4QFMA

The structure of aif2gamma subunit d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
publication title The structure of aIF2gamma subunit D152A from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qfmA01
3W2IA 3EPLA 1RFLA 3DKPA 2ZI4A 3NEYA 2CHQA 1XTKA 4JLBA 4YXWA 1J7KA 3CCVB 821PA 4LBWA 3MFYA 5P21A 1VIAA 2KBFA 1QG0A 1U98A 3W5JA 5AJWA 2DFNA 4JT4A 4WZAE 1YHQB 2GWHA 4DEYA 1G7SA 3A58B 3BH6A 2ODNA 5FPTA 1N5JA 2QQEA 1XPOA 3EZFA 2C77A 3NVAA 4OL0A 3SNHA 4PHGA 3RS2A 4Q4AB 1YJ5A 1E2NA 3UXMA 3SQXA 4HLQB 1ZJ6A 1X86B 4BLQA 1XTSA 3TVDA 2KI5A 4OKSA 4Q9KA 1KTVA 4E09A 1U0LA 2PJZA 4PSKA 2ZRKA 3THYA 1ZU5A 3W6NA 3RRZA 1DO0A 4XVUA 1Z22A 4X8HA 3HP1A 5BW8A 4WXRA 3ADBA 2ZRPA 1SVMA 1Z07A 2ATXA 3BJIC 4FN5A 4KI0A 2FNAA 1NMXA 4US0R 2J5XA 3TK1A 1JAIA 2YWFA 1S1CA 5EE0A 5G3ZA 4ZPXA 4B3DA 2GDJA 1NN5A 2ZRJA 2FDCA 2VNKA 3LX5A 2IEYA 1FNDA 4DBLC 4DLWA 2XB2A 5DH9A 1DDIA 2H7VA 5KNDA 4NU0A 4NYMQ 2VHCA 2VIIA 4JBYA 2OXRA 3EAQA 2RC6A 3EA5A 4QNRA 2HUPA 4OI0A 4G1BA 1Q21A 4V0KA 4CEIA 4C7OA 4AYWA 2F55A 4RD4A 1W34A 1QG2A 3T1VA 4HZUA 3QXCA 3W3ZB 2CRVA 3MAAC 1BOFA 1W48A 3RSLA 3S1AA 5KSPA 2RGXA 2ZAMA 2GXSA 1Q3HA 2IHBA 4Q1DA 1ZM7A 1D2EA 2B7BA 1FQJA 4D0NA 1XRJA 2GF0A 2C04A 4HB3A 3N2IA 3N2EA 1YZQA 5L8VA 1UFQA 2AWNA 1HT1E 4JYBA 4Q9IA 4EPXA 3E1SA 1NLZA 2XB4A 2XEXA 4BRWA 2PCLA 2YNMA 3CF6R 4WIAA 1T9HA 1K5DA 4ZDIA 3HU3A 4NTZA 1TAGA 2FOLA 4XWAA 2REBA 4XD7D 1E64A 1ELOA 1G8PA 3DPUA 1D9ZA 1KSGA 1RE0A 4PHTA 4LX0A 4B3FX 4F38A 4BZPA 3NKVA 3OHMA 2HCJB 4ZI2A 4QOSA 3CRZA 3K9HA 4WBSA 2QBYA 2J87A 4M1MA 1MKYA 2F1RA 1XXHA 2IBMA 2QUZA 2O8CA 4KBGA 2OBMA 2BMFA 1N0VC 1NKTA 4EPTA 1E2HA 1QUEA 1E0JA 4D4KA 1Q82D 4G5OA 4MGKR 3SOPA 2HF9A 4FXPA 1KMQA 1VQOB 1S96A 2GAAA 5B57C 3UMRA 4ZCLA 2YWEA 3U3KA 3Q5DA 1G4UR 3IIKA 4G01B 1MO6A 4LJ9A 1V5WA 2HLDD 3BK7A 1GNQA 2UVQA 1KO1A 2WSMA 3OESA 5EXXA 2V4ZA 2IF0A 1D5CA 5J40A 1GUAA 5HXBA 4TQUS 4LI0A 3CWZA 3V76A 1JR3A 1OXTA 2HYDA 5JJLA 3WMFA 2WMOB 3RRMA 1F60A 2CDNA 1FNCA 1ZM3A 3U6BA 1DAGA 2W0MA 4G5GA 1AS3A 1TUEA 2V6JA 1ZC4A 4A15A 3GJ6A 1X1SA 2YC4C 3M6AA 1DE0A 3CC4B 3JQPA 1JXOA 4DJTA 3ZD7A 5F9HA 1RYFA 1CNEA 2WOOA 3K0CC 2ZJOA 5J4KA 4HE6A 3LH5A 1CRQA 3W5HA 3EWAA 1N6LA 4MGZR 3L8ZA 4OK6A 5FOTA 1KAOA 3BWDD 1FRNA 1XPRA 1KI4A 3KX2A 4NONA 1TVCA 1SGWA 3KUCA 2Z6VA 3HJNA 1R0ZA 2RGDA 3MGCA 3TSZA 3SI7A 1EFRA 1R8SA 4IJMA 2OTJB 1NN0A 1PJRA 1Q3TA 2KSQA 1ZBDA 4EFNA 2AD5A 1BX0A 3AF4A 3VR1A 4MGIR 4YQFA 2FMXA 4A8JC 1B0UA 4PAMA 3TW8B 1GO2A 1C4OA 2VH5R 4MRRA 3GLIE 2XTMA 4MKFA 2ORIA 2RHMA 2G77B 3CM0A 3NC1C 4IFBA 1JJ2B 1RKBA 1FNMA 1YZKA 1QGAA 2ZVPX 1ZIOA 4A2QA 4TQAA 1W0KA 4Q02A 5DE3A 2GXUA 4KVGA 1ZU4A 3K0FB 3W3AA 4B2IA 1E2PA 3WYGA 1Q1ZA 1TEXA 3Q5EA 1XD2A 1Z0IA 3ASZA 4V03A 2E87A 4ZKDA 5JI2E 3HU1A 2QGNA 3B1WA 5DO9A 1ESNA 4IDHA 4PZZA 1ZNZA 2J59A 3DM9B 5E4FA 4ZKEA 2JJ8A 4KSCA 5BQ5A 3C15C 1E69A 1HE1C 1TADA 4Q9JA 1CLUA 1ZM9A 4IEIA 1TNDA 1VMAA 5AUQA 5TARA 3U3RA 4R2IA 1BX1A 1GRQA 1GM5A 4NYJQ 3AF0A 4PC7A 3EPHA 5AJZA 3SJAA 4CEHA 3PUYA 3R7WB 2RGNC 3PQCA 4TYNA 1KJYA 4IOLA 1E9FA 5JLJA 2AFHE 2REOA 4BGDA 3QKTA 3WHLA 1XTIA 2F7SA 3VX4A 5B64A 3O47A 2P6RA 4A2PA 4Q9LA 2XITA 2V8OA 1JAHA 3WRXC 3IO5A 3KB1A 4A0RA 1TTTA 3W5UA 3ZQ6A 1W1WA 1I4DD 2ONJA 3NH6A 1JALA 1P9RA 3OE7A 1E2MA 4QGHA 5LPNA 2F9LA 2VHUA 2CJWA 1ANKA 2YOFA 1J99A 1ZC3A 4MYCA 3IQWA 2VEDA 3VQTA 2RMKA 4J0QA 1W4BA 3PFIA 4MDEA 4CEHB 3KTAA 1OHHD 3SFZA 1VQLB 2NPFA 2ZI3A 5L3SB 4NHOA 5JWOA 1XJCA 2QTHA 2R6DA 3U4QA 2BOVA 3C41J 2QPTA 1E2GA 2ZS9A 1BYIA 2WV9A 3MHPA 1Z6AA 1E9CA 1RYHA 721PA 2ERXA 3TGPA 5FUWA 2QAGA 4URYR 1LW7A 2XNSA 4K46A 3QBTA 3VX3A 3AF2A 5G41A 2DR3A 3PENA 2HLDA 2OG2A 4KFRA 4ZIRA 1SXJC 1WP9A 5DI9A 2ZEJA 3HYRA 1YU9A 5DNYB 1UPTA 2GK6A 1DG1G 3EASA 2GJ8A 5AWFC 2GJ9A 1VQ5B 4JL5A 2GZHA 1E62A 4DQLA 1JEDA 2BJWA 5FUYA 1RC8A 2O8BB 4U9UA 1Z6TA 1AGRA 3AV0B 3I56B 1DTSA 1G5PA 4D81A 2ZR7A 2Z4RA 5BN4A 1IN4A 2XZLA 2IYXA 5J4YA 5JRJA 2IYRA 3GLFA 4WAUA 2DFKB 2DB3A 3I8SA 4DQKA 5LD2C 4A6XA 3OAAD 4A9AA 3RANA 1G17A 1Z08A 4V0LA 4M0LA 1Q81D 2EYQA 3L0PA 5G40A 3BE4A 1ZVQA 4A82A 4YMVA 2B21A 2ZYTX 4V0MA 3DEFA 4HLDA 3K70B 2W6ID 1YHNA 4KXFB 3TBKA 1MH1A 1VG1A 3OIYA 5DLQC 2JJ2D 2J0QA 3B5JA 2QL6A 2CNDA 3LO5A 4TZ6A 1P62B 2PX0A 3B1YA 2ZE5A 3UK6A 2Q9BA 1QF9A 1VHTA 3ZIAA 2VP9A 3CBQA 1E2IA 4EFMA 3RC3A 1YI2B 1HQYE 3QE2A 2YHSA 2AFIE 3I3SR 2WJIA 5C1BA 1XEWX 4C4PA 2GXAA 4K1XA 5IK2D 5TDHA 2OCYC 5IT5A 4HDCA 2KB0A 3P26A 4V02A 1NY5A 3CCUB 4WW0A 4IOJA 2F1HA 5EP2A 4G5RA 1TEVA 4W5JA 1JR3E 3NBZC 1YR7A 1XP8A 5JCZA 2NZJA 2ZJYA 3DL0A 3GFTA 2DERA 1JPJA 3BC1A 3R8FA 2W58A 3I73A 1FP6A 2HYIC 2DEUA 2IEZA 5F2EA 1NVWQ 3MSXA 3QQ5A 1M90D 4UJ3A 3DMDA 4QC2A 4M4SA 4KYUA 4PQYA 1KSFX 1T0JB 1QHGA 3CC7B 3QEOA 3QFCA 3A1WA 4EKDA 1OXSC 4QGFA 2Q3MA 3EIHA 3EC2A 4B3BA 2FA9A 2LKDA 3TAHA 4ZCMA 3K53A 2EWWA 4B73A 4B3GA 4CEIB 1E0KA 3EZ2A 3VNVA 3SFVA 1AK2A 3IDQA 2QT0A 3IPXA 4LHVA 4XTCS 2FH5B 3AH8A 2WWYA 2NQ2C 1L4YA 2TMKA 3LLMA 3QXJA 4Q21A 1QHXA 5EXTA 1ZNYA 2RKOA 1DAMA 4IXMA 4MRPA 5GADl 1NBMD 4BECA 1NN1A 4TWZA 3MJHA 3M0EA 4I1VA 1GL6A 3SS8A 1Z2AA 2P5TB 2WJVA 4PFSA 5B2ZA 1KY3A 3V4RA 3MMPA 3EZ6A 3GLGB 3ZZUA 4JVMA 1IXZA 4LK2A 4DLRA 1NG9A 3IEVA 2V7QA 1NMZA 1YZTA 4W5HA 3MJRA 4L4UA 1WB9A 4QBIA 3M4YA 3VTKA 4Q48A 4DDTA 4DT1A 2F43B 2Q21A 2YC2C 2O52A 3ZVLA 1ZNXA 1AMOA 2QZ4A 2R9VA 2P6NA 3IEUA 5HR5A 2CL0X 1UMKA 5D3QA 3THXB 1VQ8B 5A0FA 2B92A 4PC3A 5E95A 3SJZA 4OI2A 1KOFA 5HZHA 1SVKA 4BFVA 3U6KA 1K9MD 2X77A 2Z0MA 5G3YA 3UKDA 4AURA 5AUPB 2J0SA 3T1OA 2Q0HA 3LWNA 2QMHA 2RGNA 3CCJB 5KTYA 1EK0A 1QBKC 4DHEA 4OHZA 1AZTA 4PSVA 2QSYA 2C9CA 3VR3A 1FNNA 3QPWA 2IS6A 2ZS8A 3CKLA 4B32A 1E2QA 1P2UA 4NCNA 2IF2A 2CK3D 2DCUA 4R7ZA 2QTVB 2G1JA 4EPVA 1ZW6A 4S35A 4MYUA 4LBVA 2DY1A 1GOTA 1YRBA 1CR1A 2ZRLA 3KKMA 4HATA 2ZRAA 4IHQA 1A82A 4GZMA 4BFWA 4D26A 1ZD9A 4IDOA 2ZJAA 2EQBA 4OBEA 5JRZA 2MMGA 1T4GA 1O87A 2KWIA 4WQMA 1M1KD 2IXFA 1PZNA 2ZPTX 4GRAA 3DOEA 2FSIA 4B3XA 2FGJA 2IC5A 3B9PA 3EG5A 3ONWA 3E70C 4MKIA 3T06B 5HCIA 2WWWA 1M6NA 4XTRA 4CRWB 1ZAKA 5HKKD 4BFTA 1RZ3A 4HUQB 3FPAA 1UEJA 5GJVC 3CXCB 1N2CE 4LC1A 1PUJA 2A5JA 2BWJA 3FE2A 5FOSA 1KZ7B 3KQNA 1E9RA 1HH4A 3U7EB 4G1UC 2BMWA 1P60A 1W2GA 4CT4B 4KFTA 4LHZA 2FSHA 2GRJA 1VDZA 3T61A 1J8MF 2G88A 1QVFB 2QQ0A 2R6FA 4NCIA 1AJEA 1JEEA 2G0NA 2AK2A 4RKEA 1NF3A 1FPMA 4OI1A 1W35A 4QGAA 1LS6A 3FKSA 2AN9A 3BERA 3NBXX 1NSTA 1N3BA 3I8XA 4BQSA 1W36C 2C5LA 2PMKA 2GNOA 3GJ8A 4RKFA 1XEFA 4MKGA 2DFTA 3HDTA 2NO9A 4IOMA 4OK3A 2PLRA 3CD6B 1G3UA 1Z2CA 4D6PA 1XEXA 1SVLA 1E32A 3QFRA 4FMBB 2WKQA 1O3YA 4S2EA 3AVXA 2R44A 1UJ2A 3GLFE 3X1DA 4LDJA 5CJ2A 2ZE7A 2ZI7A 4BLRA 4Q7JB 3O8CA 3B6EA 3UMSA 1Q57A 5CDFE 3BFVA 1UF9A 2FEMA 5EE9A 4Z8YA 1TQ6A 2H18A 1G4AE 4RZ2A 4DSTA 1OXUA 4ACAA 4LGMA 4YDHB 3UPUA 1N5KA 3HWSA 4B35A 4MRSA 4A2WA 2GXQA 5CYPA 2QMUA 1IJFA 1D1NA 5HKKA 4URWR 4RSGA 3SYNA 4DB4A 621PA 4A36A 1P3JA 1A2KC 3B1ZA 1COWD 3LXXA 3I1FA 1KI1A 1R4AA 4FI3C 2HJGA 2W6IA 5FTLA 2J7PD 2ZRIA 3K1JA 3D31A 3QKRA 4GBMA 2W6JD 2XNCA 1QFYA 3O8BA 3H86A 1EGAA 4EFLA 4B34A 3TQFA 2JLRA 3RS3A 1CXZA 3LO8A 2V7QD 4NPHA 4BEJA 1XMIA 2OFOA 3AGQA 2ZETA 4AYXA 1Y63A 2ZE6A 3X1WA 1IJEA 1J2JA 1NG1A 1EG7A 3V9PA 3VHXA 1M1YE 1BQEA 1DEKA 2PCJA 2F3TA 4HEJA 2GEVA 3U3MA 2UZIR 1UM8A 4Y9UA 1XTQA 2RGBA 1KDRA 4RFSB 4MDFA 3CX8A 1GJRA 4DDUA 4X8MA 3U3JA 1VCNA 4RD1A 1JJVA 4YLGA 2VF8A 4Z8XA 3NG1A 1KO5A 4A0GA 3DVLA 4NYMR 2ZRCA 3BH0A 4A0HA 1D6JA 3QXSA 4M21A 1EFTA 2O8DA 4AI6A 3KKPA 3FMPB 1SKQA 1SQ5A 2BBOA 2WHXA 4HSEA 4MYHA 3J81k 2IXGA 1CR4A 3KB2A 3KZ1E 4NL4H 2EIXA 4IOKA 5JWRA 3QF4B 1E9DA 2DHRA 1GTVA 3CH5A 3L8YA 2XZPA 3ICQB 2JIZA 5CIWA 3CCSB 4W9MC 1J8YF 2EW1A 1SKYB 2ZRNA 3H1TA 5GJCA 3SJBA 3F5FA 5H1YA 3I55B 4KCGA 2QTLA 2PMDA 4V0NA 4LBYA 3CRVA 3AVYA 2O0JA 1KJZA 2W2VA 2IYLD 2ZU6A 5DI3B 5FBQB 1AN0A 4FCWA 3GMTA 4RZUA 2ZSAA 1ZCAA 1GZSA 4GMDA 3X2SA 3THWB 2CHGA 1P2TA 2I1VB 2PEZA 3DMNA 3RAPR 3U44B 2IYZA 4BLOA 4GZLA 3TAUA 2XNJA 1E98A 3W2FA 3GJ0A 2IT1A 5TY0A 4U00A 3LBNA 4QHTA 1Q12A 2ZVQX 4DIEA 4DEXA 1Y3AA 3NXSA 4LC0A 1E2DA 2O0KA 4LJYA 1R8QA 5EP3A 1MABA 3QE0A 3OIWA 1P6XA 2P2LA 2OBLA 4DRZA 5KSZA 1UKVY 2YVUA 1GNRA 2A7QA 3W90A 3B9QA 2CNWA 2G9NA 1J70A 1VYUA 1YZLA 2JDID 3SR0A 4BZQA 4ZI3A 1G20E 4U5XA 4TMTA 3CX7A 4EPYA 3AF3A 3PUZA 4TYYA 2MSCB 3LD9A 4Z54A 5M04A 4KLZA 2VTKA 4OQNA 3ECCA 1NVVQ 4DUGA 2JIZD 4Q47A 1IQPA 2ZSEA 4M1YA 3RWMB 3HU2A 3IKJA 2ZUBA 1TU4A 4L9WA 3ZLJA 1G8FA 1YZNA 3MWJA 4GDFA 4PC2A 4F4IA 1ZINA 1SXJA 4RD3A 3VO1A 2PZEA 3JZMA 3X1ZA 1F2TB 2OV2A 3IBGA 4OHXA 1EFUA 3IHLA 2RGAA 3QKSA 5FUVA 5TB5A 3UMFA 3E1YE 1F48A 1Z06A 3TR5A 1WA5A 1U94A 2PBRA 1K6MA 3H0KA 6Q21A 4C2TA 5KPDA 2WMNB 4G1VA 2C9YA 2E9SA 3R7WA 4F7DA 3LW7A 2BKEA 2BHRA 3GEHA 2XSZD 1RJ9B 1L4UA 1KC8D 3NHAA 4YAOA 4CYMA 3FGNA 3CH4B 2XAUA 2PEYA 1FX0A 1JR3D 3RHFA 3A4MA 4TZ0A 4KBFA 3OAAA 2BF4A 1G3IA 2L0XA 3OIUA 4HLUA 3KKQA 2ZJZA 3JVUA 2ZI9A 4Q5IA 2XNDA 4ZDKA 1LB1B 1GKIA 4R71A 3AVVA 4WOPA 1CS4C 3G5UA 1OXXK 2CE7A 4PHHA 1PV4A 1G3RA 3QOFA 1KYIA 5FPSA 3WBKA 4I99A 1ODFA 4OQFA 1TPZA 3CRMA 3REFA 4Q01A 1FNBA 1C9KA 3ZGXA 1UADA 1QZXA 2IL1A 1JECA 1M7GA 3IPYA 4Q4AA 3U7FB 3QEJA 1BH2A 4FMDF 1DO2A 4CZ2A 2WWHA 1Z3IX 2G83A 1YR8A 2XOKD 3K0AA 2FG5A 3LNCA 3A8TA 4UNSA 1S9DA 3D3QA 3CLVA 3U4QB 5DSZA 1F6BA 1E1RA 1MRNA 4PZLA 4PZYA 1FX0B 4LV6A 5FL7A 2PJRA 3PUWA 5KOYA 4TTPA 1ZUIA 1YE8A 2Q3HA 3A36A 1VG8A 2OK7A 1XCGB 3RS7A 2IYTA 421PA 4DCVA 5K8UA 2X3UA 4JLOA 1DBSA 4RFVA 3CCQB 2J7PA 2F43A 4ITRC 4LWZA 4C0QC 3ADCA 1ZNWA 2QA4B 3LVRE 3P27A 3FHTA 4XH9B 1NJGA 3EW9A 1Q1QA 2WICA 2IYVA 4NE2A 5HCNA 1W5SA 4TMXA 2QP3A 4AF6A 3OJWA 2GTPA 4LV8B 5D3MB 1LS1A 3PEVA 1UBFA 4ASUA 1HV8A 5EP1A 2AKYA 3FPKA 1JXMA 5FBVB 5CYOA 2V9PA 1VYTA 3SBDA 3B60A 1K8AD 4IXNA 3CPWB 4MA4A 4ZDWA 1AS0A 3OZVA 1EWRA 1ZIPA 3B82A 4Y0VA 2ZR9A 4LJAA 1QG4A 1NDHA 4TMWA 1DDGA 2I3BA 3B13B 3AKYA 3CUEF 5FBRB 1CIPA 3B1VA 4QG7A 2IS4A 5H59A 3ND9A 4MUAA 2HXSA 2IYSA 3FKQA 2BBTA 3I72A 2DPXA 4BEBA 1R6BX 3GJ3A 3R9WA 3VKGA 3QPVA 4NP6A 3QBVA 4E07A 2VNJA 2NTYC 2XTNA 3FMFA 4LHWA 4ARZA 3TQCA 4W7SA 3KQLA 2IW3A 2CL7X 2ERYA 2NO0A 2RB4A 1FTNA 5DYGA 1JA0A 3ADKA 5L3RA 5DYIA 4KITB 3AVTA 1OYWA 1MO5A 3CWQA 4Q4HB 4UXIA 3W8NA 3OZXA 5SZIA 1VKJA 1BYUA 3F8TA 3AUYA 1G6HA 4A8JB 4BRUA 3QG1A 2X2EA 2QPOA 2YINC 3L0IB 1DARA 2JLZA 3A6PC 2QMEA 3AQ4A 4PO8A 5J4HA 4Q7MB 4U7DA 4HLCA 1ZYUA 2Q3FA 3ZZ0A 1EP3B 1UDWA 3PITA 3SEAA 1WMSA 1P72A 3B2EA 2R6CA 1QHYA 2ZUDA 2FU5C 1W2HA 2XJ4A 3THXA 3GFPA 1FMJA 3BH7A 4NCHA 5LB2A 4CW7A 3LBIA 4GP7A 2JASA 3IQXA 3V4FA 1NY6A 2V54A 5JJKA 1LF0A 2W83A 4TL7A 3W2HA 1E4YA 2QEQA 2B7CA 4LSGA 4ACBA 2ZAOA 1IN6A 4AD8A 4H9GA 4QM7A 2H16A 1IHUA 3LLUA 2QP4A 1HUQA 4C2UA 4PGOA 4NMMA 3TIFA 3KJIA 5GVRA 4JSYA 1DELA 4LYFA 5IRCD 4N3NA 3OE7D 4LHYA 2O5VA 1JQLB 3TJZA 2J41A 1XBTA 1W4RA 1GVHA 2JLXA 1YQTA 1OIXA 1IY0A 2NGRA 3IIMA 3LA6A 2ZJBA 2BBSA 3EWSA 4ZO4A 3LBHA 4KJZA 4LUCA 1ZMXA 5BN3A 2VP2A 3IIJA 3TSOA 2OUKA 3B8HA 2G0TA 4B6FA 1G41A 2AL7A 3DM5A 2IS1A 1IAQA 4QRHA 1KAGA 4PR0A 1G7RA 2BV3A 3C4JA 2DYKA 4PO1A 1Z6XA 4DZZA 4XJXA 3GCGA 4D82A 4URZR 2CCKA 1TF2A 2OILA 2QORA 2ZSFA 1I2DA 2CE2X 4DSUA 4UQOA 3C5HA 1XMVA 3SC3A 1BJKA 3T12A 4HB2A 4BZXA 1RVDA 2ODWA 3DOFA 3EIQA 4BFUA 4C3ZA 4UAJA 1IN7A 3KXIA 4B47A 4OK5A 4PTLA 2OLJA 2VYQA 1CR2A 4RVCA 4NYJR 4M1WA 1Z8FA 2OBNA 2QRNA 1GG2A 3EPKA 2QTZA 2BMDA 1OJLA 1AA9A 4TL8A 2NO7A 4HAVA 4DLTA 2WKRA 4ZDJA 1R0YA 2D4HA 2KE5A 5SZHB 1UBCA 1KJWA 1KMHB 3CR7A 2JAQA 1XD9A 4JLVA 2LCFA 4Q4JB 2GKSA 2H8KA 3SDZA 1M74A 4IDQA 2B8TA 3AVUA 3CMAB 3GD7A 5HE9A 1N25A 4D4MA 3ZIAD 1XMJA 2DFLA 1ZM2A 1OLOA 4HUQA 3NBFA 4LJ7A 1LY1A 5E7IA 2V1UA 4POAA 1G18A 1KI3A 4NDZA 5DN6D 1W4AA 4RZXA 4M1KA 3GJXC 1KIMA 4L15A 1XZPA 2O8FB 1VCOA 5IK2A 1GAWA 1VCIA 5CK4A 3AM1A 1WRBA 5IDVA 1WBDA 4YHBA 1GWNA 1U8ZA 3PR1A 5EMNA 5FPYA 1II0A 1KKMA 2ZJ8A 3QUSA 2BM1A 3HR8A 3UIEA 2ZJ5A 1OV4A 3VU9A 3AEZA 1KSHA 3U61B 3ZJYA 5KSWB 3BS4A 1EESA 3MWKA 1AKYA 1W47A 2OCBA 5BYKA 4OHYA 3MWYW 1E1RD 3QY0A 3ZS8A 4DCNA 2WIAA 1CKEA 2VLIA 3ZDQA 4QM6A 5GJWC 4UNRA 3AVPA 1IXSB 1N5IA 3O8DA 4YMUA 1M7HA 1OIVA 1DAEA 3S1AB 3CNLA 2VP4A 2HT1A 2QM8A 1EP2B 5LBIA 4P4SB 3KTAB 1Q20A 1MABB 1Q7YD 1E2LA 2QEXB 2GZDA 3SJCA 3VNUA 1Q1EA 3ZVRA 4Q00A 1XB2A 3H84A 2GA8A 2QU8A 4NCKA 1VG0B 2GILA 1AZSC 4JLKA 5DHFA 4DCSA 5KDDA 1CQXA 121PA 2WWFA 4JLJA 4BFSA 3DDCA 2BMJA 5CM9C 5GV8A 1VHLA 1W87A 3HYTA 1HURA 1NBMA 1TF7A 2GJSA 1VIYA 3JVVA 5AJVB 2LKCA 1AIPA 3N5CA 2YZ2A 2ZJ2A 4N0EA 5C4MA 4FK8A 1T91A 1KI2A 3ZS9A 4BLSA 4KO8A 2WOJA 4C0BA 1EFCA 2P67A 2FJUA 2ODBA 1GRNA 2XSZA 3OEHD 3Q7QA 5CLQA 4BLTA 1KY2A 2GCOA 3FVQA 3G71B 2ZYVX 1T3SA 4OQXA 1FTSA 3EPJA 1SM4A 3K0EA 4N3GA 4YAUA 4WA7A 4EDHA 4G5QA 1KGDA 3P4YA 2QN6A 1NL3A 5KDLA 1H85A 3RRNA 1IY1A 1GL7A 1S1MA 3VHLB 1IB0A 4PO9A 1EFRD 2ZS7A 1KI8A 3P1JA 4EJSC 4EIWA 3RS0A 1CJMA 1FUKA 2QRZA 1L7VC 4IEEA 2YOGA 1A5TA 5C46F 3ND8A 1GNPA 2QBYB 1OFIA 1G9XA 4LYHA 4EQ6A 3ZBUA 2CMKA 2IUTA 1M2OB 3K9NA 2VNIA 1P9WA 4KHZA 4QKQA 1SVIA 1S3GA 5EE3A 4O3MA 1UAAA 4PX9A 1E79D 3UG7A 3RS4A 2PT7A 3SE0A 4PHFA 4JJZA 1TLLA 4RFSA 5H5JA 5FTJA 3V00A 1VCMA 2EU8A 2GCOB 3Q9LA 4N0DA 4UXHA 3NWJA 3OEEA 4BPBA 3G0HA 4Z1MD 3UG6A 4B75A 1US8A 5JSZB 3RVBA 1E9AA 2VO1A 2UZ3A 2H57A 1XMSA 1A4RA 5THXA 1ZP6A 4FINA 1KO7A 1D9XA 2ZQ5A 2ASEA 4JBXA 5H8WA 4EJSB 4RD0A 2F6RA 2ZSDA 5JEDA 1U8YA 3CZPA 4YONB 2W2TA 3W5VA 2WSSD 1W2BB 1LNZA 5DN6A 1AQUA 1P7CA 1GVNB 1JJ7A 1E2KA 4F91B 5J47A 3OFNA 4XD7A 1E9SA 3VR5A 1ESMA 2DBYA 1F3OA 2WM9B 1N6KA 1U81A 3GJ4A 1OKKD 1PLLA 4II7A 1X6VA 3UANA 1G6OA 1BO6A 3ADDA 1U0JA 2FPKA 3LW8A 4PC1A 3OF5A 2XZOA 1E9BA 1VG9B 3PUXA 1NP6A 5D3MA 1HA3A 2D06A 4E22A 2XGJA 5LDDC 4P6VF 5DHAA 3FFBA 4EJSA 3HR7A 2NZ8A 2Q6TA 3DZDA 1BIFA 2J0VA 3LQRA 2H5EA 2O0HA 1R5OA 5EP4A 3RC8A 2BPOA 1OHHA 5DIFA 2R6HA 1EP1B 1H8HD 1Z28A 3T1QA 1G16A 1A2BA 4P33A 4HUTA 1Z6GA 4HLUC 4EAQA 4P4TA 1UBEA 1EWYA 1TF5A 2VP0A 2BBWA 3LQQA 1LFDB 2EYUA 2JCSA 3CCEB 1MT0A 1QHSA 3GLHB 4DLZA 1CR0A 4F7WA 2OO7A 1FW6A 2A9KA 2QA5A 2GK7A 3CNNA 1CNFA 2MSEB 1F5NA 1T8TA 1KI9A 2A5DA 1DPFA 3VO2A 2DWOA 1E0AA 4C0AC 3K0SA 3CC2B 2N1BA 3LY5A 1KK3A 1JA1A 4KSBA 4C7OB 2X19A 1OB2A 1G8YA 3IUYA 1SXJB 1VQ7B 1NN3A 3X1XA 1G8HA 4H1VA 3RNLA 4DDWA 2OLKA 4DDVA 1YZUA 3K70C 5F3WB 5E7JA 2EFDB 3GLFB 4R9UC 3GEEA 2D2EA 3FKSD 4B48A 4BASA 1JBKA 2E1RA 1QH0A 1G3MA 5FL7D 4JBWA 5FA6A 1SVOA 2J9RA 1QVRA 5FTKA 3AP3A 2W00A 3A1VA 3MWLA 3CRW1 1CF4A 4ZGNB 2FF7A 1E2EA 3GLHA 2QDXA 1VQKB 5EZ6B 3WP0A 1N6OA 5A4JA 2X2FA 1P61B 4JKIA 5EUMA 4M22A 3TUJC 4FCVA 1Z63A 2IYUA 3W6OA 4NYIR 2IYYA 2VP5A 2WJJA 1IXRC 1KO8A 3QF7A 3SZRA 4TN1A 5KU1A 3ICEA 1HE8B 4NYIQ 2D74A 5CK5A 4AG5A 2FE4A 2ORWA 4LY6A 4XVRA 2VF7A 4NCJA 1SULA 5TXGA 2W6JA 5E3HA 1OB5A 1XEWY 1NRJB 1QFJA 1E63A 2BDTA 3NBYC 3K9LA 1A7JA 1NKSA 4X8OA 4Q1AA 3R8CA 1EX6A 2OK8A 1JB9A 4L5BA 3THYB 4I1OA 1TX4B 2C03A 3QJYA 1Z47A 3QVVA 1AS2A 3T34A 5DISB 2CLCX 4PPGA 3FTQA 3ZVMA 4X8LA 3W2EA 1HY3A 4ON9A 3VKWA 2YOHA 4A0FA 3VR2A 5HZKA 1KD1D 3I32A 4TYPA 2N46A 2C95A 4LYAA 3CR8A 1II9A 4L9SA 5HTKA 1QVGB 1E1QA 4R2HA 3SHWA 1GKYA 3Q7PA 1FMLA 2GPJA 3GLIA 1E2JA 2FFQA 4UNPA 2BCGY 2SHKA 3B1XA 1VQ4B 2V6IA 3QPUA 2WTUA 3E20A 2VP6A 3TW4A 1HYQA 1NVVR 2ZI5A 4C0JA 5KPJA 4PC6A 4QGGA 4EPRA 5AUOB 1OE0A 3JQQA 1OT3A 2VA8A 3CF2A 4ERNA 4P31A 1OFHA 1IY2A 1LVGA 2B6HA 2XTZA 4KFUA 1KI6A 4QJ3A 1OIWA 4OJQA 3WYAA 4HZIA 1U2RA 2IWHA 1G5RA 3G6EB 2QMOA 2Z4SA 4ZGQB 2EFCB 4JLMA 2F1IA 2GEUA 4OJKA 1E79A 1F2UA 4XSGA 2H1LA 2IYQA 3C8UA 1SKYE 2AD1A 3OZWA 5FTMA 1XXHE 3OEED 2J0UA 1WF3A 2QAJA 2WAXA 2VZLA 5KHOC 4GOXA 2V55B 2N42A 2ZITA 2Z43A 3LAWA 4YXWD 1IN8A 1S8FA 5KSOA 3LFUA 1NJID 2XNDD 4KYIB 1OKKA 3WNDA 2AXNA 1G7TA 5FOUA 5C18A 1II8B 5FBWB 5FI1B 3Q72A 1X8LA 4DLXA 4XWOA 1KSJA 1JR6A 5JECA 5AJXA 1XTJA 4AIIA 4TL9A 1CBUA 4Q66C 4DUGD 3TMKA 5L3VA 5JHGB 1V43A 2GVZC 1JNYA 3QIAA 3MG9A 4FIDA 4A8JA 2PH1A 1N0UA 3OZUA 5GV7A 4H1UA 4NKRA 3U2QA 4M1TA 2WJYA 2W2XA 4Q18A 2BSAA 4HB4A 2G1KA 4HDOB 3MCAA 3GP8A 2ATVA 1ZRHA 1QFZA 3SYKA 2HXYA 2GBLA 3CB4A 5FH9A 3KJGA 3DO6A 5KDOA 3IGFA 2J0UB 2LWIA 2C96A 1IN5A 1YJ9B 4MRNA 1RPZA 4DVGA 4HAWA 2BC9A 4L16A 1P4SA 2EWVA 2GCPA 1JB1A 3A4LA 4JLDA 4AKEA 4TLAA 4I1SA 2G3YA 5F98A 1II8A 3AKEA 2JLVA 2AHOA 3AVOA 5GJBA 4GOJA 1XEXB 4O25A 2A78A 2CXXA 1SZPA 3CZQA 2JLQA 3FFAA 2BGIA 4IVQA 4TYQA 1N5LA 2Q9CA 5JS7A 4PAQA 4TQ9A 2FPMA 3I5YA 1KO4A 4UNNA 1E0SA 2HJVA 3H4MA 3GLGA 3FWYA 5JI3E 3PG5A 3ZD6A 2WVJA 1J9ZA 5EE1A 1MOZA 3LRPA 2OT3B 2W0SA 2FSGA 4P3YA 4FW9A 4DT1B 2FFAA 4PPQA 2EFGA 5TR9A 4MRVA 3EZ9A 4CDGA 2OEPA 2ZYWX 5DI3A 1IBRA 3GQBA 5A5GA 4PSAA 3I61A 1J90A 1Q1BA 4UJ5A 2VYFA 2JLUA 4F92B 1OSNA 4YAFA 1UKYA 4K81B 1MO4A 4HAUA 2H17A 4JLPA 4GPTA 5CJPA 4HZUB 3TKLA 2JEOA 2WJGA 3CW2A 2G6BA 1TUIA 4M1SA 3IO3A 1VECA 4D0LB 1P2SA 2FPLA 3A1TA 2JJ2A 3WP1B 4D25A 3BFXA 2VHJA 5EXPA 1PLJA 4MYTA 1XCPA 3AVQA 1OFUX 1X8JA 1XPUA 5AJYA 4QFMA 4B76A 2ZRHA 3K70D 2OFXA 2CLSA 5ANRB 1Q44A 3OEHA 1U8AA 3CCLB 3QKUA 1UDXA 2PT5A 5EE5B 3TE6A 2OM2A 4LPKA 4KV9A 4D4JA 1T3LA 1Z5ZA 1GL9B 2OCAA 2OHFA 1Q0UA 1S72B 3BBPA 1KHTA 4K8OA 4C30A 1W0JA 1GDDA 4V0ME 4LV5B 4JL8A 1EWQA 3QXXA 4B6EA 1K5GA 1XD8A 4ASUD 4A4DA 3RWOA 3W9YA 3PIRA 3EZ7A 4B74A 4US2R 4CEJA 4I81A 3NEJA 4KLNA 3KDSE 1W0JD 3G82C 2FX3A 1R7RA 2OXCA 1W7AA 1FQKA 3EIEA 4QBGB 3QG5A 2D7CA 4Q1FA 2JA1A 4Q7LA 1FUUA 3L0SA 1CEEA 5AUNB 2JLYA 3FDIA 3EX7C 4I4LA 4UKDA 1GIAA 3NH9A 4FMDB 3SBEA 2QG6A 3K8YA 1QHIA 3U7HB 1U99A 1G291 2BCJQ 1CTQA 1PLKA 1U90A 1ZCBA 1R0XA 3PCRB 5FFMA 1MR3F 2VL7A 3VU9B 4Z51A 3P32A 3E5HA 5DGXA 2WJHA 3PJRA 2CJWB 3BGWA 4IRUB 1VQ6B 2R62A 2GESA 3WHKA 2PZFA 5IHPA 2BEJA 3C16C 4CEJB 4LJ5A 2NOAA 4BUJA 2WKPA 3OJXA 1NBME 3D7MA 4GSYA 5L3QB 4M8NE 3VR4A 5HE8A 5JFGA 5L3SA 4PQRA 5J4LA 2QSZA 1A8PA 2PLFA 5JJIA 1QGYA 1G21E 1R5BA 2RC5A 2ZRMA 1S3SA 3QFSA 4JZKA 3SQWA 2VBCA 2CVFA 2Z83A 4QNMA 1ZM4A 3B78A 3GLGE 2BMEA 3AP1A 1M7BA 5B30A 1XX6A 1ZD8A 3LXRA 3EXAA 3QENA 3RS5A 3UWOA 1NIPA 5F9FA 1VTKA 1QUFA 5KYKA 4GT1A 1S9HA 2NG1A 3U44A 2EFEB 3CONA 3L43A 3REGA 1TQDA 3RLFA 3KKNA 4RD6A 2IHYA 3NHBA 4IDPA 2HEIA 3L2OB 5JS8A 2GVDC 2WPDA 2HMAA 4JIMA 1W5TA 3FHCB 3PXGA 1Q86D 4HAYA 4LHXA 5C4GB 1S0UA 3L82B 2R8RA 1X3SA 4YALA 2AR7A 3BIFA 1T5IA 4HYYA 2A30A 2RGGA 5FR1A 3FJOA 5FOVA 4EH1A 2P5SA 1L2TA 2FWRA 3R9IA 3T5DA 1A1VA 1W44A 3I62A 4Q1BA 2UKDA 3L0OA 4IKEA 5CLLA 2OSBA 3FOZA 4TMVA 1M34E 1YIJB 1FOEB 1KZGB 4TLBA 1RRGA 2A3RA 1DG3A 3LVQE 4URUR 4B33A 3CPJB 4CVNA 1H8HA 1N6IA 4IDNA 4AWXA 2VQSA 2K5UA 5AN9A 5FPKA 3U7GA 3Q8XB 1NVXQ 1W49A 4GP6A 4QJ4A 1I7PA 3KL4A 2P0EA 2REXB 2OE2A 3Q85A 3TSWA 4BFXA 1Z83A 5FI0B 3WXMA 1FZQA 4BE7B 2IXEA 4GOKA 2O8BA 2F1JA 3WNCA 1K8RA 1KDPA 4MGYR 5GVSA 1LTQA 2IK8A 2MSDB 1P9NA 2ECKA 5E7MA 1WCV1 1YJNB 2X1VA 3C7KA 3N70A 4A6PA 2A5YB 4XSHA 4DKXA 4DLYA 1ETUA 2QM7A 3AF1A 3NIBA 3T5GA 1SXJD 1GFIA 4LRWA 3W8RA 1XF9A 3WNBA 4N1AA 1E99A 4B4DA 1VQPB 2ZI6A 3MUFA 2CHVA 2JJ1A 8OHMA 2C99A 4OHWA 3AP2A 1AM4D 2RGCA 2PX3A 1P5ZB 1NNEA 4KAXA 2QE7D 3RDPA 1Z0AA 4YMWA 1KK1A 2A5GA 2XOKA 1GKUB 2AX4A 3W34A 5FR2A 3W5IA 1GILA 1KDOA 4RCYA 2QI9C 4Q19A 2FEOA 521PA 3IBYA 1CJTC 4B3CA 4HDQB 1WE2A 2ZE8A 2GQFA 3GJ5A 3KQUA 3R20A 4FD2A 4HAZA 4TTQA 4G0NA 3NDBB 4P32A 3A37A 3TUIC 4D80A 3U3OA 1L8QA 3U5ZB 2VHQA 4DSNA 1OGIA 1OXVA 5CITA 1R5NA 4TLEA 1SHKA 1TQ2A 2ZXUA 2YKGA 3K9GA 1G19A 4L8GA 4ILEA 1T6NA 1U9IA 2OESA 1U9IC 1W46A 2NO6A 5UKDA 2R65A 4B43A 4RCZA 4BFZA 1F2UB 4TTRA 1XU4A 1BMFD 4AG6A 3U60B 2NPIA 4NZYA 3TH5A 2BJVA 2O8EA 2D62A 1QX4A 3G4SB 1NLYA 2FGKA 2QNRA 4ZV4A 1OF1A 1F20A 2GJKA 3ZQJA 1RRPA 1LV7A 1YZGA 3GEIA 4PPFA 3BB3A 1PVOA 4DLUA 2OAP1 4Q1EA 1YITB 1AQYA 1T5LA 3T15A 3WMEA 3CRRA 2ZSBA 5IF9A 3MD0A 2RAPA 1E6CA 2HF8A 2ZREA 5SZJA 2MMCA 1OH7A 3SHFA 1DADA 1NLFA 4OQLA 2ZIAA 1QRAA 3D6TB 4DWJA 2IS2A 4RZ3A 5FPHA 1PUIA 1T3HA 3I4LA 4HE5A 4FCTA 2ZM5A 4ZCIA 3QFTA 4C0SA 1FFHA 2NO1A 4B71A 2GZAA 3AKDA 2D2FA 4AC9A 1RJ9A 4CGZA 3RYTC 4TLDA 3BFKA 1S2MA 3DHWC 1G5TA 3GPLA 2AK3A 5G53C 5CM8B 1I2MA 1N6PA 4TL6A 1RRCA 3RSOA 3QVUA 2ZRBA 3I92A 2KJQA 4DC9A 2RCNA 2FSFA 3FYHA 3UATA 2DWQA 5KNBA 1OH8A 4O0MA 3ZYCA 1JPNA 3BD9A 2V3CC 4UXJA 1B2RA 3WBJA 4ARZB 3ZH9B 4F93B 1JQJC 1G1MA 3QKRB 1KMHA 4Q4JA 4F4CA 3NTUA 4IVPA 3E2IA 1T0HB 1E1QD 5TMPA 2YWGA 3GLHE 3DKVA 1N6NA 1IONA 1NSFA 5CIQA 4AKHA 3PEWA 4HI0E 3RRYA 1W0KD 2J45A 1YKSA 4XOIA 4Z1MA 2EVWX 3A1UA 2CNWD 2YWHA 1I4TD 5AR1A 3M1IA 4FWTA 4DB2A 3TNFA 4AKIA 2BEKA 1AGPA 5K8LA 2JJ1D 1KDTA 3KJHA 4R98A 2ANCA 2O8CB 2CK3A 4YDSA 1YVDA 2QP9X 5EJEA 4IW3B 4FMCF 3PVSA 5BYJA 1M8PA 1UKEA 1NVUQ 1S4QA 5FTNA 1BS1A 2C98A 1XTRA 1NMYA 3CPHA 3GLIB 2F9MA 3R9XA 3DZ8A 3EC1A 4JVLA 4LZZA 4M9SA 4P0TA 2ZRDA 1RW4A 4DLSA 1GP2A 5EQTA 2IA5A 1JI0A 4YAWA 1TL7C 1W36D 5JHHB 3ZVNA 5BN5A 4QXAA 4TMKA 3EA0A 2DETA 3CX6A 3BAFA 4LYJA 5LD2B 3H2YA 4NH0A 1VQMB 3B7GA 4URVR 2NIPA 4P4SA 1R0WA 4WZBE 4M2LA 2GHIA 1LF5A 1SHZA 2CVHA 1H8ED 2R6AA 5H70A 5LB4A 2XJ9A 3C14C 3VKHA 2PL3A 4GI7A 4BWYA 1SVWA 1HQCA 2IUSA 4EUNA 2RHDA 4A92A 1DVRA 4JL6A 4JSTA 1KKLA 3GJ7A 3WMGA 3KQHA 1XXHB 3PV0A 4PPNA 2GJAA 5KO2A 1RRFA 4XWKA 2VNHA 3GFOA 4JYCA 1TU3A 1DAFA 3IHWA 2VSXA 3TLXA 1OPXA 2C78A 5KSYA 3PUVA 3TVTA 3O8RA 4CT5A 1VYVA 1XCMA 2WAYA 1KNQA 3ES9A 4B44A 1XE1A 1QHNA 2BKUA 4EPWA 3CCRB 2YJTD 2Q9AA 5H68A 2CCGA 3ETLA 2WBLC 5TVKA 1CJVC 2AKAB 3BXZA 4TT3A 2QPAA 4TLCA 5AK0A 3X1YA 2HT6A 1DAKA 4JT2A 2FV8A 4KU4A 2RH5A 4LJ8A 2QROA 2B8WA 3BORA 3CNOA 4PXAA 4AY2A 2NMVA 1COWA 3LVBA 1I4LD 2JGNA 3BRWD 1MV5A 3CIOA 3P4XA 1K73D 2ZUCA 1OH5A 1G7CA 1T8UA 2O8FA 2BN4A 3AGPA 4NBSA 1RIFA 2ZRFA 5JMTA 4KFSA 4JKYA 2ODEA 2ZR0A 1BKDR 4GMXA 1VQ9B 4PANA 1GAJA 1VQNB 1XD2B 2D3WA 1D2MA 1D2NA 4QHYA 4YMTA 3JZAA 2JLWA 5EXSA 4U02A 4GL2A 1Z0KA 3K09A 4KODA 1QVAA 4Y0AA 3VR6A 1R2QA 5J5CA 2Y8EA 1CU1A 4PQFA 4MITA 4LOAA 1Z0FA 2D7DA 221PA 4OYHA 3LV8A 1NIJA 2HCBA 2R6GA 1X1RA 4M9QA 4WVFA 1D8TA 3D8BA 1EFHA 1WDTA 4P4UA 2IWRA 4DCUA 1HT2E 2ZYUX 3THOA 4Q4LA 3K0CA 2QY9A 1OYYA 4HAXA 4DSOA 4G5SA 2QGZA 2AXPA 1DAIA 4Q1CA 4JLNA 3W6PA 5JWHA 3CMEB 2IX3A 3LDAA 4M53A 2C9OA 4C9BA 2QTFA 3CF0A 4IVRA 4YMSA 2IUUA 1SVSA 3SYLA 4MKHA 4TSFA 4LBZA 3THWA 1E2FA 3A1SA 3Q3JB 4FMCB 4ABYA 3ASYA 5B58C 4LJ4A 1P75A 2J7KA 2XX3A 4Y7CA 2V1XA 1N6RA 1G8GA 4RJLA 2BGJA 4D4LA 2ZRGA 1NI3A 4YC7A 2O8DB 2PIAA 1N0WA 4Q03A 3IILA 4BPRA 4B2PA 1E4VA 1UBGA 2A2ZA 2WIBA 1SXJE 2ZTSA 4LPSA 2WWGA 1N6HA 4OI4A 3OFND 1GRRA 2JDIA 1XWIA 2ORVA 3K0AB 1HTWA 5FOXA 2VPPA 3F3YA 4XVQA 2FN4A 2KBEA 1ONBA 5CDFA 2CCJA 2C8VA 1P2VA 2QAGB 4E5UA 4JMPA 4O2RA 3CO5A 1KQSB 3F0TA 4QBFA 3SN6A 2P65A 4IFEA 1CJKC 2P6UA 4C0HA 1Q22A 4RD2A 3ZBTA 2GETA 5EZ5A 5J4VA 3KFVA 2I1QA 3B85A 3OW2B 3ZC3A 4D2IA 1W36B 3CCMB 2GF9A 1E96A 1US8B 5JSZA 4LJ6A 4QBHA 2B5OA 2GCNA 3T35A 3FHOA 2WZQA 5L3QA 1GR1A 3OIVA 2YV5A 4QL3A 4AKGA 3QNUA 3BB4A 4G3XA 2C2HA 1WBBA 2RGEA 1Z0DA 1HEIA 2QE7A 3TUZC 1UKZA 2WSSA 3VMFA 1XZQA 4GNKA 3AB3A 2IYWA 1YRAA 1XFAA 3A4NA 5ELXA 1IOZA 3LX8A 1OH6A 2BVNA 4QHSA 3P20A 2PZGA 4XIGS 2QAGC 1KI7A 1QHHA 3NC0C 4EQ6B 3K0FA 1DOAA 5EUQB 4AK9A 4MH0R 1AKEA 3FMIA 3VFDA 4TMZA 4C0LA 5HPYB 5KUTA 2XXAA 1GITA 4M9ZA 1KRHA 4URXR 1DS6A 1XNJA 4AF7A 4JVSB 5FOWA 2FZLA 2GBLC 5C2JB 1OW3B 2J46A 3K09C 1G64A 4TT3D 4V0OA 5BXQC 4PAOA 2WWXA 1OGJA 4D0GA 4C43A 2GAOA 2VSOA 2VSFA 3SU8A 2YYZA 1EXMA 1CULC 4O2LA 4C0KA 3AVWA 1CJUC 2ZROA 5K8IA 4QJ5A 1H65A 2JLSA 1E9EA 5JBQA 5FUXA 1F2TA 2HDNB 3QF4A 1KK2A 3FB4A 3QKSB 5JZVA 1FL9A 3NDPA 3FMOB 3PEYA 4I1UA 2BIFA 4M9XA 2Z5FA 4MQBA 3KQKA 2AWOA 5TV2A 4GFDA 4LCBA 1QHHB 4DIDA 1YR9A 2J1LA 1FP7A 1R10A 4ESVA 2H92A 3KFXA 2WPDD 4WXPA 3I5XA 2A5FA 3BB1A 4A1FA 2P3SA 4Q9HA 4RY2A 4DXAA 4TSFD 5JCPA 1H8EA 2FFHA 5JEEA 4B2LA 2O8EB 3KKOA 2OAQ1 1YJWB 1U0HC 2VRWA 3WYFA 1G3QA 4KVAA 1YR6A 3MLEA 2I4IA 1WXQA 2ONKA 5SZKB 1ZD1A 1CP2A 4JJKA 1W4CA 1EX7A 4F4JA 3WRYC 1Z29A 3CPEA 1ZUHA 1TMKA 4Y9RA 3WY9A 2QT1A 2DWPA 4CIDA 3QSYA 2OTLB 4BFYA 3KXLA 1UEIA 4M1OA 2XXAB 1KK0A 2CLDX 2ZANA 1E94E 2QENA 3KJEA 1FRQA 1KI6B 4Q7KA 2FFBA 3AKCA 3UWKA 3JQRA 1BMFA 1KNXA 1P73A 2OFWA 2ZU0C 1X8KA 3W2GA 4DLVA 4OHVA 3VAAA 4BLPA 2JATA 2R2AA 1GAQA 5CB6A 1E3MA 3CRQA 4TYWA 5KNCA 3HPQA 1C1YA 1H42A 1XJ0A 4JVNA 1CRPA 3MRSA 4ZIRB 1Z0JA 2X8AA 4AYTA 4JLAA 3EARA 3RABA 1N8RD 1MO3A 4MUBA 3KUDA 3ZZTA 1TQ4A 3AUXA 3QI2A 3QXHA 4E03A 1QDEA 3C5CA 1WQ1R 4CF7A 3BOSA 4UNQA 4US1R 1VPLA 4HB0A 3TRFA 1MRSA 4JS0A 2BM0A 2OCPA 2GEDA 5CB8A 1ZUNB 4OQMA 1QGZA 2J3EA 1XDBA 5BWMA 1XJQA 2OZEA 3HPRA 2F3RA 4DCTA 1NJFA 2EFHB 3TR0A 2CEAA 4Q4HA 2ANBA 3T1TA 2CL6X 2WWIA 5FL3A 2CBZA 1GSIA 2VHTA 5FBLB 2HV8A 4W5WA 5K8TA 1B23P 1DAHA 1IM2A 4ESHA 3KXKA 1Z6YA 1OFTA 3PEUA 2FZ4A 1FDRA 4WZ6A 4FWIB
chains in the Genus database with same CATH superfamily
3EPLA 1I94B 1M0TA 1I0ZA 1BE0A 1QNFA 2ZI4A 3P19A 4BYGA 2JFXA 3ED1A 4N12A 1J7KA 2Y9MB 821PA 4LBWA 2WYWA 3GPDG 1QIJA 1V6SA 1QG0A 5AJWA 5M2QA 1GQQA 4M87A 1JI3A 2AI1A 3GEMA 4NECA 4Y6LA 3Q39A 1Q6YA 1RJWA 2CDCA 3ORHA 1G7SA 3BH6A 1KZ1A 4F4DA 2ODNA 3DTNA 3JQ8B 5JD5A 3C7AA 4EHAA 2GPSA 1M2VB 3K5WA 4DCCA 4PHGA 4IIEA 2Z6BD 3F7MA 4U8HA 1JDUA 1YJ5A 2BFWA 1O6ZA 2GKGA 2B2XA 3L07A 1AKWA 4BLQA 1A4XA 1HC7A 2KI5A 4JR0A 1KTVA 2FVGA 1QG6A 4NBNA 4OKSA 2D7JA 4Q3AA 2PMFA 5A62A 2IKSA 4R81A 2QRPA 1DO0A 1GG8A 1U3WA 2PGAA 2HBQA 4XVUA 3HP1A 4DNPA 1KEKA 1M5UA 3AB7A 4FW8A 3F6CA 1JHUA 1GNTA 1NF8A 4W1RA 2ATXA 3A8JA 1R6XA 4KKVA 4MWCA 2JVKA 4FYVA 3TK1A 1H05A 4RPGA 2DGDA 5G3ZA 1UBHS 2DPYA 4ZPXA 4B6SA 2GCIA 2GDJA 4XZ3A 4CIYA 2VNKA 1XK6A 3LX5A 1E0DA 3BSSA 4GM4A 4FFOA 4EGFA 4DLWA 1GPBA 5BSXA 2E0IA 5DH9A 3K0KA 1RI2A 3KDPA 2H1SA 4NU0A 4ALKA 4FGZA 2VHCA 1Y9JA 2OECA 3ND6A 5CCBA 3EAQA 2P68A 2RC6A 2FSSA 2AW5A 2HUPA 4IWYA 4QNRA 3E9QA 1Q21A 4OI0A 4C7OA 3IAUA 1Z4KA 1WW2A 1ORWA 1W52X 4RJTA 3PF8A 1CF9A 3UK7A 4XB6B 1RIIA 5TT0A 2DOKA 1Z7YA 3BRQA 3WLHA 2GXSA 1T2FA 1UM9A 3PHJA 4H1WA 2VK8A 1Y8QA 2BEWA 1L0BA 1Q1NA 3TNYA 2OOKA 2FFRA 3GR6A 3TOXA 4NMHA 2EBHX 5E7QA 3V32A 1LI4A 5FBZA 4BX0A 3L7NA 4GMHA 1NM5C 1GTSA 3KBBA 4S1PA 1UFQA 3BMNA 2QG9A 1FRFS 5FB3A 3R7NA 2F1LA 4EPXA 3KPJA 2GK4A 3RG2A 1JDPA 3WOHA 1I1OA 4P3IA 1VPEA 2ZZGA 2GHQA 3JZFA 1NOKA 2RHOA 3ILSA 3E84A 5HXAA 1SU8A 2YNMA 2Y1GA 3TIIA 2WTNA 4X8IA 4WIAA 3T4XA 5JYEA 3ODGA 2WWRA 1YRQA 2ONZA 4UD2A 5CU7A 3E9RA 3ZDBA 1EGVB 1UJBA 5CFPA 2JB9A 3C6ZA 3GFQA 3HU3A 2FOLA 5CX1A 4B81A 1R0RE 1A77A 1H2WA 1JT2A 3ABSB 3QHAA 3ZE0B 2IHKA 3FTNA 1E64A 1G8PA 5A6SA 5IDYA 1D9ZA 2X9QA 4U6QA 2WAMA 4PHTA 4X1IB 5FUQA 3NKVA 4ETWA 4CU2A 2UVPA 3LSTA 1Q0TA 3KQYA 2I6FA 1DCTA 3CRZA 3K9HA 2YW9A 2QBYA 1E89A 1N2OA 2J87A 2P1ZA 2RKWA 3QQPA 3UQYS 2F1RA 2WM8A 2QUZA 1RAIA 3BCUA 4RESA 5JMOA 2O8CA 3D6UA 4KBGA 4YCJA 2H54A 2QHXA 3LPAA 4AP6A 3BNWA 2XF8A 3ENNA 5KI6A 1GZ5A 1MW8X 4D4KA 3LRXA 5CHEA 3QKIA 4BKMA 3UK0A 3SOPA 2HF9A 4FXPA 2W71A 3D43A 1PK8A 1S96A 1XQ9A 1NRIA 1A9QA 2I34A 2C7VA 2OC9A 2P9BA 2YUTA 4WZBA 2EKQA 1Z6ZA 3R9XB 3Q5DA 1INLA 4AJ2A 2O2IA 1Z4LA 1AGXA 1KR5A 1ZFNA 2HLDD 1GNQA 3PE6A 5CG2A 3K73O 3OPVA 2F62A 3OESA 4HMOA 2O0MA 2GUGA 5I01A 5EXXA 2D5AA 5JAZA 5IJ0B 2IF0A 1TCBA 1QBGA 3DZHA 4FE7A 2HR1A 5HXBA 5EA2A 2I3AA 1UZMA 4LI0A 3CWZA 5J2UB 1SUSA 3OFJA 1YS1X 3GAMA 5AM4A 4RA6A 1O96A 1F60A 1PWXA 1FNCA 1DAGA 1MB3A 4G5GA 1AS3A 2Z8YM 1C0LA 1RYMA 2V6JA 4A3SA 3T5AA 1ZC4A 2QZSA 3W2TA 4A15A 2YC4C 6NULA 2FWMX 3M6AA 1IM8A 3IOYA 1JXOA 3JQPA 1PFYA 3AEQB 3WAKA 4BNMA 3ZD7A 4S1NA 4GWKA 1RYFA 3K0CC 3II6X 1PJ7A 5J4KA 1VI5A 3LH5A 2D5CA 3SS7X 3VSEA 1X2EA 4MGZR 2R7NA 2OMKA 1G63A 3KCNA 1ENOA 1NVKA 2A57A 3DYIA 1EINA 1WO8A 4NONA 2FPIB 3FSGA 2P2YA 4HBZA 1SGWA 3TVYA 3KUCA 1PF7E 2RGDA 2DM6A 4MK4A 3SI7A 4Q1VA 2OTJB 1M75A 3RC9A 4BBZA 4XYGA 3UK1A 1BX0A 1RLUA 5EZYA 5E6RA 3PRKE 3ISJA 2FAXA 3JYOA 4OP2A 1Y48E 3DW3X 3SOZA 4YLYA 3GLIE 2XTMA 3N0XA 3CM0A 2RHMA 4IFBA 1HNWB 1PEYA 3RK1A 1GAXA 3KT8A 1RKBA 4DNRB 1MAAA 1JKJA 3DQPA 3PGA1 1OV6A 4PBTA 5CLHA 5LSAA 3CCFA 5DHTA 5IKOA 3MT9A 2VYNA 5DE3A 2GXUA 2Y71A 5TMDA 1TVKB 1MPXA 5JZ9A 3ZU3A 3D6JA 1RKXA 3H4TA 4ND4A 1JA9A 4JC0A 4C01A 1WW8A 2Q2WA 3W3AA 4B2IA 1TEXA 3K0BA 2E87A 4YFVA 1GTJ1 2UXCB 1MAWA 3B1WA 1B93A 3FJ1A 1ZHFA 3ANMA 3CZCA 4IDHA 4OQDA 1FC0A 3MJEA 2QW8A 3OLXA 2J59A 3IDAA 2NAPA 2KLBA 1RXYA 4LDAA 3GUHA 5HYVA 2JJ8A 4KSCA 3X1MA 1HE1C 4KH0A 4Q9JA 4IEIA 1ZM9A 3S5UA 1H4TA 1ZZEA 4KUGA 3FPSA 5AUQA 3ITEA 3H9JA 4MP8A 3O21A 1NASA 2C54A 5EESA 4CM4A 4DV5B 3IOMA 2H63A 3AF0A 3IQIX 3ZV5A 4S1WA 4ZHQA 3HGTA 4ZOLB 1Q1AA 3JQAA 4K9LA 3TLYA 4CKEB 3SJAA 4CEHA 3PUYA 1CF2O 1YTLA 1C7ZA 2O7QA 3TQIA 2Q1SA 3PQCA 4TYNA 4Q7EA 3IEMA 3AIMA 3C1UA 3CVOA 3ZD9A 4J7AA 5JSYA 2PR2A 3COZA 1G0NA 4OHBA 7GPBA 5JCJD 4Q9LA 5F51A 2IOHA 4FOSA 3WRXC 1Q15A 1Z4IA 2PKEA 3K9QO 3TX2A 5JZSA 1W6UA 4HGNA 1Y6GA 2ONJA 4PLPA 3JYQA 3B6JA 2I67A 4M60A 4J29A 1IJBA 3DEAA 3HY6A 4TXNA 5IC5A 5EVCA 2F9LA 4YT2A 3WC4A 1WF6A 3A04A 1XKQA 3BF7A 3UTCA 1ANKA 2JKZA 1JMKC 3C5VA 2YOFA 3D4IA 1F9EA 4DMFA 4RSRA 3IQWA 1EQAA 5CURA 4P26A 1Z6PA 4QBTA 3PFIA 1I4EB 2GHRA 3KTAA 2H4HA 4FNMA 2ZULA 4GZ3A 4Z9XA 5SYAA 3SZ3A 1BHO1 4BMZA 4OHKA 3LQKA 3HACA 3SHQA 1RS0A 1XJCA 5JWOA 2R6DA 3ZIDA 3HJGA 2VJCA 3VPFA 3Q8MA 2CUZA 1Z0SA 2ZS9A 2FQWA 1BYIA 3RHZA 1Z6AA 3PDUA 1GLVA 3FBGA 3VC2A 4FB5A 5IKEA 2VTBB 2XNSA 5DYTA 3B9BA 1TKBA 4ROXA 3G5LA 3QBTA 1DKMA 2FUCA 4NAVA 5K3BA 3EVBA 4KFRA 2QUKA 1H6AA 2ZP1A 3VC3A 4ZIRA 1WP9A 4UD6A 5DI9A 1YBFA 1UPTA 5JROA 1ZLXA 1U8XX 3BGOS 1OT5A 1R4ZA 2NADA 3EASA 1Q74A 4LRXA 4GAEA 3QVMA 4O02B 3LI2A 1I4OA 4JL5A 5ALDA 5AWFC 3OQOA 1YQGA 3KYDA 3U37A 1RC8A 4F11A 3NGXA 1MH9A 3TB4A 3A7DA 2KHZA 3BKWA 4TV8F 4YIKA 3QLUA 4MW7A 3THSA 4D81A 2WT8A 3WQSB 2PRKA 4X20A 4PGGA 5F1KA 1C8VB 4CDMA 4A0SA 5JRJA 1NKVA 2NT4A 4YWHA 2V45A 2ODAA 3DMTC 3VXKA 4A6XA 3OJCA 6LDHA 1G17A 3KEGA 1Z08A 3S2IA 4S1TA 3EUEA 4MIEA 2XYRA 1UD2A 3L5KA 4HMPA 4JA2A 3EFEA 2I65A 2VUTA 4L22A 1XUOA 1SBHA 1K98A 1SCKA 2PZJA 5ICMA 2JI6A 4A82A 2AVNA 4YMVA 4JI8B 1MX3A 3DEFA 2DP4E 4FQ8A 4KWIA 3T3PB 4U9HS 4PABA 1LDEA 3H8JA 3OIYA 5DLQC 4HVCA 2J0QA 1B6TA 1UT5A 3ISVA 4G4SO 4QVGA 4UAGA 4TZ6A 1RXUA 1AUPA 3BXEA 2GX6A 2AZDA 2VRCA 1AXEA 2FQYA 5IUNC 1ULTA 2CYBA 1QF9A 1UBLS 4J0KA 3P94A 4E30A 5LN1A 1JEAA 4D96A 5BMVA 1YI2B 1MJHA 3ROEA 4MS4B 3ZI4A 4CODB 4E2FA 2IIPA 4WZKA 1ZOSA 2FWIA 4J0DA 1Y4DE 1XEWX 4MV1A 4ZAVA 4NJEA 4LCJA 4CHGA 4ER0A 5IT5A 4EMBA 3ER6A 2XUHA 3MMSA 1NY5A 4PX5A 3PNBA 4V02A 4Z3DA 2F1HA 1EVIA 2EV9A 3JD0A 1XSEA 5EP2A 5B4TA 3AEKB 1PO7A 1LSSA 1JR3E 1YR7A 3ZDCA 3H2ZA 2W2MA 3GZTB 4MI1A 2ZJYA 3Q0EA 3PZBA 4ZAWA 2Q27A 5BR8B 2LNDA 5F2EA 5I47A 2YL2A 5FWXB 3H94A 2Z8XA 5K3OA 3MSXA 3O95A 1JFRA 1P17A 4LXYA 3DMDA 4QC2A 5J35A 1KZHA 2HRRA 5K0CA 4HH1A 4IJUA 4R2LA 5DM70 1AURA 4E5KA 1MAVA 3QEOA 1ULBA 3OQHA 4EKDA 4QFDA 4LYYA 1U2EA 2Q3MA 3EIHA 2ZK7A 1X1QA 1G8AA 2FA9A 4DYVA 4WFJA 3DF9A 1KZ9A 2C7PA 3OLCX 4B3GA 2IE8A 1E0KA 1PNQA 2I71A 3BWBA 3VNVA 1K4MA 3VU1A 5KNDH 1A71A 1SQ6A 1PT9A 3H8WA 3IODA 3IPXA 3L6BA 4O2BA 3H5IA 4XTCS 1WNFA 2WWYA 2NQ2C 3WK6A 3H2HA 1LBTA 1QB8A 3PF9A 4M8SA 5CVTA 1NAHA 3E3AA 2RKOA 1DAMA 2VH2A 3EUWA 4WOKA 5GADl 3G5MA 4TWZA 5TGTA 4JYZA 2ZKIA 2H2DA 2WJVA 4JDPA 4PFSA 1D2CA 1KY3A 4K6KA 5LDHA 2GZ2A 2HADA 3GLGB 1USVA 2ZXEA 4OYYA 2F64A 3HKDB 2I78A 1IXZA 4H16A 4KXLA 5AKIA 4S1VA 3KB6A 4DLRA 1OZAA 4TOIA 2V7QA 3DLTA 3VPDA 3IEVA 4F9EA 2QPLA 4ZAYA 5G4LA 5HZGA 3CUWA 3VTKA 4E21A 4DT1A 3ZVLA 1AMOA 3JYHA 3IEUA 5F33A 5H0IA 3J7TA 4C14A 4TMYA 1UMKA 1FYWA 5D3QA 1JQBA 2WSLA 3MJTA 4ZZ1A 1N1DA 1ULSA 1BXRB 2MSLA 2VNSA 3OZTA 5COBA 4I8IA 4DJDC 2R4UA 4TX1A 5F77A 3SLNA 5E95A 3VPGA 1RI1A 1KOFA 1I36A 1ZUNA 2D1YA 4WECA 5DHRA 4QDZA 5HZHA 3AHEA 5AH0A 4MHSA 5FADA 2J0SA 3T1OA 2FSUA 3LWNA 3OUTA 5HCUA 4DY4A 5KTYA 4ABTA 1ZGCA 1HEYA 1EK0A 1THTA 1QBKC 3BHNA 4OHZA 2FEAA 1O89A 2Q1UA 4FE3A 1EHCA 2QQ5A 4Y67A 3A1DA 3Q8WA 2R8EA 2LR0A 4FEGA 4QYTA 1MDBA 3CKLA 3DNPA 3VZCA 4ZYUA 1DTEA 3E3NA 2H59A 3NYIA 1E2QA 3WYNA 1TC1A 5HIKA 2F59A 2HWYA 3LKZA 1ZKMA 2QTVB 4EPVA 2QVZX 4EB6B 3EJ6A 2F3UA 3AIKA 4HL6A 1HDGO 1C1DB 3CG0A 1MA0A 5E8JA 3SKYA 1CR1A 2I2CA 2XMRA 4IZIA 4HFRA 1TQHA 4RPLA 1V6AA 2R7LA 1DKOA 4B0OA 5ALYA 4JJAA 5GOTA 4CV3A 5AXDA 2ZJAA 2EQBA 4OBEA 4CMEA 4HBGA 5JRZA 5HTOA 4N41A 1PR1A 2KWIA 4DR6B 2OV8A 2FHSA 5EWMA 1PBTA 2J3HA 5ICSA 4GRAA 5I9NA 2FSIA 2PQ6A 4LQLA 1N2CB 3VI3B 3T0GA 1P1RA 4MKIA 3TQSA 1IG3A 1ZX1A 4BATA 4BX2A 2PUDA 3MD9A 3HRKA 4OXQA 5IPFA 4QULA 3BJZA 1JDSA 1UEJA 1T1EA 3Q12A 3CXCB 1BFDA 1U8CB 4O8CA 5DIZA 2C4TA 2BWJA 2JIQA 1XQBA 2VDJA 4N3AA 2MWMA 5F7JA 1BA3A 1RLJA 2B4KA 4G1UC 2BMWA 4YR9A 1KEPA 4DQDA 4CT4B 1LXCA 3TX6A 4KFTA 2PGDA 3AILA 2FB9A 3CXRA 2G88A 3I9MA 3OUZA 4F72A 2R6FA 4GBGA 1EDEA 1TM4E 3QOXA 1JEEA 2AK2A 2AMJA 1NF3A 3UPTA 3K72B 1L5MA 2WQZA 1USKA 4PPYA 1HNXB 4HJXA 3ACCA 1SG6A 3OI7A 3KT0A 2GNOA 3GJ8A 2QNIA 2ZIUB 1LLDA 3G3EA 4JB3A 4YRDA 3PDIA 2GZSA 4IOMA 2XQKA 1G3UA 1N4AA 4A16A 2BR5A 1XEXA 4R1QA 3MWFA 1MORA 1E32A 4LXXA 4FMBB 5IJXA 3QKWA 4WJLA 4GE0A 1UJ2A 1Y0RA 3TSYA 2CV2A 3X1DA 4LDJA 4J16A 4V38A 5D85A 2ZE7A 3BFPA 1QCDA 1XV5A 2HSGA 4MVJD 1BDMA 4EJ6A 2OZKA 2YVLA 3C4QA 4JGBA 1GT6A 4KB5A 3UMSA 4PYLA 4Z8YA 1G4AE 1Q77A 1V4NA 4RZ2A 5LZ4A 1JIXA 2WDPA 4FYHA 2AJCA 3E1GA 3I76A 3L7DA 3SSNA 4DQXA 3EBLA 3SVTA 1RAEA 1P44A 3FSJX 4B35A 5A06A 5EJ8A 3UBTA 1XMOB 2GXQA 4ZFNA 5IS2A 4URWR 2NU7A 3X0DA 1P3JA 1OLSB 3B1ZA 3D3NA 3ESYA 1COWD 3I1FA 4G4GA 4YIHA 2TRSB 1YS4A 2HJGA 3OW7A 4L6IA 1QC5A 4XRRA 3DWEX 2X2PA 4PG6A 4WXMA 3TN7A 4Z4CA 8AT1A 1G0OA 1VP9A 2P9ZA 4JELA 2PD3A 1R1DA 5EINA 1QFYA 3RAEC 3H86A 3O8QB 5GONF 4EFLA 4B34A 4EA7A 2KPOA 2VRCD 1WOPA 5IYQA 3ZIUA 2JLRA 2XDWA 2PL5A 3RS3A 3RI3A 1ECJA 4A91A 4BLWA 3I9JA 4BNUA 1JL3A 1W9XA 1KETA 3GNLA 4WASA 1DWPA 1NBOA 2ZE6A 2CHFA 4C78A 1U1DA 1I7NA 1VE9A 1Z33A 2E1PA 1EBBA 2HN9A 3QVXA 1UJNA 5BOSB 1NP7A 1JEQB 1ZNQO 1GADO 2OO5A 4K9DA 5GQSA 4O8ZA 3VHXA 4F2DA 5HQTA 3VDQA 3HLTA 4H31A 5AKKA 4IM7A 4AJNA 2W22A 5CD1A 2XCIA 1UM8A 4Y9UA 3GNTA 3TZLA 2JG3A 1EZZA 3ZCPA 4DL9A 2PS9A 1Z7BA 3S27A 3CX8A 2OV4A 2GEFA 4DDUA 5TQ2A 3RYIB 5KKAA 4R05A 1VE1A 1JJVA 4Z8XA 3H1EA 4DGSA 1N2XA 2FPIA 3FY4A 2ZRCA 3AFMA 1UBTS 3QXSA 1SKMA 1EFTA 2X41A 2Z1NA 2IY9A 4AI6A 1NXWA 1SQ5A 2BBOA 4WPGA 1P74A 4HSEA 2MINB 2Z6AA 4GS5A 2OENG 4E6EA 1C30A 3JASA 4E5MA 1P9OA 3WK8A 4I3HA 2NSLA 5LYYA 2GASA 3ELYA 3NM4A 1GTVA 4CL8A 1OBHA 3CH5A 2XZPA 1NI4B 3BGVA 2JIZA 2FQ1A 5CIWA 3A32A 1VHQA 4PN3A 4F12A 4BLUA 4UQLA 2WU0A 1J8YF 1SKYB 2HO4A 2B98A 1E5VA 1A2OA 1U2TA 1M6EX 3RB8A 2CXTA 2ECPA 3GT0A 3BQMB 3NAMA 3AVYA 1WQ4A 3QFFA 1D0IA 1P39A 4O4HB 2ZU6A 2AG5A 2JIMA 3GT7A 1E8NA 4HLNA 4QA9A 4EG3A 4ENSA 3RLIA 3RFTA 3T7DA 2FETA 4F84A 3DMNA 3N28A 2BW0A 5B1SA 4PM4A 1T3TA 2PSFA 3JALB 3O0TA 4HNAA 3IBSA 5D7NA 5L4NA 4KVFA 4MI3A 3VJLA 5D1HA 4V24A 3IURA 1G55A 3OG9A 1MCZA 5E2IA 1WS6A 5A1JA 4C4AA 4FDLA 5JNSA 4LY0A 3WLSA 3FPHA 1CETA 4LC0A 1E2DA 1VL5A 1X87A 2RH8A 3FF1A 4EVIA 4TTTS 4ZZIA 3OIWA 3HP7A 1H2HA 1P6XA 2VF5X 3PK0A 1UKVY 2WV7A 1JG2A 1V37A 2A7QA 2A88A 2CNWA 4LJKA 2G9NA 1RTTA 1WCYA 3SR0A 4BZQA 4Y2PA 4LKOA 2QRJA 4U5XA 3OQMA 2XADA 4QU5A 1OA1A 5CCDA 2PD4A 1DJMA 3M7IA 3LD9A 1AGNA 3KCQA 1W9HA 4FUTA 4DTIA 5KYVA 3G2NA 3LPLA 3GFBA 3MJFA 4MVCA 4EABA 4EG6A 5L45A 4ND6A 4R8RA 1TO2E 3KOUA 3ECCA 3ECAA 1T2DA 1DU4A 4ZEWA 3JD3A 1IQPA 2ZSEA 2JW5A 3UMMA 1NBEA 4DQ0A 2ZUBA 4HC4A 1TPYA 4WKGA 1G8FA 1YZNA 1SRRA 1YZYA 2MJLA 2G36A 2CNBA 3E15A 2ZDGA 3MWJA 1SXJA 1MB0A 1CQZA 3MOSA 4ALIA 4C03A 1F2TB 2B78A 2OV2A 4EKEA 3UMFA 5FUVA 1NXSA 4P6YA 3QWHA 3E1YE 4MWSA 4QEDA 3G7NA 3NRCA 3R3JA 1KKUA 2D1TA 4YAKA 1FDOA 4ZICA 5LU9A 3R7WA 5THKA 1JYEA 3WWEA 1S4MA 4B4OA 2BHRA 2XSZD 5E9QA 5LWQA 3DV0B 1L4UA 1RWVA 3FYDA 3NHAA 2ILVA 2VBUA 2YN2A 3QX7A 4Q3OA 4AZVA 2PEYA 2P9EA 1JR3D 1TCCA 4OOFA 4J0GA 3TLGA 5FWXA 1D4AA 2L0XA 1A8SA 4RF2A 3V4OA 4RH3A 3BRWA 4ZQGA 2FX2A 3KKQA 1YBAA 1TMGE 2Q50A 4LJSA 4Q5IA 2YYAA 1EVZA 3DWFA 3GC6A 3KZXA 2DYIA 3LX4A 3FFTA 3AVVA 3SEFA 1CS4C 2J67A 1HM5A 2E4ZA 2J8ZA 4TWIA 4ZAFA 4ZANA 1UOPA 1G3RA 2I33A 4D02A 1QIGA 3TINA 1SD5A 1E3QA 3ZDYB 4U7JA 3F4LA 3BCDA 2V0CA 1ODFA 1YR1A 3GZJA 4OQFA 1TPZA 5FPSA 4YI5A 3ZPXA 4I5DA 1JEJA 3P9RA 4IG4A 3NI2A 4FJ2A 1UADA 3EZLA 3WWCA 3UT5A 2P91A 3QPAA 4M0FA 1J00A 4Q4AA 4D9KA 4LE1A 2WB4A 2XCUA 4EVSA 1BH2A 4RETA 4JNCA 4BP3A 1DO2A 2GN6A 3OQ6A 1FP4B 4NEQA 2TMYA 3E5RA 1DLJA 2G83A 3N2KB 4L76A 3K0AA 5EIEA 5KYTA 2X85A 3A8TA 3MCWA 3UJNA 2O2SA 3UHPA 4D1YA 1QM5A 1H2XA 2CDAA 4PZYA 3W5AA 3R4CA 4G0OA 4NG5A 4LV6A 3V1KA 4DIOA 1FFXB 1Y1SA 4OGKA 1X7GA 5KOYA 4PN7A 1CUCA 5C52B 2OXIA 4UEWA 4WZEA 4MO9A 3AHDA 4R2MA 1XCGB 5ECGC 3E8SA 2Q62A 3LUJA 4JLOA 2WAOA 3ESQA 2X9GA 3CCQB 1BCRA 4FBLA 4RFVA 1KP2A 4J4BA 4C0XA 4QZVA 3EOBI 3WNQA 1VLYA 1DEXA 4MUXA 3D02A 1MFZA 3VDNB 3VPXA 1B42A 2VJMB 4LNUA 4R1MA 4PNEA 1ZKDA 1QMGA 3UJPA 1REQA 4R01A 4S24A 1W5SA 3MCVA 4CLDA 4E1AA 4RDXA 3WGMA 1XA3A 3PSHA 1F0PA 1UP6A 4XQCA 2Z9CA 4R1SA 3V8VA 1NFRA 1M2HA 1UPFA 2AKYA 3FPKA 4Z7NB 5FBVB 1Y0YA 2CFRA 4MUYA 2WVHA 4XKJA 5AHKA 3HBFA 2GPYA 5ALZA 2W8ZA 4YJ2F 1GLNA 1QRUA 4IXNA 1CUEA 1P81A 4ZAZA 3PTZA 1AS0A 3OZVA 5JSQA 3FCUB 3QU7A 4QOEA 3ZZ1A 1IATA 4FGKA 5C4IA 5JAHA 1NMSA 1N5MA 3UA3A 1Z8DA 1K9VF 3AKYA 4OXRA 4B6PA 4EGSA 4BGUA 2B83A 1H1TA 4QG7A 2EHJA 3FTDA 4K9RA 4N9WA 3ND9A 3ZZNA 4O2BF 3V2UA 1B1CA 2X8WA 3CE9A 3PPIA 4ZCTA 1YOVB 4PYRA 1L6RA 3BHIA 4ZV9A 4ARZA 3TQCA 4X94A 5FJJA 1PJTA 2ERYA 2IW3A 3IAHA 4EO4A 1RM3A 1U7OA 2RB4A 4Z4YA 1QRDA 2WU8A 1L5HB 1QE0A 1V1JA 3WWPA 1JA0A 3BY1A 3T5PA 3EX7C 1QP0A 2WY2D 3ORRA 1OYWA 1THGA 2P1RA 2R6JA 2QVLA 4A6DA 1S2OA 4UXIA 3OZXA 1PJBA 5SZIA 1VKJA 3L8EA 3UW1A 1DJPA 1G6HA 4BRUA 3PD7A 1MTOA 1E5DA 2QPOA 2ROQA 4LDQA 2I2WA 1Q5PA 1QR6A 3AINA 4PCUA 4EY3A 4AQ7A 3HKDA 4PYKA 5J4HA 4KWTA 5ALSA 2W2NA 1D2GA 3O1JC 5LYJB 2LW7A 3B2EA 3D7KA 4ER7A 5ED0A 3D0KA 2QUJA 1XNQB 3D7RA 1DT5A 1AKMA 2Y1XA 3THXA 3GFPA 5LB2A 1C8BA 1DLIA 2QJOA 5LQJA 3LL7A 3CGWA 4UE6A 2L69A 3V4FA 3VNRA 3OTGA 3M6XA 4JCOA 1PW7A 1ZONA 4F5EA 5JJKA 1UAYA 1EJBA 1PTJA 3LG2A 1ZI9A 2QEQA 2ZRQA 1M2WA 3CUYA 1KYWA 3HDHA 3RU9A 2RARA 2IPXA 1IHUA 2NV6A 4J9UE 1HUQA 4JP8A 3A2KA 3DFMA 4WUVA 1ACMA 1I0LA 1OYVA 2GN8A 3BMQB 4NWIA 5IUJC 3VPCA 2VJNA 5AM1A 2F4NA 3OOSA 2CZGA 1MXFA 1UBMS 2RHHA 3NDRA 2AC2A 3PJGA 2LIPA 3AERB 3UCFA 2OP0A 1OIXA 4GOLD 3LA6A 4HDKA 4P22A 5DP2A 1F4LA 2ZJBA 3VJKA 1F51E 3U0BA 1HDEA 3T38A 2YQZA 2DU8A 1XDSA 4W1SA 4WLOA 2XA9A 1YQXA 1ZMXA 5SV2A 2HY7A 1JWAB 3UHFA 2JC3A 2FMUA 2G0TA 4GM0A 2WFMA 1AZLA 2CFCA 1G41A 3BICA 4NULA 3K7EA 4W1QA 2DPLA 2W2QA 2IS1A 2P3LA 2C7OA 1QP4A 2DYKA 4PO1A 1N2CA 4ND2A 4MR8B 4BMDA 4JP5A 1DIBA 1RJEA 1QYIA 1Z6XA 4RNCA 3P0HA 2C61A 4X41A 4XJXA 3UAWA 4CFZA 2Q1WA 4DZZA 3RROA 5IMSA 2ZZMA 3OCYA 1PUXA 2ZWAA 1R6UA 4F6LA 1J9GA 5JPDA 5FV4A 4O4IF 1SUDA 1V8OA 2A0UA 1I2DA 2CE2X 4Y98A 2NPOA 5HKOA 1F4VA 2DECA 4H3SA 3F97A 1E60A 3HWWA 3MWEB 4FXOA 4LSZA 1BJKA 2FOXA 1XRMA 1ZR4A 3P2MA 5C8XA 3RIEA 4CLHA 3DOFA 1LDGA 2I7DA 3H75A 3KEQA 3N6XA 4BFUA 2WUGA 1Q16A 4I0WB 3COJA 3KWFA 1FUYB 1NA5A 4G5XA 2VDUE 3M4NA 3KXIA 4OK5A 1T9BA 2XTJA 2HHHB 2P6OA 1Z2DA 1JKXA 3C70A 1WZ2A 4DDHA 5FLKA 2JGJA 1H1LB 1Q0HA 2ILTA 1MOQA 4NYJR 1Z8FA 1O8BA 3PPYA 1GG2A 2FHPA 4BWGA 1OYOA 3H5WA 2LD4A 1N2BA 4JJFA 1AA9A 3RFVA 4YX9A 3O2SB 3KYBA 2I4RA 5HF8A 5BWCA 2NO7A 4HAVA 3D59A 4L50A 4L75A 2QR5A 4IRMA 4RIFA 1H2EA 1Y7PA 2KE5A 4L9RA 5KWSA 2W11A 3E22B 1AUVA 4LMBA 1UBCA 4C06A 1SCAA 1RI3A 1KMHB 1THZA 2JJQA 3CR7A 4JLVA 5L3ZA 1YB7A 1N78A 1A9XB 4KBYA 4NU6A 1M74A 3VH1A 4C7VA 3AVUA 3LBAA 1KH3A 3DOCA 1N25A 1XZKA 2EBFX 3MJDA 4RPIA 4CUKA 1Z45A 3N8HA 4KXNA 5EHQA 3JTMA 1XMJA 3D8RA 2R2GA 4MUEA 4W5OA 4JB0A 4TTSA 3ESZA 3HY4A 1MD9A 2IU3A 4HUQA 1BOOA 2OC4A 5BSUA 4LJ7A 1MJNA 1AN9A 2V1UA 5JXWA 2P62A 4ND8B 1ZW1A 1JHZA 2A0WA 2R6ZA 5HIMA 5IT0A 1VCOA 2QL9A 1GAWA 3TEMA 1FU8A 3GHYA 1HNNA 3VTZA 3P9PA 3ET5A 3IMFA 1HORA 1IHYA 3ETJA 5EMNA 3KV1A 2CKMA 3ZU5A 2HWWA 1WMFA 3TIVA 3O31A 2ZJ8A 1KKMA 1A98A 1YS9A 2BM1A 3CLTC 3N6VA 2GYUA 1OV4A 1W85B 1KSHA 4INZA 1XQ1A 3SJUA 3BS4A 4MZDA 3ULKA 2YS7A 1AKYA 1QIHA 1W47A 3OZGA 4R8LA 5CFOA 3QY0A 5CIYA 1ADCA 1CQPA 2UUOA 3KKZA 3K9CA 2V7VA 4QO7A 2VLIA 4ID9A 4LZJA 1I2BA 3AVPA 1M7HA 1OIVA 5AVWA 1B74A 1DAEA 1FX1A 3S1AB 1Z74A 2VTVA 1GGEA 2PX5A 2VH1A 3TTSA 3LYAA 5ALPA 5AOVA 1Q20A 1MABB 3QEMA 1E7WA 1WVGA 4Z5XA 13PKA 1RZUA 4HYTA 4Q00A 4QT4A 1UMDA 2XRFA 2QU8A 2V7TA 5DHFA 2GILA 1AZSC 4FJ1A 3I5AA 1D1PA 3BVPA 2FUG6 2WWFA 4JLJA 3ESAA 4P53A 3DDCA 3HWX1 5FO1A 5GV8A 5B3KA 2QX7A 1EK6A 1A7KA 5G1PA 1PR0A 1HLGA 1PFKA 4IY1A 4XCQA 3ZDEA 3PNYA 4D4HA 2PNFA 1CUJA 3LPCA 1VIYA 5AJVB 5CYGA 4GU5A 3RIMA 1AIPA 3R0IA 2XD9A 3ZTYA 3PS9A 4CFYA 5C4MA 4FK8A 5L4LA 3ZCQA 1T91A 4YMGA 1JSCA 2VK1A 4WH0A 4BLSA 5SYNA 1E8MA 2P67A 4J7UA 1TCAA 3JR7A 2XSZA 1GRNA 3Q7QA 2D8MA 3O93A 3OCVA 2GRUA 4UHDA 4OGWA 3HVHA 2JFUA 1VJTA 5HOEA 2ZYVX 3AEUA 2JRLA 3RRFA 1WMBA 2JS7A 2NZYA 3M6WA 4NG4A 5AO9A 1F5SA 4EDHA 4UQPA 4G5QA 2GYYA 3P4YA 3UHJA 3EEQA 4JEMA 1IY1A 1S2LA 1HDZA 4UHHA 2VHWA 4O1HA 1IB0A 3OKXA 1MENA 1DWUA 1T2AA 1GGNA 2Q5HA 3KEOA 1FF9A 2QRGA 4PX3A 5IN5A 4AICA 3AM3A 4X54A 1YH3A 3RS0A 3FWHA 1FUKA 4EJSC 5ERGB 3H5NA 1NBHA 3QM1A 2I03A 2EKBA 1NDUA 1PYGA 3KFLA 3CZ4A 4LYHA 1MPTA 3ZBUA 4P12A 1JKJB 1RDFA 1I7LA 3EXFA 2FWPA 1T8SA 2VNIA 3FYUA 3D8HA 3KSZO 3N2NA 3ORYA 4F4HA 5JMPA 2H5JA 1JQKA 3I6MA 4O3MA 1EE9A 3D8SA 1UAAA 2PSSA 1E79D 3UG7A 2P4EA 3SE0A