A 4DUYB 1WB5A 1L4YA 2QPOA 3HBMA 1RXIA 4LWQA 1WXIA 4RF2A 4MQFA 1YJXA 3HL0A 1KI7A 3GMDA 3ORYA 1QO7A 3HG7A 3WMEA 4BVGA 4CCSA 1ZR2A 1TJYA 1E1DA 1IJKA 2GAIA 4IS3A 2Z4TA 1Y3AA 3HP7A 4RXMA 3CO0S 3FE2A 1E92A 1I8TA 1N9KA 2HM7A 4MR8B 1Y37A 4ERNA 1LSOA 5AVVA 5JLJA 3CJQA 1BHSA 1PNVA 1R74A 3FCYA 3NIFB 3D2BA 1EWVA 3T1VA 1IZZA 3CZMA 3IVGA 1NUHA 1VECA 1RMQA 2JLRA 3G5MA 4IO1A 4BB5A 4BEJA 2I6SA 1HT1E 3A27A 2XWSA 4XLHA 1VGRA 3K9GA 2DKNA 3H1FA 3LT2A 3LX8A 4J49A 4KXQA 5CDFE 1QH9A 1UXOA 2Q3LA 4YJFA 5U4QA 3ZNNA 1NRXA 1YVEI 5ILOA 5G4LA 1ADYA 1D1PA 1H6DA 1XPJA 3KZVA 3DAFA 5CG2A 1FQOA 3T5PA 3IX7A 4HQ6A 1T35A 4OHCA 3UF0A 5HZAA 4RZ3A 3UXHA 4Y67A 4FHEA 1NBOA 521PA 2HA3A 2XY4A 4IIEA 5DHUA 4DV4B 2F4NA 1U5AA 1A77A 1UEIA 5EG5A 3HMKA 4TT8A 3VKVA 5M5BA 1SUIA 2V7BA 1RIFA 3N70A 1D2NA 2GXQA 3WYCA 3QI2A 1N9GA 4HDRB 4AUKA 1RC8A 5EA2A 1CQJA 2J9XB 1BN7A 2V1XA 1CP3A 1W8DA 1EP9A 1JJ7A 1U7ZA 2P9ZA 4FD3A 4DUGD 1MV5A 4LRQA 2D74A 3AU9A 5FFMA 2CLCX 1JXMA 2JDID 5IJ9B 4D9KA 4MRMB 1LV7A 1N34B 3FHTA 3CLVA 4QPPA 5A5EA 2AEEA 3TXYA 1QYCA 2DZDA 2GPBA 3L6CA 4AZVA 4PINA 4PLVA 5JV5A 5EKSA 4Q9IA 5HYVA 2B4YA 2JKYA 4LK3A 4BE4A 1Q0HA 1Z6TA 2NO0A 3CF4A 3GY0A 5DF1A 4F6LA 4Q1VA 5CB4B 1F2DA 2GF9A 5AHOA 2OYCA 3A6EA 4DYVA 3W5UA 3I6MA 2IEBA 2H08A 3KXIA 3K9LA 3RVLA 4ZDIA 2OD2A 4BNIA 2WHXA 1YLOA 5CDHA 3NATA 2I4LA 2ZTHA 4XQCA 5JY1A 2EQBA 4PQFA 4YJ3A 5LKAA 4KPEC 4ZV9A 4WTOA 3WFZA 4LXHA 4MP3A 1OAKA 2RGNC 4I8DA 4QNRA 3DMDA 1XZAA 1TJNA 2UV8A 3I1YA 2B4TO 1ZM4A 3AVXA 1GFSA 2XCIA 4RM3A 1W8IA 3A2NA 5FL7D 2B4KA 4ZCPA 1KFJB 1LLDA 1PDOA 5D8DA 1EBUA 1BE1A 1V1MB 5IKXA 1OYYA 2PBRA 5GJWC 2AMLA 3OM1A 1E7QA 1J20A 3CLUC 5EE1A 1APBA 4EG4A 1VA4A 3BXFA 4ZT7A 1E96A 2F43B 1NU8A 1L1EA 1QAOA 2SKDA 5DISB 2FWMX 1Y0YA 3L77A 3KVVA 1V11A 1A88A 1B6GA 4NENB 4NS4A 3ZDDA 3SCZA 2ZUTA 3NC4A 2DQKA 3K9BA 3R6TA 1XTKA 4BMDA 3ETJA 3NFRA 3IEVA 3SDZA 1CR4A 1EVKA 3DOHA 3T3OA 1USGA 4E5PA 1K3UB 4F97A 1OXXK 3BOSA 4FDUA 1N07A 1A97A 1U7DA 1XE1A 4R8KA 4EG7A 4E2YA 3GYBA 3LT0A 5LBUA 1T9HA 3FOBA 6YASA 2CFSA 2IYPA 4KXXA 4X1OA 2PUJA 1TA0A 4NV0A 3S3TA 3AYZB 2RJ3A 1LBHA 3LF2A 5CVDA 5A3RA 4FDLA 4XI9A 2HPAA 3C87A 4QX6A 1K7SN 1QDLB 1M2GA 1GZ6A 1QS0A 4IIBA 4XCVA 4GE0A 3R9WA 5JH7B 4MWCA 4ZO9A 2UYOA 2UVQA 3N2IA 4MV3A 3UMFA 4I46A 3K0KA 5SV2A 4BLOA 4NLLA 3HZHA 4O2AF 2FRDA 2RBGA 1AU9A 3C14C 1X0VA 1XN1A 4RF4A 3SGLA 5SY6A 5K4HA 1A9XB 1LTHR 3ULKA 2NPFA 4B3BA 5A1JA 2QBYB 1MHPA 4Y6SA 3KKMA 4JOCA 1WUKS 1NR5A 2BKUA 3ANLA 3TOCA 4HYYA 3BN3A 4O2BA 1FTNA 1L5GB 2FW8A 1JKFA 1NHWA 1MZPA 1RAFA 2DLNA 4KHZA 4M7PA 4N0MA 1SC6A 5FNVA 1QYWA 4UCQA 5G02A 1SXPA 2FUNB 1KK3A 2WM8A 3FCAA 1ESCA 1P9RA 2YY6A 4L0MA 3TNJA 4B44A 5C4MA 2VTBB 1PIWA 4HZUB 1U2DA 3LYLA 3FPLA 5M2QA 1XT6A 2XLBA 1M67A 4XJXA 4DJ5X 5AXCA 5L6MB 1X0XA 3E3MA 4TTJA 2PMCA 3P27A 5F7OA 5JWRA 4DRZA 2C61A 1G8AA 1MIOA 4J29A 4YVFA 1N08A 1E94E 2ZUDA 1ZWKA 2VF7A 2ZT8A 3LQ4A 5J5VA 3ZC3A 1TFUA 2ZREA 1NSTA 3K6KA 4RCVA 4UXIA 4A4DA 2E55A 3K6JA 3IB3A 2YY5A 3MJCA 3Q2OA 1RM4A 3BJRA 4ZOAA 1BQ3A 2B0JA 2HHLA 2PKWA 4JNCA 4LI0A 3CMMA 3AR3A 3ZVNA 3G7NA 1DJMA 2DHCA 4GLBA 2J7PD 4YJ2B 2BOVA 1CQXA 4GUAA 3Q11A 1T4DA 4HEQA 4KCGA 5FPYA 2YWFA 1E8DA 2PE5A 2QA4B 3JD4A 1WD5A 4ZAVA 3RFXA 3V4PB 2AK2A 3VNRA 1RHMA 1QQTA 2I3GA 1IXRC 2ZYRA 4MV0A 1QYVA 3RODA 3NHYA 4B3FX 2XB4A 3FJ1A 3DLBA 4WK4B 3UK6A 1WDKA 1NX9A 1MO5A 3EIXA 1YA6A 4OOSA 3EUWA 3S68A 1L4GA 3ZY6A 1Q74A 3UMJA 2Q2OA 4MP8A 4JMLA 1VIAA 5IRCD 2VCEA 3TTVA 1OI4A 2QJRA 2X3FA 4YFVA 3V34A 2ERYA 1C14A 2LGJA 3LY7A 5E7IA 5FEMA 3R7WA 5CURA 5AVKA 3S40A 5BV2P 4M0FA 5JDIC 4MDFA 4D41A 3KL9A 2TMGA 4D5EA 2VZLA 1NI5A 2QPTA 5HW0A 2O8CB 1U3GA 1WPCA 1ODTC 2X3UA 3JVEA 3I9V1 4PFKA 1W4AA 1A8SA 3EC1A 1V9CA 3JWGA 3IP6A 3HO8A 1ZO8A 1NI4A 2D2FA 3UQYS 2GI4A 5BWLA 2AW3A 1II9A 2CK3D 1X19A 3OTQA 3WDKA 3WI7A 2YXBA 3PRKE 3RW9A 2WJPA 4FCWA 1QF6A 2FFHA 5E9AA 4KVGA 3GPIA 1J5PA 1X2BA 3RH0A 2WZNA 2JANA 1KI1A 2YINC 4KP7A 3M4YA 1NVFA 4IMRA 4FYIA 3SEJA 2VJLA 1N0UA 3CUTA 2EG9A 4NMMA 1IQUA 1YOVB 1ECGA 1AT1A 1FXUA 3R6GA 1FXWA 4YV7A 1F48A 2B37A 3C48A 2ZJ4A 3RROA 3H9JA 3IQHX 1TNDA 3SR0A 1PQ4A 4BJ6A 3TRDA 1L8AA 4YLGA 3WL5A 3ZW9A 5DNDA 4QDTA 3MUNA 4U7GA 2J41A 2PG3A 3NHPA 4DLVA 1U98A 4DB4A 2F1RA 4J1QA 1GA4A 5HZKA 1XLWA 3HFGA 1BO6A 4LJ7A 3HN2A 4PHHA 1D1TA 1CQWA 1L7VC 4MIOA 4H7PA 2YBEA 3MTIA 2FLWA 3ZIUA 2P3MA 1OLSA 3DV0B 5FTWA 4N0PA 2J59A 1Z28A 4PBTA 5E6UB 3GMIA 5JQGA 1CY4A 3RVBA 1HYQA 2P0AA 4WLFA 2WYWA 4B3IA 2FHPA 1KO7A 4XM3A 1M1NB 2ECPA 3CWZA 4RIHA 1VL1A 3RC9A 4BOYA 2MSLA 4J7CA 4X62B 4FS3A 1BX0A 1NJFA 1PKXA 1K0FA 4I9FA 3HM2A 4JOSA 1OLUB 3VC2A 1LA2A 3V3KA 4FCTA 2D3NA 1KMMA 3T6KA 4EW2A 1QIGA 3FPEA 5AVYA 1NAHA 3NTRA 2GRUA 2NUPA 3HWWA 1GCUA 1I94B 4MQ5A 4UAVA 3FWYA 5DJ5A 2ZYWX 3WHLA 3PVDA 3BMCA 3IUMA 4LSWA 1JB9A 2HHCA 3LDHA 3OU2A 3CRZA 4O1MA 3ZIAD 1OGYA 1Z4IA 2X15A 3JSXA 2YV3A 4LHXA 1L5NA 3KQWA 3SHQA 2SCUA 1ID8A 2SBTA 4WNCA 4RHEA 2J46A 4FYWA 4MAFA 1UDBA 2WUGA 3MHTA 3JQQA 1DOHA 2J3KA 4G0ZA 1FSSA 4EY3A 3THXA 2ZSHA 3LLCA 1AVTA 2YHSA 4L4YA 4OHXA 1M0SA 1W88A 3T99A 4CCYB 2CV0A 1MJFA 2ASEA 2LUOA 2YZ2A 1SXJA 3BWXA 1ISIA 2WUDA 4KVFA 4P84A 1NMZA 2GTIA 2A5YB 2ZP1A 3CNQS 4M7RA 1CW2B 3U7GA 1KQPA 1ULZA 1UMCB 2NO5A 1JSXA 3GFTA 2YBDA 3R6DA 3VBEA 3OEED 4A8JA 5BSRA 3FWZA 3HBFA 1D4ZA 1J6UA 1Z18A 4GPTA 3STYA 1KP2A 4ZZ1A 1ATZA 3HYTA 3PDHA 3ZZ1A 2OBTA 2Z6UA 2VPZA 1U5CA 3TEJA 1UKBA 3U49A 3OF2A 1U2TA 1PQWA 4TMKA 1W0JD 2QMUA 4UM9B 3F6YA 5K9ZA 1HE1C 1E4OA 2GEBA 3IIJA 1KE1A 1DL5A 2F3SA 2QL9A 2QRNA 3SYRA 2OBBA 2H1VA 2O3RA 3FVTA 1JJ2B 1E8NA 2FN9A 5K8CA 4MJXA 4XDHA 4MVXA 1ZU5A 1COWA 1N6OA 2FETA 4NMXB 3T15A 2HRRA 5LNK1 2C5LA 4PLGA 3OFSA 3GP3A 1BKDR 4I1VA 4XFKA 3O82A 3R23A 3V76A 4CKCA 1XPRA 2FOLA 2JGIA 3EZ2A 1IHOA 4JJKA 3L1IA 1K6MA 4PU0A 4QO7A 5CG1A 1XC7A 3NBFA 4FR5A 4NKRA 4YB8A 4MGHA 1SD2A 4PYMA 5LDDC 1XXLA 3GOQA 2X58A 3G6KA 4IJKA 3PUMA 3ITDA 3V1YA 1YJQA 2EP8A 2R6JA 3H2GA 3H5VA 3GLFA 1UBEA 4KKXB 2RE8A 1BVRA 4CFZA 1U0NA 1H2HA 2C83A 3DVRX 2FPIA 2CF5A 2I6TA 2IDKA 4DLKA 1IATA 1GSAA 3TF5A 3LUCA 3GGCA 1ZBDA 4MJLA 4CF5A 4YUYA 3F6EX 4DV6B 2WM9B 5TGDA 3ZQUA 4CBVA 1O87A 5AW0A 3FFWA 3IKTA 4HGQA 4YJ3B 5ENVA 2H92A 4GIBA 5JZOA 2EFHB 2QSUA 1SM4A 3G02A 4HD8A 4K6KA 1BCRA 1FDSA 4F9TA 3TUZC 4AS2A 4MV6A 1AUPA 3OIWA 4ZYZA 4QBIA 2XUFA 3DL7A 3U4HA 1ACMA 2CNLA 4CLXA 2H1LA 1N8KA 2RK3A 4RIGA 2ZL7A 1C9MA 1UMBB 2D2IA 2Q6IA 4ER3A 2NP7A 2X8KA 1LPAB 2CMFA 1QGYA 3QQ5A 1XL1A 1VGQA 2RARA 3SC3A 2XUIA 2B92A 4PS0A 3UJHA 3NEJA 2IE0A 4PRZA 4X7FA 1EWKA 3SBDA 4EQ6B 1VCHA 3FPCA 5BWMA 2C5SA 4OBXA 2J09A 1Z8HA 3O92A 5AJYA 2YYAA 2ZKIA 3PL1A 1AQ6A 2C2XA 4UBNA 3WAKA 2XW6A 2NXEA 4S2EA 2D5CA 4RW0A 2Q2NA 1SXIA 2Q45A 4JLUA 4RZIA 1AN9A 3C6BA 1JT2A 2MWMA 3FTCA 4NF2A 4CTMA 4HNAB 4WXPA 5EVCA 5KU1A 2FSFA 5BQPA 1A7KA 1D4FA 4XYGA 1HRDA 4JOBA 1M2VA 4B2LA 1IN4A 3NTUA 2ZIAA 3K1ZA 5TR9A 3P9ZA 2VJQA 2YXPX 4JXJA 4LPKA 1ZX1A 5CX4A 2P65A 6REQA 3C6QA 1RKXA 4YAFA 1UFOA 5GTDA 5JJ5A 4F5EA 1N0VC 2Y0DA 4DCPA 5C32A 2Y92A 3B9QA 5JTUA 1NF9A 3I9NA 8OHMA 2O50A 3OEYA 1R0SA 2J32A 4LYJA 3P9QA 4EY4A 3G17A 4PWYA 1II8A 4PLWA 4A0SA 1M8GA 2JCYA 2KBEA 2YS7A 1EFLA 1XQYA 2PKQP 4XRGA 2QLFA 3Q41A 4GFDA 3A6FA 3QZUA 2ZM5A 2C95A 2PHZA 2X5OA 5COAA 5EFZA 4HNTA 1E3MA 3O6VA 4EITA 3TW8A 4WWVA 2HRZA 4PLFA 1FFDA 2WJGA 4D97A 4P0TA 4WK0B 4EG6A 3M4XA 1R9MA 3SOZA 3VU8A 1JDBC 1QVFB 2AOUA 2EWMA 5ICFA 3PXXA 1IQRA 4I4LA 4EAAA 2V3WA 4W9NA 3N8DA 1JYSA 2IUEA 3MC1A 3B12A 3RJMA 3MWFA 3ORRA 5K3SA 3ILSA 5CYOA 4CR8A 2DAPA 2PKQO 1OXMA 3JRWA 4BWYA 2FHSA 1E3WB 4FCVA 4LXGA 5KC9A 4DJDC 2A9KA 2PK3A 3C8HA 4EYOA 4IYRA 3IV7A 3WNVA 1M34E 1ZESA 3ZHQA 2PLWA 4MAAA 5A88A 1BU8A 4P1VA 4JL8A 4MARA 3NE5B 4BFTA 1U8ZA 3HWX1 3BK7A 4DUGA 1SEVA 1JXQA 4I1YA 2HUNA 1X9HA 2JDIA 2RHLA 2GERA 3TW0A 1Y89A 2VIIA 3UT5B 4OSOA 2OO7A 5AW7A 1N36B 5A4FS 2PTHA 1KKUA 3R3HA 2DETA 2EBUA 2PFSA 3DEKA 3BEOA 3AGQA 3DF7A 3MAGA 3KTAA 4RK0A 5DHQA 4Z1MD 1Z33A 2FFRA 2PAFA 4F2WA 2P6NA 2AN5A 1DQRA 2BFPA 2ONZA 4TRJA 3RKRA 4CMJA 2A9OA 1PJLA 1PX0A 2HJWA 3ECAA 1PSDA 3HU2A 1E2JA 2IC5A 3UWSA 1KJYA 3YASA 5J4YA 2RCNA 4ALLA 5J2TA 5AVTA 4DM4A 4FFDA 4XFJA 2YZ7A 1XNRB 3ZHUA 5BQ3A 1TU0A 2AOXA 3BL8A 4H15A 1LFAA 1AK1A 3TN7A 1FTYA 1A04A 4JXKA 4UDYX 4X91A 1BDHA 2DR2A 3LP8A 2CUTA 2A9FA 4PYIA 1V0EA 3L04A 4UARA 3VDXA 4EHKA 4ZI7A 1E2BA 3QSYA 3UMVA 3ZXYA 2HKIA 2LE0A 5EEGA 1M2JA 3DPIA 4I81A 4BTVA 3KS9A 2AI2A 3ESQA 3OCVA 1UFVA 1ZCBA 1EFHA 3KQQA 3PZRA 2VF2A 2E89A 3AJDA 4YCLA 5G2OA 1D09A 3S8EA 1JG6A 3UFXB 4KXMA 4KJXA 3PI6A 3GJ3A 1GTVA 4PO9A 4A2WA 1FIUA 4C05A 1V8BA 4KAFA 3CUUA 4JBHA 4P32A 5G53C 4Z86A 2C07A 3LKZA 3BT7A 5EJIA 1LQTA 3QXJA 1HG0A 4Y6QA 1EXMA 2XBLA 3PD1A 4WL0A 2WJ4A 1OZ0A 3A9WA 1PJTA 4G1UC 2ZE8A 4GLFA 1FDVA 5DEIA 4CN8A 3EC2A 1WUHS 3EXEB 3IMKA 5ARDA 5L7TA 1F20A 1Z82A 4NPCA 4V3CA 1CQIB 2OILA 1TA9A 2FJ0A 2IXDA 3FOCA 4CQMB 1C7EA 3SEFA 4E1VA 4ME6A 3P2OA 4FN5A 5E6SB 4DLXA 1YUMA 3R20A 1NQAO 1RQNA 4DDUA 4GGOA 1LSUA 5LC1A 1T15A 4XIFA 1LLUA 1X2EA 3VI4B 1V8OA 3ZI7A 1JWLA 3WV4A 1YZKA 4N54A 4UEJA 2UUBB 1GPH1 2J3IA 1DEXA 5EXEA 2G06A 2YDXA 1L5HB 1WZEA 4IDFA 2R85A 1XYYA 5FUYA 4PZEA 4L9WA 2XB2A 4B6PA 3L6UA 3PC3A 4YAEA 3DDUA 4BNLA 3DOEA 3FR8A 3E5NA 1N6LA 2BR3A 4LXQA 3REQB 3NDBB 1X87A 3F3KA 2CRVA 4NMHA 4AT1A 4DMHA 3KAPA 5JRJA 4PHFA 4C0HA 2FE4A 1CJTC 3KFLA 5ELMA 3EOBI 3LXMA 2GM3A 1QNFA 1S01A 3CNBA 2BGTA 3ZHXA 1Z4MA 1E77A 2W2NA 2QAIA 2DFKB 3OZAA 1RYFA 5DBGA 4CIBA 1A9TA 1U5BA 4XOIA 3AVYA 1GQYA 1SURA 4AICA 4O4LA 4YT4A 1JZQA 1WMAA 2QUKA 5DHSA 4AJPA 1MRZA 4R9UC 1MB3A 2V5VA 4XEUA 2Z5LA 4ZCMA 4TYMA 3ZI4A 1H0SA 1M75A 1WUJS 1OWPA 1Z4OA 2HSJA 2XMBA 3BMOB 3FYSA 3PQCA 3QXHA 1QWOA 3KELA 5CD1A 4QFCA 1E62A 3A8IA 1EIZA 1IHDA 1UXIA 1W4BA 3LXXA 3NKLA 1XGKA 2JF0A 3OP4A 4TLBA 3V00A 1R37A 3SFTA 3WZMA 7ADHA 4GPBA 3KKKA 4BKUA 4L73A 2J7PA 1YFLA 2F8SA 2VL7A 3WSWA 3RNOA 4FC7A 3H5NA 1K88A 2HU8A 4OL9A 4ZTBA 1PR1A 4Q00A 4ZVMA 5BNFA 1CF9A 4AFNA 1GZUA 1E4YA 2CVHA 2QRMA 2W8ZA 3F7TA 3G88A 4OGFA 1P17A 3QVSA 2JZNA 2I2WA 4F38A 1M7BA 1FQJA 4R2HA 1SCNE 3PR2B 2Z95A 5LBIA 1A5ZA 1BMQA 1E2EA 4B7XA 4BZPA 2QRPA 3LPCA 2A4MA 3QKTA 1UADA 3G23A 1C4KA 1N6HA 3LM8A 3BQMB 2X6RA 3QOFA 2DU8A 3RK4A 2P3OA 2AF4C 3D3WB 3Q0EA 5IBRA 1V3QE 1IBLB 3N8KA 3GVKA 1SVIA 4ZOLA 1BTOA 2IHKA 3RJ9A 1U02A 4ZT3A 3DFKA 3Q9SA 2HCFA 2RDMA 4AJLA 1NUPA 3QFHA 3KT6A 5K3BA 3MCVA 1LQUA 2A14A 2J1LA 4K6HA 4CM5A 2Q5EA 1NDHA 5EERA 2PUBA 2JBWA 1KFEB 1H2WA 2DFDA 2WYHA 1WXXA 1REQA 1EWTA 4Q4HA 3IMEA 3KJZA 4MW0A 3GLGB 3KT3A 4MYTA 4D1YA 1O96B 4QREA 1C50A 1GUAA 4AWXA 3C4QA 2D13A 5I48A 2ZIWB 4Q47A 4NQZA 1F2TB 1DE0A 3LKVA 2XIJA 1FFAA 1P8AA 1TVKB 1Y7IA 3AIIA 3OZUA 3EVFA 3GRRA 4GBMA 4HH3C 3BFXA 3M6FA 1W9MA 4M89A 4ISCA 3AVVA 3I39X 2DMRA 1GV0A 4V0NA 4FQ8A 1J8FA 4RPCA 2AJLI 2HXGA 5F73A 1C7ZA 4EZIA 3GJ8A 1D2AA 3UM9A 3ZUPA 2FPWA 1VDMA 1PT8A 4ND1A 1Z2NX 5IM4A 4BPBA 3P2MA 2M6KA 4MYSA 1ZD5A 4PM4A 1ZITA 4X6XA 5C4IA 1CJKC 4OHZA 2DY1A 3I6ZA 3PJFA 1RWXA 4CF6A 2O59A 1TAUA 1XMPA 1QGAA 1HM5A 1MMFB 4PHCA 1U99A 3NEYA 3E2MA 4Q3KA 2AK3A 3IOCA 3NHRA 2PS1A 3UH0A 3H11B 4GP7A 4XORA 4P35A 3PUHA 2QV7A 4RKEA 3FZGA 7REQA 1X80A 4WN9B 4FFBB 3RNLA 4D2IA 5LDGA 1MO3A 3UHAA 3PUJA 3R2JA 1GTJ1 2PIDA 2PJZA 3ABQB 4WZLA 3WLJA 5K0BA 4OSEA 2P9TA 4FOSA 2JK0A 5DCUA 3T9CA 2AE2A 1ELOA 2RGEA 1KEUA 1FFEA 1RLUA 1RI1A 4KUHA 1J06A 1PW7A 1VKZA 3G9XA 1RPNA 4HEA1 4YROA 5DX0A 1CZHA 1GR0A 2XEDA 2HO5A 2JEZA 1E2HA 2BH2A 5KNCD 2XTJA 4PZYA 1SH7A 3EDYA 2QB5A 1FDRA 5EMMA 1AF4A 1BKSB 1HDYA 2NT4A 1K8AD 4GOLD 4BB6A 4BFSA 3VKGA 1B0PA 3A9VA 2GZ1A 4YNBA 4PANA 3OPYB 4IWYA 3VYTB 3CG0A 4HH0A 4TYWA 4ER0A 1QRDA 2HH9A 2NSJA 2XUAA 1OZFA 3NBAA 4HLUA 4LC0A 4HAVA 3NGLA 4OHOA 2AYZA 4BJHB 4PNPA 1S0UA 5B5SA 1QO9A 2H11A 1YJAA 4WBNB 2RK6A 5BMVA 3ZCXA 3C3EA 2WJ6A 4IFIA 1RQLA 3SYMA 1VCMA 3QEOA 5JJCA 2D6FA 1RKBA 5E3IA 1N6PA 4ZVQA 4ZEVA 3IKLA 3ZIAA 4DIDA 3ASPA 3HCNA 2Z4SA 4MP6A 1G0NA 3KZXA 3L8CA 2XKAA 1JIQA 4BQFA 5A6SA 3RS7A 1Q5PA 4AWAA 4D4MA 5TMEA 5A7GA 2RGGA 1X92A 3I2HA 3GRVA 4RH0A 1CS0B 1PEYA 4IIJB 4OKSA 4PWZA 5FULA 3LVBA 1L5VA 1QNLA 2R8RA 2D0IA 3ETLA 3HR4A 4FXOA 1EB9A 1FS5A 2GYWA 2O2XA 3QKWA 4IOKA 4KXFB 4OQXA 5CH5A 1F6BA 1Y7TA 4HQRA 4OIMA 1JHXA 1C8LA 1JYEA 4MV8A 3OEEA 5TQ2A 3RC7A 3ZS8A 4ESHA 4C4RA 5L46A 4JYMA 1T5LA 5BSGA 4EY8A 3OZGA 2DT8A 1Z5NA 4JZKA 1PWHA 1NVBA 2H7YA 2W90A 4MPRA 3PTZA 5C18A 3CCSB 1I36A 1OYWA 2JZOA 1JMVA 2GN1A 4FZ5A 1W0JA 3A4YA 5GWXA 2GBGA 4B3CA 3HJHA 4XWOA 1KVQA 4Y2YA 1BEEA 3HB5X 3ZS9A 4IFTA 3ES9A 1O94D 3Q10A 1SVLA 4UCWA 1KJWA 4E51A 2NV0A 2KX7A 1ZUWA 3ABOB 3C70A 2IS2A 1XEFA 4FMDB 3IELA 2GTPA 5ERGB 2BFNA 2A33A 4E1AA 4HNUA 1XSEA 1ZQ1A 4WPGA 1HPLA 4I08A 4FDAA 4LHWA 5B3AA 3A70A 2GOYA 3CCBA 4BVFA 3EVDA 4TV9A 1MC5A 4Z9YA 5ESDA 5HSGA 4RZ2A 4REQA 4LJ5A 4CHTA 4E5KA 3B6KA 2A58A 3EXFA 3JASA 4IV8A 5H8WA 4URWR 1I18A 2XWJI 3UJ8A 4PX9A 5J1SB 3SAJA 2IV3A 4PC2A 5LXTA 4BGEA 1GV1A 2B3DA 2MSWA 1CY8A 2EYQA 1FRVA 4GC5A 1Y1QA 2HFKA 4R2KA 5BWBA 2VAPA 4J43A 3SJCA 2C9MA 2JGMA 4D0NA 4YI3A 3SLDA 3BH4A 1A9YA 1WVIA 3ABIA 4KGVA 3WGVA 2REOA 1ESZA 1I7PA 4ZT2A 4K9NA 5FWYA 2OGUA 4RD3A 1ZH2A 2WD7B 4RVHA 2ZR7A 3OO0A 3S28A 1JKJA 1KYVA 2W0SA 3ISVA 2BISA 1IWPB 3EIFA 4YY3B 1P5JA 4IDGA 3PDIA 4KITB 1K08A 4LNHA 2GAOA 4GMFA 1JSZA 2W22A 4EFMA 1UPFA 3K35A 1CXZA 3K4QA 2IZ0A 4JJZA 3TBHA 2GJ9A 3H2KA 4ZOBA 4E12A 1A8UA 1NNLA 3GZ4A 5DNYB 5AN9A 1B2LA 3A9UA 3EXHC 1U31A 4R9NA 4E09A 1U9IC 3HC7A 2VJIA 3TTTA 4YAOA 4O63O 5DBFA 3SQLA 4DTIA 2BFFA 3LHDA 1M6EX 3SR3A 2R84A 5A5VA 1OFUX 4B6OA 3GVHA 2P8SA 1K7FB 4FKBA 4QODA 3D9QX 2O3JA 1MQSA 1W5BA 2BFBA 3T56B 5TEVA 4CDMA 2QRUA 3FWPA 2WDPA 4DDTA 2WIKA 2NZ8A 3JQ9C 2PWYA 1WTCA 4O2LA 1A9RA 3IPYA 4HAUA 4ZVVA 3EZFA 3K9QO 4TZTA 3OPNA 1Q0QA 3OJLA 4C3UA 4KODA 2ZSJA 4H31A 4J0KA 4O4HB 5JAUA 4MB2A 5A9TA 3T06B 1Q7CA 2PUHA 4HTAA 5AI4A 4UREA 1GGJA 4NJEA 5D85A 5JROA 2DTDA 2VAXA 2VDKB 3FCCA 4D98A 4RZUA 3ICWA 1GZDA 3GGJA 2IIQA 3NHSA 3G9ZA 2G08A 2Q4RA 3RWMB 3UBTA 3GBVA 1FDTA 2F1MA 2OBRA 3MWJA 5JOQA 2CFCA 4IUYA 1BMDA 2W48A 4M6WB 1EJ0A 4BFLA 3ASQA 4YAIA 2YR0A 3W3ZB 4RY2A 1P4GA 3LBNA 4G1CA 1VQOB 1M8FA 5FI5A 1Y8RA 2JGFA 3VPSA 3HV2A 1H8ED 4U7TB 4BJ3A 5F98A 2XVXA 3CIOA 1YDEA 3NGMA 5I4IA 2BR5A 1E1NA 2W4QA 1GQOA 3PR1A 3TZQA 2ZRPA 4J16A 3EXIA 4N7MA 3HU5A 4L2IB 4TMFA 5TMDA 3SSMA 4HRXA 5AI5A 1W4LA 2ATEA 3BWMA 2V96A 3C5EA 5KSZA 1UUFA 4QU9A 3UMGA 4WDQA 5H7XA 1CEQA 3DAHA 2W6ID 2QX7A 4TQGA 2JFXA 4FYPA 2DJIA 5ALPA 3DDWA 4RVSA 3ELBA 3D5QA 2PBZA 4K26A 2UYCA 5E7QA 1PK9A 3HNRA 1NW7A 4PYOA 1GPJA 1YR7A 2NV4A 2PQ6A 3DEZA 4AJKA 5I7UA 5BNTA 4IQ8A 3DDYA 4G56A 1KPIA 3DVAB 1RW4A 1E89A 4DMCA 4CM9D 3HXOA 5BNWA 1DUVG 1LI4A 1JEJA 3GCWA 2RKBA 2DEUA 2AB0A 4U8GA 1AD2A 1UPXA 1DXOA 1O94C 3DOIA 5DDIP 1OHHD 3T0GA 3UJDA 2R8EA 4X64B 4Z1MA 5IBCA 4PN3A 3C6YA 4ZVPA 4QOEA 1CIPA 1ZNYA 5KHAA 1ZM9A 1P6QA 2Y1LA 3RVQA 1GCOA 1WSAA 1HLFA 3KR2A 5TRDA 4EECA 1E3DA 3IAS6 1XRRA 1KMHA 5AQ1A 4XX1A 3S81A 4Z49A 1SG6A 3W5IA 1RQ2A 4GGPA 3P97A 1Z0JA 2AWNA 4BZQA 4CTJA 1PSWA 3LC7O 4XYMA 5B55A 3WB9A 4XD2A 2XRFA 4P3OA 1P2TA 2QTVA 2YIJA 5TPWB 5LB2A 3OHSX 4BO9A 5GOTA 4ZVUA 5HBGA 1SXGA 4G07A 1OB0A 1SHZA 1AC5A 2FZ4A 1E5LA 1FE8A 3BBLA 2VXBA 4U3JB 4Z53A 3OPOA 4MPTA 2FYTA 3I73A 3KOXA 4MYDA 3ZWYA 4GNRA 4FGLA 3PQ4A 3V9AA 3V8BA 1WW3A 2GCPA 1YFKA 1K4KA 3C8DA 3FRJA 1M1YB 4V0OA 3M7IA 2PUVA 1IEQA 1ZBQA 3D3EA 1UBJS 2P79A 1OWLA 1I1QB 5T4EA 5IUKC 4O02B 5DK6A 4M60A 1IOWA 1R50A 5GONA 2O8BA 2EP5A 2XNDD 1KZ6A 1YZNA 2AXQA 1P1CA 3I83A 3FTDA 3QA9A 3FHLA 2P62A 3EIUA 1GNRA 1SCUB 1XVVA 4M2LA 3FRIA 5EYPB 4X9XA 2IF2A 2NP6A 2ES4A 4X1IB 5AJUA 1GSHA 2IHVA 2WU3A 1GKLA 2ZVPX 3QUCA 4MA4A 4EHHA 4F7DA 1AXGA 3KSAC 3E7FA 2QY9A 1WQ3A 3DUWA 1VJTA 1Z5OA 4WOJA 1NF8A 4G81A 5E4TA 1EFVA 2NVOA 2KVOA 5FBVB 2O23A 2XOXA 4ZU1X 1YR2A 1VB5A 2D5AA 2G4LA 1U3TA 3Q6NA 3WGHA 3UUWA 2G8NA 1CF2O 1K1EA 4YEJA 1NXOA 2WWYA