4QFMA

The structure of aif2gamma subunit d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of aIF2gamma subunit D152A from archaeon Sulfolobus solfataricus complexed with GDPCP
rcsb
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
total genus 109
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qfmA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qfmA01
2CK3A 2VPPA 1YJ5A 3N2EA 3VO1A 3W3AA 4XWAA 3MRSA 2GPJA 1IM2A 1ONBA 4GMXA 3B82A 2NZJA 2E1RA 1NBMD 4YXWA 4C0QC 4B32A 5AJVB 2PJZA 3LV8A 4HB3A 1OH6A 2QTLA 5G41A 1II8A 1DDGA 5FUYA 5FBLB 3EPJA 2BVNA 1B2RA 3VR2A 6Q21A 4CEJA 1OE0A 3RS0A 5J4YA 2QT1A 3CCJB 2QRNA 1OHHD 1KI4A 2VEDA 5ELXA 2FGKA 1V5WA 4DB4A 1AJEA 2F7SA 5EMNA 3WRYC 2C95A 1E6CA 721PA 2PLRA 5KNCA 2FU5C 2JEOA 3AF0A 1CBUA 1P2UA 3U44A 1Z08A 3TK1A 1UKEA 4AK9A 4LHYA 3BERA 4EKDA 1ESMA 1Z2CA 4TTPA 1FX0A 4HAWA 1D1NA 3RRNA 1I2MA 4Q48A 1UEJA 3QOFA 2O8FA 1IHUA 4P33A 1RPZA 4DVGA 4KVAA 4LWZA 4Q47A 1Z47A 4DLSA 3DMNA 2OHFA 2OV2A 3PQCA 1ODFA 3OEED 1E9BA 1E2DA 1PUJA 2IW3A 1M7GA 5DISB 1QHXA 5H5JA 1WA5A 3VO2A 4CW7A 1TEXA 4AYWA 3THWA 4EAQA 4D0LB 3U6KA 2DERA 4HDCA 4EQ6B 2ZSBA 1LF0A 3K70D 1Z6TA 3SN6A 3TMKA 2D7DA 5GV7A 2GVZC 3IHWA 1F2UA 5JCZA 1KO7A 1KJZA 2YWHA 1ZD8A 5D3MA 2X19A 2DR3A 2A78A 1M90D 2QTHA 1W49A 4X8OA 5FPSA 1ZINA 3VU9B 4PZZA 2GQFA 3RS3A 4BUJA 3GLIE 4MA4A 4E5UA 3EC1A 2D06A 3CNOA 2IHYA 4HUQB 3WYAA 1NJID 2YYZA 1DS6A 3TJZA 4AKIA 3T5GA 4JSTA 3W2IA 2FZ4A 3QBVA 4HLUC 3TBKA 4EPXA 1XPRA 1JJVA 2D7CA 3GJ6A 4NDZA 4LDJA 2G3YA 3ZIAD 1NN0A 4RCYA 1G7RA 1Z0AA 2A5FA 4C7OA 4M1SA 2W6IA 2XJ4A 1XCMA 2EIXA 3PEYA 2OBNA 2P5TB 4IVPA 2WVJA 4U00A 2J87A 2NO9A 3AVPA 2WBLC 4LK2A 4C0KA 1T91A 1VMAA 1E2MA 4QL3A 5AUPB 2ZSAA 2IBMA 3ZD7A 4OK3A 3TIFA 5HKKD 3A6PC 5DN6D 3VKHA 4DSOA 1JI0A 1X1RA 4BGDA 1GITA 3RS2A 2QMHA 4ZIRB 1OGJA 3WP1B 1H8EA 5C4GB 3MAAC 2WJJA 3TUIC 2WPDD 5B64A 3QKTA 2DBYA 4M1WA 4Q4AA 3B5JA 4Q1AA 1NJFA 4RJLA 1MABB 4D2IA 3THYB 4NBSA 1E2PA 3G5UA 2ZE6A 3QXXA 1HE8B 4A0FA 1G9XA 3I3SR 3IIJA 4GL2A 2JIZD 3CZQA 4B71A 4KFSA 2BBSA 3GPLA 3GP8A 4WAUA 4ZI2A 3IIKA 1BO6A 4WW0A 4NYMQ 1FNNA 3DMDA 1I4LD 3DM5A 5A5GA 4TYPA 4MGYR 2C9OA 1GFIA 3FMPB 4QHTA 4LC1A 1F3OA 3X1ZA 1DE0A 1GOTA 1TUIA 3BB1A 4KYUA 4C2UA 1KSFX 1N6PA 1J7KA 2XB2A 2BEKA 1G8GA 1OKKD 2PEYA 1TX4B 2OSBA 4G5QA 2OO7A 2QDXA 1ZBDA 2IYYA 4ARZA 2PT5A 1N5LA 1R0ZA 2LKCA 1VYVA 3U3OA 1GJRA 3E1YE 4MRNA 2WSSA 4EFNA 1VQKB 3RVBA 4BFTA 5TXGA 1S9HA 4JL8A 4UJ3A 3GLHE 1L2TA 1KSGA 1K9MD 4PO1A 4B3BA 4AI6A 3QPVA 1GWNA 4HLUA 2FFQA 3CC7B 3OF5A 1UADA 1W2HA 2ODEA 5EQTA 1W36D 1XMVA 4II7A 1M8PA 4N1AA 2GCOB 4D6PA 1B23P 4AWXA 4DSUA 4YALA 2ZRIA 4QGFA 2CL7X 2A7QA 3O8BA 5LB4A 3AGPA 1AKYA 1CXZA 4N3NA 3CH5A 3GFOA 2C78A 1JPJA 2DFLA 2ZRGA 4JLDA 4KHZA 3Q9LA 3ZZTA 3G0HA 2XOKD 4BLQA 1Z6XA 1YR7A 2D62A 4KXFB 4GDFA 4BFYA 3OFND 1U9IA 4HB2A 1OT3A 1XP8A 2WWYA 2P65A 4OKSA 1Z5ZA 2ZIAA 1ZIPA 4C2TA 1E2QA 3W2GA 1II8B 3K9NA 4PQFA 2QN6A 3WP0A 4EDHA 1ZUIA 1OFUX 4IOKA 4CEJB 2IYUA 3RRZA 3Q3JB 2QPTA 3PFIA 3FB4A 4M1OA 2ZYTX 5DO9A 3TVDA 4LYFA 4MDFA 5KO2A 3ZVNA 3OE7A 4EFLA 4IW3B 2IF0A 4G1UC 4TMTA 4MYCA 2F1RA 2BM1A 3IO5A 3R8FA 1ZCBA 4FXPA 4NKRA 1NMXA 2ODWA 3U44B 3IGFA 2PL3A 4KJZA 1HH4A 5C1BA 1H8HA 1FX0B 4MGKR 2O8BA 4PSVA 1RVDA 3I8XA 5EP1A 3FOZA 2W6JD 3TW4A 2EVWX 2J9RA 3MUFA 2GEUA 4IXNA 5GVRA 2CDNA 1GL6A 2LCFA 4X8MA 4US2R 3I55B 1VHLA 3BBPA 2PJRA 2QT0A 1E9SA 1TQ2A 2FSGA 2ODNA 1JJ7A 3EZ9A 1JR6A 4P32A 3T1TA 3THWB 5BW8A 1KI1A 2WWWA 2ZETA 1E63A 2E9SA 3JZAA 1KZ7B 4GNKA 1E1RA 2DWQA 3CRVA 1T3LA 4ZDWA 3TSOA 4KVGA 3LD9A 1F2UB 4A4DA 2ZS9A 3F8TA 5D3MB 4DCVA 2ZYWX 2XSZA 4ZKEA 4V0LA 3B2EA 2WM9B 3MJHA 4Z1MD 1VQ9B 1ZNYA 3H84A 5KOYA 1FQKA 2NO6A 4WOPA 1VPLA 2B7BA 4YDSA 4YLGA 1OYWA 3GD7A 5DLQC 3O47A 2O8DA 3EZ7A 4OI2A 3LO8A 4BASA 1T5LA 1NBME 3BE4A 3RSOA 1GKYA 4C7OB 1BYUA 3CUEF 4P31A 3D3QA 4HYYA 3IDQA 5GADl 3R7WA 4BRWA 1ETUA 1M1KD 3BS4A 4IHQA 1KC8D 2XZLA 1QZXA 4L9WA 1R4AA 2P2LA 2FSFA 1IN8A 2JJ2D 4ABYA 3ZQJA 4PO9A 4BEBA 1OFHA 3IPXA 2ZS8A 3SBDA 3GJ8A 4JLOA 1G20E 1XBTA 1KKMA 4LV6A 2RGBA 2VZLA 1U94A 1JEDA 4Q4AB 3QXCA 5FR1A 2RHDA 1LY1A 2JDID 4QG7A 1HY3A 4OHXA 1S1CA 2I1VB 3P27A 1DO2A 2GJ9A 2IXFA 2YOHA 4B2IA 1NP6A 2W2TA 2V7QD 4A8JC 4HEJA 1ZNXA 1ZMXA 3NKVA 2ZRCA 2R65A 3L43A 4D0GA 1E0KA 4XD7D 1E79D 1AS3A 2J1LA 1FL9A 1CKEA 2OTLB 1R10A 3K70C 1D2EA 1K73D 3C7KA 4B6FA 3QXSA 2YHSA 3K0CC 3DOEA 1PVOA 1TVCA 4P4SA 1BYIA 4DEXA 3DKVA 2WKRA 4OQMA 3RABA 4KLZA 4Q02A 4BRUA 1OIVA 1WQ1R 3CRW1 2AD1A 5JRJA 4KV9A 2OBMA 5TR9A 1LTQA 2PBRA 3QEOA 1SM4A 1JXMA 4B6EA 3SFZA 1QFZA 4F38A 4ARZB 1E0JA 3LAWA 3LVRE 1CU1A 1Z8FA 5EXTA 5CIQA 4O2LA 3A4LA 4WXPA 4CF7A 3A58B 3CR7A 1KHTA 3CPJB 3HU3A 4B44A 4FMDB 2FFHA 1KK1A 1AN0A 3A37A 4HI0E 2JLRA 1NVXQ 2RH5A 2R2AA 1ZUNB 2WWIA 1YU9A 4UNQA 2REXB 4X8LA 2JLVA 4DZZA 1N6NA 4UAJA 3FKSA 3HP1A 3Q72A 3P26A 4G1VA 3ASZA 2FMXA 1OHHA 1YI2B 4CVNA 1X1SA 2ZE8A 3A1TA 2IS2A 2KBFA 1ZYUA 3KKNA 3WYGA 3P1JA 1J9ZA 1FNCA 1CNFA 1W4CA 4TTRA 1IXRC 1SVWA 2F43A 2HXSA 3GJ4A 3SQXA 2G0TA 3K53A 3Q5EA 4YC7A 1E9DA 4RZ3A 2G0NA 2GA8A 2QI9C 621PA 2VBCA 2P0EA 4OYHA 1QHHA 4CYMA 1FRQA 4W5WA 4XJXA 2YJTD 3W5UA 3SI7A 2IHBA 2AL7A 1UBCA 2FEOA 2P3SA 3B1YA 3BB3A 1ZNWA 3KXIA 1N8RD 2BBWA 1MRSA 1TAGA 3L2OB 2AR7A 4TLCA 3PXGA 3UXMA 3VHLB 4A1FA 4DCTA 2HLDD 4KFRA 2RC5A 3PUVA 3W8NA 3OEEA 4Q1EA 2ODBA 1COWD 3I72A 3EA5A 1A2BA 3ZQ6A 2ONJA 2FZLA 4G1BA 4TYWA 1LB1B 4RD6A 1W35A 5JI2E 1E99A 1O3YA 4H9GA 1Z0KA 1M7BA 2ORVA 2QTZA 3K0CA 1KDOA 1TF5A 2KB0A 4GPTA 1QFYA 2JASA 3IQXA 4OQNA 4MYHA 2O8BB 3CO5A 4G5SA 4DLZA 1QUFA 3AUXA 3LX8A 3BXZA 4EPTA 3W6PA 1NVVQ 4FMBB 1XMIA 2DHRA 521PA 4XVQA 3IILA 1EFRA 1KDPA 3LVQE 4Z8XA 3CCLB 4DEYA 2JLYA 4DLRA 4EPYA 4QGAA 4DDWA 3ZIAA 4LUCA 1W36C 5A0FA 5FL7A 2CVFA 1JQLB 2FFAA 2Z6VA 4G5OA 1QVGB 3FMIA 5FI0B 3PV0A 3U7HB 4ESVA 4W7SA 4LY6A 4K81B 1PUIA 3ZC3A 2QE7D 3QJYA 3Q7QA 2WWFA 4OHWA 3SNHA 4PPFA 1TUEA 3ZZ0A 1FTNA 1ZUHA 3NC1C 4HAVA 4NCKA 3G71B 5HKKA 2F1JA 3IHLA 3FYHA 5DN6A 4C0LA 4HATA 3TQCA 2QP3A 2ZJZA 5CB8A 5EE9A 2KI5A 2YC2C 4D4LA 4EJSA 3OAAD 3F3YA 2ZRHA 4AF7A 3PR1A 1XZQA 3A4NA 2O8DB 2Q3FA 3MJRA 1JQJC 5HCNA 3W34A 1Y63A 3ZGXA 2YWEA 4BEJA 1NG9A 1KY2A 1N25A 2BWJA 3VQTA 1QG2A 2WAYA 1DEKA 3R7WB 5HE9A 1HT1E 1QUEA 3CRQA 3L0OA 4TQ9A 3RWOA 3PCRB 2OESA 2EFGA 5FL3A 4B3XA 3FE2A 4C3ZA 1FDRA 2KBEA 3ZS9A 4KCGA 5DYGA 5L3VA 1RYFA 5FTKA 2AWOA 4U02A 4DQKA 2CE7A 3VAAA 4W9MC 2A5DA 1W46A 3GLGA 1NVUQ 4PQYA 2WJGA 5E95A 2XJ9A 1L4YA 3KXKA 5JLJA 2ZRDA 1R7RA 2QMUA 3ICQB 1YZKA 2DCUA 1A1VA 1YZTA 5BN4A 4PC7A 4JKYA 3OEHD 4DLTA 4B3CA 3NDBB 1KAGA 3AVYA 2FPKA 4A82A 4P6VF 2VP5A 3QFCA 1M2OB 4DKXA 1II0A 1P2SA 5KDLA 1YZNA 4ESHA 2AFIE 5EE5B 3EZ2A 5HZHA 1EFHA 3Q85A 5JFGA 2IYZA 3EZFA 4P4SB 4C0JA 2CBZA 1TPZA 2XITA 4WVFA 1G8PA 3BFKA 5G3ZA 1HT2E 3ZVLA 2OCBA 3NHAA 4ACAA 1SVSA 1Z29A 1Z07A 2WHXA 2DEUA 4HB0A 1N0WA 2PCLA 3LLUA 5J4VA 3MWKA 4IRUB 1BQEA 4MRPA 1DBSA 1LVGA 1HEIA 1HV8A 2XOKA 1S72B 1QRAA 1I2DA 1W87A 1D9ZA 2G1JA 2QM7A 4YAUA 2AD5A 2FN4A 3HYRA 4AKEA 3OFNA 2F1IA 5EE0A 2RGAA 4U9UA 3LH5A 2G9NA 5FH9A 1GAQA 1OFTA 2IT1A 5KSYA 4B43A 3FDIA 3C4JA 1R5NA 1W2BB 5C4MA 4PGOA 4G5GA 2X1VA 3KQUA 2VP2A 3ND8A 5KDOA 3WNDA 4EH1A 2ORIA 1MOZA 3R9WA 4OQLA 1KDRA 4C0BA 1XEWY 1KI8A 3KJIA 3TGPA 4E09A 2F43B 3W9YA 3DM9B 2ZI9A 5TV2A 2BKEA 3BAFA 2GK7A 2J3EA 1NLYA 4JT4A 2PIAA 4AC9A 1QHHB 3HYTA 5GJVC 2HXYA 1ZM3A 4L16A 3I73A 3T1QA 5EJEA 4RD2A 3WRXC 4L4UA 3RANA 2FOLA 2ZYVX 4L9SA 2O8FB 4V0OA 4ZO4A 3CF0A 2O8EA 3HJNA 5B58C 2RGNC 5FOVA 4Z54A 1GSIA 2EW1A 5DGXA 3NC0C 3C41J 2H17A 2QEQA 4TMXA 4TN1A 4LJ8A 3TR5A 1M7HA 2YZ2A 3FTQA 1JR3D 5J5CA 4ACBA 3E1SA 4IOJA 3K70B 2ECKA 1YJWB 2OXCA 2ZUDA 1OLOA 2VRWA 3OIWA 3QE0A 5CB6A 3CBQA 2NOAA 4YQFA 3I62A 1SXJD 3FFBA 1C4OA 5G53C 1VQ8B 3KUDA 1EFTA 3NWJA 4Z1MA 2BM0A 4GSYA 3KKQA 2QBYA 2JJ8A 2ZAOA 3L0IB 3SS8A 1N6HA 2R6CA 1KMQA 4YHBA 2QM8A 2YC4C 4QJ4A 3ZDQA 3VNVA 3SJBA 2ZPTX 5IDVA 4ZGNB 2P67A 4CGZA 2HCJB 1EX6A 4WZBE 4MRVA 4D4KA 4EFMA 1Q22A 3REFA 1G21E 2OTJB 2XNCA 4JBWA 3T06B 2OAQ1 5EP3A 3W8RA 4Y9UA 4KO8A 1DARA 1E2EA 1GKUB 2V1UA 1G5PA 4QJ3A 3TAHA 3I1FA 4OHVA 4XH9B 3RNLA 2OLKA 1OIXA 1E64A 2J46A 1YE8A 2B8TA 2G1KA 2J0VA 4RY2A 2J7PA 1I4DD 3G82C 3GEHA 4JBXA 4EJSB 4TLAA 2JDIA 1BIFA 3KUCA 1G64A 2NO0A 3CXCB 1NSFA 3D7MA 5AJXA 1TU3A 2V7QA 3LA6A 1E2IA 2K5UA 5E7IA 1TF7A 1N2CE 1U8YA 1XXHE 5KPJA 4XD7A 1E79A 1IXSB 3W3ZB 3FFAA 1GVNB 1CJVC 2ZITA 3JQPA 1D9XA 3QKRA 4OQXA 3VR6A 3D31A 2V54A 3HR7A 2GTPA 1IN5A 4A2WA 4URZR 1SHKA 1W0JD 3BH6A 1PJRA 2VLIA 2NIPA 5FA6A 1AZTA 1M34E 2V6IA 4HAYA 2VP4A 4NE2A 3Q8XB 4F4CA 5J4KA 4JLPA 4WQMA 2GDJA 1J8MF 3KQHA 1KK2A 2X2EA 3GLGB 3CCRB 5JJLA 3RRYA 1YR9A 4ON9A 3QVVA 2ERXA 1KI6A 1UKYA 4M9XA 4MKGA 2VO1A 1ZC4A 5SZIA 3IPYA 4DWJA 2CVHA 4GOJA 5M04A 4KLNA 2RB4A 1GNPA 3FGNA 4Q21A 1EXMA 2P6RA 3AGQA 1XEXA 1IB0A 3QI2A 1VIAA 3OZXA 3FMOB 2W83A 2OILA 1R5BA 1GIAA 2ZVQX 2MSDB 3SYNA 3UIEA 1S96A 4IXMA 5JHHB 1J99A 4I81A 2BSAA 3KTAA 4XTRA 4Z8YA 4QKQA 1W36B 2IYRA 3H0KA 3BB4A 3MFYA 4XOIA 1GNQA 2EQBA 4AYXA 2FPLA 5JWRA 2UKDA 2R6DA 1VYUA 4CRWB 5FPKA 3P4XA 5HCIA 4C43A 2IWHA 2XGJA 1ZAKA 3TUJC 3GLFE 1RRGA 2DFTA 3BK7A 3LRPA 1ELOA 4OJKA 3E20A 5SZJA 4D4MA 1KOFA 3RHFA 2XTMA 1P3JA 2WAXA 2QROA 4PHGA 1F20A 3ZD6A 2G77B 4C0HA 1KI9A 1E62A 2FSIA 4RFVA 3X1DA 1KNQA 3K9GA 1M1YE 4LI0A 4JZKA 3B1WA 5FPTA 4BLOA 1Q81D 1YZQA 1OJLA 1S0UA 4IFBA 1JB1A 5DH9A 3FKQA 3AM1A 4V0ME 1FNMA 1COWA 4XSHA 2XNJA 1EG7A 5JEEA 1AS0A 1P2VA 2GEDA 4GBMA 4M1YA 1KYIA 4UNNA 3VHXA 2JLXA 1CF4A 4YAWA 4QHYA 4D4JA 3HPRA 2VNKA 4N0EA 5CM8B 5JWHA 2SHKA 1N5IA 2ZRJA 3TSWA 2WKPA 1E32A 2PCJA 2OM2A 5FOXA 4AD8A 3C5CA 4M22A 4B73A 5F98A 1G6OA 2VP6A 5EP2A 5JWOA 5L3SA 1XTJA 4DLWA 4JJKA 4B3DA 5H1YA 3L0PA 1QHGA 3NXSA 4ILEA 4IVRA 2O8EB 2IUTA 1T5IA 1SKYE 3BH7A 4FWTA 3BC1A 4TT3D 3OIVA 2FV8A 5FBRB 1FMJA 2FWRA 4DLUA 3UK6A 2VHQA 3LQRA 2WV9A 4JYCA 1WDTA 1D2MA 4ZCIA 2V4ZA 2X3UA 1CR4A 3VMFA 5B57C 5K8TA 1YJNB 1A5TA 4JVSB 1E9CA 2H1LA 1VCIA 2GESA 2WJVA 1NI3A 2QE7A 1F6BA 1FNDA 1VKJA 3IO3A 4Y0AA 5F9HA 2ZTSA 1G1MA 3EC2A 3ZS8A 5FTMA 5DHAA 4B75A 1NNEA 3GLIA 1SVLA 4KODA 4LGMA 3TAUA 3WHLA 1VQLB 2QBYB 5G3YA 3QG1A 3FWYA 4A15A 2QSZA 4A9AA 5F9FA 3C16C 5BQ5A 2ZE5A 4B2PA 4TTQA 4RKEA 3H2YA 3BOSA 1IN7A 2QY9A 3VX4A 4V0MA 5DI9A 5CJPA 2PZGA 2CCKA 4LOAA 4C9BA 5CLQA 3CCEB 1Z0IA 3I92A 2GBLC 4YMSA 2CMKA 3CWQA 1ZW6A 1PV4A 1FQJA 2EFEB 2F6RA 2F9MA 1KD1D 3ETLA 3RYTC 2XTZA 1XTQA 1G7TA 3KB1A 2AFHE 1S9DA 3QF4A 2PX0A 1D5CA 3MWLA 1T8UA 4C4PA 1E2LA 1R6BX 5JMTA 4FI3C 5L8VA 3CWZA 4A2QA 2OG2A 5KSZA 2ZYUX 3VR3A 1AGPA 1QHSA 5EZ6B 1NLFA 2QQ0A 3ZBTA 3AVOA 4NONA 4LV5B 2YOGA 1RKBA 1JPNA 1RE0A 1U0JA 4P4UA 3IBGA 3OEHA 3OZVA 4DHEA 3WBJA 1P9RA 1EP3B 1BKDR 5GJWC 1UDWA 3OJXA 2VSOA 4AIIA 4F93B 3GEIA 1X8KA 2QORA 2A5JA 4FCWA 4Q9KA 3QKRB 1KGDA 2C99A 1G7SA 5EZ5A 2R6HA 4E22A 1TQDA 1FZQA 3CMAB 2YWFA 1EWYA 1OXXK 1AZSC 4LHVA 1EGAA 4PXAA 1IY2A 1ZVQA 2BDTA 3VR5A 1SXJC 1GG2A 3QKSA 1E9FA 4O0MA 1JR3E 2Q6TA 3HU1A 3IUYA 3UG7A 1KI6B 1K6MA 3A36A 3LO5A 4M1KA 2HYDA 4F4JA 2OK8A 2OCYC 1H85A 1XNJA 2BMDA 3ES9A 1SXJE 1ZM2A 2CHQA 3NBFA 4XIGS 2Q21A 1Q3TA 1DAMA 2GNOA 4C0SA 4YDHB 1DAEA 2BMWA 1EWRA 1XEXB 4JJZA 2JCSA 5UKDA 5JSZA 1XD2A 3GLHA 2EYUA 4GZMA 2HDNB 2O0HA 4OI4A 2ZR0A 5HPYB 3ECCA 5LD2C 4WXRA 1WB9A 4XWKA 4NYMR 3OIUA 2DFKB 1E96A 1WBDA 4ZPXA 1R8SA 2H5EA 3C15C 3KTAB 2FH5B 5HXBA 4NYIR 1EX7A 3EIEA 3REGA 1CP2A 1YITB 1DOAA 2GBLA 2GK6A 2CNDA 3F5FA 1SGWA 2IYWA 2ZQ5A 2J0SA 3RS5A 1P5ZB 4QGHA 1W7AA 1U81A 1XPUA 3LVBA 1SZPA 1GM5A 3CRZA 3VR1A 2F55A 5HE8A 4CIDA 3BH0A 4OI0A 1RRPA 2F1HA 2DETA 3AP3A 4Y7CA 2EWVA 2CHGA 1VG8A 3QSYA 4JLNA 3B1XA 2ZUBA 2ZRPA 2GVDC 4WIAA 4BFZA 3QPUA 5KDDA 1KY3A 3EA0A 4PQRA 5H70A 2X77A 1U2RA 2JAQA 2PEZA 1VECA 4FCTA 1UJ2A 4F91B 4HAZA 5IK2A 3WBKA 2ZJOA 1UDXA 2W2XA 3CX7A 3AVTA 4OJQA 1HYQA 4M9SA 4MKIA 4BFSA 2A9KA 2DPXA 2GZAA 1T0HB 4ZGQB 2WJIA 4YMTA 4N0DA 4TYYA 2ZRMA 4NTZA 2BGIA 3HR8A 1IBRA 2BMEA 1YRBA 1W0KD 4M2LA 4BZXA 3RS4A 4LBYA 5FBQB 1MRNA 5KU1A 2GRJA 4NU0A 3W6NA 1RYHA 4DSTA 3G6EB 3QE2A 2OE2A 1XE1A 1P6XA 2YV5A 4B34A 1VDZA 5L3SB 1ZM9A 4EPRA 2IXEA 3A1SA 1W34A 2EFHB 2JLQA 4URYR 3PEVA 1W47A 4Q4LA 5AWFC 5DYIA 3QQ5A 2VP0A 3CPEA 2GAAA 3GJ5A 5TVKA 1C9KA 2CEAA 1UBFA 4OL0A 3K0FA 5DSZA 1JA1A 1TNDA 2QEXB 4OBEA 1TADA 3SBEA 3UWOA 2N42A 1NKTA 4KITB 3U7FB 4IOMA 2NPFA 1U8ZA 4BECA 1W4BA 3GLFB 2CL6X 2XXAA 4FD2A 2VHUA 3T1VA 4Q9HA 1NLZA 3AF2A 2MSCB 3WNBA 4LV8B 3EPKA 1VQOB 1BOFA 1KI3A 3HU2A 4CT4B 3KKMA 1MH1A 2FDCA 3GLIB 3CIOA 1W1WA 1XTKA 1YKSA 3FMFA 4KSBA 3U3KA 2Z4RA 3U3MA 1G7CA 1V43A 3CLVA 4GOXA 3LQQA 2QNRA 4MYTA 5FTJA 3KJHA 4TL7A 1NBMA 1N6IA 1EESA 2OK7A 1VQMB 2A5GA 2BMFA 2NQ2C 4Q1DA 4RD3A 4UXJA 4PC3A 4KFUA 4DLXA 3ND9A 5AR1A 4MH0R 2ANBA 4HZIA 4BLTA 2CHVA 1GAJA 1OB2A 1W0JA 2NTYC 2PZEA 3QF4B 2BMJA 3TE6A 3GQBA 4BLPA 4TL6A 5EUQB 4DSNA 2O0JA 1XB2A 4ZDIA 4NH0A 2LKDA 2GEVA 3AF4A 4M53A 4LHWA 3SQWA 4DLYA 2WJHA 4MGZR 2AXPA 1G5TA 1N0VC 5TMPA 3L8YA 4B74A 1SKYB 2WZQA 1G4AE 2B92A 3D8BA 4W5JA 1MO5A 2VA8A 1E1QD 5EE3A 4AG6A 1OXUA 3AKCA 2BN4A 3W5HA 2XTNA 1J70A 4TMZA 3CR8A 3EXAA 4URVR 4KBGA 1H65A 2VQSA 1VYTA 3AUYA 2G6BA 1G3RA 4L15A 5CM9C 4BWYA 4YMWA 2CL0X 1NG1A 3K1JA 4A8JA 3QXHA 3N70A 1VQ6B 2BF4A 1VQPB 2ZSFA 1JAIA 4HZUA 4D80A 3VKGA 3QKSB 2ZI7A 3DKPA 4Q4HA 1X3SA 4GFDA 2VIIA 3KXLA 5BWMA 3GMTA 1AK2A 4D82A 1KDTA 1N6LA 1TF2A 2PZFA 3VR4A 121PA 1E4VA 2PX3A 1YIJB 4KI0A 3SHWA 2HF9A 2ZI4A 4NHOA 4V0KA 4Q1FA 1Q44A 2IYLD 3AVWA 5H68A 1P7CA 3X1YA 2ZRBA 1XJCA 1N6KA 3QUSA 4MQBA 1G17A 1QBKC 2DWPA 1YZGA 1XD2B 1A4RA 3C5HA 3GLHB 4GI7A 4HLQB 5JSZB 3MWYW 1IJFA 1GRNA 4DDTA 1QVRA 2HUPA 1XMSA 3MSXA 1P61B 4UNPA 3V9PA 3QBTA 2Q3HA 5FBVB 4LJYA 1Q0UA 3CNNA 4RFSA 4M9QA 4UKDA 1BMFD 3TVTA 4FMDF 5F2EA 3A1UA 1VQ4B 3J81k 1DDIA 2VYFA 2ANCA 5IRCD 3U5ZB 2IL1A 3I8SA 3KZ1E 4Q9LA 3OHMA 2HJVA 1AM4D 5CYPA 2X2FA 4H1UA 1PLKA 5TB5A 4NMMA 2EU8A 3UANA 3UKDA 4QM6A 1S1MA 2WOOA 1EP1B 2WPDA 4UJ5A 4E03A 3ZZUA 2E87A 2RGGA 3EG5A 1QGYA 4LPSA 4JLBA 1U90A 4TT3A 3MGCA 3QXJA 4JVMA 4R2IA 2JIZA 2VNJA 3CB4A 2BGJA 4V0NA 1CTQA 3A1VA 4B48A 2I3BA 3THOA 5L3QA 3C8UA 1QGZA 3SDZA 1YJ9B 3P4YA 1E94E 3FPKA 2YINC 4NYJQ 3SHFA 2YKGA 2GKSA 4L5BA 1UF9A 2QAGC 2XZOA 1AIPA 3R20A 5K8LA 2W58A 2GAOA 1XU4A 1Q1EA 3NVAA 2PLFA 1GZSA 1N5JA 4G01B 1TMKA 3CONA 421PA 1P60A 5FBWB 1OKKA 1XEWX 4EPVA 1CS4C 2R6AA 2CXXA 3EW9A 1W4RA 1JJ2B 2AK2A 1HQCA 2ZJYA 5B2ZA 1AS2A 2QP4A 1Z0JA 4GP6A 1VQ7B 3K0FB 1CRQA 4DRZA 4JLAA 2Z83A 2ZU6A 3EPHA 1RJ9A 4OHYA 1P62B 4XVRA 3V00A 1KRHA 2ZU0C 2FFBA 1GUAA 1TQ6A 4B3FX 2WMNB 1MR3F 1G19A 4BFWA 4OI1A 2XXAB 4TLBA 3EWAA 2HJGA 4HLCA 4JS0A 2IYQA 1FW6A 4MDEA 2F3RA 3KFVA 1S4QA 2QMOA 4BLSA 1Z6AA 1SVMA 2C98A 2C8VA 2VNIA 2VTKA 3AP2A 4IDPA 1MKYA 1VCMA 4RD4A 3AB3A 4XSGA 3SE0A 1IXZA 4PZYA 2WIAA 2ZM5A 1IJEA 1S8FA 2RGCA 2RGDA 2QA4B 2KSQA 1CIPA 2ONKA 2TMKA 3AV0B 3EIHA 3JVUA 1W2GA 1NVWQ 5E7JA 2IUSA 4LBVA 4O2RA 3K9HA 5FOUA 4NCJA 5AN9A 3PUWA 5E4FA 2XNSA 2QAJA 1IN4A 2VF8A 2GHIA 2VSXA 1QG4A 2OCPA 1CR1A 1M6NA 4QRHA 4PR0A 1H42A 3EAQA 4Q9IA 4MKFA 1NMZA 1XF9A 1JBKA 1HURA 2R6GA 3NEJA 4XWOA 3IQWA 5JBQA 1VG0B 1UMKA 3MCAA 1Z22A 1GNRA 2ZSDA 1R0WA 2VF7A 1DG3A 5B30A 3S1AA 4M1MA 2QAGA 3TQFA 1GDDA 2DYKA 1IQPA 1HQYE 2V55B 3CCVB 4A6XA 1ZCAA 4PHHA 1G8YA 4Q7KA 1P9WA 1QX4A 4URWR 5AUNB 1ZM7A 2W6JA 2FPMA 4NCHA 3FHOA 3PG5A 5DI3A 4FK8A 5KSOA 4U5XA 4TLDA 8OHMA 4KAXA 4QHSA 1N3BA 4HAXA 4PAMA 3CF6R 4A8JB 2C77A 4W5HA 3WMFA 4DCSA 1LF5A 4AKHA 4HZUB 4Q4HB 1Z28A 2JJ1D 4LBWA 1XMJA 4IOLA 1SQ5A 4B76A 3NH9A 2BEJA 1KZGB 3CX6A 2GXQA 4G0NA 2QRZA 3QF7A 3HPQA 5DE3A 3MD0A 3SC3A 4Q5IA 1TU4A 1AQUA 2OCAA 1T0JB 2QSYA 5GJBA 1U0HC 4Q4JA 2Z0MA 3PVSA 2PT7A 4TWZA 3CC4B 2RCNA 2XNDD 3RLFA 1KK0A 1G16A 2R9VA 3ZH9B 3DZDA 3ZVRA 2UZIR 4QNMA 4M4SA 5KPDA 4HSEA 1KIMA 1CNEA 3T5DA 1ZC3A 2D3WA 1E9EA 1F2TA 2XB4A 3L82B 1WRBA 5SZHB 5KUTA 1OF1A 5JZVA 3AVVA 1DELA 2ZUCA 1HTWA 3EZ6A 5JS8A 3LWNA 2ZRKA 4CZ2A 5GV8A 4QM7A 4KBFA 4A0HA 3U4QA 1KSJA 2IEZA 4RFSB 3EPLA 2CLCX 4FINA 1LNZA 2J0UA 2Q9BA 2IF2A 1QFJA 1KJWA 1XCPA 4LC0A 2WJYA 3JQRA 5EP4A 3EASA 4DCUA 5J4LA 2IEYA 4NZYA 1NF3A 1D2NA 5DHFA 4RD1A 1DAKA 4EUNA 4HE5A 1W0KA 4B2LA 3JZMA 1WCV1 3ZJYA 1CQXA 1CJTC 2RGXA 1LW7A 1SHZA 4I1SA 2JJ2A 2WOJA 3CCUB 3R8CA 4GRAA 2V9PA 3E5HA 3TLXA 3A1WA 1ZNZA 1ZD1A 1VG9B 2BPOA 1VQNB 4JKIA 1ZRHA 4TZ6A 4QOSA 1GTVA 4FMCF 4V02A 1I4TD 4Q7MB 4BE7B 3AH8A 3LXRA 1NDHA 2B8WA 2FX3A 2R6FA 4TMWA 1C1YA 3QNUA 4BFUA 3PUZA 4HDQB 3OIYA 2W00A 1G3QA 1GKIA 4TSFD 1HUQA 4I1VA 2IK8A 1XJ0A 1YR6A 4JLVA 3NEYA 1YHNA 2RGNA 5L3QB 4NPHA 1XPOA 1T6NA 3KKPA 1FUUA 3HDTA 4KFTA 4F92B 2JLZA 2C9YA 3TKLA 2GJKA 5KNBA 4JIMA 4RZUA 3LBIA 3IIMA 1Y3AA 2PMKA 4Q9JA 5BN5A 2WTUA 4DUGD 1RC8A 3L8ZA 4AKGA 3DOFA 4UNRA 5FTNA 1Q1ZA 4B33A 5C18A 3SZRA 1RZ3A 2AWNA 2C5LA 4TMVA 4YAFA 1CLUA 1GP2A 2YVUA 1RJ9B 2KJQA 3QFRA 1L8QA 1SKQA 3ZYCA 2JLSA 4UXIA 3FKSD 1UEIA 5P21A 3SEAA 4M8NE 1Q82D 1E2JA 3GEEA 2RKOA 2MMCA 3E70C 4IDHA 2IX3A 3CMEB 3RDPA 2C9CA 5HZKA 2BHRA 3K8YA 3KX2A 3IEVA 3UMRA 1KO8A 4QBIA 4NCNA 4R2HA 2R62A 2ZRFA 5CDFE 2NO1A 4AF6A 3B6EA 1AA9A 1DVRA 3RS7A 3QG5A 4BFVA 5GVSA 4HAUA 1OH5A 1GO2A 2NZ8A 4J0QA 3QKUA 1XCGB 2C04A 3EARA 4ERNA 2Z5FA 2QQEA 2R44A 4D26A 4A92A 1KAOA 3FHTA 1YVDA 3T15A 1E1QA 2ZEJA 3VFDA 2ORWA 3V4FA 1CR2A 1KSHA 1OXVA 2ZJ5A 4HLDA 1XXHA 5AJWA 2HLDA 4GP7A 4E07A 1OIWA 1SVOA 5CLLA 4DDVA 3WNCA 1E0SA 5D3QA 3D6TB 4EPWA 1NMYA 3AVUA 2H16A 1Z6YA 3U60B 4FCVA 1NIJA 2BBOA 3H4MA 1EFUA 4RD0A 1BX1A 3RC3A 1S3GA 2VL7A 3KDSE 1K8AD 3T35A 3CCMB 3T1OA 3TW8B 3QENA 1OV4A 2P6NA 1P73A 2YNMA 3GJ0A 3KFXA 2NO7A 3S1AB 1TQ4A 2QAGB 2JLWA 1GR1A 1YRAA 4HE6A 2YOFA 3PUXA 4DB2A 1EFRD 4KU4A 5JRZA 3W5IA 1NY6A 4LBZA 3IEUA 3LDAA 1WBBA 2ZR9A 1GRRA 5DI3B 4Q7LA 4ZDJA 4PC6A 2QGZA 1IY0A 2H57A 3TRFA 2AHOA 5FL7D 2ZI3A 4MITA 4DC9A 2DY1A 5AJZA 1P2TA 5H8WA 2H8KA 2D74A 3LW7A 3FVQA 2IS1A 1CJMA 2AKAB 3EWSA 2VHJA 1D8TA 1BMFA 2GETA 2QL6A 4IVQA 4JL6A 3O8DA 4JLMA 4JSYA 1Q57A 2ZSEA 1DADA 5IHPA 5CDFA 1CR0A 2EYQA 3GLFA 1BX0A 2BOVA 3B9QA 5J40A 4YMVA 1FUKA 4ZCLA 1KI2A 1U9IC 2GF0A 2R8RA 4PAQA 1E2HA 1XRJA 4Q4JB 3N5CA 1Z0DA 1XX6A 3MG9A 1Z06A 4LJ6A 1G3MA 2O52A 3F0TA 2ATVA 3LY5A 1F2TB 2OUKA 2B21A 2CE2X 4FN5A 2EWWA 3NBYC 3OAAA 1OH7A 4CEIA 1GRQA 3I5YA 3V76A 3MWJA 3VTKA 3O8RA 4LJAA 1E69A 3U4QB 1GAWA 1W4AA 3U61B 1K8RA 1A2KC 1DAIA 5FPYA 2CRVA 1IAQA 2J0UB 3B7GA 4Y9RA 5LBIA 4U7DA 1UKZA 1MT0A 4NYIQ 2AN9A 1CEEA 1KKLA 5TARA 1F5NA 1XEFA 2UVQA 4QJ5A 1UAAA 2J45A 2OXRA 1CULC 3X1XA 1FP6A 1QGAA 1P75A 2G83A 2N46A 4NP6A 2JATA 4UXHA 4Q18A 3KL4A 3X1WA 1QDEA 1ZIOA 1QVFB 3DZ8A 5IF9A 2FA9A 1Z83A 3CF2A 2IUUA 3SR0A 1J90A 2VYQA 1DTSA 1VQ5B 1E4YA 3W90A 4FW9A 1IOZA 4DBLC 5HTKA 3LXXA 1E0AA 3KJEA 3P20A 2RC6A 5K8IA 3W6OA 4S35A 3I56B 2V3CC 1LV7A 5JEDA 1OPXA 2WWXA 1O87A 4LJ5A 4OQFA 4GZLA 4IFEA 4OK6A 3ADDA 3QFSA 1ESNA 2OEPA 5FUVA 1XD8A 3W2HA 2B6HA 4C0AC 4MKHA 3TR0A 4AG5A 1VCOA 4TLEA 4PFSA 2JA1A 1KNXA 1ZU5A 1G8FA 4RSGA 1ANKA 4R71A 4ZCMA 2HCBA 4BLRA 5AUOB 1Q7YD 5JJIA 4Q01A 4A0GA 2GJ8A 2QTFA 5FUXA 1GL7A 1G41A 3GFPA 2HEIA 4PANA 4RZXA 1WF3A 2RGEA 1GILA 1L7VC 2GWHA 2ATXA 2ZVPX 4PHTA 2IYVA 4RCZA 3LNCA 4V03A 1PLLA 5F3WB 5FUWA 2W0SA 3U7EB 5J4HA 3R9XA 4Q66C 1UPTA 4DIEA 1FNBA 1QVAA 3K09C 1R8QA 2VH5R 1E9RA 5JI3E 4YMUA 2OZEA 3B13B 2RAPA 3JVVA 1JB9A 4XTCS 5EXSA 4A6PA 1A82A 4QBFA 1E98A 1NIPA 3UATA 5IT5A 2QG6A 5GJCA 1UFQA 4CEHA 1GL9B 2FEMA 2BCGY 2D2FA 2V8OA 4MYUA 4ASUD 3UG6A 1A7JA 3AKDA 1Z63A 1TEVA 3ZLJA 3QEJA 1Z6GA 1ZU4A 1K5GA 1OXSC 3OZWA 1XXHB 2OFWA 2VP9A 4US1R 4TQAA 1II9A 3Q7PA 1SULA 4PC2A 1NKSA 4FWIB 5DIFA 4CDGA 4JMPA 2OT3B 5E7MA 4YONB 5AK0A 3SJZA 2FNAA 1D6JA 1ZP6A 3BRWD 2FG5A 1MV5A 4IDNA 2HT6A 3LFUA 1FTSA 4O25A 2JJ1A 4R9UC 2WKQA 3SYLA 1KO5A 2EFCB 221PA 2AX4A 2ZREA 1JR3A 4R7ZA 3GJ3A 4IJMA 5EXXA 2VSFA 4IDOA 1LFDB 3BD9A 2DB3A 1TL7C 2ZRAA 5CJ2A 1MO6A 1SXJA 3AKEA 1U0LA 1J2JA 2F9LA 3ADKA 2XNDA 2FGJA 1RW4A 4PPNA 3PJRA 3JQQA 2CJWA 3M0EA 2OFOA 2A30A 4KSCA 4BZQA 1FPMA 2ZI6A 3I5XA 3K0EA 2RHMA 2OBLA 3K9LA 3ZVMA 2UZ3A 4I1OA 3T61A 4M0LA 4PPGA 2J5XA 2WMOB 4NCIA 2XEXA 4GMDA 5C46F 5KNDA 3B78A 1JALA 1G4UR 2DFNA 2MMGA 2GF9A 2NGRA 5FFMA 4TZ0A 4KYIB 3DDCA 1PLJA 4UQOA 2GCNA 5KHOC 4JLJA 4MUAA 1GVHA 2PMDA 2O8CA 4DT1A 3K09A 3FPAA 1MO3A 1WXQA 3MLEA 2CNWD 4A0RA 4LJ7A 1UBGA 2J7PD 4BZPA 2ZS7A 4ZI3A 1K5DA 1E2FA 2QENA 4B35A 2I4IA 2GILA 3W5JA 3ADCA 2CK3D 3CPHA 2FF7A 1IONA 1OSNA 1OW3B 1YHQB 1T3HA 3NTUA 4L8GA 4YXWD 4CEIB 3I4LA 2FE4A 1R5OA 4K8OA 2VHCA 3W2EA 1RRCA 3B1ZA 4IEEA 4WBSA 2H7VA 4QBGB 4PSAA 4DJTA 2O0KA 3B8HA 2IXGA 2ZAMA 1SVIA 4ZKDA 3NBZC 4QBHA 4TSFA 1TLLA 2A3RA 2Q0HA 3SU8A 5AUQA 2HMAA 1F60A 1U8AA 4AURA 4PTLA 3V4RA 1Q1BA 2REOA 4TYQA 3PUYA 4PAOA 3PITA 3HWSA 4IEIA 1DPFA 4ITRC 4JVNA 3CKLA 3AQ4A 3W5VA 4DUGA 4DQLA 2ZJAA 4F4IA 1QH0A 4DIDA 3TNFA 3EX7C 1NSTA 1X8JA 4P3YA 2J7KA 4PSKA 1G3UA 4LHXA 2IWRA 1N5KA 2GXAA 5JJKA 4PC1A 4Z51A 4PHFA 2D2EA 5KSPA 1CJKC 1HE1C 4CT5A 1Z2AA 2IYSA 4QXAA 3DEFA 3SFVA 2J0QA 1AMOA 1ZD9A 2QU8A 1E9AA 1W48A 3RAPR 4MRRA 3WMGA 2XAUA 1NJGA 5CITA 3K0AA 4TL9A 2BC9A 1VCNA 2Z43A 3WY9A 4M21A 4A36A 4ZV4A 4Q00A 4GT1A 1KO4A 4B47A 4M9ZA 4EJSC 4Q19A 1WE2A 5TDHA 4G3XA 2BIFA 2Y8EA 1Q20A 3RSLA 5LB2A 4PO8A 2C96A 3CW2A 3MHPA 2BCJQ 1KO1A 2CLDX 3N2IA 1YZUA 1AQYA 4GOKA 4QC2A 2C2HA 4LPKA 1BS1A 3KQKA 2ERYA 3Q5DA 2B7CA 3CC2B 4NL4H 5FOSA 3MMPA 3M4YA 3KKOA 3BORA 5BYJA 5DNYB 2ZANA 3BGWA 1L4UA 4BQSA 1EP2B 1KMHA 3TUZC 4MGIR 4UNSA 2ZRNA 4BFXA 2NPIA 2KWIA 1UKVY 3OW2B 2W6ID 4P0TA 1HA3A 4XVUA 3AF1A 3NG1A 1Q86D 1OXTA 4OHZA 3SJAA 1R0YA 4N3GA 4LJ4A 2ZJ2A 3VX3A 2ZXUA 2NMVA 5CK5A 4LZZA 3CM0A 3NH6A 5CYOA 3UWKA 3PEUA 3U3JA 5E3HA 2IS4A 1YR8A 3LLMA 1JA0A 3P32A 3B9PA 4IKEA 4JT2A 1AKEA 2QTVB 3GLGE 4TMKA 1NN1A 1H8ED 1XTRA 3U3RA 3M1IA 4CEHB 1QF9A 1Z0FA 4F7DA 2GXSA 4TQUS 4WA7A 3THXA 3BWDD 4HB4A 1F48A 4B4DA 4YAOA 1DAHA 1MO4A 1CRPA 3AVQA 1G6HA 3T34A 5A4JA 2QUZA 1T3SA 5EE1A 5K8UA 2Q3MA 2X8AA 2W2VA 2Z4SA 2CCJA 2KE5A 1M74A 1XDBA 2LWIA 3U2QA 3AEZA 3TSZA 1N6OA 5EXPA 5C2JB 5BN3A 3DHWC 1UBEA 2A2ZA 2WSMA 3LBNA 4URXR 2CLSA 1NRJB 3ASYA 4MUBA 4AY2A 2GXUA 1E2NA 1US8A 3KQLA 2VHTA 4D0NA 3OESA 1G18A 4FIDA 1BJKA 4QNRA 3ADBA 2NG1A 4X8HA 1XFAA 2GZHA 1EWQA 3IKJA 4TYNA 3PENA 3ICEA 1XJQA 1SXJB 3M6AA 5BXQC 3R9IA 1LS1A 2CJWB 2V1XA 1NN5A 1W5SA 1DAGA 4K46A 3DPUA 1FMLA 2HT1A 2ZRLA 4LX0A 2WSSD 5SZKB 4MRSA 1QHIA 2Q9CA 2ZI5A 5CIWA 4D81A 2HV8A 1WMSA 1XD9A 4H1VA 2FJUA 3L0SA 2A5YB 3CH4B 5KSWB 4M1TA 4EIWA 4O3MA 4LYHA 4P4TA 1DO0A 5J47A 1YZLA 4A2PA 2BJVA 5FR2A 5LD2B 1T8TA 4I1UA 2BJWA 4US0R 3VKWA 2ZJBA 3QVUA 4HDOB 4URUR 3WXMA 3BIFA 2IS6A 1T9HA 5JHGB 2O8CB 2VNHA 4DT1B 2L0XA 2WWGA 4PZLA 4OK5A 4QGGA 1T4GA 2F3TA 1S3SA 1KJYA 5FPHA 2J41A 2MSEB 3X2SA 3U7GA 3DVLA 2C03A 1KTVA 1QG0A 5FI1B 5JS7A 1NVVR 1VG1A 1Q3HA 3DL0A 1U99A 4JYBA 1OB5A 1DG1G 1FP7A 1XTIA 5TY0A 1FFHA 2P6UA 2ZJ8A 3SJCA 2O5VA 4JVLA 3KJGA 3FJOA 1JEEA 5AJYA 2QP9X 4JL5A 3SYKA 2YWGA 5FOWA 3WYFA 2GZDA 2REBA 2W0MA 3CCQB 3H1TA 4DLVA 2AK3A 3AVXA 4BPBA 3NHBA 5L3RA 1FOEB 4K1XA 5EUMA 2QPAA 3CPWB 3NDPA 1W5TA 4LRWA 3AKYA 1RFLA 3OE7D 3QFTA 4JBYA 4TL8A 1JAHA 3CCSB 2H18A 2BV3A 1VTKA 4Q1CA 3RWMB 4EQ6A 1G291 1QHNA 4PPQA 3GJXC 3VNUA 1XZPA 3TH5A 3BFXA 2RMKA 3G4SB 1ZM4A 1H8HD 4B3GA 1NL3A 3VU9A 3ONWA 1VHTA 821PA 3KQNA 2I1QA 4LYJA 3W2FA 1E2GA 1QHYA 4HUQA 2DWOA 2QPOA 2JLUA 3OJWA 3T12A 4DDUA 3DO6A 2XX3A 4IDQA 2IYXA 1OH8A 2QZ4A 1J8YF 5KYKA 1RRFA 2XZPA 5ANRB 1IN6A 2AKYA 1KK3A 1N0UA 1P9NA 1JECA 1XTSA 2ASEA 2IYTA 1EFCA 3PEWA 1SVKA 1I7PA 3CRRA 2H92A 3K0AB 4NYJR 1BH2A 3PIRA 5JCPA 4RZ2A 1PZNA 5H59A 2GCPA 3FHCB 1E1RD 4WZAE 3KB2A 1ZJ6A 1UM8A 4FMCB 4POAA 2EFDB 2P5SA 3SOPA 1OFIA 3B1VA 4HUTA 5JECA 1KQSB 1P4SA 3C14C 1NY5A 1Q1QA 4DXAA 2XSZD 4C30A 1LS6A 4D25A 1KI7A 5FTLA 1A8PA 4ZIRA 5BYKA 4Q1BA 2IA5A 3B60A 1OYYA 4LJ9A 3AF3A 3E2IA 3IBYA 1Q21A 1X8LA 2D4HA 2WICA 4DCNA 4WZ6A 4RKFA 3UMSA 2OAP1 4LHZA 1NN3A 4ASUA 5IK2D 1MABA 1CJUC 4F7WA 1E3MA 1KMHB 2HF8A 3THYA 1E2KA 3A8TA 1B0UA 4JLKA 4I99A 3O8CA 4PX9A 3CX8A 3QIAA 2JGNA 2CCGA 2ZROA 4S2EA 5FOTA 1G5RA 2WWHA 2ZE7A 4LYAA 5HR5A 2PH1A 1FRNA 2QGNA 3UPUA 3I61A 1X6VA 3U6BA 3GFTA 3B85A 2BKUA 1U98A 3QPWA 2FSHA 4ZDKA 4R98A 4BPRA 5THXA 1DAFA 1G3IA 3GJ7A 2WIBA 1WP9A 3LW8A 3CD6B 2IC5A 5CK4A 1TTTA 5KTYA 3H86A 3WMEA 3THXB 2OFXA 1R0XA 4AYTA 1YQTA 3OZUA 1W44A 3ZBUA 1OGIA 1IY1A 1Q12A 1R2QA 2ZR7A 4I4LA 2OLJA 4RVCA 3WHKA 3I32A 2QA5A 3LBHA 1G8HA 2J59A 1JXOA 3CZPA 4G5RA 2N1BA 1S2MA 3RRMA 1EK0A 5LDDC 1X86B 1AGRA 2B5OA 3LX5A 4LCBA 3AP1A 3NBXX 5LPNA 4Q03A 1US8B 3BJIC 3BFVA 4LSGA 4QFMA 1Z3IX 3NIBA 3K0SA 1RIFA 2G88A 2QMEA 3GCGA 2GCOA 2HYIC 4Q7JB 1N6RA 3CNLA 1VIYA 2GJAA 2AXNA 3QY0A 3RC8A 2CNWA 2Q9AA 1JNYA 3CRMA 3EIQA 5G40A 2GJSA 3A4MA 4Y0VA 1XWIA 2V6JA 3UMFA 1P72A 2BBTA
chains in the Genus database with same CATH superfamily
2IPOA 4FYMA 2YRWA 4XVHA 3VO1A 2QUIA 2JKVA 2OXFA 3H9QA 3TQSA 4AZVA 3IL2A 1P77A 2NVBA 2JB9A 3V34A 4C0QC 4XIFA 1HE4A 3AHIA 1E2UA 1L5VA 4ZARA 3AJAA 5G41A 1YZ3A 1PZGA 1OWLA 2ZIXB 1II8A 1G5IA 4E0BA 4F71A 5D6NA 3BICA 3TECE 1B2RA 1X7GA 4L2IB 1BC5A 3WIDA 4CEJA 4XFKA 3RS0A 3CCJB 2QE6A 1OHHD 4FHCA 3ZHYA 3G5TA 1CUVA 2BZ1A 4PSCA 2CJYA 2C95A 721PA 2PLRA 2IJGX 1NRWA 4D74A 2H6EA 3BULA 5KEIA 2G9VA 1P2UA 4ZRNA 3RE1A 4C4ZA 3LZ6A 1N36B 3BERA 5ECWA 1FVHA 2Q4TA 3IIIA 1U3DA 1FX0A 4ZC8A 1TYDE 1BVHA 3CURA 1Y8RB 3QOFA 3WZ2A 4RF2A 3HTXA 4P33A 4P7BA 5IMSA 2VAWA 1PGJA 4I50A 1NQXA 1H3NA 4RV5A 3HB5X 5KOIA 2OHFA 3P0IA 3EDCA 4Q39A 3TZEA 2AQKA 3EFEA 3LZDA 4CHGA 1E9BA 1N8KA 1HTTA 4XN0A 1GUZA 1WA5A 2EW2A 3VO2A 3AK4A 3OZCA 1TEXA 3OZFA 4RFLA 4AYWA 5CDYA 2Q4DA 2I3ZA 1JXAA 4O08A 2FN3A 4EQ6B 1V8DA 4C08A 3IXMA 2Q1TA 1ULTA 3EHEA 5GV7A 3NMUF 2QLFA 1T2NA 1KJZA 1ZD8A 2VQ6A 2DR3A 2ZIWB 1M90D 3NGLA 1W49A 4IJUA 2IX9A 1ZINA 3Q2OA 1W19A 2GQFA 4PZZA 2G5CA 4MA4A 4W9NA 3KEFA 3KT8A 3THSA 3SKVA 2IHYA 3A3YA 4HUQB 3WYAA 2YYZA 4ZAYA 4AKIA 2P1DA 1LX6A 1U7UA 3K1YA 4MX8A 5EZYF 3HG7A 3W2IA 2PO7A 3SLNA 3HCFA 1XPRA 2D7CA 1T13A 2QVZX 4IKOA 2IY8A 4LDJA 1MRZA 2P77A 4EMTA 3GRPA 3QSGA 2A5FA 4ZGGA 4NFYA 2XJ4A 4RQUA 3ROGA 2C1XA 4NZNA 4C7OA 3A3NA 4YJ2B 2FP3A 2OBNA 2P5TB 4U00A 1N4AA 3WGZA 4KPGA 3UT5B 2J87A 3AVPA 4CUZA 5BXYA 4MV3A 1WSWA 4LK2A 2YDXA 4B81A 2VQDA 4RA9A 4PVCA 3UJCA 2GOYA 4HRXA 3PCTA 4KXQA 4XR6A 1I1HA 1O6BA 5HKKD 4WXEA 3ESDA 5KJFA 3H3XA 1X1RA 4BGDA 4FT4A 1GITA 1RHMA 3ILXA 3C1UA 1U0OC 3QWBA 4HFJA 1OGJA 4KDCA 4NMHA 5CGZA 5C4GB 2FUNB 3SJ7A 2WJJA 2WQ7A 2R8OA 3N2GB 3IA7A 3QKTA 4GLFA 4M1WA 4JMQA 4Q4AA 2HBZA 3B5JA 1TZJA 2ZZMA 3GDOA 4Q82A 4DR7B 1T34A 3AF6A 1A9YA 3G5UA 4KRXA 1GAXA 2OZVA 1HE8B 2ZKLA 1E6LA 2CFSA 4KNWA 2NUTB 3LQYA 5D3KA 3RU9A 4B71A 2Q5EA 3O4VA 2AW3A 4KFSA 2PKXA 4FOSA 4WAUA 1QH9A 1XVAA 2C4TA 2ISSD 2ZP1A 3IIKA 3IBSA 4NYMQ 2C00A 3DMDA 4CV0A 1HDRA 2OQRA 3SM3A 3ZXYA 3CVVA 2C9OA 1GFIA 2J67A 3PL1A 3GN1A 1F3OA 3D8RA 1DE0A 1EFVA 4ZOEA 3ZY5A 5FHRA 1NQ5A 4X65B 4IIYA 4WCFB 2BEKA 2EJUA 3DMTA 2PEYA 3F6RA 3FCCA 3LC0A 3S8MA 1ZBDA 2RHRA 3D02A 2PT5A 2BM8A 1LDMA 2MU1A 4M0MA 5ALRA 3EXG1 5KYXA 2IPAB 5AP9A 1FLAA 2I2AA 2JL1A 3E1YE 1LSUA 4EFNA 1XLTC 4C6SA 3ETHA 3GZ4A 4R2JA 5K1ZA 1PWZA 2XODA 1KMNA 1RI5A 1SCBA 2ON6A 4NFSA 1R66A 4PO1A 1BWPA 2VC2B 3QPVA 4R5HA 4AI6A 4G1MB 2FFQA 2JAUA 1TCUA 1UBKS 2PA0A 3A0RB 3ICPA 2M2IA 3FG9A 1PK8A 2PUWA 1CEYA 3HJBA 1ZUNA 2IITA 4BU0A 3SZLA 3FDJA 4WBXC 2WTXA 1Q0ZA 1QMGA 2WD8A 3DV0A 4II7A 5AKLA 1UANA 2WU3A 1OI7A 2DZDA 3JQFC 2H5LA 3IVCA 1E4EB 1M2JA 2QY6A 2VXCA 3DFIA 4QGFA 1H6AA 2ZRIA 3ZE0B 1DQNA 1TJ4A 3L9WA 3O8BA 1DWOA 3VV3A 1ADBA 4N5NA 4N3NA 4AAYA 3JQDA 3GJYA 2CFOA 4QUBA 2BGGA 4JLDA 3ZWDA 2ZRGA 5C35A 3Q9LA 3ZZTA 1ZXBA 5HBRA 3G0HA 2XOKD 5DGDA 2FW8A 3OCJA 1Z6XA 3PRHA 1D2GA 2D62A 3RC2A 1SRQA 4GDFA 3N59A 4BFYA 1OOEA 1HEYA 2FPPB 5HFJA 2P65A 3I5AA 1Z5ZA 3L8CA 5JNWA 4MQUA 3L04A 3OG9A 3C3PA 1DC7A 1E2QA 2EKLA 1IHYA 3DL7A 3GY0A 4EDHA 1O4WA 1ZUIA 1OFUX 3E23A 4IOKA 1I3MA 1B0AA 2VHWA 2IYUA 4GPD1 5FWXB 3Q3JB 2QPTA 3PFIA 3H4TA 3AF5A 5DO9A 3JD3A 4LYFA 1V5FA 1QV7A 4M8LA 4UMEA 4BVLA 3NEAA 2ZIVB 5KTPA 4MOWA 3KQQA 4XGQA 5HF6A 3WLRA 1OQAA 4TMTA 1V3TA 2F1RA 2BM1A 4L74A 2UU9B 4NKRA 1J2EA 4FDAA 2ODWA 3FCYA 1JQEA 1ISGA 3G6KA 4LK3A 4WNAB 3U44B 2PL3A 5JDIA 3VOAA 1TW2A 3A1NA 5E9WA 5K4GA 1JPUA 4FR0A 5AVRA 2O8BA 4P5EA 4F5WA 3FOZA 2Q5JA 4KQJA 1ONSA 1CB7A 5FEMA 4GZ6A 2DPYA 2YVKA 3OFKA 1Q0SA 1Z82A 1FP1D 3O84A 4OOFA 4TKMA 4LF4B 4KVZA 2PAFA 3M1LA 4M1EA 3VNSA 3LHIA 4BMSA 1JJ7A 1A8QA 2H5IA 1WZCA 3HLTA 4QUIA 1EXVA 2HTEA 2QS9A 2XA9A 2YUTA 3T1TA 3ZDRA 2QU7A 1KI1A 4NH4A 1P1IA 2YHBA 4KLCA 3ED1A 1E63A 1KF0A 2AE2A 3KD3A 4ZDWA 4BO2A 5AVVA 3LQ4A 4XUDA 5DBFA 2PD6A 3BIJA 5IKEA 1U4OA 4A4DA 4JVOA 5D3MB 5SY9A 1H2RS 1S2DA 2BAGA 3AU8A 4BNMA 2QZZA 4OGWA 4XLHA 2HQRA 2XSZA 2GMWA 4BB6A 5C32A 3TLAA 4IF6A 4PAAA 3WL6A 4QQ8A 5TT1A 2QSUA 2NO6A 4G9EA 2PGJA 2B7BA 4GNRA 1M9NA 4D6XA 3FWPA 2OZPA 4NSNA 2BHTA 1S5PA 4LJSA 1X77A 3C43A 3G13A 1JIUA 3C98A 1EJBA 4DC1A 1T5LA 1FS5A 1OJ7A 2COUA 4UVHA 2GN9A 2GAJA 4RLQA 2OECA 3CUEF 2DJ5A 4KOEC 4CFSA 2QRJA 3CJQA 2Q1SA 4HYYA 1EXWA 3KV1A 4KIJA 5GADl 3PWSA 1CRLA 3H8VA 1J4AA 1WCIA 3C6ZA 5FB3A 1QLJA 4EGCB 4N18A 4Z99A 3HC7A 4M3NA 4RVFA 4E5PA 5LMNB 4PINA 3RG2A 3D43A 4B7XA 5K0EA 3ZY2A 2C9ZA 2B36A 4X20A 5IZCC 2A6PA 1EXDA 2FFJA 4G6ZA 3U5TA 2Y4OA 1SIOA 3UMYA 1MQSA 5A3JA 3GARA 1G20E 8ATCA 1R0LA 3QQPA 4HWSA 4YREA 3LP8A 1LPOA 1Z2DA 4MB2A 4XIIA 5CLIA 5FR1A 5KYYA 1XYGA 1HY3A 2W43A 4WZLA 1YV9A 3G17A 3ICWA 1T36A 4OHXA 2O4UX 2J48A 4OLJA 4P2BA 5JVDF 4ENQA 2YOHA 3W4KA 2W2TA 2V7QD 4A8JC 4HEJA 4F2WA 4XYLA 1ZNXA 3W9SA 2QX6A 2FK7A 2R65A 2OHVA 3DFKA 1HLGA 1E79D 3NAZA 3EQ6A 1EE9A 2J1LA 5ALPA 4ZQHA 3NB0A 4B4WA 2HA0A 3K70C 1D2EA 1K73D 2G70A 1KZ6A 3QXSA 1TVCA 3ZHZA 3QELB 3RAEC 1JEQA 4DEXA 1P7ZA 1UOPA 1C7FA 4Q02A 2BP7A 1SUCA 1WQ1R 1ZS9A 2AD1A 2BI4A 3KDPA 4OMUA 1V0FA 1U3GA 1DV2A 1E58A 2OBMA 5TR9A 1PHRA 2WUFA 3A7DA 3ESAA 4BWFB 1UAGA 5JNLA 3A9RA 4IIVA 1JWAB 5GZ3A 1XK6A 2P1RA 3SFZA 4BRSA 1MFZA 5FI5A 1UMBB 2HJRA 4CNBA 1VE5A 4F38A 1BLIA 1A96A 1Z8FA 5CIQA 3DV9A 4Z4QA 4WXPA 4CF7A 4MULA 3RVMA 3A3GA 3HU3A 2CV1A 4B44A 3MQ4A 2FFHA 3TKYA 3U39A 3I34X 3QPAA 5CDUA 1VJSA 4X05A 3A37A 5INTA 1I2ZA 1NVXQ 4OPVA 1P7PA 4PLZA 1GEEA 5AM5A 3K96A 2L42A 2WWIA 3BRSA 1QP7A 4UNQA 2REXB 4XARA 5ITWA 4M7WA 1BCSB 5EESA 3GJTA 1RADA 4Z0TA 3KP1A 3P26A 3ASZA 2FMXA 5ERYA 4PYOA 2NU9B 1YZYA 1ZYUA 3WYGA 1Q7TA 1D1SA 4ZZIA 2PM8A 6CHYA 3WKEA 1BGXT 3EAGA 3AUAA 5ITZA 1FNCA 2E7ZA 2I6TA 1AO0A 4TTRA 2F43A 1IXRC 3L5OA 2OLEA 1W76A 4G0XA 1VBNA 3UJ3X 3H6KA 1NZJA 2PU7A 3PTZA 2ODTX 1K27A 5L6MB 2O1SA 4P4LA 4MW9A 2DR0A 4EL0A 2G40A 4G9BA 3ZH2A 4CYMA 4I2VA 9ABPA 5JNUA 3FWKA 2YJTD 2YYAA 2E3JA 2FEOA 1FJGB 1SHTX 3WGNA 2BBWA 1MRSA 2ET6A 4RF5A 3M4NA 4A1FA 3I42A 2RC5A 3QVMA 4YUXA 2VDLB 3KV3O 2I2DA 2HBQA 4S1VA 2Q3CA 3FNGA 4D4LA 4FGJA 3LPDA 5AJHA 3N6VA 2AVNA 5LP6C 1J21A 1L6RA 1UL1X 3OTHA 2BFOA 1ZIYA 2B98A 1UXJA 1WG8A 2PMEA 4RD6A 5KYVA 5HZMA 1KC3A 5K0BA 1E99A 1ZOSA 1V1RB 1M7BA 1U9JA 2ORVA 4RHTA 1KDOA 1YT5A 3GVHA 5B53A 4KB5A 4Y2GA 5BY2A 3AL3A 4MYHA 4HNTA 3CO5A 3HKDA 1V5EA 4JI2B 4DLZA 1RI2A 4O3FA 4YRLA 2OBTA 3HEBA 2ZJ4A 5I3ZA 3VKGA 4BQFA 5DT2A 4Q6WA 5ALTA 1NVVQ 4BZWA 1IBSA 1JIJA 3UUGA 4FMBB 2DHRA 521PA 1IQRA 1EDOA 1QB7A 2WINI 5DSXA 2OGUA 3EXIB 5EI5A 3UMJA 2SKCA 4LFBB 4OCZA 1M10A 4AY3A 3WOVA 4XDZA 4EA9A 1R0RE 2D5AA 3MCWA 4LUCA 5FL7A 5A0FA 1VHOA 2CVFA 1P5RA 3GLQA 3QKWA 4AT1A 4OXKA 1JQLB 2ZCUA 3PP8A 1I10A 3L7AA 1QVGB 4UHHA 3PV0A 1SIBE 1FFAA 2Y71A 3BCUA 3ZC3A 4Z4GA 2HPZA 2WWFA 2J85A 2MSNA 3O5AA 1SB8A 3PYMA 1G5QA 3UHFA 1JTEA 1UJBA 5CLHA 3NC1C 2P2NA 4BMVA 4B8WA 1Y6RA 1GUFA 2F1JA 2J9XB 3IHLA 3R24A 6NULA 5EHZA 5F51A 4PAWA 3MOIA 3S0JA 2HK9A 2GYYA 1QYDA 2KI5A 3JXEA 1C0PA 3Q11A 1Z4IA 3CEJA 5G0TA 5BV7A 4XWWA 2CUTA 4MUJA 3UBTA 1JQJC 5HCNA 2FJ0A 4OB7A 2PXCA 2E21A 3ZGXA 5MGNA 2JIMA 4QO7A 3RUDA 4MYDA 3BTOA 1NG9A 4N48A 2Z6UA 4F97A 2DF8A 3GPIA 2E4ZA 2IZ5A 2AOWA 3WGGA 1DEKA 3DEZA 3ABIA 2X4GA 2PWBA 1E61A 4ZAFA 1DC4A 3EEIA 4C6TA 3OLVA 3E8SA 3FDZB 1E7MA 1NM5A 1GL3A 1R6UA 1T0UA 2OESA 5FL3A 1I2CA 4B3XA 3JD0A 3HRKA 3ZCSA 3OP4A 1Y98A 1KJQA 4HAIA 2DHDA 3ZS9A 3GWGA 5DM70 4IZIA 2AWOA 3I6IA 3OC0A 4DQKA 1GZVA 2WB4A 3EYWA 4F3RA 3ZHTA 1YTUA 4YX9A 2UZ0A 4J2HA 5F2KA 2IDZA 5DRYA 2VT3A 5HK8A 3ASQA 1RI1A 1UEXC 4K1LA 4PQYA 1Y81A 3OWHA 4YIHA 3HQ4O 4MR7A 5E95A 1C3VA 1L4YA 4MQFA 5FXMA 2W98A 2X1MA 2AEJA 1QGED 4IFTA 1YZKA 4R3UC 3K5WA 3F9CA 1A1VA 4XVCA 1KVSA 2ZK7A 3ZOZA 2P9ZA 3RUIA 3AFIA 4DLTA 5DX1A 1T1GA 4A82A 3H5NA 4YK7A 2VP5A 3QFCA 2J32A 3MMNA 4GDMA 4B84A 1P2SA 3LPNA 3WL4A 1KJ8A 1EEXB 2R1TB 3IP8A 1C30A 5EE5B 3WSWA 5AVWA 5HZHA 5IYZA 5JYEA 5E6RA 3Q98A 4MS1A 4XPZA 5JFGA 2DLNA 5DK6A 4YFVA 3ICCA 1MIOA 2I5PO 3U7RA 1X1BA 4LY0A 4JBIA 3HJRA 3BFJA 1TPZA 2H7CA 2XITA 3UMGA 2NP6A 3AUSA 5JCJA 3ZLUA 3BFKA 5E2IA 3DKIA 3F96A 5JXJA 3NHAA 4CTJA 3MF4A 5HQJA 4IDEA 5IARA 3NHWA 2ILVA 4XJSA 3TOZA 1PT8A 3TPZA 2DEUA 4LRTB 4PYNA 1U3FA 3G8DA 5G0SA 5J4VA 1KRWA 2BLNA 1EAYA 2Y2VA 1DBSA 1LVGA 1HEIA 1I3CA 1HV8A 1N3YA 3QEKA 4D4GA 4DJFC 1EVLA 5HKBA 4JP2A 1BH6A 2GYWA 3OFNA 2XYGA 2B4YA 3T4UA 1DFIA 4D9FA 1ZUD1 4B4UA 1K92A 1JJBA 5JYCA 4BNWA 4FYVA 2GASA 2X5OA 1U0RA 3BSYA 4E1VA 3T1HB 4GI2A 5I7FA 1GSOA 3VSDA 4AIRA 2V7VA 3AONB 7REQB 3T3HA 5KSYA 2D1FA 1LH0A 5F1PA 3A8JA 1QO9A 3ZX5A 1R5NA 4O02B 1DKRA 3D8TA 4HQ6A 3CISA 4OXNA 5HCUA 2JVKA 4OP7A 1TO1E 4OQLA 5IVDA 1XEWY 2A1UB 3WWEA 2JH8A 2XCOA 1KQPA 1O9HA 4X91A 4DAEA 4E09A 1YJ8A 2C20A 2HWWA 1E0DA 1Q11A 3GEPA 3DM9B 3L7JA 5DLYA 4QECA 5DHTA 1KBOA 1C7QA 2V4MA 3KTOA 3DEYX 3FLEA 1NLYA 3E8MA 4AC9A 2DBQA 4XDHA 5GJVC 4AZ0A 3RANA 4XB2A 1U8CB 1M72A 1JG2A 1HDCA 1JKJB 1NP7A 4L9SA 2O8FB 4J76A 4ZO4A 4RS4A 4BJ5A 3P5BA 4H6WA 2BFDB 2B20A 3S81A 3HFGA 3IEMA 3R7DA 3LDGA 3FZQA 1U1CA 4Q3CA 4Z54A 5GIPE 2BH2A 2I33A 2YS7A 1KWKA 1WQ3A 2AOTB 3N05A 3NC0C 4IS3A 4TMXA 2XHEA 1TMYA 4LJ8A 1M7HA 2WUDA 3RJTA 3ZYZA 4JGIA 1Y3BE 2EX0A 3EUFA 4X1IA 5DGCA 2YZ2A 3I9JA 3K70B 3VTFA 1Y82A 3B3QA 3RSSA 3BE8A 2J30A 3O03A 5D2CA 1QFXA 3ZU5A 2NOAA 1SXJD 5G53C 3OX4A 4OGGA 5KQLA 1VQ8B 4YJFB 3WWZA 4Z1MA 4GSYA 1Z7WA 2QBYA 4E12A 3L0IB 2V45A 3DG9A 2GI4A 3HP7A 2PZKA 5DE3A 4YHBA 1IOLA 4QJ4A 5GM2A 3VNVA 3KKKA 5HG0A 3B3GA 3ZWPA 4JAVC 4R1PA 4UHDA 1Q22A 1A9OA 1UKBA 1VHDA 2IUEA 2OTJB 3G8CA 4IZ6A 5ENVA 5I3CA 1H1DA 3TG8A 3UO8B 5EP3A 3V42A 2PQ2A 1DARA 2PGOA 4YUWA 1SQFA 4J07A 4D1YA 1AU9A 1IQUA 2F90A 2V1UA 3I1FA 2O5CA 3VPGA 3VR4A 3D4PA 2NLOA 4XH9B 2F64A 1E3ZA 1ZD4A 4GKVA 1IWOA 3GGSA 1JV2B 2JGDB 9LDBA 3FPJA 1PJQA 2DQ4A 3JAKB 2D0OB 4G0PA 4QU9A 1SG9A 3SLGA 3O38A 4YP9A 4OIMA 1LNSA 2G1KA 2X8JB 3WYDA 2W6QA 1GZHB 3SIWA 3ZQUA 1I4DD 4JBXA 1M73E 1P91A 1LJ8A 4MR9B 4OJTA 3VYTB 3AJ9A 4UAGA 2JDIA 2EARA 2BHNA 2ATCA 4Y1GA 3KUCA 3JALB 1P1BA 3CXCB 1NSFA 2QX8A 3D7MA 3LWBA 1SG6A 3VYWA 5IZ4A 3TGLA 3LA6A 4G5YA 1XTUA 4GGPA 3VDRA 1VJDA 5E7IA 4H3VA 3SYMA 2IZZA 4WCDA 1H5UA 5I47A 1SA0B 5KPJA 3AI3A 3WAGA 3JQPA 1D9XA 1S6YA 1P80A 3VR6A 3HR7A 1T4CA 1THGA 3A32A 2XQKA 5LP6B 1OA0A 4NE2A 2VLIA 4IIHA 5FA6A 1M34E 1NATA 3H8SA 2UUOA 5JD6A 2GDJA 5GONB 1Z5NA 4OBXA 5CVTA 3KQHA 1XL1A 4MWSA 5EIEA 3GLGB 2H9IA 5JJLA 4WA8A 3HZOA 3EG9B 2IZ1A 4TX1A 4J1TA 1T3TA 1ZC4A 5SZIA 1R64A 3RWOA 4BB9A 2UYGA 3IPYA 3T53B 2CVHA 2ZJ6A 3EA4A 3U80A 5M04A 1VB3A 1X14A 3ZU4A 4F21A 3FGNA 5BSFA 5KX5A 2O1EA 4GQNA 4XR9A 4Y2JA 3AGQA 5BN4B 3IAS6 1IB0A 1XRPA 3QI2A 3WIOA 2GPSA 1VIAA 4AY6A 3C3BA 4OLBA 1TYEB 2OILA 2ZVQX 2MSDB 1XMOB 1S96A 2DQKA 1YS6A 1LBTA 2BSXA 2V9ZA 1YRWA 1BS2A 1JHYA 2YRXA 3KTAA 4I81A 4O1MA 2W6OA 3VUEA 5JRJA 3EK2A 4IIUA 5AFSA 2VYND 2FQXA 4HAOA 4NC9A 2UKDA 2R6DA 3DVQX 1LEHA 2VA9A 4CRWB 1FUEA 3L3BA 4FQ8A 2XGJA 4N7BA 3GDGA 3BWXA 3LLCA 5HCIA 3TUJC 4PN3A 2JFVA 5JPIA 1LPSA 1YQ9A 4D4MA 3E20A 3ROQA 2XEDA 4DC0A 2XTMA 1JW9B 2WT4A 1MJNA 1F20A 2ONYA 4EELA 1LXCA 1XRRA 1SRRA 2Z9BA 1X39A 2QUKA 2ACWA 1E62A 5CAEB 2IV7A 2GK3A 5JO0A 4AO6A 5KJ6A 1NI5A 1H0KA 2IP2A 1U3TA 5GP1A 1XT6A 3B1WA 3I2IA 4YBZA 1VPVA 2NN3C 1S8OA 3I9MA 1QOPB 1BU5A 1GSAA 3EVGA 4I46A 4KQEA 4Q7EA 2H54A 5K3AA 2OC9A 2G04A 2Q2NA 1FNMA 2FQ1A 4JI3B 2XNJA 2QJTA 5JEEA 4KXYA 2P30A 4L5CA 4XDGA 3RIYA 4AJEA 2P4HX 1Z3CA 1G8MA 2JLXA 3DF9A 5F76A 2OWDA 1B8UA 2G8LA 1FXWA 1UKCA 2FQYA 1JF8A 4FLMA 3CZCA 1PG0A 1B41A 4J4BA 4OGKA 2ENUA 3ESQA 3SMQA 3ZD8A 4JOCA 2SHKA 1N5IA 1K3FA 4G6IA 3A4TA 4GWGA 1TO2E 3TSWA 2WKPA 2CDCA 4JNKA 4DM7A 4M22A 1RRMA 1M66A 2VTDA 5F98A 1C3OA 3ANYB 4BQQA 4JJKA 1PFYA 2EJTA 1JTVA 4KWIA 4ILEA 2H31A 5LLDA 1HNZB 4TRRA 1U3CA 1H66A 3HDJA 4TT3D 3BC1A 5CVJA 4ZAWA 3RSHA 1DNPA 3W05A 2ZYRA 3GWZA 4MYRA 4DLUA 5D5HA 3UK6A 2Q1YA 2VHQA 3GLTA 3LQRA 1SIUA 4JYCA 1J9GA 1JFRA 1YS2X 2QOEA 4NBUA 4CV1A 3PWTA 3QYPA 4PW0A 2XIQA 1Y9ZA 1YJNB 5IG2A 1A97A 2WJVA 1HSOA 1VCIA 2VWHA 3R5XA 5E6SA 4FFNA 1NI3A 4NZPA 3LUPA 4OXRA 3HB0A 4Z9AA 4DCOA 3IO3A 2R4TA 2HU2A 4FJ2A 1G59A 3HBAA 4UU1A 2Q28A 1FTWA 1LQUA 2ZTSA 1YCHA 3EC2A 3NT5A 5HP4A 5FTMA 1U0TA 2D8AA 1KJJA 4HEA6 5G3YA 2YXNA 3WMXA 4A8TA 4KZKA 4ZK2A 4A9AA 1M1YA 4A15A 3C16C 3H9GA 4LJLA 1LBHA 4M0UA 4GI5A 2JGAA 3M5DA 5BQ5A 5BUQA 2QD4A 4BQEA 2Z1DA 4REOA 3H2YA 4MLZA 3HWX1 2C9BA 1T0BA 2UAGA 1IN7A 1CY4A 2QY9A 3BWCA 4TQGA 4V0MA 5A05A 2PZGA 5HDBB 3I53A 4MI6A 1DQPA 2QUAA 3CUSA 3KCQA 3QUCA 1EFAA 1F2VA 3ENKA 2D1YA 3JATA 1Z0IA 2XWPA 4HY3A 1ONNA 1HDXA 2QRPA 2CMKA 2P2SA 3QKIA 3RYIB 2FDXA 4DW8A 3ETLA 3BMOB 3RYTC 2AH5A 1MW8X 1VRVA 1EQAA 1G5FA 3QF4A 3KJZA 2G5PA 4CLOA 1SKAA 5HM8A 4N3AA 5EQFA 1BFDA 3ZHQA 3EFOA 1RWVA 3H1GA 5EA2A 3LSTA 1E2LA 3GT4A 4DG8A 3LE8A 3UAVA 2OG2A 5DNDA 1NX6A 1QHSA 1ECJA 3RGGA 3T7JA 1NLFA 5EIBC 1PJZA 1TQHA 2O05A 2QQ0A 1CUGA 4RX1A 5LMUB 1Y6FA 1B1CA 5CXQA 2GM9A 2EZUA 4MZDA 4LV5B 3DEHA 3GGCA 5BW4A 3K8ZA 1RE0A 3ABQB 4LJKA 3C8DA 3OZVA 3MJSA 1P9RA 5HW0A 1EP3B 1W9XA 2PD3A 4AIIA 3OJXA 1Y0BA 2BFBA 4F93B 5MN5A 4Y6LA 4MQMA 1THZA 2C7BA 1KGDA 5FBHA 2C99A 1FDUA 1TM5E 5EZ5A 1TQDA 3R5KA 2BTEA 4LWQA 4H0FA 1ENYA 5EIFA 3S29A 2Y9PB 1EGAA 2AUMA 1IY2A 2BDTA 1ZO8A 2PUTA 2CXSA 4X94A 5IS2A 4D41A 3AXTA 3IUYA 1AO3A 3N28A 3GZJA 4YRMA 2C2YA 2G67A 3A36A 3COVA 2H3HA 1PKXA 2HYDA 2WHYA 4UUAA 4F4JA 4JQSA 2I6QA 1BXRB 3WL3A 3NBFA 4ZYTA 1ZM2A 4AJ9A 4XIGS 4Y2YA 4OPSA 4XB1A 2Q21A 2YJ3A 3B9BA 1E3EA 3RRJA 2GNOA 5BRJA 2ID9A 4YDHB 1DAEA 3BDIA 1WOMA 1CT9A 2OQ2A 4DA7A 5IKXA 4N3BA 4Z4WA 2O0HA 4OI4A 2ZR0A 1AUVA 1C1DB 1N92A 4QYIA 4RHCA 2EJBA 4BNFA 5LD2C 4BV9A 1RC1A 3LCUA 4L5JA 3FPCA 3B5IA 3OIUA 4CM6A 3CE9A 4ZPXA 2H5EA 3C15C 1JQ5A 1ZK3A 3M1AA 2CDRA 4BYGA 2K4MA 1EX7A 1LX7A 3REGA 3SM9A 1LPPA 5B7NA 1CP2A 1J2YA 4XORA 2O8NA 1ECBA 2CNDA 3C87A 4GBJA 4KWCA 5CXSA 4CQNA 3R3UA 2ZQ5A 2YWJA 4X92A 3KPYA 4QGHA 1YMQA 5KAPA 1MVOA 3GR6A 3K8QA 3TD9A 1XPUA 5JBNA 1GM5A 1SELA 3CRZA 2EEZA 3GRRA 2F55A 4XX0A 3SQOA 1U8FO 3QHPA 3PBKA 1RRPA 3QNMA 1V1MA 2O5EA 5CPBA 2ZTVA 1P1KA 2DETA 3INYA 2EWVA 2RFLA 2P2DA 3GN2A 4J2TA 2BFEB 4JLNA 1WTHD 4L3WA 5DLDA 2VK1A 2ZRPA 2GVDC 5K0CA 1V96A 2O2JA 2W90A 1PJSA 2B4TO 3AFHA 4PQRA 5H70A 3R8XA 2X77A 3K0BA 3UHPA 4LJRA 1ZICA 4FCTA 4GOLD 4CI9A 5IK2A 3DDHA 2I4MA 4HAZA 2ZJOA 5CCXA 1M76A 1GGVA 1BDMA 3HV0A 2C9MA 4JFAA 4PG5A 4PZDA 4H1WA 3HM9A 4FSXA 3KLMX 4MKIA 2DU8A 1CUXA 4BFSA 2IQIA 2QD2A 1WXDA 5I45A 5JSHA 3EC7A 5K51A 1JLKA 3R3XA 3VHXB 5AKIA 3CP8A 3OZIA 3KAQA 3Q9UA 2AG8A 5DHPA 4NTZA 3RHZA 5MFPA 2HMWA 4CETA 4TT8A 1YOVA 1MEEA 3I9LA 4BZXA 1M1NB 1RMQA 1U0SY 2JF0A 2OV6A 2CF4A 2NZYA 4QWWA 5FBQB 1MRNA 2GRJA 3IDZA 3NFYA 1YB4A 1QB8A 2JEYA 4DIMA 3G9XA 4TTVA 3H5VA 3ENQA 1ZGAA 4IUBS 1P6XA 2YV5A 5DXAA 1ZM9A 3GZNA 1AKMA 4R01A 2QMQA 4RH3A 4ZN6A 1KR2A 4Q4LA 4QGBA 5FJIA 5AWFC 5L3ZA 4M0DA 2VP0A 3V4PB 1Q91A 3L6CA 3NWEA 4M60A 3O21A 1RBZA 5TVKA 1C9KA 2CEAA 4FW8A 3ZNNA 4WEOA 5KWSA 3C6KA 3PWZA 1SKMA 2P69A 3STUA 1TNDA 3QZUA 3N07A 1G0OA 4RKWA 3WSTA 4CCSA 2E4AA 3SBEA 2FPWA 3RHSA 4BNKA 4F84A 5EHIA 1NKTA 2H11A 2XKJE 3U7FB 3QVJA 4IOMA 4BECA 2R1VA 3M6XA 1Y5LA 2VHUA 2RKBA 4FD2A 4FX5A 1PSWA 1NLZA 3A8KA 1ZLXA 4IRMA 2MSCB 3EY4A 3O8OA 4LV8B 4C20A 2YS6A 1KI3A 5IH7A 1ECPA 4KAFA 4U6NA 1VCHA 2BGMA 2NT3A 3DBIA 3KKMA 3LI2A 1Z18A 4XSVA 1NX9A 4DGSA 2A0YA 3CLRC 3GAZA 4LZWA 1X7DA 4DTCA 1QR2A 2IELA 1W1WA 4Z0PA 1YKSA 4X7CA 1CE8A 2AYZA 2DECA 2ZQZA 3H11A 4EY3A 3U3KA 2VDMB 1G7CA 1V43A 3CLVA 3WGJA 1H4TA 4A6EA 5JQGB 3LQQA 4MYTA 3T52A 5JSFA 2AGVA 1PS9A 3WYBA 2NQ2C 2BMFA 4NESA 4YJKA 3WL8A 1EESA 4GAEA 1UDAA 4I2NA 4PC3A 1R4MB 4LMAA 3MN1A 1X74A 1Y7LA 4ENTA 5EGNA 2RH4A 1XCJA 5MHTA 4DRXB 1N9GA 5CFOA 1W59A 3B1FA 5KC9A 5ALGA 3KE9A 4BLTA 5KNCD 2NTYC 2E85A 4IO1A 2BMJA 1IDOA 1H6DA 3GQBA 2OFFA 3W6UA 4BX2A 4TL6A 3RYFA 4FBLA 4HQOA 1WLYA 4O2BF 2Y1WA 3OKPA 1WUIS 1Y48E 4K86A 2GEVA 5EKUA 3AF4A 1YB5A 1G20A 4R3NA 1FYWA 1YQQA 4UE3S 4DYVA 1HT0A 2OM6A 4B74A 1U6KA 1FY2A 1IYZA 1CK4A 2WZQA 3HV2A 4A0SA 1G4AE 5LDGA 3D8BA 4AG6A 2VA8A 3UNXA 1E1QD 3AHEA 3VBCA 4JXZA 2D5CA 3EGOA 4CMIA 5CFPA 4YCLA 4CKWA 2PUDA 4XOTA 3CEPB 1R18A 1H65A 1O5TA 3ZV4A 2IXBA 3NETA 1G3RA 2ZTGA 1YE5A 2GD6A 4BWYA 2Q99A 1ORHA 3JV7A 3K1JA 4BE4A 2FWNA 1DTEA 3N70A 3DR5A 2BF4A 4RPBA 2AXEA 1JAIA 2RHBA 3RIMA 4HZUA 5LUBA 2FWIA 4JK3A 1LJUA 2EW8A 4NE7A 4TV8B 4ZZ0A 1YI8A 1SVUA 1KDTA 1DUIA 1X87A 1XZLA 4W5OA 1XLVA 2I9KA 3IPCA 2PX3A 1E4VA 2G08A 2WYVA 4RZIA 1ZDMA 4Y30A 3AUJB 2ZI4A 2ZBFA 5IJ9B 1JIVA 1GNTA 4Q1FA 2IYLD 3C74A 3BF8A 1N7HA 1FTYA 3CZ4A 3MT9A 2I87A 3LM8A 2HRZA 2P6OA 1YFLA 3NOQA 2DMRA 4MQBA 3U1VA 1GQOA 4BO7A