4QFMA

The structure of aif2gamma subunit d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of aIF2gamma subunit D152A from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qfmA01
5JI3E 2QDXA 4RZUA 1M1KD 3QF7A 1Z0FA 1AZTA 5FTKA 5BN3A 1UAAA 3RS5A 1Q22A 3CX6A 5GV7A 1XWIA 1X6VA 4UXHA 5J47A 1AS0A 3BWDD 4Q02A 2ZM5A 4UAJA 3VMFA 2NGRA 3GJ6A 1Z0DA 4C0HA 1VG1A 4ZIRB 1RFLA 3EW9A 3QOFA 1W2HA 1W0KD 2WJVA 1R5OA 2AWOA 2ONKA 2VL7A 2VQSA 5DH9A 1G4AE 2F1HA 3KXIA 1E3MA 2JCSA 2BMWA 1U81A 4HE6A 4QM6A 2AK3A 3WHKA 1SVSA 5KTYA 3KKNA 1II9A 5HKKA 3M6AA 3EZ9A 2UVQA 2VP2A 1EP1B 2A7QA 2QPOA 3REFA 3EIHA 3S1AB 2GRJA 4DLVA 4TTPA 2VP0A 4WAUA 4D2IA 2Q9AA 3CCQB 1ZD9A 4B3FX 4QJ3A 3DEFA 1CLUA 2B8WA 4ZCIA 3EXAA 3GLHA 3G4SB 3DOEA 5AJZA 1I7PA 2JLXA 3U60B 2WOOA 1MO5A 1FUUA 2NPIA 5P21A 3G0HA 2ZVPX 2P65A 3NHBA 3ZVRA 4TQUS 2DPXA 4BLRA 4XSHA 1HE1C 3OHMA 3O8RA 1Z63A 1OH6A 1KSGA 4UJ3A 2BF4A 1T9HA 2CXXA 3NH9A 5D3MB 1WBDA 4PSVA 3UANA 4UNQA 2QM7A 1ZVQA 2O0KA 4EJSC 2CJWA 3LX8A 5FOWA 1SVLA 4PPGA 4D4MA 2FEOA 4OHYA 4HB3A 1MRNA 1MO4A 1UKZA 3ND9A 1KO4A 5TDHA 2QP9X 4KFUA 4M1MA 1FX0B 3KXLA 1YZLA 3BB1A 2WPDD 3SOPA 4MUAA 4A2PA 3R7WB 1E32A 1P75A 3EZ6A 2Q9CA 1Z22A 3AGPA 2P6RA 4BFVA 1OLOA 4AY2A 1E2HA 4EPXA 1E4VA 4YAOA 1KI3A 4KITB 2FH5B 1Z83A 1J9ZA 1CIPA 4EPWA 4V0MA 1CP2A 5LB4A 2ZROA 4QBGB 4RZ3A 4UNSA 3RANA 1HQYE 4P4SB 2F1IA 3GLFA 4M2LA 2B8TA 2QNRA 5FOSA 3P4XA 1G8YA 2D2FA 2HCBA 2V7QA 2YINC 3QBTA 3P20A 3OESA 4QNRA 3BS4A 3RNLA 2CVFA 5H68A 5CLLA 5HE8A 4N0EA 3BAFA 1M90D 2FA9A 3UWKA 2PZFA 2FSIA 5L3VA 1E9BA 1GP2A 2JJ2D 4G5RA 4OI0A 1G3QA 3CRRA 4GOXA 1FOEB 1VCOA 3MRSA 5C18A 2ZPTX 3MMPA 5HZHA 2O8BB 2JDIA 2ZJ8A 1KI9A 3BGWA 1UEIA 2QG6A 4R7ZA 5CB8A 3K9HA 1JXMA 4B43A 4GP7A 5JS8A 4G5OA 1E1QD 3WMGA 4NL4H 2VA8A 2W2TA 2OESA 2ZUBA 1E2KA 4ZV4A 1XZQA 3ZZUA 2AKAB 2VF8A 2VHCA 3U7FB 2PT7A 4IVQA 1SKQA 1N6NA 1XMVA 4JVLA 5GVSA 4OHZA 1KKMA 3NC0C 1W34A 1II8B 2GQFA 1D5CA 4Q18A 2REXB 1IN8A 2C78A 4JLDA 3VFDA 1S9DA 3I5XA 3AKCA 1Z47A 2WJIA 2XTNA 2IUUA 2J59A 4M9QA 2ECKA 4DSNA 1YE8A 2C8VA 3B9PA 2ZEJA 4A6XA 1YZNA 4DUGD 1OHHD 1YZTA 1GO2A 1LF5A 2ZRKA 2QORA 1NI3A 4Q1FA 1UADA 3R9XA 4V0ME 3R9IA 1FX0A 2G83A 4J0QA 1CR2A 1XEXA 2PBRA 2PCJA 1GZSA 2Q3MA 3CCEB 5G3YA 5JEDA 4RVCA 2YWGA 2FFBA 3FGNA 3BC1A 1SKYB 2D7CA 2RGGA 3C7KA 1D6JA 3GLIA 5F98A 4L5BA 2P5SA 2PX3A 3JVUA 1P2TA 4D4KA 4FK8A 2FFQA 2CNWD 2FU5C 2KE5A 1IN5A 4GRAA 3WP0A 2G6BA 4AKGA 3KL4A 2Q3HA 1EFRA 1VYVA 3QVUA 1GAQA 2IEZA 4C4PA 4AYXA 1LS6A 2ZUCA 3ADKA 3QEJA 1VHTA 2GAOA 4B35A 4BQSA 3PEYA 1YZQA 2WWFA 4CZ2A 1G6OA 3THXB 1BX1A 3U6BA 4Q9LA 4Q00A 2WWWA 3ZC3A 3QE2A 5D3MA 4C3ZA 1J99A 3IUYA 1J2JA 3T35A 3X1WA 3WP1B 4C0BA 4UNRA 2YJTD 4ZKEA 3B1XA 1WCV1 3AV0B 1H65A 2GEVA 1E62A 1T3LA 4UKDA 5AWFC 1A2BA 5HPYB 1SXJE 4Q03A 2NO0A 4NCKA 4JL6A 2YOHA 3SEAA 1SGWA 1Z0AA 2OILA 4HUQB 3RDPA 2GJ8A 1UEJA 4TYWA 4G1BA 2XITA 4HB2A 2OFWA 2QSZA 4ON9A 4CIDA 2G3YA 4B4DA 3R9WA 1WMSA 1OGIA 1FRQA 2IUTA 4EAQA 1KO8A 3LY5A 4U9UA 3CC7B 3O8CA 4IFEA 1Z28A 1EFCA 3AF3A 4HAXA 4E5UA 4HAWA 4GBMA 1II8A 1T3SA 4YAFA 4PSAA 4JJKA 4RY2A 1N6KA 1NKTA 2A30A 3E70C 3VKGA 3NG1A 3DHWC 1XD2B 4ZDWA 3OEHA 2HYDA 3T1TA 5L3QA 1VECA 1ETUA 3GEEA 4YQFA 2QPTA 2QMOA 1QH0A 1XCPA 1FNCA 3AP1A 3CR7A 3N2IA 1NN5A 4OK5A 4IJMA 2A5FA 2ZAOA 3DM9B 2RH5A 1U9IC 3EZ7A 3MJHA 3NC1C 1OIWA 4I81A 2EIXA 3NH6A 1W5TA 3TH5A 2R6CA 1NVWQ 3IHLA 1J7KA 5JCZA 1T5LA 3D8BA 3K0CC 4EPTA 1G291 1XF9A 4YALA 1AN0A 2A78A 4URWR 1GILA 3SFVA 2XZPA 4TL7A 1BH2A 1H8HA 2FFAA 4RKFA 4BE7B 1JI0A 3OAAD 4NCIA 3AVTA 2R65A 3AH8A 3KJIA 1EX7A 2R9VA 3HR7A 3AF1A 3IEUA 4DDVA 3L43A 1E94E 3W2HA 4GFDA 5KU1A 3AVXA 1NP6A 1IY2A 4QRHA 3V4RA 3KUCA 1WRBA 3NBYC 2OCYC 2C96A 3DZ8A 4XSGA 3VR4A 4NZYA 1HH4A 1MKYA 1ZNXA 4DLUA 3ASZA 3OFNA 3CD6B 1KKLA 2EYUA 3PEUA 4HUTA 4R2IA 3LLMA 5B30A 1RC8A 1P73A 1NBMA 1Q1EA 4YMTA 1XTRA 1E2IA 4IXMA 1I2DA 5EP3A 4IOKA 4BLSA 1XPUA 1E1RA 2P5TB 4BEJA 2I1QA 1PLKA 1A2KC 2V55B 2A5GA 4W9MC 3Q3JB 1R5NA 1AIPA 4TYYA 3P32A 4PO1A 1XJCA 1GWNA 1P9RA 4BFXA 2ZRLA 3FMPB 2GDJA 5JEEA 3W2FA 3KUDA 2DBYA 1NMYA 2YKGA 3PFIA 3QVVA 3VR3A 2PJZA 4AD8A 5KDOA 5KPJA 2WZQA 3LVQE 4KU4A 1OIXA 2V54A 4D0NA 3CMAB 2WMNB 3LVRE 3B2EA 1DAKA 4TLBA 1G8PA 3BB3A 2VP6A 4YHBA 2IWHA 4CEHB 3ADDA 1QHHA 3AKYA 1P7CA 3MJRA 3AKEA 1LY1A 3W2GA 3IHWA 4II7A 2KBEA 2ZE5A 2GILA 3U3RA 2GPJA 1P61B 1ZUIA 4D6PA 1CR1A 1T4GA 1EFUA 4IOJA 2A5YB 1KZGB 4MRRA 1JXOA 2AFHE 5TXGA 2CLDX 2Y8EA 4OHXA 5IDVA 5K8LA 4EDHA 3VQTA 4FWTA 1XX6A 1UMKA 4V0LA 4YLGA 3X1DA 2H18A 4PPNA 1D2MA 2ZE8A 4M1YA 1KJYA 5KSWB 2H8KA 2C95A 4BFUA 4QJ4A 1Z08A 1AS2A 2MSCB 1EX6A 4Z1MA 4PX9A 4TMKA 3ZYCA 4PC3A 4LOAA 2QQ0A 3ZBUA 4JVSB 1NN0A 2PZGA 4LZZA 4PAMA 4PC2A 1NNEA 3UG6A 2BKUA 3K09C 2I3BA 5DLQC 1NL3A 3FVQA 4V0OA 5FUXA 4NYMR 5DHFA 3UATA 1VDZA 4Q9IA 4YXWD 3K0SA 1UM8A 3RS2A 3SJAA 5JBQA 4FMDF 3CW2A 4IDNA 1CULC 3HR8A 4IXNA 4R2HA 1AZSC 1T3HA 3KKOA 4NPHA 1OGJA 4Q7KA 1WP9A 4BEBA 5B58C 1QFYA 2XEXA 3Q5DA 2ZJBA 2ORIA 3EWAA 1G8GA 2QAGC 3E1SA 1Z5ZA 1LW7A 2V8OA 1AKYA 1N8RD 4DCSA 3FWYA 3X1YA 3EPKA 2F9LA 2SHKA 2J7PD 2FEMA 4PO8A 4URUR 2X1VA 3OZUA 3DO6A 4NYJR 1ZM2A 2AXPA 1KMHB 2XNSA 4DCTA 1W35A 2KBFA 4PC6A 4PPFA 4LI0A 2REOA 4MYTA 3Q9LA 3CCMB 4JT4A 2BN4A 1N6OA 5FUVA 5JRJA 3K09A 3QY0A 2ZI6A 3PQCA 4PTLA 3ADBA 1LVGA 2R6AA 4LHYA 2HF8A 3SNHA 4QHYA 4KFRA 2W58A 1OYYA 2VYFA 1AS3A 3CNNA 1LTQA 1Z3IX 5H5JA 1M7HA 2BEJA 3BXZA 4MYHA 4RZ2A 2XXAA 2X2FA 4LBYA 4TLDA 1G7TA 1KSFX 2QA5A 2CE2X 2IYWA 3QKRB 1E63A 1HTWA 2QAGA 4QGGA 4BLQA 2NMVA 3W90A 2H7VA 4ESHA 1YITB 4HDQB 3E20A 4P6VF 1DAFA 4TMVA 3DMDA 5G53C 4PAQA 1DE0A 4R98A 4B44A 3L8YA 4M53A 2RGXA 1NG1A 4MKFA 3BJIC 2OCPA 2BCJQ 2EW1A 4P31A 1N6IA 1QBKC 1ZD8A 2ATXA 5CITA 3FKSD 4PZLA 2GJSA 1Z6XA 2OHFA 1GJRA 1JEDA 2ZRNA 3A8TA 3CX8A 3QG1A 3WBJA 1ZMXA 5A4JA 2RC6A 3FHCB 1UBGA 2FSFA 2D2EA 3JVVA 4N3NA 1N6LA 2IA5A 1FP7A 5HE9A 1U0JA 5HCIA 1GVHA 1E1RD 3VR1A 1G5TA 4TWZA 1KO1A 1CR0A 2B5OA 4FI3C 4US2R 1TL7C 1RZ3A 1P62B 4RCYA 4H1VA 1R0WA 1IBRA 3QIAA 4TQAA 3LA6A 2YZ2A 5JCPA 1GG2A 4NHOA 1FMJA 5CLQA 4C0KA 3WRXC 3MGCA 1CJTC 1W1WA 2DWPA 3HYRA 1N0UA 4ASUD 1ZP6A 3CCJB 3ONWA 3DVLA 4A0FA 1BKDR 4DQLA 2IC5A 1CR4A 2CDNA 3KKPA 2HV8A 4XWAA 5H1YA 3SBDA 1KJZA 4A82A 2C99A 3NHAA 4KO8A 4ZKDA 1A8PA 1R0ZA 1U90A 2D4HA 2JLSA 4X8HA 2D7DA 3FMIA 1YR7A 4F4IA 1TQ4A 3ZD6A 1KRHA 2GVDC 1SXJB 3N2EA 3QPWA 3UG7A 2F3RA 4DLTA 1SVIA 4UNPA 4DB2A 3GLIB 4LC0A 2IW3A 3OFND 1T0HB 2ZJYA 3TE6A 3B7GA 3VTKA 1Q86D 3WNDA 1OPXA 1OXUA 3LNCA 3AVPA 5E7IA 3KQHA 1F20A 4O2RA 4IW3B 4GZMA 4ASUA 1IJFA 4Y0AA 1Q82D 3BB4A 4NYIR 1GR1A 2ZREA 1RJ9A 3LXXA 3PENA 1KSHA 3THYA 2CLCX 3BBPA 3QF4B 2HMAA 4O2LA 2HT6A 4IEEA 1OH5A 1YIJB 4E22A 1AKEA 2Z4RA 1NVUQ 2ONJA 3Q7PA 4AK9A 1KI2A 2GXAA 1S9HA 3LO5A 4Z8YA 3REGA 4WZ6A 1CTQA 1U0HC 2JIZA 2UZ3A 4CEIA 1E79A 4Q1AA 1M7BA 2PJRA 2R6HA 2IXGA 3K9NA 2UZIR 2ZR0A 4Q47A 4LJYA 4XD7D 5JWRA 2HEIA 2O8CB 1M1YE 3GLIE 1W46A 1KDOA 3TLXA 1H85A 2DB3A 3CRZA 4GZLA 1E0KA 3I73A 5EP2A 5C1BA 4M9SA 1PJRA 3FB4A 5C46F 4FMDB 2YC4C 4MGIR 2GHIA 3BFKA 3W2IA 1P6XA 2XB4A 1NN1A 4AG5A 2HT1A 1VQKB 2JASA 1ZUHA 2A3RA 3KFVA 2ZRMA 3FFAA 4OYHA 3VKWA 2BHRA 1KNQA 2DFLA 1T8UA 2BMJA 4LYJA 2OK8A 3B1YA 1ZNYA 5FTLA 4GMDA 4YMVA 4DIEA 3SJBA 1Z06A 4HE5A 1QUEA 1TQ2A 1U2RA 1KTVA 3TAUA 3GQBA 2RB4A 3PVSA 2P0EA 4KV9A 2YWEA 3RSLA 3UWOA 2BM1A 4NH0A 4AYTA 1NVXQ 3QKUA 1LNZA 2DR3A 3NBZC 3T1QA 4HLCA 3CNOA 1E9DA 2IYXA 3GMTA 3I8XA 4U7DA 3AVVA 2IL1A 2G0NA 3AP3A 4Q5IA 4V03A 1R0YA 3CPEA 1NJGA 3KQNA 2J46A 3BFVA 4B32A 121PA 2R62A 2H5EA 3MUFA 4MDFA 1YI2B 1BMFA 1GKIA 1YZGA 1IONA 4KSCA 4ZDIA 5L3SA 1G8FA 1XEWY 2DWOA 2QT0A 4TZ6A 3SHWA 2BPOA 2DWQA 2ZRIA 3ZVNA 4I4LA 5HZKA 3EARA 4RD6A 4IKEA 3U7HB 1RRCA 3TJZA 3THYB 4JMPA 1KHTA 1NBMD 1S0UA 2IXFA 4PHGA 3NXSA 3U4QB 5E7MA 3U7GA 3IIKA 1Q57A 4DLRA 3KFXA 1NJID 4LJ9A 2IYZA 2WKQA 4A8JC 5IK2D 1F2UB 1AM4D 4N0DA 1M74A 1QZXA 1OB5A 2Z4SA 2ZU6A 3QXCA 1P9WA 1ZNZA 4ABYA 1DTSA 1L8QA 4KVAA 5KDLA 1N5KA 1DARA 2X2EA 3BIFA 2J0SA 5EQTA 4AKIA 1NLZA 2WJHA 3HU2A 4PXAA 4V0KA 1QHIA 1AGPA 3PUVA 3HJNA 4BZXA 3A37A 5FBRB 2GA8A 2OEPA 4DB4A 4M9XA 4M9ZA 2H92A 4YC7A 5KSPA 1XZPA 2XZOA 2GEDA 5FPYA 4U00A 5HR5A 4Q66C 1Z8FA 4B2LA 5TY0A 2FJUA 3CCVB 1IJEA 4F38A 3SN6A 3EA5A 4OHVA 1CBUA 2OLJA 2X19A 3GLFB 3TUJC 3PUXA 4ITRC 4L16A 4N1AA 1A82A 3SFZA 4I1SA 3T15A 5AUPB 4A0RA 1ZU5A 1CRQA 4TYQA 2AXNA 4Z54A 6Q21A 2QE7D 3TSZA 4HAYA 3VR5A 1B23P 2CCKA 4US1R 2QEQA 2IBMA 3MG9A 3ZVLA 4F93B 5UKDA 1KD1D 2WVJA 2BBTA 3IO5A 4HLUC 3QFCA 3C8UA 4DWJA 1DDGA 4Q4LA 3G5UA 4QM7A 2ZXUA 4X8OA 1Z6TA 1FTSA 1KAGA 2Z43A 2ZRDA 2CHGA 5FBLB 5JWHA 4KYUA 2WICA 1ZNWA 1QVRA 3EAQA 3A6PC 1ELOA 3FPAA 1ONBA 3UXMA 3WY9A 1C1YA 1GL7A 4MRPA 1XPOA 1X86B 4Q19A 2JA1A 4F92B 2QA4B 4NP6A 1QFZA 2C9YA 2EWVA 4ZGNB 1TF7A 2J45A 3W34A 2VNKA 4BFSA 4DJTA 3KXKA 3EX7C 1FNMA 1A1VA 2QSYA 3T34A 1ZIOA 4HLQB 4PQRA 2GJAA 2IYYA 3OZVA 1E9RA 3CO5A 2F1RA 1XTIA 5FTNA 3ZVMA 3C5CA 2O8FA 1XJ0A 2V1UA 4IDQA 2XB2A 2IYTA 2Q6TA 1IHUA 2OCBA 2WWHA 3ZZ0A 1V43A 1QRAA 1YVDA 4BGDA 4IOLA 3PUZA 3DMNA 4EPRA 4D4JA 1TEVA 1NF3A 4D0GA 3TNFA 1VTKA 1YRBA 2C04A 2HXYA 1G8HA 3ZZTA 2Z0MA 1J8YF 3A1TA 4HDOB 4ACAA 2XNCA 2IUSA 3LRPA 4B48A 1CF4A 3KB1A 4DZZA 1XCMA 4Q1CA 1BOFA 4QGHA 1MH1A 3MSXA 3N5CA 4XH9B 4WZBE 1T6NA 2YWFA 1MABB 5G3ZA 3QQ5A 3U3OA 3L0PA 1MABA 2PEZA 1XB2A 2BMEA 5AUNB 1ZINA 4FW9A 2YNMA 1GKUB 2ZI5A 4JL5A 1QFJA 2D3WA 2H57A 2ZYVX 3VR2A 1VG9B 2LCFA 5TV2A 3G82C 3LH5A 4BLTA 1YR6A 3FTQA 1JB1A 3QEOA 2DFKB 4M1WA 2ZI4A 1KK2A 3BOSA 5B2ZA 1SQ5A 1JJ7A 2VNHA 4RJLA 1BMFD 5KUTA 1OB2A 4JLAA 1QVGB 1UDXA 1OV4A 1W0JD 3B85A 3IPYA 4JLJA 3H2YA 3CKLA 2F7SA 521PA 1CNEA 1E2LA 1EXMA 4MRSA 4DKXA 4MKGA 2YV5A 5JHHB 1NJFA 3PR1A 4KBGA 4LBZA 3AKDA 3EC1A 2OK7A 3H0KA 3MWLA 5AK0A 4MH0R 4U02A 3TQCA 4M8NE 4TLAA 3TUZC 1W49A 3WXMA 1E99A 2PH1A 3IQWA 2IS2A 1FDRA 3VX3A 1MO6A 2NIPA 2O0JA 2XOKD 1K8AD 2PMDA 1M6NA 2W2VA 2E9SA 3PEVA 2VIIA 2QROA 2QRZA 4TMWA 3NDPA 3CWQA 4P4UA 4DLWA 1GFIA 2ODEA 1Q44A 2C5LA 4M1OA 3X1XA 2V4ZA 3EPHA 1YQTA 2IF0A 3HPRA 1SZPA 1H8EA 2GF0A 2Z5FA 3K0FA 4OI4A 2JGNA 3KJGA 5FOUA 1TPZA 3CCSB 4JLVA 4EQ6A 3TW4A 4P4TA 1EWQA 3THWA 4M4SA 4HATA 3SJZA 2NO9A 3VU9A 1XDBA 1OT3A 3H4MA 1EFRD 1LB1B 4GP6A 5KNDA 4LWZA 5AJXA 3PXGA 3BERA 4Z1MD 4LHZA 1SVOA 1NRJB 2ZUDA 2JEOA 4Q4HA 2WV9A 5CB6A 5K8IA 3L0IB 5KSOA 2OSBA 4A8JA 1NIJA 1Y3AA 1IQPA 2FFHA 4A8JB 5CYPA 4C0JA 4DXAA 2IS4A 1TAGA 1XXHA 2ORWA 2EFDB 2QGNA 3T61A 2WBLC 3QJYA 5BXQC 3F3YA 1G3UA 4M1TA 2CEAA 3A1UA 1KK0A 1ZRHA 3EA0A 4IFBA 3MLEA 1ZAKA 4L4UA 3RRZA 1KC8D 4H1UA 2ASEA 4NCNA 2VLIA 4IDPA 3GLFE 4NE2A 3W3ZB 1JEEA 2Z6VA 1EP2B 3X1ZA 2VEDA 1K73D 1PUJA 5FOVA 3UMRA 1BX0A 1CKEA 2G88A 2ZS7A 2F55A 1OJLA 1SM4A 4TMZA 2J7PA 4PGOA 4Q1DA 5CJ2A 2L0XA 4C7OA 2VSOA 4CEJB 4GL2A 2ODBA 1W4CA 5K8TA 3L2OB 3RS0A 4MRNA 4G01B 1WB9A 2JLVA 2WTUA 4GPTA 4DCUA 1ZJ6A 4K8OA 3FE2A 4B2IA 2LKCA 3GFOA 5EP4A 4FIDA 1OW3B 3U61B 2NPFA 5G41A 1NVVQ 4LX0A 5EZ6B 2AFIE 4OJKA 3AVUA 2ZSFA 3L8ZA 1YZKA 4JYBA 1Z2AA 4B3BA 4NYJQ 1BYIA 5DYIA 4MGYR 2XJ9A 4CGZA 2H17A 1R2QA 3PV0A 4XIGS 1GIAA 1VQMB 1YRAA 2PX0A 1IY0A 4JLNA 4Q4JA 3VAAA 3LVBA 4D82A 1E2QA 1LFDB 4HB0A 1E0AA 2I1VB 3WRYC 3I61A 4MYCA 4KODA 2CE7A 3OJXA 4H9GA 2KSQA 3AEZA 4DDWA 2IXEA 3W2EA 1E4YA 2GK6A 4JBYA 4MKIA 5KYKA 3LQRA 1Z6GA 4KAXA 4DLXA 2FMXA 2RGCA 3IIMA 4KVGA 5F2EA 3RRMA 2RGDA 4C2TA 1RIFA 4B3CA 2J87A 4EPVA 1Q81D 2J41A 4C0LA 5FBVB 2HYIC 1GVNB 2JLUA 4LHWA 1ZM4A 5E95A 3U5ZB 2ZJ5A 2CHQA 721PA 5TR9A 2B6HA 1ANKA 3V00A 4WBSA 2G0TA 1E9FA 1ZM3A 4B3GA 1BS1A 1KZ7B 2LKDA 3C15C 1QGAA 1SHZA 4CF7A 2R6DA 3CPJB 4WVFA 1JECA 1CNFA 2IEYA 2GNOA 3I72A 2N42A 3NEYA 4A2QA 4YMUA 1XPRA 4M1KA 5FA6A 3K8YA 4OKSA 2WM9B 1XEFA 3K0EA 4TMTA 4LBVA 4U5XA 1ZCAA 1DOAA 4P3YA 3I4LA 2BJVA 2IHBA 2IYUA 1CJUC 5CYOA 2ZI9A 3NVAA 1FUKA 1SVMA 3HWSA 1N25A 3B6EA 4GNKA 4PO9A 4TTQA 2CRVA 2J7KA 4Q1EA 4Q4AB 4B73A 1W5SA 4BFZA 3OEED 2B7CA 5LB2A 4LDJA 2FF7A 3QNUA 2OFXA 3CWZA 4LC1A 4BUJA 1P2SA 3E2IA 3QXSA 4QC2A 4A6PA 2O8FB 1NSFA 4TN1A 1XRJA 3QKSB 1XNJA 1GNRA 1GUAA 2GXQA 3AF4A 1QF9A 3KKQA 5DI3A 3W5IA 2IK8A 2ZTSA 1P5ZB 1P60A 4GOKA 1E2JA 4AURA 1QHHB 5FH9A 1BQEA 1DAHA 3A58B 1ZC4A 3GPLA 4M1SA 4QG7A 4GOJA 3ZQJA 1KI8A 2HLDA 4D25A 1YHQB 3MWJA 4DQKA 2HJGA 4JLPA 2BGJA 2ZJOA 2BC9A 1KMHA 4OQFA 4NCHA 2P6UA 1XEWX 4GI7A 3QFSA 2YYZA 5FR2A 3CC2B 4C9BA 3RHFA 2NOAA 4YDSA 3W3AA 2LWIA 4QFMA 2KB0A 1MRSA 3H86A 4LJ8A 1YJWB 5CDFE 3SQXA 1ZCBA 3FDIA 4AC9A 3SBEA 3C5HA 4NDZA 2C77A 1E6CA 2JLZA 1OH7A 4TYPA 1T5IA 5F9FA 1XTQA 1DPFA 3F8TA 2XXAB 2ZI3A 1WE2A 3BRWD 2QQEA 1I4TD 1W87A 5FFMA 2VP9A 1VQ4B 2FSHA 5JZVA 2PIAA 1PVOA 1UDWA 3RYTC 1WQ1R 2ZSEA 5JECA 4B34A 1J70A 4ZCLA 4FCTA 5SZHB 1EESA 1UFQA 4N3GA 3E5HA 3IKJA 1VQLB 1RJ9B 1RVDA 4B47A 4TMXA 3UK6A 1OSNA 5AUQA 3ZIAA 4QBIA 2ODNA 2R8RA 5KO2A 4PQYA 1EWYA 3FMOB 4ARZA 4QGAA 3N70A 621PA 1FQJA 5BN5A 2GTPA 1Z6AA 2QL6A 2YC2C 3QPVA 1SXJC 2QTZA 2BBOA 5AR1A 1M8PA 5DN6A 3ICQB 4FXPA 1G7SA 5EUQB 4QBHA 1CEEA 3MCAA 1YJNB 3U3JA 4CVNA 4LYFA 2XSZD 1E96A 4JKIA 4JYCA 4CEIB 3QXHA 4KBFA 1QGYA 1F6BA 2ZJAA 3CRW1 1VKJA 2WHXA 4LJ4A 1G17A 2A5DA 1U8ZA 3QI2A 2BWJA 2AR7A 2MMGA 1KSJA 1W4AA 2J1LA 4Q4AA 1IXZA 4RFSA 5B57C 2F1JA 3IILA 3BK7A 1X1SA 5FPSA 3LQQA 2OBMA 4PAOA 1NMZA 2RGEA 1VYUA 3ND8A 2QENA 5BQ5A 2YOFA 1IXRC 1F2TA 4JSTA 3HDTA 5KSZA 3SZRA 4BFTA 4HYYA 4FMBB 4TTRA 1TQ6A 1OXVA 4YONB 5SZJA 3W6PA 4CEHA 1N6HA 4LUCA 4OI1A 2CHVA 2JIZD 1ZM9A 3RS7A 3K70D 5H70A 1OXTA 2GZAA 2E87A 3H84A 4MGZR 4TL9A 1D1NA 3R20A 1TQDA 2W83A 5JJLA 4ZI2A 1RYHA 4EUNA 4AG6A 2QT1A 2ODWA 2ZU0C 3TGPA 3LW7A 2OM2A 4G5GA 2WWGA 3QPUA 1IAQA 1C4OA 2QMEA 2X77A 4FMCB 1NY6A 5CIWA 1DVRA 4A2WA 5JRZA 1AK2A 2ZITA 5FL7D 2JJ8A 1ZUNB 4YDHB 1HT1E 2J9RA 1G41A 1H8HD 4C7OB 1HT2E 1SVKA 4DLYA 2O8DA 2ZSDA 1CRPA 1KNXA 2QMUA 2X3UA 4PZZA 2OCAA 3OEEA 1CQXA 1QHXA 4E07A 4ZI3A 1N3BA 2VRWA 4XWKA 1OXSC 1NBME 3RAPR 1UBFA 1JBKA 3QBVA 1G3RA 1IN7A 1TF2A 3CMEB 3CZPA 3U2QA 4HI0E 1JJVA 2ZE6A 1E69A 3U3MA 4A1FA 5M04A 2ERYA 4HLDA 1G5PA 2J0VA 1WF3A 4OL0A 1TEXA 2GJ9A 4XJXA 3W5VA 2QMHA 4Z51A 1A4RA 3KDSE 1QVAA 1VIYA 2HXSA 2ATVA 3L0SA 3QFTA 1B0UA 5DI3B 1DS6A 1YU9A 1ZIPA 3CUEF 1Q3TA 3LO8A 4OI2A 3MWYW 3FHTA 1QHSA 3DKVA 1GDDA 3NEJA 4G5QA 3NKVA 1YZUA 4TLCA 3GJ4A 3Q85A 2ORVA 4MITA 1XTKA 1JQLB 2BBWA 2BJWA 2UKDA 1OYWA 3CLVA 1EG7A 2O0HA 2GAAA 1SULA 5JSZB 4XVUA 3R7WA 4QBFA 3LWNA 1VCNA 3PJRA 3JZMA 5H59A 5LBIA 1II0A 2D06A 3P26A 2QUZA 3QFRA 4M21A 5DIFA 4EFNA 1H8ED 1IB0A 3LD9A 4OBEA 4W5JA 4PHTA 4AKHA 3PUYA 1KDPA 5IRCD 1G7RA 2NQ2C 2OLKA 5C4GB 3ZS9A 2QBYA 4GDFA 2WWIA 4D80A 3W6NA 3A4LA 1EWRA 2OT3B 4KCGA 4NMMA 4G1UC 1R8SA 5BYJA 3AP2A 3RRNA 3GD7A 4QNMA 2JJ1A 5TARA 3R8FA 2RGAA 4BRWA 3KX2A 4DEYA 2NO7A 2RC5A 3T1OA 2P3SA 2ZYWX 1MR3F 3KTAB 5FPTA 3NIBA 1BYUA 3CIOA 4UXJA 1XTJA 2QTFA 5CK5A 2QPAA 5SZKB 4PFSA 4HAUA 1P9NA 3LDAA 5EUMA 1G9XA 2RKOA 1DEKA 4Q7JB 1P2UA 2FG5A 2CNDA 1S8FA 2CBZA 4LHXA 4RCZA 1E9AA 2ZRAA 1ZC3A 5EXSA 4CT5A 2ZE7A 3CNLA 1JA0A 1VYTA 3B60A 1MT0A 2WPDA 4DC9A 1LF0A 1QHNA 1QDEA 2XAUA 4NBSA 4BPRA 4DVGA 4NONA 3WNBA 1KI7A 5FBWB 3VKHA 2FOLA 2AD1A 1XMSA 3OIYA 1S3SA 1KJWA 2ZJZA 3GP8A 2A9KA 4EKDA 3CBQA 3FYHA 3EIQA 3I92A 4HB4A 4OQNA 2PCLA 3TK1A 5LD2B 4JZKA 5LD2C 3U4QA 4NKRA 1RRGA 5BW8A 2CCGA 1YHNA 2DFTA 3I56B 1R8QA 1Q0UA 2IHYA 4O3MA 1Z0JA 5L3QB 4BZPA 3OE7D 3ZDQA 1VQ6B 3JQQA 1OFIA 3O47A 3U44B 3CCRB 1HY3A 3IBGA 4AKEA 4ACBA 1TUEA 4B75A 5EMNA 1T0JB 2KI5A 4I1VA 1W36B 2IS1A 3CXCB 2VTKA 3BE4A 4JVMA 4DDUA 1KO7A 4RD1A 1WDTA 1T91A 2FWRA 2GESA 2N46A 2W6JD 1BJKA 3QXJA 2FGJA 5J40A 5E3HA 2GCOB 4LJ5A 5EE3A 3T1VA 2GCOA 1XP8A 5HXBA 2JDID 3WNCA 1W2GA 4JBXA 2AKYA 1GOTA 1OFHA 3OF5A 4MA4A 3WYAA 2MSEB 2ZRGA 5JMTA 2QBYB 2VBCA 2XOKA 1K9MD 5A5GA 5EXTA 2WWXA 1KIMA 1DG3A 5CK4A 2WWYA 1NVVR 1XD9A 4R71A 3OIVA 4KXFB 5JWOA 1E2EA 3TR0A 4GSYA 4KLZA 1L7VC 4IDOA 4D81A 1TX4B 4W5WA 1ZBDA 4B33A 3GJ8A 1E79D 1S2MA 2NTYC 3ZD7A 2QAGB 3P4YA 4Y9UA 3K70C 1E1QA 5GJCA 5J4YA 4QKQA 3GLGA 2CVHA 2WSMA 4YMSA 3THXA 3BH7A 2ANCA 4ARZB 3BH0A 5FBQB 5THXA 2GF9A 4FMCF 4GMXA 2GXSA 3B9QA 5CM9C 4WIAA 1X3SA 1Q7YD 4QXAA 3OJWA 3D3QA 3LBNA 1KI1A 2CK3A 3MD0A 4GT1A 5DYGA 3SU8A 1NMXA 1IN6A 1R10A 4FINA 4S35A 4DLZA 2VH5R 2QU8A 3U6KA 1N5JA 3WMFA 3I8SA 1N0WA 4Q9KA 3TW8B 1GL9B 2GXUA 4PPQA 4LK2A 2QM8A 4OQLA 2PZEA 4P32A 2GBLA 2ZETA 3MAAC 1JALA 5A0FA 4K1XA 2RGBA 4HEJA 1OFTA 2GVZC 2WJYA 2RGNC 2AN9A 4CT4B 3W8RA 4B6EA 2CNWA 1U98A 2NO6A 3O8DA 3T12A 4AWXA 2W00A 3GLHE 2ZSBA 5IHPA 4TSFA 4URYR 5EXXA 4DT1B 5FI1B 3KB2A 2JJ1D 4P4SA 3OIWA 1OKKD 1DELA 4LBWA 2IS6A 1HURA 2IYLD 2J3EA 4B74A 3W5JA 1G3MA 5CDFA 4DSTA 2FV8A 2HJVA 4A92A 2YVUA 5HKKD 3KTAA 4JSYA 1Q12A 2O5VA 2DFNA 3KZ1E 5FOXA 1QX4A 2BIFA 1F5NA 2JLRA 4BRUA 1TF5A 4L9WA 2JLWA 1YKSA 2Z83A 4ZO4A 2XTZA 1VQPB 421PA 3AVYA 1OIVA 2EFGA 2QE7A 2QRNA 1GKYA 2EQBA 4JJZA 2FX3A 1G21E 1O87A 2AK2A 4P0TA 3VHLB 3CZQA 3VHXA 4Y0VA 1GL6A 3X2SA 4DSUA 1WXQA 4TT3D 1COWD 4AF7A 3GJ7A 2BKEA 3A1WA 2ZI7A 3B1ZA 4LGMA 1JPJA 1VPLA 1GRRA 1FQKA 3CX7A 2X8AA 1EK0A 3ZBTA 1F3OA 4Q1BA 2AX4A 1DDIA 3AF2A 3VR6A 2IYRA 1RYFA 3WYGA 3K0AB 4L8GA 4XVQA 2BMFA 3K0AA 3L82B 5IF9A 2XJ4A 4LV6A 2OG2A 4PZYA 2PLFA 2JLQA 1P2VA 5J4KA 1D9ZA 1Z2CA 5EXPA 3CPWB 3NTUA 2VHQA 2FNAA 2BMDA 2FZLA 1ESMA 2KWIA 3QKSA 2PMKA 4K46A 4RZXA 5J5CA 1G20E 1VQ9B 1HQCA 2CJWB 1F2UA 4NYIQ 4AI6A 1PLLA 2QN6A 4KJZA 3DOFA 3GCGA 5CIQA 3RWMB 5KDDA 1S1CA 4XD7A 2WMOB 1MOZA 2F43B 3OEHD 3ICEA 2XX3A 1J90A 1KI6A 3F0TA 5FTMA 4EFLA 1KK3A 2B92A 4HLUA 1VQ8B 4HAVA 1XMJA 3NBXX 4RFSB 4AF6A 1AJEA 3JQRA 3MWKA 3NWJA 1KY2A 4F7WA 1EGAA 1AGRA 1XD8A 1DAMA 1MV5A 1DAGA 5IK2A 5C2JB 4OHWA 4MKHA 2VZLA 2NZ8A 2AL7A 2V7QD 3G6EB 4EPYA 2GETA 2ZRBA 2ZSAA 3D6TB 3I3SR 1KY3A 3AB3A 2OE2A 4L15A 3SDZA 3UKDA 4C0AC 1E2DA 3LBHA 5GJVC 5HCNA 4URVR 5F9HA 3THOA 2CLSA 2OXCA 2VSXA 3GJ0A 2ZYTX 3K9LA 4WQMA 1VCIA 2XTMA 2BBSA 1NLFA 3ZS8A 1A7JA 1FP6A 2ZR9A 3GJXC 1BIFA 3IDQA 4XTRA 4BASA 1HYQA 2BSAA 2ZRFA 4O25A 5AJVB 1XMIA 2FPLA 5KOYA 5HTKA 4MGKR 2XGJA 3QF4A 3GJ5A 1W48A 4C0QC 5TMPA 5B64A 1Q3HA 2PEYA 1N0VC 1E0SA 3K0CA 4KI0A 2DY1A 5DISB 2XNDD 1G16A 3TR5A 4Q7LA 3VNVA 2EYQA 4DRZA 2W6ID 1HV8A 3TIFA 1TUIA 1KYIA 5FI0B 2QI9C 4EIWA 1N5IA 2ZS8A 1W7AA 4FCWA 3QG5A 1UKVY 3WHLA 3IBYA 1ZW6A 2V6JA 2O8EB 5GVRA 2CL0X 4KYIB 1VQ5B 3Q72A 1SKYE 3EZFA 4MRVA 3W9YA 4ESVA 2WAXA 4PHHA 4W5HA 3E1YE 1R5BA 1U8YA 4URZR 2CL7X 3LAWA 2BOVA 3K0FB 4EQ6B 4A9AA 4F91B 2DCUA 3A1SA 3K70B 1U99A 1K5DA 3GEHA 2PL3A 3AUYA 2W6JA 1N6PA 2PLRA 3HU1A 2VNJA 4XOIA 3EZ2A 4UNNA 2EU8A 4LYHA 3F5FA 3DPUA 5AUOB 5EE9A 2ZANA 1XD2A 4ZIRA 5ELXA 1VIAA 4IEIA 3B82A 2XNJA 1G1MA 4V0NA 1R0XA 1E9SA 3RSOA 4OK3A 2AD5A 4F4JA 2BGIA 1X8KA 4RD3A 3VO1A 1A5TA 2B7BA 2GZHA 1XFAA 3A36A 4BPBA 4B76A 4CRWB 2FE4A 1US8A 3LX5A 4UQOA 1K5GA 2RAPA 3EC2A 5J4VA 1W44A 4EJSB 4XVRA 4G3XA 1GRQA 4BLPA 5JI2E 1GNQA 1SXJA 3SQWA 3PUWA 1VHLA 3SS8A 2VNIA 4C43A 3CPHA 2EFEB 5ANRB 4C0SA 4I1OA 1XE1A 3W8NA 5BYKA 5DO9A 4E09A 5EJEA 4PQFA 1U0LA 2VSFA 3AM1A 4Q21A 4B2PA 2RMKA 1TU4A 2Q9BA 4RSGA 2JLYA 1Y63A 4DEXA 4B3DA 4FD2A 2G77B 3P1JA 3SHFA 1S96A 3W6OA 1KDTA 5FL3A 1TMKA 3FPKA 2VHTA 1UKYA 2VO1A 3ASYA 3WMEA 2OUKA 1FTNA 2ANBA 3TVDA 3ZGXA 1JNYA 4I99A 3BFXA 4EH1A 4M0LA 3C16C 1XJQA 2Q3FA 1CXZA 1G3IA 3O8BA 2YHSA 3QSYA 3FMFA 4CW7A 1ZM7A 3MHPA 4WOPA 4KFSA 1U8AA 2AHOA 4DBLC 1G64A 4DHEA 1HE8B 5D3QA 2OTLB 4IDHA 2BVNA 3CR8A 2GCNA 3TSWA 3IO3A 3BD9A 4LV5B 4QL3A 3V9PA 3PG5A 1NSTA 4LYAA 3VO2A 2K5UA 4TL6A 4BZQA 1XEXB 4Z8XA 3QKTA 2YOGA 3U7EB 3WBKA 3DZDA 3KQLA 3HP1A 1SHKA 2IF2A 2W0MA 3A4NA 3IPXA 3TQFA 2WKPA 3RRYA 4BLOA 5DNYB 1VQOB 2GKSA 3M4YA 1VG0B 1W36D 3KJHA 2ZYUX 4LHVA 1U9IA 3ZIAD 3RC8A 2C03A 3LBIA 2MMCA 4DT1A 3KQUA 1FNBA 1OE0A 1G19A 2DHRA 4P33A 5DSZA 4JIMA 4LY6A 4FN5A 4A15A 5GV8A 4D0LB 4LPSA 3P27A 2H1LA 2QEXB 2ZS9A 1VG8A 1JAIA 2N1BA 3DL0A 5KSYA 3QKRA 3OE7A 1ZD1A 4PANA 5L8VA 1TVCA 4OQXA 1N5LA 1Q20A 1N6RA 1H42A 2WIBA 2ZRCA 3EIEA 3J81k 1CJKC 5DGXA 3SYLA 3UMFA 1US8B 3WYFA 4AIIA 1IXSB 2NG1A 4DIDA 1NDHA 1Q1BA 4PC1A 1JR3D 1MO3A 3EWSA 2D74A 1QVFB 1LS1A 1NLYA 2EFHB 2KJQA 1XXHE 2BEKA 1G6HA 2XNDA 1Z0IA 2JAQA 4QOSA 5E7JA 4YAWA 4G1VA 4CYMA 4CEJA 3OAAA 4ZPXA 1UF9A 1FMLA 3DM5A 5JJIA 4ZDKA 5JHGB 1QUFA 1FPMA 3QUSA 8OHMA 1PV4A 1GTVA 4HSEA 3I1FA 1E2NA 2R2AA 4E03A 3U3KA 3CC4B 3GEIA 4RKEA 1LV7A 2CL6X 1NY5A 2GCPA 4S2EA 4MQBA 4K81B 4LSGA 4W7SA 1JR3A 1UPTA 1G4UR 4OJQA 2GK7A 2FPKA 4TLEA 2WOJA 1P72A 1Q21A 4JBWA 2F43A 1PUIA 4IVRA 4LCBA 5GJWC 4QHSA 2VHJA 3R8CA 1RRFA 1DBSA 4PR0A 4Q4JB 2P6NA 2VF7A 5GADl 4YXWA 1E2MA 4TZ0A 1D2EA 1TLLA 3CRQA 2E1RA 2BCGY 4PHFA 3TBKA 4FCVA 4KLNA 4EJSA 4TSFD 3THWB 1E2PA 3KQKA 2TMKA 1F2TB 4JT2A 1RRPA 2F6RA 3RVBA 1YJ5A 1NIPA 3TSOA 221PA 2FSGA 4IOMA 1OXXK 3HU3A 1QG4A 4EFMA 3A1VA 1QG0A 1ESNA 3SI7A 4RD2A 3CM0A 1OKKA 1XBTA 3GLGE 1QGZA 1OF1A 5CJPA 3G71B 2GEUA 4AYWA 3ADCA 1XXHB 1OHHA 3H1TA 3CH4B 2QP3A 3SC3A 2BM0A 5JFGA 4L9SA 3T5DA 3FHOA 1DG1G 4WA7A 1CJVC 1EP3B 3RLFA 1GRNA 1Z6YA 1TNDA 5KNBA 3UMSA 1N2CE 3C4JA 1COWA 4TT3A 4JVNA 2ZIAA 1HEIA 2QY9A 3I32A 3ZJYA 5C4MA 1E9EA 1RW4A 2O52A 3SE0A 1P4SA 2QP4A 1KQSB 2WSSD 4BECA 4Q9HA 5EE0A 2ZR7A 1AQYA 2HCJB 2DERA 1G5RA 1OFUX 1O3YA 3GFTA 4RFVA 1NN3A 1GSIA 3FOZA 1JAHA 1IOZA 3GFPA 1QG2A 4JL8A 5KHOC 3LFUA 5FR1A 1EFTA 2HLDD 1KO5A 1Q1QA 1KAOA 2ZAMA 4XTCS 1VMAA 2IWRA 1E64A 3LXRA 3FFBA 4YMWA 1KI4A 4XWOA 1VQ7B 2C9OA 5FUYA 3AF0A 2VPPA 3L0OA 4Q48A 2G9NA 1E0JA 1S4QA 3FKQA 4DCVA 1PLJA 4B6FA 4DDTA 3W5HA 1E2FA 2QTVB 5EP1A 1G18A 2FN4A 1SXJD 2RGNA 1T8TA 2QTHA 4NTZA 3TUIC 1Z29A 2NZJA 3TVTA 2W0SA 2ZRJA 1D9XA 2H16A 3V4FA 3CF6R 1B2RA 2OV2A 2OFOA 2OBNA 5TVKA 1HUQA 1E98A 4UXIA 2VHUA 4YAUA 3Q7QA 4B71A 1K6MA 5EE1A 4A0HA 3IEVA 2F3TA 3ES9A 5FPHA 1F60A 4ILEA 1W4RA 2C2HA 3CF2A 2J0UB 4CDGA 2C9CA 1IM2A 1I4LD 1TU3A 2J0UA 4Q7MB 4KFTA 5FTJA 1KGDA 2JJ2A 4JS0A 4M22A 4X8LA 1D8TA 2VYQA 2CK3D 1SVWA 2V9PA 4Y7CA 3PITA 4LJ6A 4DSOA 3NDBB 2O8BA 1NKSA 1L4UA 4JLBA 4UJ5A 3AVWA 2ZRPA 1L4YA 3EASA 3OIUA 2QGZA 1FW6A 2AWNA 3GLHB 1VQNB 3KKMA 2V1XA 1P3JA 1KK1A 3AQ4A 1Z0KA 5EZ5A 3TKLA 2ERXA 2DYKA 4DCNA 2Q0HA 1S72B 1XU4A 3CB4A 4LV8B 2R6GA 2OO7A 4KHZA 1JJ2B 3LV8A 3ZH9B 1W36C 4X8MA 3UPUA 2ZJ2A 3CRMA 1ZU4A 1QHGA 4RD0A 3DDCA 3FKSA 5SZIA 3K9GA 2W6IA 3UIEA 3CH5A 3D7MA 4PC7A 5JLJA 2RHMA 1JR6A 4V02A 1FFHA 2DETA 1FL9A 3C41J 2CCJA 2W2XA 2QZ4A 5FOTA 4MDEA 5FUWA 4HZIA 3T06B 1W4BA 4US0R 1KI6B 4HUQA 1J8MF 3MFYA 3B1WA 1KMQA 2IYSA 3IIJA 4DUGA 1JB9A 2F9MA 4LRWA 3ECCA 3CCUB 2GWHA 3IQXA 3Q5EA 4B3XA 4IVPA 4A4DA 3RS4A 2FDCA 2VP5A 4TL8A 5L3RA 3OZWA 5DN6D 2J0QA 2HDNB 1GAWA 2IYQA 4OK6A 1I2MA 1DO0A 2C98A 3W5UA 3B78A 2OZEA 2P2LA 2BV3A 1G7CA 1EFHA 2BDTA 3TAHA 2IT1A 1W0KA 2G1JA 2QAJA 5JJKA 2WAYA 4QGFA 4Q4HB 4RD4A 3JQPA 5KNCA 1FZQA 5KPDA 3NBFA 2FZ4A 1L2TA 3B8HA 1XCGB 4ZDJA 3V76A 1C9KA 3D31A 2R6FA 2OXRA 1S3GA 3RABA 4ZGQB 1KDRA 3M0EA 5J4HA 4JLOA 5DHAA 2IYVA 1WA5A 4C30A 1HA3A 3CF0A 4JKYA 1GNPA 3PIRA 4BFWA 4URXR 2V3CC 3SYKA 3LW8A 1UBEA 4A36A 1FRNA 3RS3A 1CU1A 3JZAA 1NG9A 4WW0A 3RWOA 1R7RA 1M7GA 2EWWA 1WBBA 2WJGA 3A4MA 3PCRB 3VX4A 5H8WA 1F48A 1RPZA 3EPJA 3S1AA 2QTLA 5J4LA 3ETLA 1DO2A 2RHDA 3GJ3A 2O8DB 4HAZA 2ZVQX 5DI9A 5K8UA 5LPNA 5F3WB 4R9UC 2O8EA 3I55B 2A5JA 5AN9A 3TMKA 1YJ9B 4F7DA 3DKPA 1ZYUA 5L3SB 1GITA 3B1VA 4KSBA 3AVOA 2B21A 1OH8A 1DADA 3KJEA 4MUBA 4LPKA 2DEUA 4NCJA 3HYTA 4POAA 3GLGB 2WIAA 5EE5B 1TADA 2REBA 1PZNA 3AGQA 1E2GA 3B13B 1VCMA 2XSZA 3IGFA 5GJBA 1Z07A 2D62A 5CM8B 4HZUB 1UJ2A 2HF9A 4HZUA 3SJCA 4DLSA 2IX3A 3TRFA 1AMOA 2V6IA 3EPLA 3U44A 3HPQA 5BWMA 4NYMQ 1GM5A 2J5XA 1D2NA 1E9CA 1UKEA 1YR9A 1IY1A 2GJKA 4MYUA 4WXRA 1XTSA 2NO1A 3AUXA 4D26A 1FNDA 1RKBA 5JSZA 3K1JA 2FPMA 3QE0A 3VNUA 3OW2B 1R4AA 4FWIB 1CS4C 3I62A 3SYNA 2ZQ5A 1AA9A 1R6BX 1JA1A 1QHYA 4WZAE 4I1UA 4Q9JA 1W2BB 2RCNA 3CONA 3VU9B 1TTTA 1I4DD 2EFCB 1RE0A 4C2UA 3CRVA 3RC3A 1BO6A 1M2OB 1X8JA 4ERNA 4QHTA 5E4FA 4JLKA 1KOFA 1YR8A 4BWYA 5DE3A 1AQUA 4LJ7A 3FJOA 2WSSA 3QENA 4TQ9A 3T5GA 3ZQ6A 2JATA 3I5YA 1W0JA 1GAJA 1JQJC 2EVWX 5TB5A 3B5JA 3AVQA 2WJJA 4ZCMA 1IN4A 2OTJB 1JPNA 1UBCA 4PSKA 5IT5A 3BORA 4O0MA 5FPKA 821PA 1DAIA 5LDDC 2PT5A 5AJWA 2YWHA 2A2ZA 1U94A 4Y9RA 4TYNA 3Q8XB 2R44A 4JLMA 5G40A 2HUPA 3LLUA 5FL7A 2WKRA 3EG5A 3OZXA 4D4LA 4A0GA 1S1MA 4WXPA 3CCLB 2G1KA 1DAEA 1CJMA 2FGKA 2OAP1 4BFYA 4G5SA 4Q01A 3BH6A 3C14C 1X1RA 4NU0A 4G0NA 1JR3E 2OAQ1 2ZRHA 1ODFA 4IHQA 4LJAA 5JS7A 3ZLJA 3QXXA 1X8LA 2O8CA 2GZDA 3K53A 2CMKA 3PEWA 2GBLC 1K8RA 1M34E 4HDCA 5AJYA 1V5WA 2MSDB 2P67A 3M1IA 4OQMA 2VP4A 4IRUB 2XZLA 5BN4A 4F4CA 1W47A 2I4IA 4QJ5A 1Q1ZA 2OBLA 1FNNA 3SR0A 2Q21A
chains in the Genus database with same CATH superfamily
5KYWB 3BD6A 3A3PA 2CJXA 2NNLD 2ZZEA 1A7AA 2ROQA 3CPSA 1M9NA 3GT0A 3RS5A 1XWIA 3FPPA 4UXHA 3BWDD 5HVNA 2ACKA 5C7IO 2P1DA 3VMFA 2NGRA 5EJAA 3PYXA 2XPCA 3BICA 4HKTA 2VQSA 2C4TA 2VL7A 3CGWA 3OIDA 4P7GA 3HXTA 2F1HA 3KXIA 1T2VA 2CD9A 2ID9A 3AZQA 3BL6A 4UMFA 4BX3A 1U81A 5H7XA 5CFMA 4BX2A 3ONVA 1V71A 3UYLA 5KTYA 1II9A 5HKKA 5CH3A 1Z37A 1AKQA 2HNKA 3KSMA 3OTQA 5CNIA 3EMVA 4ZQEA 5F77A 2A4KA 3KKKA 5B7PA 2CNBA 3PRJA 3QPBA 4HX5A 1XNQB 2OB1A 3CUKA 3F49S 2JN9A 3EVGA 3ASQA 4WK0B 4J03A 3S1AB 4DLVA 5BW4A 1NBHA 2P0YA 3R7AA 3UHOA 5AI6A 4LF5B 1DX4A 4WAUA 2C94A 1ZD9A 1WL8A 2AQKA 3G4SB 2VUIB 2QJRA 5ALLA 2JLXA 3GN2A 2WOOA 2ZDQA 3UK0A 2ZVPX 1WU8A 4I1RA 4MJLA 1L5HB 2Y1CA 4XD2A 4XUCA 1D7AA 4B6PA 1UMBB 3H11B 1WCIB 3Q39A 3MLAA 1ZR2A 3SR4A 1HE1C 1NRXA 4UM8B 4HWPA 3QBJA 2X9NA 1QZTA 1T9HA 3ZDZB 4F72A 2CXXA 5FLEX 2CXHA 2XIJA 5D3MB 2WFZA 4C76A 1FW8A 2DSNA 3UANA 1WBDA 1XDGA 2G7MC 3I58A 1NVDA 3IDSA 2BUAA 4XSVA 2BISA 2R8EA 2CJWA 1MOSA 2GS9A 3LUDA 5G0WA 3LF2A 1A71A 1KEKA 2IPLA 3FTPA 4D4MA 2VF5X 3D5TA 1UKZA 3ND9A 1KO4A 5TDHA 3LQKA 2WF7A 1Y3HA 4QQ8A 3ZCVA 2HF7A 4Y1RA 3VJRA 2WNHA 4GGPA 4M1MA 3ZPNA 3TZHA 2BMAA 4FB4A 5JPIA 1IWBB 3NMUF 1JJIA 4R2MA 3GBVA 2AOUA 1MC4A 1XYVA 1P75A 2AOUB 5GTDA 1XN1A 1Z22A 2LD4A 2Q6IA 4S04A 3GUHA 2FPSA 3WRXA 1OLOA 4BFVA 4UC0A 2JAWA 5CT4A 3HBAA 1ZMRA 5AK4A 5YASA 1NT2A 1KI3A 4YAOA 1T3ZA 3VYTB 3D6UA 5BORA 3PKJA 4EPWA 3NFRA 4RDJA 4OOFA 5EJ5A 4RZ3A 3L93A 3LCVB 4UNSA 3RANA 1HQYE 2YYYA 5JD5A 8ABPA 4M2LA 3TF5A 2B8TA 2QNRA 2VR1A 1A4XA 3KQSA 4NENB 5AI4A 4KQWA 2HBRA 5FOSA 2YINC 4X0CA 1QIFA 3PHLA 5LLTA 1DKNA 1Y48E 3OQIB 3T5BA 3BS4A 1X1QA 4EDFA 5CLLA 1C0EA 1U65A 3GROA 5CW2A 5BVGA 2GFIA 1KL7A 3BAFA 3QUQA 1RE1A 3PRKE 1UBUS 2DTXA 2HDHA 2HBQA 2JK1A 4ITVA 4JR1A 3L0ZA 1P19A 1UXGA 3PR2B 3RFXA 3UWKA 5L3VA 5M2QA 1GP2A 3PDJA 4MNTA 4QU0A 4KJXA 5EPOA 2YXLA 4DUZB 4OI0A 2I3AA 2BFEA 5A3QA 1FOEB 1VCOA 4BO3A 5IH7A 3OKPA 4LNAA 4QXOA 1F51E 2D1YA 5EVCA 4YDQA 3AHJA 2FW6A 2L82A 3MMPA 2WVGA 1K98A 2HRQA 2OBYA 2MYPA 2BR3A 1H93A 2P9TA 4WV3A 2X0DA 3Q8LA 3CEJA 1UZUA 5K99A 2QUHA 1ISPA 3HL4A 3R3SA 4XB1A 3WDKA 4R1SA 5KTMA 4YRRA 3H1PA 4FT4A 1YUMA 4RADA 1C8VB 5AKXA 3X2EA 1B8UA 1NTOA 5CYFA 1BFUA 5H02A 1Y5IA 4Z9AA 2W2TA 3EVNA 5JDCA 3IHTA 4TLMB 5EIBC 5JD3A 1IVNA 3Q0TA 4D44A 3ZZUA 2AKAB 4X6LA 2VHCA 4ALNA 5BSGA 6REQB 3NCHA 4ZO9A 5HOEA 1SKQA 1HT3A 3WK6A 1G2OA 4GI2A 1NVEA 3F6SA 5ALIA 4OHZA 3P9RA 3SC2A 5GVSA 3ABQB 1UUFA 1RZRD 2RB5A 3CR3C 2IOFA 4Q18A 1RCUA 4MQMA 1IN8A 2C78A 1TA4A 3RHTA 1S9DA 3AKCA 4ZHSA 1T2AA 3ER6A 1SUIA 2M1XA 3JPWA 2HHLA 5K3FA 3R5FA 4QWWA 4C5BA 5LWHA 1XLTC 4M9QA 2CLLB 1YE8A 1ISHA 3B9PA 4MDHA 2C8LA 4A6XA 5JATA 1GO2A 4FEAA 4C0XA 2RAVA 2QVLA 4V0ME 1JHAA 3R9IA 3U7QB 1A1SA 1DUVG 1T9AA 4IQGA 4H08A 4BX8A 4R9VA 3PK0A 3UOWA 3K0HA 4K2HA 4WE3A 4IIYA 5LDHA 2FFBA 4YACA 2X4DA 4RTKA 3QP9A 2D7CA 3V4ZA 1N5MA 3CZ5A 4D9CA 2V03A 1EBFA 3C70A 4MQUA 1QP7A 5F98A 2NV4A 4JI7B 1M1XB 4FK8A 2FFQA 2W2LA 4Y9TA 2KE5A 3H1AA 4GRAA 3R77A 1G6KA 3RJTA 2Y76A 2GD2A 2Q3HA 3KL4A 4WN9A 4AKGA 2WT4A 1ESEA 5B3AA 1FLNA 2IEZA 2WG2A 5DSTA 3WQHA 2C2OA 4QD3A 4R01A 2BSQA 4YECA 1MNAA 4JJ7A 1JZSA 4CKEB 3KKLA 3QEJA 2GRAA 4OFWA 4GGMX 1SRQA 4A8PA 1EQ2A 1IDOA 4BQSA 4BQRA 3SVTA 2WWFA 4H7FA 4ZVUA 4G37A 3V7FA 5JPDA 1IBKB 3JWJA 1ZICA 3RIEA 1P39A 3HSKA 3W06A 3ZLUA 4FU0A 4CG1A 4J1QA 5ARBA 3IUYA 1J2JA 3HXMA 3EPPA 3CNBA 4MV7A 3WP1B 4G1MB 2UUCB 1F4LA 1DUIA 3IFSA 3P9QA 3MRTA 3KWLA 1H65A 2GEVA 1OYOA 3D1JA 4M0CA 3NGXA 4LIPD 3WRVA 2X0KA 4AP9A 2XYVA 3BKWA 4REQA 1N5OX 4OSPA 2GJ8A 4RAOA 3RDPA 3HCRA 3ZGLA 1N3LA 2JBWA 1T36B 3H4VA 5FWYA 4LVNA 4MINA 2OFWA 4PHCA 4YPFA 5FWYB 1Y6JA 1RJDA 1UMCA 3R9WA 1BU5A 2IUTA 2DUUA 5HMMA 4AMUA 3O8CA 4IFEA 1Z28A 2WE8A 2PQMA 1O58A 3AF3A 4HAXA 3UJCA 2Q45A 4FQ8A 2DQYA 3EVZA 4GBMA 4P36A 2VVTA 1II8A 1T3SA 3N2NA 3VC1A 3BZUA 2WYHA 4IDDA 3QLUC 1KJNA 3E70C 3NLLA 2GPAA 3NG1A 4BMXA 3DHWC 3RFTA 4LFCB 1XD2B 4AO8A 4B3HA 2CFRA 5DLPA 3T1TA 1M5UA 3SYRA 2H59A 2ZUSA 4EHNA 3NHRA 4EMSA 1MEJA 1XCPA 4DTIA 1FNCA 3OTHA 4HYQA 4RPDA 4MK4A 1RC1A 4FSDA 3UAOA 3KVRA 2RH5A 4FHGA 4GC5A 4CIYA 3BG5A 1OIWA 3W8DA 2GZRA 1MGPA 3IAM1 3H8WA 1O1YA 1FVXA 3RF6A 2P4UA 4DSZA 4EG3A 1T5LA 5JCZA 4F3KA 5K03A 4EPTA 3FFXA 1HKUA 3L3BA 2BH2A 4YALA 2OOSA 4FYMA 1TEZA 1AN0A 4RLQA 4XQ0A 4URWR 4BJ6A 1PNQA 4S1WA 5JSHA 4RHUA 1GPNA 4LNHA 1BH2A 1Y4AE 4YO8A 5KAPA 5K3EA 4QTXA 1SXPA 2EFYA 3KOWA 3AH8A 4HBZA 2CUNA 4OFXA 4ZD6A 3G2PA 2Q5CA 3MGGA 3HR7A 4INJA 3RR2A 4DDVA 5E9AA 4DQVA 1X87A 3W2HA 3NB0A 1USKA 4RV5A 2QX8A 1EX9A 3QLEA 4GFDA 5LXTB 3WK4A 1SIOA 4KPUB 1NP6A 3V4RA 2PH3A 4MVCA 1ESCA 1L5OA 5JU6A 1U3GA 2OCYC 3EGEA 4XSGA 3RS9A 3ZYZA 3KT6A 3IE2A 4IBOA 5FO0A 4ZREA 3S29A 5KYYB 4L3VA 4RGVA 3C4VA 3V8EA 1NVBA 1X7WB 3A2MA 4Y2JA 1RRVA 3CVWA 3VYSB 1G2QA 4JHLA 3DLHA 2OZVA 3BWVA 4WH0A 1Q1EA 1DUSA 4YMTA 4I4TA 2XBMA 1N32B 1RZVA 1HYHA 1AKVA 1X7HA 2P5TB 1NX9A 2I1QA 3E7DA 4MMXB 4XM0A 4V0QA 1A2KC 1XL0A 4IM7A 1U7WA 3KZMA 3VDRA 2A5GA 1WUIS 3FUWA 2GQ0A 1L3BA 4CIWA 3KD2A 5LZ2A 1HWYA 1C9YA 1GWNA 3S3TA 3T9DA 4BFXA 3PNSA 1D4OA 4FZ3A 1W5BA 1Y1RA 4BX9A 1BQ4A 5JEEA 5BWOA 4BNUA 4RH1A 1EM8B 4FQ5A 2DBYA 4I7EA 5AVYA 2W90A 3QVVA 3VR4D 1HE3A 2PJZA 3U31A 3VR3A 1MDBA 3NHLA 1QB7A 3BMQB 1VJRA 1L5NA 3B2EA 3GVLA 2R6ZA 2GN9A 3AEUB 3DL2A 3DXFA 2VP6A 4UAVA 4E30A 2XODA 3C6KA 1UZMA 4D41A 4X97A 4YWJA 4M37A 3MJRA 3PLRA 4RTPA 1LLCA 4LWQA 3SICE 2Y67A 3SG0A 1ZIDA 3UB3A 3F6EX 2C2WA 1Z2DA 1SG0A 3IHWA 2NV0A 2P9GA 2RHGB 4IJ5A 3U3RA 2D2VA 1BE6A 3HZOA 1CR1A 4D6PA 2HUNA 4E2XA 5KYXA 2W5UA 2QTWB 4QYSA 2AFHE 2Q3LA 1FFSA 5D6OA 1S8OA 4B0PA 2P2DA 1P18A 3SEFA 3OZGA 4RNCA 3WO0A 1B41A 5K8LA 1YS4A 4PLVA 4IPTA 1VKNA 1NUHA 4UHEA 5CLJA 1XX6A 1UMKA 4V0LA 4YLGA 3GG9A 3S2UA 1GLNA 1TJ4A 4RF2A 3RUDA 3B3QA 5HZGA 3TOVA 2ZDHA 3OLQA 3P0IA 5DM1A 5GMOA 4GVPA 2C95A 1S2NA 2PZLA 1Z34A 2B2XA 3AONB 1OWOA 3QRWA 4QJ4A 4RA9B 4XFDA 4EA6A 4U2KA 1EX6A 4WZAA 3ZE1B 2AB0A 1VGVA 3C1AA 3ZYCA 4AMVA 5A02A 1XAIA 5JXWA 4LOAA 3BX1A 3MOGA 2G1UA 2WAAA 2JGKA 2PZGA 4NAUA 5BQOA 5INTA 1OLXB 1H2XA 3K09C 5CEFA 1ECFA 1TKBA 1UFKA 3FVQA 1T34A 3AEKB 4U7TB 1FMCA 1VDZA 1JDTA 5DN9A 4Y67A 3RS2A 3SJAA 5AM3A 4IXNA 1GRCA 4R2HA 3RHZA 4NPHA 4BEBA 3UOGA 2HA2A 3W8EA 3T3NA 2XEXA 2NT3A 4EHJA 3EDRA 3EWAA 3IKTA 3RT1A 5EIEA 1X7DA 2B30A 5FF9A 3IUNA 3ZXIA 1Z5ZA 1BEEA 3FRHA 1LW7A 4ANFA 1N8RD 1F6DA 2J9XB 4N6OA 3ZCSA 1DEXA 1WW8A 2F9LA 2SHKA 1NBIA 1VJGA 3ZGNA 2XZDA 3HXQA 5WRFA 1T2DA 3OBBA 4NYJR 5B1SA 1ZM2A 2AXPA 4DCTA 4Z3KA 5FLKA 1JFTA 4W5TA 1QP0A 2CLIB 4PC6A 3W3AH 3G0IA 4BKOA 2NXWA 2REOA 3GIRA 4JT4A 4GHWA 3ZWCA 4TRNA 3FRIA 1XVTA 4PTLA 2ZI6A 1XO1A 5B3JC 4POOA 2DFVA 2GCGA 4GLOA 4DC0A 2IW1A 1NYQA 2ID7A 5I48A 1S2DA 4BO5A 2HF8A 4CF3A 2W58A 3I05A 2O20A 1Z3IX 3JU3A 5CGZA 4CKWA 1U0EA 4TT8A 2X2FA 4LBYA 3FPBA 4EYQA 4I9FA 1KSFX 1JG6A 4UM9B 2H4WA 3B52X 2PZMA 4GYJA 3DS8A 2GPBA 1E1YA 2FUCA 1UMDA 3S6JA 4ZOQI 1XA0A 4OQDA 3V6LA 5LQNA 3ZE8A 4CMEC 3KPUA 2NSHA 3VPHA 3ZNNA 4F46A 2H7VA 4O1IA 1SZDA 1YITB 4HDQB 3E20A 2VUSA 2JI6A 4FYKA 3DMDA 1OLUA 4GLFA 4INPA 4RLSA 2Z04A 4UNIA 5DX8A 4RSRA 4R98A 3KSUA 1RLOA 5L7YA 4MKFA 3KZNA 4WCFB 5J43A 3G0DA 1QBKC 2Q7DA 3M89A 4DPKA 3PFFA 1YR2A 1Z6XA 2ZRNA 3QG1A 4HX9A 1ILEA 1YIDA 5EIOA 3A6KA 1ZMXA 2PSDA 4BNHA 5A4JA 2GFHA 4JI0B 2A3NA 2FSPA 3OZAA 3S7TA 1EZ4A 4N3NA 1N6LA 4J0CA 1H5UA 2IA5A 1FP7A 3KLBA 3GDFA 3N6XA 3MTBA 1YMQA 2RSLA 1U0JA 3AJDA 4P58A 1O6ZA 3VR1A 1AB5A 3QA9A 1QLJA 1H9BA 1KO1A 1CR0A 2E37A 2B5OA 1L7XA 1P1HA 1YC5A 3ORFA 4FI3C 4NOLA 3TRHA 4US2R 5HNKA 4AKHA 2BFCA 2G9QA 1OROA 1WB6A 3S99A 1HZZC 3QJ5A 1R0WA 4E5YA 1IBRA 4E15A 3LA6A 2YZ2A 1SKMA 4NHOA 1HL7A 4FQ7A 4MPRA 3V3KA 5IHXA 4FYHA 2I29A 3HDQA 3BIWA 1QC5A 1CQIB 2CZQA 4TKOB 1CJTC 1C8LA 2ZYRA 2CLKB 2ZT6A 1GPMA 2DWPA 1N0UA 3ESCA 1EEXB 1ZP6A 2W9XA 3T6KA 2EW8A 4ASUD 1EUYA 3A9SA 3ONWA 4OAQA 3UTDA 4OYYA 1BKDR 2YJ3A 2EHJA 4WLUA 4W1SA 3KKPA 1JEOA 3FPGA 4XWAA 5DWQA 3HBJA 5DWVA 3SBDA 1KJZA 1N92A 2PX2A 3DFMA 3GNQA 1QM5A 3LX6A 2D13A 2G06A 5CB4F 4ZKDA 4LF4B 2HEGA 1R0ZA 2JLSA 5BWNA 2R3SA 3R6LA 1LU9A 3GGGA 3GYGA 5T4FA 1YR7A 4DANA 4K0KB 2FX2A 3PGMA 4QUEA 1KRHA 2GVDC 2ZYSA 4L74A 3MQ4A 5C34B 1YUNA 2WD9A 3IP9A 1SVIA 3V42A 3PFCA 1TEHA 2RG7A 4LC0A 2IW3A 1TD1A 2PL1A 3EGDA 4I50A 3R4CA 2XVMA 3KU4A 4S1TA 5JFOA 1T0HB 2ZJYA 3TE6A 3EW7A 3I6BA 5ELLA 2G63A 3VTKA 4B5LA 3J81A 1OPXA 1WY7A 3MNFA 1Z17A 4YCMA 5E7IA 4WHMA 5IKMA 4H0FA 4K8RB 4UD2A 4F60A 2JI9A 3NOVA 1IJFA 2ZJ0A 1UJNA 3A2NA 3B36A 1GSOA 4EL5A 3JRWA 2J9ZB 3JQFA 3PNBA 1WO8A 4AJHA 1K4KA 5A71A 1QYXA 2QNIA 1RJ9A 2ZREA 3KTFA 3LXXA 3ZX5A 1FSGA 1QMGA 2IH2A 3PENA 4C87A 1KSHA 4JC8A 4HWGA 3WWEA 4EL0A 1VRVA 3I5MA 4ZMSA 1PR9A 4O2LA 1ECBA 3WGHA 2CWDA 2OBFA 4HDRB 3ZWBA 5CEJA 1YIJB 4E22A 4F97A 4D45A 2IITA 2Z4RA 3HCPA 3SD7A 4CMIA 3RGGA 3Q6RA 3Q7PA 4AK9A 1S9HA 1VLHA 3LO5A 4Z8YA 3EFOB 3D1VA 4DCMA 3V7YA 2NUTA 1CTQA 2PGJA 4W7HA 2BMVA 3ISJA 5CXSA 4EUEA 4AQ7A 1W581 3H94A 3O4VA 4CMAA 2OXFA 4CEIA 1Q7RA 1M7BA 1VSUA 4P5PA 4C0WA 3EFEA 2UZIR 2ZR0A 1H1DA 5CJJA 3X2SA 2ZUFA 1W46A 2ZBEA 1KDOA 3TLXA 2DB3A 2WPNA 2R8PA 2H29A 3CF4G 4GNRA 1N5RA 1E0KA 2WQZA 4GZLA 5JZSA 3OLYA 1PR2A 3PPYA 3IJ5A 2NO4A 1XTUA 5C46F 4MI3A 3NHZA 2YC4C 3OWXA 2GHIA 4MGIR 3ZW8A 3PX7A 1XU7A 2QIOA 3KT0A 1PS9A 4ENWA 3CY6A 1Q6ZA 1J9EA 2XB4A 2PFGA 3F74A 2NWQA 1HT0A 1UPXA 3K4HA 2Z2IA 1KNQA 3V9AA 4MJ7A 4R8MA 2VJBA 3B1YA 3FUVA 4AIRA 4DIEA 3VYUB 1Z06A 2CXSA 4QSHA 1RHJA 1XZIA 5CH5A 1EHIA 1JSZA 3EGVA 4C3OB 3MB5A 2VXYA 3U7GA 2EGUA 1RBMA 4Z6KA 1N3YA 3DZBA 1R0SA 4MIKA 5DBOA 1LNZA 1Y7IA 1EJBA 4HLCA 2AVNA 3CNOA 1XR3A 3DZHA 3TG2A 1NI5A 4KEAA 2OC4A 4TV8B 1IZYA 4BU0A 1C0KA 4NQRA 4Q5IA 4TV9F 3IC5A 2DBQA 3EH1A 3CPEA 3O1IC 4YT8A 2V8BA 3OTIA 2IDKA 2QVCA 121PA 2R62A 2WT9A 1KEVA 3BFVA 4KR6A 3KE9A 3BCSA 4MDFA 3CP2A 1A98A 1GKIA 1UPAA 2XQGA 4EI8A 5JNVA 1G8FA 1XEWY 2YVLA 5TT0A 2VEOA 3Q87B 3SHWA 1GUZA 3ZWWA 3FM9A 3V1LA 2ODQA 3AF5A 4YB8A 2BPOA 5DM70 3WB0A 1CUHA 4I4LA 4MW9A 2WHRA 4FFVA 2R1VA 5CB4A 3U7HB 2QZJA 3F1KA 3P0EA 3TJZA 3TRJA 4PNEA 1KHTA 3FDXA 2O2EA 1TCVA 1Q57A 1SBIA 1SUAA 2PR2A 2VF4X 2X7HA 3JAWA 3C3XA 4X8LA 2FPGB 4BFLA 4LJ9A 3H5AA 2WKQA 1DCFA 3ESZA 3H3XA 3IOBA 2Z4SA 3DUFA 4QUZA 1OB5A 3FSGA 4TKLA 1ZNZA 3RVDA 4MVJH 4ABYA 4HTAA 4E0FA 1DTSA 3OD5A 3BJMA 2QHXA 4J6FA 4RX1A 3SSAA 4AAYA 4XRGA 5IJ0A 4Z4IA 4Y2TA 2X7JA 1ZK1A 1NWHA 5EWJB 4BN0A 4AJ9A 6ADHA 1RABA 3D64A 3R40A 2WJHA 4PXAA 4AWBA 4V0KA 1KYQA 3CE6A 1Z74A 1QHIA 2B5WA 5HX7A 2B0JA 1C2YA 1U0SY 3PUVA 1YCHA 1NYTA 2RFLA 1WOPA 2PZKA 3A37A 4K86A 4BMPB 4RLFA 4RIIA 2OEPA 2Y4OA 2FQ1A 1AO0A 5AVWA 1DFIA 3N86A 5KSPA 1L5GB 2G4LA 5AK3A 3PI7A 4FNOA 4EY6A 4KYTA 2OD9A 5JUWA 4G0VA 1NT4A 1SD2A 4KN6A 4XQ9A 4H7JA 4WBXC 5KCMA 4NBNA 3SN6A 2Z8XA 3NO4A 4NZNA 3EA5A 4OHVA 5DYWA 3T06B 3W8FA 1YQQA 3E53A 5AKLA 3GLFB 5EJGA 3HS3A 5KHOC 3LBYA 1JHDA 4BNZA 4RPBA 3IRUA 4NV1A 3UHPA 4N1AA 1DC7A 4U8HA 2GBFA 1GCUA 3T15A 3HCAA 2H65A 4WOJA 4BNVA 2BEVB 1YA4A 4QO7A 1CRQA 1L3IA 2YVQA 1JAYA 2M6LA 4Z54A 2I6QA 2VPQA 5LKRA 4LHEA 4HAYA 4PF1A 1PJ5A 2ZUWA 4QDKA 2QEQA 3SSNA 1HDIA 1NDQA 2FZKA 2C83A 2LR0A 2NU6A 2P27A 1ZHFA 4RVSA 1UK7A 5D3KA 3T54A 3U81A 2XDAA 3WGJA 1Q2XA 1EA7A 1K6IA 4GL4A 5CXXA 4DWJA 3QW4B 3LRTA 4CIXA 3RIXA 4FKBA 3TD6A 3WSWA 4L50A 4BB0A 1UP7A 5IUJC 1T2NA 4UEQA 1NW9B 2IE8A 1ELOA 4PG6A 1ONBA 4X95A 1Y6FA 1GL7A 1I6MA 1D07A 2Z1NA 4MRPA 5F3DA 1XPOA 4KQFA 4Q19A 1D3AA 1CJCA 2E1BA 2JA1A 1EWVA 4KV7A 2DGDA 2DSTA 1BKYA 2FMHA 4K2AA 4KXUA 4J91A 3TW8A 3WAKA 3QXGA 1ZQ1A 5LQKA 1D04A 4ZGNB 1A8UA 2VNKA 1OWPA 2Q1WA 4HX2A 4BFSA 1OAOA 2XCOA 4C4AA 3CF4A 3JARA 4DJTA 2RKWA 3HDVA 3KQPA 3UW1A 3EZLA 3H5NA 5EINA 3OA0A 3TFOA 1ZI9A 2EX4A 4IIEA 1ZIOA 1XF1A 2H0RA 2PLAA 2WU8A 1I4OA 3CO5A 2F1RA 1XTIA 3R3XA 4KLRA 2FVGA 1XJ0A 4X7PA 4UHFA 1V43A 2C2BA 3QLVA 2WTEA 2FMKA 3STVA 1KYYA 3KPYA 1NX6A 4QLAA 4YGYA 4U6NA 2PSJA 1OPRA 3FIUA 1ULUA 3H9BA 4MV8A 5FWXB 3FCOA 1C0PA 3ZTTA 5TGTA 1M6EX 1YRBA 2FWMX 2Z0MA 1CG6A 4G41A 4L28A 3L06A 1GCAA 4LE0A 3LRPA 1OXBB 3STTA 2ZYDA 4B48A 2WMDA 4D8UA 3KB1A 3UH0A 1XCMA 4H27A 1QPGA 1UZLA 4JA2A 5JAZA 4MXDA 5CBPB 3CZAA 4I4TF 5G3ZA 1SBYA 3AR6A 3QE9Y 3N8HA 1I8TA 1K63A 3L0PA 3OWOA 5EEHA 4KXVA 4PGAA 4R8RA 4TM7A 1K89A 5FADA 4FW9A 1BJRE 4Z4CA 3RCBA 3FGPA 3VR2A 4I55B 2PANA 3PC7A 3PJDA 1YR6A 4JJEA 4Q9NA 4ND3A 3EY4A 3MJFA 3QEOA 2DFKB 4J3FA 3ZWKA 3HB1A 1UK8A 2X6XA 1KK2A 3ZQKA 2CDAA 3BOSA 1SU6A 5B2ZA 1JJ7A 2VNHA 5LNK6 1H6AA 1W52X 1R8JA 4JLAA 3U4HA 4U63A 4KHPB 2R96A 1FC0A 1P0CA 2JBAA 3RUFA 4WBNF 1X14A 2HOQA 3NFYA 2HSEA 4X7DA 1E77A 1EXMA 3BMCA 2IQIA 2VDUE 4MA0A 4UMDA 2WP0A 2XB9A 3WLKX 1NJFA 1XQYA 1E7MA 4BQFA 4KBGA 2L69A 3H0KA 4EHBA 5LWQA 1KEZA 2AYYA 3BWYA 1FJ2A 1YV9A 4M8NE 4BOYA 3TUZC 4DOMA 3SY8A 3WXMA 1E99A 3V2HA 1YAJA 3EVFA 4JR2A 2IS2A 5L45A 1U9ZA 2MSLA 2YNMD 3VX3A 4QUKA 1JKMA 3B38A 1MO6A 2O0JA 5EFOA 4O2BB 3EJ6A 5MN4A 2VTBB 2VTBA 2F1KA 4XE5A 1UDRA 1Y6ZA 2QROA 1I2BA 3EZYA 4Y1RB 1U02A 5LA6A 4DLWA 3C39A 1OX4A 1Q44A 2VXCA 3FVRA 4N0PA 1QKIA 1OX4B 4UEJA 4XB6B 5DBHX 1CYEA 1GGVA 3V8QA 1H8EA 5FOUA 3K0FA 4KXWA 1M2NA 4EQ6A 5B7QA 3CCSB 4JLVA 3PEEA 2I33A 1EE1A 3DT9A 3QKWA 2NVUA 4P4TA 4ZVPA 4HATA 1AF7A 1U2GC 3SJZA 1SCJA 4N40A 4BNMA 3KL9A 1EFRD 1G66A 3DVRX 4GP6A 5KNDA 3IOEA 5T3YA 1Z16A 4C6TA 1QKKA 1X7YB 3BERA 3M6LA 4ID9A 4W4TA 4WVLA 4Z1MD 4W5NA 1RPAA 2HU8A 2ZUVA 2UZ0A 3ZZMA 2WV9A 1Y6RA 5CB6A 4NENA 1C3EA 2WFMA 4LY9A 1PD0A 5IVDA 1Y3AA 3ZDAA 5E8JA 1XXHA 5ICEA 4OHFA 4KVFA 4MW5A 4MPDA 2WBLC 5BXQC 1SQ0A 1TMYA 2PMWB 4LRTB 4II3A 5JNSA 3EC7A 1TZKA 4LAFA 4XIFA 5F5XA 3MLEA 1K68A 3CUYA 1DT5A 1KC8D 4L4UA 3NHSA 4L75A 3HY6A 4OP1A 4NE2A 1Q50A 1WS6A 4FONA 4MWGA 2VPTA 3A11A 5LBTA 4Y2UA 3KEOA 2JFWA 2VEDA 3FIJA 4KIFA 4Q3OA 3V1YA 1K73D 5DIZA 1C1XB 2A5LA 3OCVA 3UMRA 2ZS7A 3CEMA 4Z49A 3Q7RA 1I6KA 1Z4OA 2PXXA 3NVKI 4ZT2A 2BI4A 3KJNA 4PGOA 1SBNE 5T6BA 4C7OA 3WDSA 2SICE 4AZWA 8MHTA 4ADSG 4D7AA 1I7SB 4A0QA 3GOQA 4J75A 1PVDA 4U9IS 9LDBA 4RZHA 2ID8A 1UT5A 3RS0A 1JIJA 1QRDA 1LWNA 1RC0A 1QJ4A 4I46A 1UANA 1ZJ6A 2OCLA 2Q1TA 2PYDA 2F3UA 5EP4A 5COQA 1TW2A 4Z4EA 3C98A 1NXTA 3U40A 1NVVQ 3QU9A 1FEZA 4LX0A 1RHRA 4MS1B 2JD0A 4RPJA 1T0IA 1YZKA 3BUSA 3JD2A 3U9SA 4NYJQ 1BYIA 4KE8A 3UCXA 1B0AA 3R5XA 1WVGA 2GI4A 3DFFA 1R2QA 3AWIA 3SSOA 3WGOA 1T2EA 5FP0A 1X70A 3GOHA 3PUKA 4N6NA 1G8SA 4Q0MA 1C7JA 5DM0A 5H80A 2DPYA 1BQ3A 1IY0A 1VQ1A 1Z8NA 2VJAA 3OTOB 3BT7A 4JLNA 3IQDB 4D82A 3EOBI 4L5YA 1LFDB 4K9SA 5K0CA 5C53B 5IN5A 1ACLA 2I1VB 2R00C 3H87A 4OJMX 3PUHA 3I61A 2WYVA 4HNTA 4ZTZB 2IBTA 2J67A 3UXHA 1NURA 2X0EA 3AEZA 3ER8A 1E4EA 1HQKA 3BXHA 1LD3A 4JBYA 2ZIXB 4MKIA 3K6SA 1DL5A 4NBWA 2FRDC 4KAXA 3HN7A 3PC8C 1N0HA 2AMJA 1V0EA 2Y3IA 2RGCA 3NXKA 2DR2A 5F2EA 3D0OA 5L6LB 4M7RA 1Q81D 3D7RA 2W2NA 2QRMA 3E03A 1VL8A 4BWVA 3HRHA 4LHWA 4NBUA 1RLIA 1DEHA 1ZM4A 1JPUA 3U5ZB 3EVTA 1NQVA 1FP2A 1GNSA 1P1KA 5CDGA 3V00A 2GCEA 1RM5A 2DECA 4B3GA 1BS1A 3GWZA 1EFKA 4G0PA 3L41A 1SHZA 1W30A 5I7AA 2R6DA 4ER3A 5J1SB 1QR2A 3TEMA 2QM3A 5HXAA 5IBPA 1IY9A 2N42A 5U4QA 2KLBA 4BNFA 3L7IA 3K8YA 2CJFA 3K0EA 1XEFA 1ZGCA 2X9VA 4LBVA 5AVOA 1ZCAA 3EEQA 2BFMA 2QLLA 4P3YA 1VLJA 3I4LA 1YRHA 2BJVA 2IHBA 1T9KA 5D5PA 2OCKA 1JDBC 1V16B 5C1IA 1YMVA 1ETHA 1RXYA 3KPVA 5ED4A 2DG2A 2D0OB 1Q0LA 2A6PA 4K9PA 1DINA 3O9VA 1GHTA 3IEKA 3KPJA 1MOQA 3HWSA 4JJ8A 4WLEA 3TO5A 1DQSA 1N25A 4GNKA 4PO9A 4M1QA 3L04A 5FI3A 3SEZA 3T0IA 3JZDA 3QVOA 4I5DA 2DY0A 3RUAA 2BLNA 4PPYA 3IXMA 4Q1EA 4B73A 5KWEA 4ZVTA 4BFZA 1RI3A 3TW6A 5LB2A 4Z0HO 3WLMA 2FF7A 3ZE7A 1K8YB 1MCZA 5AW1A 1QF7A 1JG7A 4I2VA 3P5SA 3WWDA 1P2SA 4BJ3A 3QXSA 3BIJA 1RAAA 1N7IA 1TA9A 5EHQA 1SKUA 1XDWA 3KYIB 1XMQB 2VG8A 3MWDB 1Z4NA 3RY8A 4OPVA 3W04A 2H06A 4DK1A 2G7ZA 1U3TA 2PGAA 3DHNA 3LPMA 1QF9A 1THZA 2X58A 3KKQA 1Y9EA 2FN3A 1RRKA 1ZA1A 2ZTSA 3AC0A 1P5ZB 2PBLA 3OZBA 4GOKA 4MP6A 2VK2A 4M60A 1QHHB 2BYTA 1CQZA 1BQEA 1DAHA 1Y4SA 4GOND 2BTEA 2UVDA 4UARA 1K2WA 1JHPA 1ZC4A 2NZWA 2UYYA 3ET4A 3GPLA 1WUJS 3ZQJA 4ABTA 1HFKA 1KI8A 1RXUA 1TKAA 1XJ5A 3KZVA 3R6GA 2ZTMA 3K9WA 4U0JA 4A73A 1REQB 1R15A 4M6WB 4DQKA 2B98A 2HJGA 4JLPA 4X7EA 2ZJOA 4HRXA 2C2GA 4TRRA 2HSGA 1IJKA 4UUMA 1I1OA 2P6UA 2W6CX 4GI7A 2YYZA 4QU8A 3CC2B 3LY9A 1U8TA 3RHFA 3UUWA 1KMMA 2KB0A 3EUFA 2N1MA 4GKVA 4YWHA 1VMEA 3TCKA 5GZ6A 5LYJB 5HHTA 4BRZA 3SQXA 4G81A 2EGGA 3PA2A 1OI3A 3WZ2A 1HDCA 1T5IA 3QH4A 5F9FA 1XTQA 5HIJA 2ZBUA 1M34B 2ZI3A 2C7PA 1N08A 2ET6A 2QX4A 3AY7A 1Q6YA 4PYNA 2CD7A 2F1MA 2YUIA 3FCYA 3J7TA 3AETB 1AXEA 2Q0SA 2VDMB 3RYTC 4JQCA 2W2MA 4FCTA 4PZUA 1EESA 1J33A 1ZKMA 1RVDA 4WESA 1QWOA