4QFUA

Crystal structure of a glycoside hydrolase family 5 (bvu_2644) from bacteroides vulgatus atcc 8482 at 1.90 a resolution
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
465
structure length
461
Chain Sequence
AKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETGWLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGIYGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIWMIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGHRRYGQRNYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRWNQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQMKYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKISGAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTALPDAIQKWNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a glycoside hydrolase family 5 (BVU_2644) from Bacteroides vulgatus ATCC 8482 at 1.90 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Hydrolase
molecule keywords glycoside hydrolase family 5
total genus 152
structure length 461
sequence length 465
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12904 Collagen_bind_2 Putative collagen-binding domain of a collagenase
A PF13204 DUF4038 Protein of unknown function (DUF4038)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4qfuA01
4P7OA 3UR8A 3VUPA 3WY1A 3CUIA 1UH2A 3BLKA 4QDMA 2O92A 3RO8A 3IJ7A 4MNJA 6TAAA 1OWQA 4M56A 1VB9A 4Z2JA 1J0HA 4M8UA 1E4LA 2XVLA 2UY3A 5ABFA 3VX0A 1SFSA 2A3BA 2EQDA 1A3HA 2OYMA 4U31A 3NYDA 1ISXA 1CBGA 5EFFA 2DGAA 4MB1A 4AXNA 1DWGM 3LPOA 3GNOA 1G0CA 1UWSA 3WDQA 5A1AA 5CGTA 4U5KA 1A47A 5F7UA 1MW0A 2WHMA 3BAIA 2V5CA 3WDJA 4IPLA 1JNEA 1E0XA 3GBDA 3WKZA 3L4XA 2YLLA 1JZ4A 3RPMA 3AMCA 1CWYA 4PRWA 1KGXA 3J7HA 1UQYA 3VINA 1MFVA 2ZX5A 2C8NA 1B3XA 4V2XA 3WFZA 2WC4A 3W6MA 3AIQA 4TVUA 1W9XA 2XM2A 4YHGA 3BSGA 4F8XA 3AI0A 4ZE5A 2VUYA 4X0VA 2YIHA 4H7VA 5BROA 4CN6A 1X6LA 2PWFA 4HU8A 2J7EA 3WH5A 1E0VA 4W5UA 3W25A 3TTQA 4AEEA 4ATDA 1XGZA 1E4NA 1U33A 3PZGA 4HA4A 4Y7EA 1IZJA 3WEMA 1GOOA 1K9DA 1UWIA 2PC8A 1ECEA 3TONA 2CPUA 2WMFA 1UKOA 2E9BA 2WSKA 1B0IA 1EOKA 2J7BA 3VMPA 4AD0A 2ZXAA 3AIEA 4PN2A 1E5NA 1VEMA 2BVTA 3PZOA 4CN4A 2J78A 4BQ5A 4PMQA 1XH2A 3SUWA 2F61A 1ZBWA 1ZJBA 3MV11 3EDDA 4ATWA 1WZMA 3IK2A 3WD3A 3IAQA 2XVNA 3KWXA 3RMEA 1EHAA 3TOPA 5I23A 3TTSA 4C7GA 1BHGA 4BCEA 4AD4A 1G01A 1NH6A 3L4ZA 4TXEA 3AS3A 3GNPA 1UD4A 1HT6A 4GI9A 2G41A 3U57A 3L4TA 5LYRA 3FW6A 2WMIA 1B3YA 2OWXA 1JXJA 1OBAA 3A4XA 1GCYA 3EDFA 2DQXA 3I3DA 2WBKA 4D6DA 2J8FA 3U5YA 1RD6A 3CZKA 2ZX9A 5ABGA 1LJYA 1BG9A 1PX4A 3MMUA 3ZR5A 1UH4A 3SCRA 1XSKA 3TTYA 2FDMA 5GNZA 4AYSA 4P8VA 1HIZA 5I78A 1TA3B 4UFKA 2UY4A 1R85A 4QLJA 5FIPA 4UFIA 1HL8A 3ARTA 3CHCA 1E40A 1F4HA 2CBIA 2EPKX 3GM8A 2D24A 1CXEA 4GO9A 7A3HA 2X8RA 5BXTA 4D6EA 5E6ZA 1E5JA 4GQRA 2IXVA 2J8GA 3MSGA 3VIPA 2WXDM 2GDVA 5A6BA 1UHVA 2A3HA 1RP9A 3WNNA 3ARZA 1QBAA 1V3KA 2JEPA 3SURA 1FH7A 3ZO9A 4HZ7A 2WMHA 3BAWA 3B9EA 5DT5A 2D0HA 2YA0A 3VU2A 3N04A 2TAAA 1JYNA 1FP8A 2J75A 4W87A 1V08A 5GQBA 1WE5A 2XFFA 1OB0A 2J7DA 4HOWA 4BF7A 5HPOA 1W32A 3VVGA 3EBVA 3K4DA 4PMOA 3FAXA 1VEPA 3DHUA 2V3GA 1CXKA 3FN9A 4HTYA 2VRJA 1LF1A 3M7SA 2VL4A 4DUVA 3DHPA 3WUBA 4BQ2A 3CUJA 2YKKA 1NARA 2UY5A 2Y8VA 3AZTA 3HJEA 3WSUA 4GXPA 1QPKA 3CHEA 3VMNA 1QHZA 1KQZA 1Q6DA 1JI1A 2FGZA 1QVBA 4J3UA 2E8YA 3O2LA 4MB3A 1OGBA 1UUQA 2E3ZA 9CGTA 4LGXA 4CVWA 2DH3A 4AW7A 1AMYA 2UWFA 2XHYA 1JAKA 1WAWA 2WCGA 2G3MA 2ZUMA 3AZRA 3SCQA 1B31A 2VX4A 1H41A 1CGWA 5A3HA 5CLWA 1W1TA 3FNDA 1BTCA 1NOUA 1XV8A 2PBOA 1LG1A 1J11A 4AEFA 2V3DA 2WM0A 3AHTA 3EDEA 4LXFA 1WDSA 1P6WA 2ZOXA 1UH3A 2VX7A 1QNPA 4JIEA 1Q6EA 4U5IA 1EA9C 4MAZA 4TTGA 1RPKA 4RE3A 4YHEA 3WNOA 1H5VA 2PI6A 3CPUA 3TP4A 5I2UA 1NOFA 2VI0A 4WJXA 5BWFA 1E15A 3WUGA 1WNOA 4ACYA 2XIIA 3U7VA 1CECA 5BXPA 1GOQA 3CMGA 1JG9A 4AC1X 1SMAA 1JDCA 3NUKA 3AXIA 4V28A 1B90A 2AMGA 3WQWA 4P7RA 3AFBA 2G3JA 4MDPA 4AD5A 1KR0A 4LYQA 3NJ3A 3THDA 1JYVA 2GK1B 2QMJA 3OLEA 1UWQA 4UZSA 1K6AA 1KXTA 3VDAA 1MQRA 2J47A 4FLOA 3GBEA 4DWSC 1V3IA 4OBRA 5EMYA 4X9YA 3N12A 5I6SA 1VJZA 2WAGA 2ZICA 1NP2A 4JFUA 2CEQA 1CEOA 2ZWYA 1YHTA 3F5LA 4Z2KA 4M82A 4AIUA 1X1NA 4P8WA 3UETA 4AZ7A 3L4YA 1V02A 1DWAM 1TVNA 2W4XA 3TA9A 4CU8A 4JAWA 2AAAA 5DEZA 4UFJA 5CPSA 5DT7A 3RJXA 2V38A 1C8XA 1NWUA 1MYRA 3ARRA 1AQMA 4GZIA 3WEZA 4CD4A 1EGZA 1W2PA 4EE9A 2ZUSA 2F2HA 2YL9A 4W85A 4FLRA 4D6JA 1IV8A 5JBFA 4HA1A 4W7VA 4PMUA 1HX0A 4UQCA 1U30A 3CHDA 3WIJA 4P8UA 4LPCA 2BVDA 2WYSA 3PTQA 3BAYA 2FHCA 5CZKA 5A6AA 2YBTA 1C91A 4R27A 1UQZA 1UKQA 4J3TA 4GIAA 1LG2A 1QHOA 3T2QA 1JFXA 5IXEA 2EPLX 3EDJA 1WZKA 3VILA 3VM7A 3WH7A 1GVIA 3SCOA 4OJYA 1PBGA 4DWSD 3UEQA 3VD5A 5GPRA 3RJYA 5C70A 1R8LA 1M04A 3RM4A 4E8CA 3VIGA 1FOBA 3NDYA 2YDSA 3PZVA 2WKLA 4UTFA 1Q4NX 4D6FA 3OIHA 1HJXA 2WWCA 3THCA 3SEPA 4AD3A 2W5FA 1KR1A 3T0DA 3OG2A 1NWSA 4UFLA 4A4AA 4ZXOA 3QR3A 3VIJA 2WMIB 2DIEA 1BQCA 2ZUVA 1OD0A 4UQDA 3W82A 4FF5A 2W66A 4ACZA 3VOCA 3W37A 1HF6A 3RCNA 2PWEA 3SIMA 3HMCA 2WMJA 1CGTA 4MPKA 1LL6A 4UFMA 4M1RA 4HZ8A 1ODZA 2ZUNA 4U2YA 2O9PA 1V0MA 3RIKA 5IDIA 2NW0A 1PPIA 2DH2A 3ARUA 2XGBA 3CUGA 2D3NA 1MQQA 3DECA 1J12A 2WWDA 4FK9A 2QPSA 5A94A 4JFWA 2DIJA 4CD6A 4GPNA 1EOMA 2W63A 5A6JA 4D1IA 1GW1A 3AIWA 2QPUA 1GQIA 5D8ZA 2J4GA 3GH5A 2IXUA 1EXPA 1KXQA 3AHVA 5DO8A 3AYSA 1BYAA 3QHMA 1CXHA 2G3IA 5IFTA 5I24A 3T2OA 2FHFA 3PZQA 5IHSA 3VIHA 5A8MA 1LWJA 2E8ZA 1PJ9A 2Q8XA 1XD0A 1JFHA 4RL3A 3ZT6A 3VDBA 1VENA 4PEEA 1OGGA 1B3VA 4AMCA 4D1JA 2WVTA 3WL1A 1QNOA 2BNJA 4UOQA 3WD2A 1GOWA 3UG3A 4PSPA 2CHOA 2WNWA 4B9ZA 4Z2IA 2YL8A 3HU7A 2XM1A 2WB5A 2YDRA 2WC7A 4WIWA 3SCVA 4J28A 2VOTA 3MSDA 1L0PA 3RM8A 4CCDA 4TUFA 1V3MA 4AD1A 2YLAA 3KEHA 4TOQA 1W3LA 2E40A 3W28A 4AZBA 3PZTA 1R86A 1PX3A 3WQ4A 4N0RA 3OGRA 4NZCA 1E4MM 3GXFA 2CXGA 2WK2A 1QHPA 4JKMA 4M81A 5CPQA 2RGMA 5EBAA 4B3LA 2EXOA 1GOMA 1XYZA 2BHZA 3VD7A 1E0WA 3UESA 3POHA 4CGTA 3MKKA 3MUIA 2WCAA 2ZX8A 1VFMA 5BRQA 2JALA 2E9LA 1V3HA 1S46A 4UR9A 1TR1A 3AYRA 5E09A 1HKKA 2QF8A 4PUEA 3W81A 1ISZA 4F66A 4PBGA 2VX6A 5CXPA 3KL3A 1E55A 1FP9A 4FLQA 5FL0A 5A6KA 1I1WA 1ZBKA 3FHAA 4GO8A 4HP5A 1JZ7A 4WSJA 1JXKA 1GHRA 2WVUA 1W9VA 1KXHA 1LWHA 3AHXA 2GJRA 4IM4A 3WFLA 4AD2A 1OCQA 1JZ8A 1EDTA 1BAGA 3ARPA 4W7UA 2J74A 5LA2A 2X09A 2WLZA 1QI5A 6CGTA 4M29A 1XH1A 1EO5A 2FHBA 4ATLA 4MJ4A 1Y7VA 4PYSA 1BPLB 5IFPA 1E6SM 3BH4A 1J18A 3AZSA 2GJXB 5A8QA 1UD6A 3AQUA 3K1DA 5EFDA 3BGAA 1WDPA 1QOXA 2XIBA 4MB4A 1CLVA 2WZIA 3FAWA 4PCTA 1KFWA 3WQ8A 2CCRA 4MNMA 3W29A 4OBSA 3NSXA 5CGMA 1E6NA 3VGFA 1KWGA 2B31A 3AHYA 4NI3A 1QNSA 2PWGA 4AZGA 4WK9A 1W3KA 3WD4A 3MU7A 1I1XA 4XZWA 1JI2A 2J7HA 1OSEA 3WMBA 4QAWA 1GHSA 4J3WA 2V3EA 1W91A 2OYLA 3GZAA 3WELA 4QLKA 4D6HA 5D4YA 4TX6A 1V0NA 5BYWA 3L2MA 2D20A 2C0HA 3GYCA 3WBAA 4F79A 3WN6A 4PMXA 1V6UA 3EMCA 1ISVA 2D0FA 4N42A 1PAMA 3EDKA 3W6LA 3MUZ1 3CO4A 1BFNA 2VVNA 1V6WA 4J3SA 1ITXA 1V02E 1JAEA 1CDGA 1UYQA 3OGSA 4KH2A 5JBDA 4ACZB 1HL9A 1VIWA 4H8HA 1B3ZA 2D1ZA 3ZOAA 3MS8A 3L2LA 3WENA 3MUAA 4Z2LA 3PZNA 3AOFA 1MXDA 3ZJ6A 1E73M 3ZR6A 3AXHA 5A6LA 2EPOA 4URIA 5A6SA 1E6XM 2HISA 3PTKA 4LX4A 4CD5A 2VCCA 3WDRA 4V27A 4PMNA 5AC4A 2OWWA 4JKLA 5IHRA 3QOMA 4P7QA 3W0KA 3MV01 4M80A 5ABHA 4EK7A 1UKPA 3BAJA 2J7GA 3B9DA 4HOZA 3WBEA 6A3HA 4NRSA 2VTFA 4CU7A 1E6QM 4D72A 1V6YA 1W3JA 4UQAA 5I79A 4UQ9A 3VDHA 2XTKA 5FL1A 3BMWA 4GI6A 3T0AA 2CBUA 1MXGA 1VAHA 4GINA 3VIIA 4OZOA 1CGXA 3CGTA 1UR8A 5E70A 1K9EA 2D3LA 2D22A 3OZOA 3WUFA 5D9NA 1KQYA 1B30A 1JDDA 4Z2HA 4W8BA 3CMJA 4F9DA 3A6OA 1ODUA 1VBUA 3O9NA 4E2OA 1UD5A 4KGLA 2V5DA 4MNLA 5FKYA 2BY3A 2GVYA 4H04A 4ZEPA 3GXMA 1V0KA 5HDRA 1D7FA 2BXYA 3DYMA 3UG4A 5LA1A 1QW9A 5BXSA 1UD8A 1BLIA 1E9LA 1HKIA 1C90A 1ESWA 5ABEA 4OUEA 2VMFA 2VJXA 4C7DA 2ZXQA 1FH8A 3IJ8A 1JF6A 4NSBA 3WQ6A 2ZXDA 4TTUA 3AS1A 3VO0A 1I75A 3PZ9A 2JFEX 5A69A 2EBNA 4HPHA 3ZJKA 5A6MA 2V3FA 5A2CA 3CZJA 2ZUTA 4U33A 4WKHA 2J79A 1GNXA 7CGTA 2WCSA 8A3HA 3CIVA 3D3AA 1JD9A 1QNRA 3AROA 1DP0A 2DSWA 1H11A 2GJPA 2AOSA 2NT1A 3PN8A 4W88A 2OSXA 1HJVA 4KRTA 5EB8A 1K9TA 4J3VA 3AHZA 3AIRA 4H2CA 3CBWA 3S6TA 4QLLA 1HN1A 4AZCA 4M24A 3A3HA 2BVYA 4CU6A 2YOCA 4PCSA 1E3XA 3AMLA 2VURA 1QI4A 4AZ6A 1N82A 4KGJA 4F9JA 2DDXA 4B16A 3QGVA 5E0CA 5HNNA 3BLPX 1K9FA 2J7FA 4MJ2A 3VNYA 4PSRA 1H3GA 3G6MA 5HPCA 3PZUA 3K4AA 3HN3A 2GK1A 5D9PA 2BY1A 4A3YA 4AIOA 1D2KA 2WHJA 2BHUA 3I3BA 3VIKA 1GOKA 4TVCA 2GDUA 1XYFA 2PB1A 4P7LA 1V3JA 3QHNA 1VFFA 4C7FA 1C8YA 3K46A 1GJWA 4R5EA 4DWSA 3AISA 4YN5A 1TUXA 2CIPA 2Y8KA 1KBBA 1XCWA 1JD7A 1BF2A 3IANA 1GPFA 2BHYA 3BAXA 4CD8A 3WQVA 4CUCA 4CD7A 1E3ZA 4JKKA 2PWDA 1NOWA 4QCEA 1O6IA 1E56A 1VEOA 1AVAA 3LPPA 5M3WA 1PEZA 3AIUA 3WNPA 1PZ3A 1AQ0A 2ZUWA 1G9HA 3ALFA 4HU0A 1JIBA 3D5HA 1UA7A 1CZ1A 4KMQA 4JFVA 1DWIM 1EDGA 2CYGA 3BCDA 4B15A 4K68A 3U7BA 1W1YA 3CZ8A 4WF7A 1OM0A 4EKJA 1CXLA 3KE0A 5DMYA 1ZJAA 1HP5A 2XGIA 4UZUA 3CTTA 3AMGA 3ZT5A 2VR5A 1MQPA 5FD0A 4X0NA 4WLCA 1ZBVA 7TAAA 1C7SA 4XX6A 4AWEA 1OIFA 2W62A 3NIYA 1XH0A 1CTNA 4P7NA 3AJ7A 2DSUA 1TA3A 1E6ZA 3QOKA 1WP6A 3WF2A 3O6AA 1KBKA 1V6XA 1PIFA 4HPGA 2DSKA 2XUCA 3VGGA 3OBAA 2XYLA 4AISA 4PUDA 1ZU8A 5HOSA 1E1FA 3VD3A 1GONA 1MW3A 4PMZA 3AMKA 5CSYA 3SCUA 1QI3A 5TD4A 3B8SA 5AYBA 1LQ0A 3FHQA 8CGTA 3VIOA 5GNYA 1VFUA 4NRRA 1C92A 3WH9A 1U2YA 2W67A 5JBEA 4KWUA 2VO5A 1O7AA 3PBGA 1KB3A 5DF0A 3MUY1 1FH9A 2D23A 4W93A 3PZIA 1Q6CA 3WD0A 1IZKA 2E0PA 1H0GA 1DEDA 2QHAA 2A3EA 1W1PA 1V3LA 2QLYA 4BA0A 2DPEA 3T09A 3WMSA 4WSKA 2CBJA 1UZ1A 1US2A 1DWHM 2F8QA 2O9OA 1OIMA 2VX5A 2VVSA 1QNQA 4QCFA 1HKMA 4S3KA 4CCCA 3VIFA 5I77A 1KWKA 3RILA 3II1A 1EH9A 1H1NA 2FH8A 4BZYA 4JFTA 4EANA 2CHNA 4HZ6A 1QBBA 1RP8A 2CITA 5AYIA 3ZIZA 1UR1A 1TZ7A 2EPNA 3N1AA 3N15A 3A4WA 4IPNB 3WH8A 4H41A 1TVPA 1BYBA 1AQHA 5M17A 4GI8A 2WPGA 2GFTA 1CXFA 1Q6FA 5CLTA 2JE8A 2XPKA 2X0HA 2XWDA 3B9AA 4HMEA 4BQ3A 4UQEA 3DYOA 5CG0A 1E70M 1JGIA 4WKFA 5JUVA 1KCKA 2DT2A 4RE2A 1R7OA 4W8AA 2PBGA 4J27A 1X6NA 2XWEA 1ZB5A 2G3NA 3KL5A 4JCMA 2JIWA 1HJUA 5E6YA 1ISYA 2WC3A 1CGYA 4MADA 3K8KA 1WDQA 2WBGA 1IT0A 1OT2A 5JIPA 2XFYA 1EDQA 2Z1SA 2CERA 3CZLA 1CNVA 1W9UA 1XD1A 3VD4A 2WMKA 2IUZA 2EO7A 1C7TA 1UR9A 5D8WA 4ML4A 1DWJM 3ECQA 2WMGA 4B9YA 1XSIA 2W61A 2GSJA 2WZEA 3CUHA 1UWUA 2CESA 2HVMA 4ZXLA 5A6BD 1KXVA 4DUWA 1WO2A 1XRVA 4XV0A 2JF6A 3DC0A 1TE1A 2CNCA 4DWSB 2PWHA 3AICA 2NSXA 4OOUA 1JZ3A 4GZEA 5CSUA 1J10A 3I3EA 1B2YA 2PF0A 3WF0A 2G8ZA 3VD9A 1EQCA 4W7WA 1NQ6A 1CLXA 2YBUA 4D6CA 1WDRA 4OKDA 2DT3A 2WSPA 3WF4A 2VQTA 3NCOA 5A2AA 4AZCB 4OOZA 4MDOA 4L4OA 2VZOA 4TVDA 3UG5A 1E43A 1D3CA 4D6GA 1CGVA 2OLHA 2X1IA 1R7AA 2G4FA 1J0KA 4ZFMA 3BMVA 2J25A 4HMDA 2VNCA 2CBVA 3UERA 4E4PA 3E1F1 2VQUA 1E1EA 3ZT7A 3MANA 3VX1A 2NT0A 4IUGA 2D2OA 1W9PA 1BGGA 4Q22A 3PTMA 2ZUUA 4CN1A 2ZWZA 4J3XA 1GQJA 3MO4A 3AMDA 1E6PA 4AY1A 1WZAA 4U3AA 1JNDA 3EYPA 3GDBA 2VRKA 1CYGA 2O9RA 1GZJA 1W2VA 3LPGA 4KRUA 2UY2A 2VZTA 1HNYA 2ZIDA 3L4VA 3T2PA 3ZJ7A 1PIGA 2WVVB 3RDKA 4LYPA 3W4RA 1QW8A 3ARSA 1HJQA 1C93A 3SCNA 3OGVA 3T0BA 3N11A 2QMKA 4EAMA 3IJ9A 1J0ZA 3WF1A 3ARYA 2OWCA 3M6DA 4W86A 4CCEA 5DFAA 1H49A 1UR4A 3SCWA 3K8MA 4FMVA 5BCAA 4QFUA 3BSHA 4MB5A 3JUGA 1BGAA 1HJWA 1J0JA 2CKSA 1RH9A 3F5KA 4J7RA 4PMVA 3N9KA 4CKQA 2DSVA 4GQQA 1NWRA 3AIVA 1UD2A 3ZSSA 1TMQA 2A3CA 4IISA 1HVXA 3POCA 3CLWA 2E9MA 1VF8A 1SMDA 1MW1A 5CPTA 4MTVA 4GZJA 3VGEA 1MFUA 4H8UA 3SUTA 4LQ1A 2Y4SA 1CENA 1ZS2A 3OLGA 1TFVA 1ITCA 3SCSA 3KZSA 4XB3A 2J7CA 2O9TA 2WZHA 3ZSTA 1XHGA 1QI0A 2WHKA 2XG9A 3WH6A 1JF5A 3ARWA 1J9YA 4DUXA 5M03A 2WW5A 2BS9A 1BG4A 1LL7A 3VGHA 3T08A 5GNXA 1W9DM 5FOOA 1BYCA 4UCFA 3WF3A 4DM1A 4DM2A 1EIBA 1KGWA 1WB0A 3W26A 1JL8A 1JZ2A 2VCAA 4YPJA 4W84A 1MW2A 2DT0A 1XCXA 1J0IA 1ZL1A 2VR4A 1C3FA 1DHKA 2FH6A 3N18A 2BY0A 3WEOA 4E8DA 2Z1KA 4JFSA 2Y24A 2Y5EA 1DTUA 1WCGA 4BS0A 2ZE0A 4AZHA 4U3CA 3ZM8A 1UOKA 1CIUA 4PTXA 1LL4A 2YDQA 3WMCA 4MNKA 4GKLA 1LLOA 2VC9A 4S3JA 4JHZA 4D71A 3W27A 4PMYA 4CVUA 2ZX6A 2XSAA 3GNRA 1M03A 3N13A 1J01A 1BSIA 5FCZA 1VBRA 1M01A 4HMCA 3L4WA 1UR0A 3W24A 1E72M 2BY2A 1JDAA 3BXWA 3RM9A 2X0YA 4NF7A 2J77A 3A47A 4Z2GA 2DEPA 1MVYA 1GUVA 4OIFA 4UNIA 3CH9A 1B9ZA 3GXIA 1HP4A 1YQ2A 1VRXA 1W1VA 2YA1A 1UG6A 1CGUA 1Q6GA 1GVYA 1ISWA 2VRQA 1HJSA 3MMDA 2EPMX 3F5JA 1JYXA 5I3DA 3M07A 1SR0A 5E0FA 1QI2A 3VNZA 3BAKA 2BV9A 3GH4A 3SUUA 3MMWA 1CPUA 4XZBA 1UR2A 1ZBCA 3OA5A 5KZ6A 2YJQA 2W92A 1EQPA 3VKKA 1H2JA 5CJ5A 4UOZA 2CETA 1FHDA 3ARVA 5A8OA 3EMZA 3VDCA 3VM5A 3ARXA 2X05A 2YL6A 4TX8A 4PMRA 1US3A 3AIBA 3NSMA 2Y2WA 4UFHA 2OSWA 5E9AA 1E6RA 3VGBA 3GTNA 1KCLA 1V0LA 3ZJ8A 1UZ4A 4ZENA 1B1YA 3VIMA 5KEZA 1G94A 2WLYA 1TCMA 3WD1A 3K8LA 3OZPA 4U2ZA 1GQLA 2GJXA 3TTOA 3AS0A 5A8NA 5HBFA 1BVNP 2J62A 2EJ1A 1G1YA 1UA3A 4JHOA 5JIWA 1OGSA 1W3HA 2X2YA 3BCFA 2EEXA 4B3KA 4BQ4A 3G6LA 5D9OA 2VT0A 3APGA 4XUYA 1UWTA 1PZ2A 3OLDA 4FLSA 3SUVA 3SCPA 1JZ6A 2XFRA 4W5ZA 3W53A 2YA2A 2E4TA 3IAPA 1KGUA 5HXMA 1J0YA 3ZMRA 5A2BA 3UCQA 1JZ5A 2VCBA 3ARQA 2VZUA 3LMYA 4L4PA 3S2CA 1JYWA 4H8VA 4UQBA 1OINA 4JL2A 5ECUA 4AZIA 1HVQA 3QHOA 1NWTA 4PTWA 2YL5A 3CZEA 1VFOA 4ZE4A 1UWRA 3WNKA 1BVZA 1WPCA 2CKRA 3F4VA 1H0IA 2C7FA 4MAVA 2OYKA 3L4UA 4WKAA 1DWFM 3WNMA 5BXRA 2XJ7A 2VZSA 1V6VA 4Q7NA 2XVKA 4HOXA 3BC9A 4PTVA 1Z32X 3UR7A 2VZVA 1NM9A 4W89A 4A3HA 5A8PA 1M53A 4JL1A 2XVGA 1GOIA 2JIEA 1WZLA 2ESCA 1SYTA 3N17A 4LYRA 1MWOA 1G5AA 3A4AA 2XVPA 1FFRA 2D0GA 3VPLA 5AY7A 3WDHA 3ALGA 1C8QA 5BRPA 4JCLA 4PTMA 1BYDA 1GORA 2QV4A 1W9BM 3GXDA 2WKGA 1FHLA 1WKYA 1EHNA 3PHAA 2BXZA 2GUYA 3VTRA 2BFGA 1XC6A 4D6IA 2W91A 3FXYA 3NSNA 3OLIA 5ABFB 1HXJA 1UKTA 1F4AA 3SUSA 2FGLA 3DYPA 5I5RA 3M46A 2DSZA 4P8XA 1UKSA 5CQ1A 5D9MA 1GQKA 2ZX7A 5A95A 2MANA 1H4PA 1R87A 3EMQA 3WQ5A 1B3WA 3SCTA 2XSBA 4JZ5A 3LPFA 4AZ5A 1V03A 2ZXBA 2JEQA 2OSYA 3ZQ9A 1OD8A 4PMDA 3CZGA 2RGLA 3NDZA 3WNLA 3FY1A 2JF7A 3U5UA 1FFQA 1XSJA 1E4IA 2DT1A 3AS2A 1GJUA 2WHLA 3AXXA 1UD3A 1OT1A 5AC5A 5C8BB 3VGDA 4AIEA 2WVSA 3WUEA 1E71M 4W8LA 3GH7A 2WANA 1NP0A 2WVVA 3VMOA 3WL0A 3OB8A 3WDIA 3CUFA 1CXIA 1H09A 3WDPP 5M5DA 4UOJA 3W38A 1TG7A 2A3AA 1EO7A 3KL0A 1PX8A 3CHFA 4HA3A 1VJSA 1L8NA 4RE4A 1HKJA 5C71A 5LA0A 1M7XA 3PZMA 4QP0A 5I0DA 1FA2A
chains in the Genus database with same CATH superfamily
4S1FA 2EJAA 4NILA 3BUVA 3VUPA 4PTNA 3G1VA 3CUIA 2NUWA 3NVDA 3G1SA 3NQFA 2WNQA 4GRSA 4DF2A 5DELA 3RO8A 1RY8A 2ADAA 4HQVA 2QQ6A 2Q3OA 2R1PA 2AKMA 3OZMA 4H7CA 4UXDA 4W9TA 3W83A 3EAUA 1SFSA 2E68A 2A3BA 3RXZA 1ISXA 3PPCA 5BW6A 5D09A 3FK4A 1R3SA 1YXCA 1A5UA 2G0WA 3GK0A 4XD5A 3U3HA 4Y6GA 1J8VA 4NKCA 1MW0A 4V33A 4ZCWA 3KBNA 3LX9A 2WHMA 3BAIA 4LSBA 4IPLA 3T40A 1JNEA 3WKZA 4AH7A 2VUNA 2YLLA 3RPMA 1CWYA 4AHOA 2SFPA 3TYBA 4NNCA 2ZX5A 2QCHA 5E5CA 5CC6A 3VNIA 3AIQA 1W9XA 4YHGA 5FJTA 3W86A 3V16A 5BROA 1XDLA 2J7EA 3WH5A 1E0VA 3HQOA 1RCXB 3W70A 1XGZA 4GC3A 2C15A 1XYAA 4JBRA 4ZO7A 1ECEA 1EOKA 4GC4A 4I7WA 4AD0A 2IKIA 3HO8A 1E5NA 4CN4A 1EX1A 3CT2A 1PWMA 1KTBA 2F61A 2UV8G 3MV11 2Y85A 1ZAHA 3GHRA 1WZMA 1IEIA 1W56A 4CLMA 3TTSA 4H3DA 4HBKA 2RJHA 1NH6A 2NQHA 4JNMA 3TK7A 3UVAA 1UD4A 1HT6A 2Z1WA 3N25A 3U57A 4DYJA 4ZVJA 3SR7A 4LALA 4AQLA 1XBZA 1GCYA 3VZZA 2Z28A 3CIWA 2E1WA 2Z6IA 1RD6A 2ZX9A 4RZ4A 4MHBA 1PX4A 2D69A 2YR1A 1XSKA 4ES4A 1TB3A 2O0TA 2B7PA 3SQMA 5I78A 4UFKA 4UFIA 4GXMA 1F4HA 2D24A 3DU0A 2VFHA 3RHGA 3SO7A 1OCBA 1E9YB 4C90A 4D6EA 4GH3A 1E5JA 5C9UA 3NOEA 4BEUA 1Z44A 1F5ZA 3VIPA 4NYYA 2I7GA 3R8GA 2Q09A 4RE0A 2CZEA 3ARZA 4OV9A 1V3KA 3APYA 1RJPA 3SURA 4F0SA 3CV6A 3B9EA 1LORA 2TAAA 2XDFA 1XIDA 1H61A 1S3HA 5GQBA 4FNSA 3S6DA 3VVGA 2EG7A 3FAXA 3EOOA 2ASHA 7ENLA 4HTYA 1NSJA 3LU2A 1D9EA 2X1SA 3WUBA 3NA8A 4H8NA 2YKKA 3HJEA 4OHQA 3WSUA 3S1VA 4A6GA 1TELA 1Q6DA 4J3UA 5HJLA 4MB3A 2XIMA 4BWLA 4W4QA 2E3ZA 1K6WA 4LGXA 4CVWA 3TJXA 2XHYA 1KRBC 4KIRA 3AZRA 3NZPA 4ILSA 4EPEC 1CGWA 1NOUA 2V82A 2V3DA 3S5NA 5BZAA 4PGLA 1A5CA 2ZOXA 3PPHA 1L2UA 3BLFA 3QBUA 4XO6A 4HU4A 4U5IA 1W3TA 4M0XA 3ZLFA 1EWDA 4TTGA 1RPKA 3JR2A 2GLKA 2FFCA 2G97A 5CZSA 2A4AA 3OBEA 2PI6A 4QSHA 5I2UA 1MEIA 3W2LA 4WJXA 5BWFA 1NDWA 4GG9A 1E15A 3UFYA 4BHYA 4B3ZA 1JG9A 4QS6A 3AXIA 3L23A 4RK8A 1GGOA 3SQLA 2HNHA 1TV3A 2YXOA 3AWOA 3UU0A 3RUBL 3R2GA 1GYLA 1TRIA 4AD5A 1W1B1 3NJ3A 1D8CA 5CSRA 2GK1B 1L8PA 1UWQA 2XH4A 3VDAA 1MQRA 1DXIA 4HNLA 4X9YA 4S2CA 4YS1A 5FEZA 3U2CA 5LNVA 3L68A 4IMGA 2A7RA 3U6WA 1VJZA 5FA5A 3LGDA 3NURA 5FJPA 3UW6A 3CL8A 2CEQA 3RG6A 3F5LA 1A5SA 4LUTA 4Z2KA 2DORA 4AIUA 1V02A 3N4EA 2F6UA 1DWAM 4JDYA 1TVNA 2OU4A 6REQA 4CU8A 3K13A 2AAAA 4UFJA 5DT7A 4LNYA 4GFSA 3E0LA 3PP7A 1A5AA 1F76A 4K1WA 1AQMA 3NL3A 5GJPA 3WEZA 1W2PA 3UG8A 1SZEA 2FPVA 3MT1A 2YL9A 2VFDA 4FLRA 1QCWA 4D6JA 2ACQA 4W7VA 2NXGA 1OFPA 3WIJA 3GS6A 2GWGA 4M3PA 3BAYA 2R14A 4R27A 1HTIA 3LERA 5LIWX 3H4XA 2J8TA 4GVIA 2EPLX 2QCMA 3EDJA 1OZQA 3PB2A 2A2IA 4F0RA 4MLJA 1PBGA 4DWSD 4JQ2A 3UEQA 3PBYA 5GPRA 2HXUA 3RM4A 3V4BA 3TR2A 3G8EA 3NDYA 1H1YA 3WQCA 4L6DA 4PR4A 4UTFA 5BMWA 4JTHA 5AHLA 2REQB 2WWCA 1XIJA 1PTGA 2PDXA 1Q2SA 3T0DA 4A4AA 5EY5A 3OZYA 3MWAA 3RX3A 1EF3A 1BQCA 2ZUVA 5J5DA 5K4ZA 3C5QA 4UQDA 4AHPA 1YPIA 4XVDA 4PB4A 3DC8A 3F1QA 1EJRC 1HF6A 4PL1A 4RW3A 3TKFA 3HMCA 4C6OA 1FWIC 3B05A 4GJ1A 4A8IA 1F05A 2PU0A 4L5ZA 2ZUNA 4GK8A 4U2YA 1D8WA 1V0MA 3GTHA 3DXIA 4K8HA 4C6JA 3EOSA 4BY3A 3PS7A 4JFWA 4GYFA 3MDUA 3W3OA 2PUZA 5A6JA 4XTIA 4D1IA 1ONEA 1M7OA 4XG1A 3VKDA 1NFBA 2QPUA 4XZHA 1JCLA 3QGAC 2F6KA 4C1KA 3AO0A 1QR7A 3K5XA 5DO8A 3RGTA 1CXHA 3KOZA 2R6OA 1SVDA 4GBUA 5DY2A 5IHSA 1KKRA 1LWJA 2Q8XA 3T07A 1OK4A 1JFHA 1P48A 2W9MA 3O15A 4R7JA 1QNOA 1DHPA 1GOWA 3UR5A 3SFKA 4MSSA 4IF2A 3BGJA 2WNWA 3NFUA 2WC7A 4WIWA 3CB3A 3WLTA 3MSDA 2VC7A 3DBNA 3KEHA 1GK8A 1NTHA 3W28A 2X1RA 1UZHA 5FJJA 3TN3A 1J96A 1N8FA 2CLLA 3GXFA 3W1UA 2ZFAA 4ZZ9A 3HG3A 3M0MA 3S5OA 1GOMA 2YCKX 3AAMA 2QVNA 5HWMA 4AWTA 2HTMA 1F3EA 3TZFA 2ZX8A 5E93A 1Z7AA 4GKTA 4UR9A 5E09A 3M16A 3EPOA 3BLOA 3U9IA 4XAPA 3LM7A 3LLFA 5DMLA 5D02A 4K36A 5BNKA 3KL3A 3FHAA 1GYMA 4H00A 1GHRA 4HMNA 2X16A 1O95A 1ZNNA 3GW0A 3NOYA 1LWHA 3TX9A 2FTWA 3MVTA 1JZ8A 2ZRXA 5DQPA 3ARPA 4XVEA 1EGMA 4W7UA 3TLQA 4QITA 5HMFA 2WLZA 2GPTA 3QQ1A 1FBAA 1XH1A 3EXRA 3H70A 1Y7VA 4LYKA 1BPLB 4PYSA 3CT7A 1J18A 1OYAA 4P61A 3AZSA 2GJXB 3K1DA 3K1GA 1XX1A 3DFNA 2XIBA 1CLVA 1M9HA 3LCFA 4PCTA 1KFWA 2DQWA 4MNMA 4RCXA 3NSXA 5CGMA 1E6NA 1OX6A 3E96A 3NXLA 1A4MA 3FX4A 4AZGA 3RLHA 2J7HA 4C1NB 1VLWA 4K1GA 2PSNA 2V3EA 3L67A 1SGJA 2OYLA 5B7YA 2BGSA 4LH8A 2HRWA 3IV3A 4FNQA 3MI6A 2C0HA 4V1XA 4HIBA 3WBAA 3TUUA 4PMXA 4WEVX 2YPIA 3EDKA 4CQ9A 3MUZ1 3W22A 4CQ8A 1BFNA 2PDPA 1V6WA 1YPXA 3ONBA 3KBSA 1JAEA 1UYQA 3OGSA 5JBDA 4RXFA 4I90A 4ACZB 4A8RA 4H8HA 2QJHA 3MS8A 3WENA 3ITGA 4JX5A 4A3UA 3ZJ6A 3ZR6A 3C8FA 4JN8A 4MIMA 5A6SA 2NZLA 3HQNA 4LX4A 4CD5A 2VCCA 3WDRA 4PMNA 4Y8FA 4DZHA 3THAA 3DUGA 4LUTB 4M80A 4MGGA 3G1XA 1JPKA 3BAJA 4DPQA 2QUMA 3C2RA 3WBEA 4NRSA 1ZLPA 1W3JA 1K7EA 4UQAA 3DENA 3TYAA 1GW9A 3PPFA 3CJPA 3VIIA 4OZOA 3CQKA 4S3CA 3RR1A 1K9EA 2UBPC 2D3LA 3VK5A 4ML9A 4NXKA 1EPVA 3OZOA 4JQAA 4L6OA 3TNOA 4Q8PA 1B30A 1ZFJA 3UYCA 3H26A 4E2VA 4BI7A 3LCXA 4JD4A 1Q3NA 3PNUA 2GVYA 4H04A 4NAFB 1V0KA 5HDRA 2IPWA 1TPUA 3CWOX 3WQPA 2BXYA 3BTNA 1TV4A 4IIDA 5BXSA 4OVXA 1E9LA 2J13A 1HKIA 4WVXA 2VMFA 4C7DA 3W7CA 1S2TA 4NSBA 1B57A 3AS1A 1IGWA 3BO9A 2DVUA 2E6AA 2JFEX 3SADA 2GGJA 5A69A 2EBNA 3SAZA 3HG4A 5CH9A 5AHIA 2V3FA 3EB2A 4IJRA 4WJEA 5LNWA 1GOXA 1OFEA 7CGTA 3T4WA 3VFCA 3TROA 4JIPA 1MNZA 3D3AA 3ITVA 3CK5A 3DCPA 3M9YA 4C6MA 3VNLA 3OP2A 2ZRWA 3FXGA 4DX3A 2GJPA 2NT1A 3H23A 1HJVA 1LDCA 1YW1A 4J3VA 1FRBA 1W3NA 2POZA 4O19A 4OQVA 4AZCA 4D9PA 3A3HA 2BVYA 3W9ZA 4KCTA 2VURA 4AZ6A 3LSCA 1W3IA 1AW5A 1FDZA 4UTIA 3VKJA 3RPDA 4UNLA 3VNYA 4JQ4A 3G6MA 4KERA 5HPCA 2WOQA 3E6EA 2HXTA 2YCEA 5FEWA 3KBWA 2BHUA 4DYEA 4LC8A 4TVCA 2GDUA 5M1TA 1V3JA 3GZ3A 1VFFA 4C7FA 1VJIA 4BK9A 3FLUA 3M5YA 2CLPA 3MBDA 1TUXA 4ZOAA 2W79A 3LRKA 4GLEA 4F0MA 2YCIX 1XLDA 4CD8A 3WQVA 2DVXA 4G8TA 3G0XA 2PWDA 1XLJA 5HJYA 4QCEA 1RY0A 3LPPA 4GA8A 1TE6A 3UZZA 3RX2A 3AIUA 2X2GA 3WNPA 1JIBA 4KMQA 2YDAA 1EDGA 3RITA 3ZLHA 3UXDA 1YBQB 3U7BA 3CZ8A 4EKJA 3REQB 1ZJAA 3GNXA 4CNTA 1AG1O 3KHDA 2QDEA 3V3WA 3NEHA 3NG3A 1TZ9A 3KM8A 1M68A 2QUNA 1MQPA 3D47A 4X0NA 4OE7A 2XH7A 3L0GA 4QE1A 4AEOA 5CPLA 4K2SA 2XISA 1XH0A 4EPKA 1DJWA 3HPXA 3BV7A 3TH6A 2DZAA 1T41A 1XJBA 5DMNA 1R2SA 3O6AA 2Y7GA 1PIFA 2E1DA 3BZJA 4PUDA 4F48A 1NJJA 2XZ7A 1E1FA 5CPNA 1MW3A 4AC7C 1EEPA 3BDKA 3G18A 5CSYA 4YYCA 2IKGA 1ZAJA 3FHQA 1RAKA 1YEYA 5G1MA 4ADTA 1KM4A 4O16A 1U2YA 2C0AA 3R12A 5H1WA 2KZHA 4ZO6A 3W2NA 5DF0A 1K77A 3I6TA 3I7RA 3GIYA 4B5XA 4UTLA 5T9CE 1H0GA 1Z3NA 2HE8A 4IP4A 4DJFC 4YTRA 3DH7A 5SWUA 2ON3A 4L9YA 1OF8A 2ONEA 2GOUA 1UR3M 1US2A 1DWHM 1J2BA 2F8QA 3TMQA 1VFTA 4KQNA 4S3KA 3N29A 3A3WA 2OCZA 4CCCA 5I77A 3II1A 1H7NA 4S38A 4LS2A 1H1NA 5MKGA 1AODA 4JFTA 2CHNA 3Q45A 2CITA 3ZIZA 3GRIA 2CWXA 4K38A 2Z29A 4IPNB 3EWZA 1FWDC 4O11A 1QOQA 2QKFA 1TVPA 2FJKA 4IFKA 4EOUA 4O50A 2X0HA 4HMEA 3B9AA 3H22A 3C8NA 2QDHA 3DYOA 4ZMGA 4UTTC 3KX6A 1KCKA 3UWQA 4S23A 2QPXA 3B4UA 2PBGA 1X6NA 4IPPA 2Z0IA 4DJDD 2XWEA 1ZB5A 3O6CA 3KL5A 1KC7A 3H2MA 5CKSA 2WC3A 4JTDA 1EUNA 3K8KA 3SIZA 2WBGA 4IMDA 3KTCA 5JIPA 1FDJA 5DANA 4Q7IA 2I56A 5CC7A 2OZTA 2NV9A 2Z1SA 2CERA 3CZLA 1CNVA 1OJXA 1C9WA 1IT8A 3VD4A 5CZ0A 3VE9A 1SO4A 1UR9A 3OEXA 1WA3A 3MW7A 4ML4A 1XSIA 2W61A 2GSJA 3U4FA 1PIIA 3OU8A 3TCEA 2Z2UA 3F4CA 1KXVA 4EF9A 4DUWA 1WO2A 1XRVA 4XV0A 3IIZA 3HGRA 1Z6KA 3DC0A 5E1QA 3EWYA 1TE1A 2CNCA 4J4KA 4DWSB 1JZ3A 1AW1A 3TJLA 3O6YX 1PKNA 3NPUA 3GC5A 4LF1A 3IACA 3FJNA 3KVJA 1IXPA 3O7UA 4OKDA 1OFBA 2WSPA 4QQ3A 2RDXA 3NQ2A 4L4OA 4IWWA 4TVDA 4MUZA 1D3CA 2DIKA 1CGVA 2OLHA 1R7AA 3BMVA 2CLMA 3DG7A 3TDFA 2WQPA 2HZGA 4DBUA 2NQJA 1E1EA 1T6MA 3WK0A 3QV9A 3S1GA 3LN3A 4R88A 5ECVA 4X22A 1F6KA 2Y6ZA 2ZWZA 1F3XA 4JX4A 3MJMA 3W1AA 4LANA 1E6PA 5HULA 3EYPA 4F2UA 3WX7A 3EGJA 3VKCA 3M47A 3SGGA 4FOKA 4JGDA 3M4HA 3LPGA 3MP5A 2UY2A 5L9FA 3UPMA 2B7OA 3C2EA 3B8VA 4NYUA 2WO5A 1MNSA 4YVPA 3WMLA 5C9WA 3LQLA 1EBHA 2AL1A 3CWNA 1HJQA 1XISA 3KRUA 3RN6A 3QYQA 1V8EA 1A0CA 2QMKA 4LAUA 2V30A 4PUKA 4JQ1A 2C1IA 2PLKA 5I03A 4ZOCA 2OQYA 5D2WA 3SCWA 4FMVA 3V0UA 4DPPA 3LGGA 1TX0A 4P2VA 5F4SA 5I00A 1G4PA 1J0JA 1O66A 4NG3A 4C5YA 3LB0A 3W2KA 3N2OA 4FX8A 4CKQA 3TU9A 3FOKA 4MVAA 3BOXA 1QAPA 3AIVA 4UR7A 1LTDA 3ZSSA 2A3CA 1TRDA 3TQPA 3CLWA 2E9MA 1OC6A 3F4DA 3OBKA 1MW1A 2QJNA 5IBXC 3VGEA 2VFEA 2AGTA 3EWXA 4H8UA 1GTHA 4C6QA 4OV4A 4HNCA 3N2TA 3SCSA 3KZSA 1JUEA 3CEUA 3LUTA 2V0TA 3SM0A 4S2BA 2J7CA 3CHVA 3KTSA 2WZHA 3ID7A 1XHGA 1JF5A 1J9YA 1XDMA 4DUXA 5M03A 2MUCA 1K02A 3UZWA 5KINA 5GNXA 4GACA 4XZLX 4UCFA 4DM1A 1RXOB 4DM2A 2PDLA 1JL8A 2XGZA 1XLIA 3TYCA 2NQZA 1MW2A 4PB3A 4PL2A 4YNGA 2DT0A 1XCXA 4JIRA 1KM5A 1ZL1A 1M3UA 3AJXA 2P10A 1C3FA 5I7GA 3MB9A 4JNYA 2BY0A 4LU0A 1DTUA 1WCGA 1QK2A 2ZE0A 4AZHA 3ZM8A 3N2BA 2DW7A 3H8AA 2VC9A 4ZB2A 4JHZA 5AZ0A 3EWBX 2XSAA 3NEVA 2PURA 1BSIA 5FCZA 3UP8A 5A8GA 3E38A 4YYFA 3L4WA 3HMJG 2GOKA 2A7NA 3W24A 4BJHA 3HBLA 2X0YA 2QXWA 4NF7A 1ICQA 3GX9A 4QE4A 2DEPA 3FVMA 2DP3A 1DORA 2PWVA 3SSJA 5FESA 3CH9A 5TIMA 3ITYA 3GXIA 1HP4A 1DE5A 4QEHA 1VRXA 5D05A 1JDFA 3QQ0A 2VRQA 1H1ZA 4NL1A 1ME9A 3W23A 1L6WA 1JYXA 2BODX 1SR0A 2YW3A 1S39A 1OHLA 4PRTA 1QI2A 4EPDC 1B3OA 4CNPA 4DI8A 2BV9A 3GH4A 3S47A 3PSWA 3MMWA 1CPUA 1PXGA 4HCDA 5KZ6A 1MUCA 4PBFA 2W92A 1EQPA 4HKPA 3SN0A 5CGQA 3ITLA 1W8SA 2ZYFA 3TE9A 4UOZA 3ARVA 2Z2BA 3JU2A 2DJXA 1XICA 3RLGA 2OSWA 4NZFA 1E6RA 3GTNA 1V0LA 1VHNA 2PC4A 5KEZA 3VIMA 1ZAIA 2RAGA 1G94A 1ADSA 4Z1DA 3WD1A 2QEZA 1LROA 3RFAA 4D8LA 2GGIA 4JX6A 5REQA 2X2YA 1OYBA 2EEXA 2QGHA 3GDKA 4US5A 2X30A 3LCHA 4KEMA 3APGA 1MDLA 4EX4A 3OLDA 4UNKA 5DCDA 2E77A 2XFRA 3IUHA 2E4TA 1J0YA 3ZMRA 4H6EA 1OFOA 2VCBA 3I65A 3L12A 4L4PA 1EF2A 3IIOA 1SO3A 1XYCA 1OINA 1RUSA 4JL2A 4AZIA 4HGXA 3TC6A 5DLCA 1V6TA 3M1ZA 2OYKA 3WFAA 4WKAA 5AOUA 3NYZA 1VCVA 4N4PA 1DV7A 3BC9A 4KWSA 2VZVA 4D8AA 3L7RA 4W89A 1M53A 4GYJA 4JL1A 2XVGA 3OODA 3MTWA 4Y9NA 3VE7A 3GTFA 3ONCA 4OU1A 3A4AA 1GKQA 1FFRA 1TV8A 3VPLA 5AY7A 3HIJA 3ALGA 3UNTA 3WDHA 3LBCA 5BRPA 1TV7A 4IX0A 1BYDA 1GORA 1AL7A 3S9IA 1EUAA 4H6RA 3GXDA 3S4TA 1H7WA 1XC4A 3P5YA 3S46A 4DAIA 3H2CA 4HU3A 1DIDA 2BOEX 3VTRA 5I3FA 3WLLA 1KM1A 3FXYA 4K39A 1R2TA 3NSNA 3NPWA 3FJ4A 3O1NA 1XIMA 2RHGA 5T9BG 1F7BA 1NDVA 1ML1A 2VP8A 5IRPA 5LNUA 3KCJA 1TO3A 4G7EB 3R8RA 3TEVA 1K03A 1XYMA 3B4YA 3U8GA 4AZ5A 4JOMA 1V03A 2QCEA 1KRCC 2ZXBA 3ZQ9A 4PMDA 4E3VA 3NDZA 1SO6A 2VKZG 3U5UA 2C16A 1XSJA 3KS5A 2JGQA 2QNEA 1M7JA 3AXXA 1OT1A 5C8BB 3IRDA 4AIEA 4BWLC 3WUEA 4W8LA 3GG1A 2WANA 3WL0A 3OB8A 3CTLA 3MCOA 3L5LA 1JUKA 3QSTA 4YJ5A 1DVJA 3W38A 3WLOA 3HF3A 3E49A 2HEJA 4IGSA 3GHSA 3UZYA 3Q4DA 1HKJA 2FIQA 1F8IA 5LZLA 1CXKA 3NO3A 3PUOA 4P7OA 5HQEA 3H2OA 5CC5A 4GVFA 1UH2A 4HT3A 1IEWA 1H51A 3BLKA 3PNZA 4KRZA 2JK2A 4UTWA 4NJJA 2OJPA 2O92A 4NAFA 4LY4A 1VBJA 4A29A 5LXXA 5IOBA 3DKLA 2Z1BA 1OWQA 3U2OA 4Z1AA 2ACSA 4Z2JA 3BJFA 4KWOA 1E4LA 3LCIA 2O7QA 2UY3A 3V5OA 3AU6A 5LIYX 2OYMA 2BTMA 1IHIA 4TX9A 3T78A 1TJ0A 3MZ2A 5CBBA 3CEPA 4DF1A 2DGAA 1ICPA 1DWGM 1UWSA 5CGTA 5C7HA 2WV8A 1A47A 3CQHA 5F7UA 1J5TA 5G5IA 2NVCA 2Y5SA 2HDJA 4YWIA 3WDJA 3GBDA 1S1PA 3EZ4A 3L4XA 2DZWA 1JZ4A 1QJWA 1KGXA 3C56A 2WZTA 2ZVIA 1R9ZA 3W6MA 4YCPA 3MKCA 2HWGA 4K6AA 2VUYA 2J88A 3GG7A 4EP8C 5AZ1A 4HU8A 3BLLA 4GABA 5L6UA 3QLDA 1E4NA 3QJAA 1TX2A 1U33A 4ERGA 3A4JA 1UWIA 2PC8A 5LXEA 4KFOA 1XIGA 1FCQA 1B0IA 3HV8A 1AJ2A 3VMPA 1TTJA 2QJMA 1I2NA 1I9CB 1ZCCA 2VGBA 4PN2A 1TCDA 1W5MA 3C4UA 1XH2A 3M43A 6REQB 4MWAD 3UWUA 2ZRVA 1OX5A 3WD3A 5HR6A 2XVNA 3MC5A 2V67A 3RMEA 1EHAA 4JYEA 5CG7A 1VP5A 1KM6A 4LV4A 4DEFA 1QWGA 2P3EA 3LEPA 2HE5A 3PK7A 3K30A 4IP5A 3AS3A 5C9ZA 4DO7A 1DJXA 3FW6A 1TV5A 3URNA 3REQA 2FZ9A 2QJGA 3E2RA 2RDTA 2IQTA 3GR8A 3OVQA 2WBKA 3G1HA 5LNRA 3S1WA 3N9SA 5AC8A 1Z9AA 4JDBA 1LM1A 4Z08A 5ABGA 1LJYA 1BG9A 1PTDA 2QIWA 1UH4A 3EA1A 3SCRA 3PFMA 2FDMA 3T0CA 3KOFA 2CLOA 4MJZA 1R85A 3EOLA 5FIPA 2FPTA 3F7JA 4LRTA 3NGFA 1ZQ5A 1GZGA 5I02A 2EPKX 2JKEA 5BXTA 5E6ZA 3ABSA 1PTAA 4NVTA 5AFDA 4O8RA 5EPDA 1UHVA 3WNNA 4HSOA 3M0HA 4PA8A 3TZNA 2JEPA 5LIKX 4V15A 1FH7A 2C18A 3W1MA 3VOGA 4HZ7A 1OABA 2VWTA 2Y61A 2D0HA 3W1NA 3KOXA 3V0TA 3VOIA 4S3FA 2O7SA 4W87A 3O0FA 1V08A 5JQ9A 1GWJA 3V35A 1RVKA 3UXKA 2J7DA 4BF7A 5HPOA 1W32A 1OZMA 5DXYA 5FI8A 3GU9A 3WCZA 4PMOA 1RVGA 3IIXA 3DHUA 3MHGA 2V3GA 5CCZA 3YPIA 3FN9A 3LTYA 2CLFA 5AYYA 2XSXA 2VL4A 4OGZA 4JTJA 3DHPA 4BQ2A 5KZMA 1FWJC 3AZTA 1DXEA 1QPKA 5H2ZA 5DBTA 1QHZA 3IIPA 5CSSA 3LI1A 3F4NA 3O2LA 4U10A 1SW0A 1OGBA 1UUQA 3E5PA 3LMZA 1TUFA 6XIMA 2DH3A 1AMYA 1Z8AA 2UWFA 6PTDA 1Z69A 2XIQA 3EX6A 4C6BA 1LWIA 2ZUMA 1US0A 6ENLA 4MKVA 2VX4A 4F0LA 5A3HA 5CLWA 2R82A 3W7HA 4Q32A 1LG1A 1W6TA 4AEFA 3PUDA 3AHTA 1GEQA 5EMJA 4LXFA 3MHFA 1P6WA 4DJEA 2VX7A 3FSUA 1QNPA 4JIEA 4JTEA 1EA9C 2GZXA 4OFCA 4LEQA 3ISIX 2RKXA 3WK1A 4KWWA 2QAFA 3V5CA 2XH2A 5F2IA 4QNWA 1W17A 3BG9A 2VI0A 3EXTA 3MQTA 3W7MA 4PC8A 1WNOA 4ACYA 3U7VA 1IYXA 5J04A 1CECA 3CMGA 3NUKA 4DIAA 4S3DA 3OQ8A 3WQWA 1XBYA 1EJUC 4K8EA 4GOAA 4NT0A 4S3BA 1JYVA 3CB8A 2QMJA 3G77A 4HCLA 4UZSA 1RHCA 1KXTA 4R53A 3NQVA 3GBEA 4OBRA 1XI3A 5I6SA 1FCVA 3GVWA 1NP2A 3LXAA 4JTGA 1YHTA 4CNSA 4LVBA 2LLEA 2TMDA 1V5XA 1XW8A 1SFLA 5JH2A 1Y0EA 2PS2A 5CPSA 1JRCA 3RJXA 3W85A 1AH0A 3H4WA 4LCSA 1NWUA 5H8PA 1UOZA 1B9BA 2R1NA 2YB1A 2ZUSA 3DESA 2E67A 5JBFA 3E12A 3EKZA 1R47A 1HX0A 2FZDA 4QSFA 3CHDA 2F38A 2WYSA 3PTQA 2FHCA 2X7VA 3URBA 4UBPC 1UKQA 1LG2A 1QHOA 2HJPA 3LHWA 1IWAA 3VM7A 3WH7A 2UZ9A 4XBJA 1EJWC 1E9ZB 2DV0A 4F2BA 1M1BA 3W7PA 4CNUA 1QRQA 1OG0A 3N6QA 5HMDA 3A12A 1FXQA 2DZBA 1R8LA 1M04A 3XISA 5FF2A 4E8CA 1FOBA 1QPOA 3IWPA 2WKLA 3B9OA 1Q4NX 4YTTA 4H9VA 3THCA 1SM9A 3QR3A 5AC6A 3HGOA 2DIEA 1OD0A 1NY1A 3R25A 1F8MA 1PWLA 1B4KA 4N9DA 4ACZA 1FCBA 3FGCA 5IDZA 1R46A 3VOCA 3W37A 2WNZA 2ZCGA 3T4CA 3SIMA 2PFHA 4TR9A 1ADOA 4GQ0A 4A3QA 2Q6ZA 1KFJA 4UFMA 3CH0A 1F3TA 3DI0A 2WJZA 4ZGYA 4RUBA 1UPMB 1A4LA 4QIUA 1IR2A 3BQ6A 2W3ZA 3CUGA 1MQQA 3I4KA 4GPNA 3TQ0A 1CB2A 4LWWA 3LGEA 3W73A 2WSQA 4ZQOA 4JTQA 1GW1A 1GQIA 2J4GA 3C0LA 1TMLA 1IWBA 1EXPA 1XBXA 2Z24A 3AHVA 3WQFA 3QHMA 1XP3A 2INFA 4IFKB 5I24A 3T2OA 3PZQA 3WLJA 5A8MA 2ZVRA 3I7QA 1EKOA 4RL3A 1O94A 4DXVA 1OGGA 4D1JA 1FHVA 4UTKA 4UOQA 2BNJA 1IXOA 3W7GA 4X60A 1L9WA 4XKYB 3LM3A 2CHOA 3HQPA 4GBDA 4Z2IA 4Y9MA 4IGNA 2YL8A 1P1MA 4Q6XA 3MMTA 3QSRA 3FGCB 3WQEA 2VOTA 5GVJA 3EWCA 2PDJA 3LY0A 1M41A 4AD1A 2EKCA 4B4HA 3NQGA 4TOQA 3S9ZA 1R86A 1PX3A 3CV7A 4N0RA 1E4MM 1Q6QA 1P1XA 4H83A 2WK2A 5F1VA 1QHPA 4M81A 5EBAA 4B3LA 3QLLA 3P5ZA 1LT7A 1MUWA 1E0WA 5I3JA 5KZDA 4LOCA 5JVLA 1YKWA 1S46A 1TR1A 1A80A 5C54A 3PG9A 4XBSA 4PUEA 3PAOA 4XKMA 1ECQA 4TMBA 4O1EA 1EXBA 1UWAA 3U48A 1IQ8A 3ES8A 2QCNA 1S5TA 5FL0A 5A6KA 2AQOA 1B5TA 4HP5A 5AVHA 2HPIA 1H7PA 5F1UA 3UZXA 5PTDA 1W9VA 2OKOA 5AHEA 4IM4A 1OCQA 3KBVA 4O28A 1BAGA 1M5WA 5LA2A 2PDIA 1QI5A 4M29A 4Q8VA 3NQ6A 2FHBA 2VD8A 4DRSA 4GWEA 5IFPA 1E6SM 3BH4A 1EYWA 1U1HA 1VYPX 5EFDA 3PULA 1QOXA 3W7JA 2CCRA 4OBSA 4B5TA 4QTGA 2F7FA 1G7UA 1KWGA 1W31A 3HZ3A 1K8YA 1AUSL 4R9XA 4JTAA 1QNSA 5TF0A 1M65A 1OK6A 1TREA 1JI2A 1DIKA 1OSEA 2I9EA 2PLMA 3ABOA 4WR3A 3WMBA 5C55A 1JCMP 1WUFA 1ICSA 1P7TA 3GZAA 4PFMA 4D6HA 1YBQA 4YVXA 1XS2A 3HG5A 1A0EA 4DUOA 3FA3A 4DNMA 2IKHA 4AB4A 3VNKA 5AB3A 1V6UA 4REQB 3EMCA 2GVJA 4O1DA 5BRBA 2FTPA 1A3XA 2P5NA 4N42A 3UA3A 4AUBA 1PAMA 3W6LA 3CAKA 1RJQA 2PP1A 3V1HA 4DHGA 5XIAA 2VVNA 3V75A 1NF0A 1AJZA 2BP1A 5U4NA 4AF0B 4O4WA 1CDGA 4XKYA 1PYFA 3UR2A 1VIWA 1I0DA 3L2LA 3MUAA 3WLHA 4Z2LA 3AOFA 2EGZA 3NL5A 1MXDA 1E73M 2GQ9A 5A6LA 4YCOA 1Q6RA 2EPOA 1G67A 4EVZA 2WZMA 2CZ5A 5AC4A 4JKLA 4HPXA 4RV8A 5ABHA 3W00A 3BMXA 1R9XA 4KFPA 1FWCC 4GY7A 1FDYA 2F9RA 3B8IA 2TSYA 1E6QM 3A3XA 2QR6A 1V6YA 3BL3A 4JICA 1BWKA 5I06A 2CBUA 3WK2A 3AXKA 3PB0A 4O8AA 4C6EA 1CGXA 1UR8A 2IPFA 5HWJA 3URQA 4UMAA 4AWSA 3QR0A 1JDDA 4Z2HA 2VGGA 1NELA 4W8BA 2MNRA 4TO8A 2DUAA 3A6OA 1F07A 1ODUA 4HD5A 3WBWA 1VBUA 2VDHA 3NL2A 5FKYA 2P53A 5EL1A 3K2GA 4ZEPA 4WY0F 3WLMA 1D7FA 1Z89A 5D2YA 3DYMA 1QW9A 2HK1A 3BOLA 1UD8A 3L65A 2ABBA 3GD6A 4IFOA 4AF0A 4ZQRA 1ESWA 1QDSA 3CQIA 4G1NA 5ABEA 1FH8A 4H6KA 1TJ1A 2QDGA 3IJ8A 5D33A 1JF6A 4GUFA 3BANA 1C29A 4O1CA 3VO0A 4Q4QA 4MOZA 4L64A 2PDQA 3WLRA 4WRHA 4H6QA 2ZUTA 4XD3A 3UA4A 2TRSA 1BVWA 1JD9A 1DP0A 3ZWSA 3NTYA 3UYIA 1MZHA 1EZ2A 1H11A 2OZ0A 4ZB0A 3PN8A 4W88A 3GVRA 1W5PA 3M41A 1TMHA 3AIRA 3CBWA 1FWWA 1HZYA 3R7MA 2YOCA 4MZ8A 1XLGA 1E3XA 4X3ZA 2X7WA 2DDXA 5B80A 3QGVA 2NXIA 4GIRA 3BLPX 1K9FA 4FOUA 2BMBA 3K4AA 2OQHA 1XLBA 5D9PA 2V68A 3SY8A 5JMUA 1VYRA 2WHJA 4KEVA 3QHNA 1UJQA 3P84A 1C8YA 3K46A 1GJWA 3U2EA 4R5EA 4DWSA 5KSWA 2Z00A 4IMAA 2ZTJA 3QV6A 4EWND 2Y8KA 2DVTA 2BHYA 5AVNA 2I5IA 1O6IA 1XQKA 1VEOA 3H4GA 3KLKA 5M3WA 1PEZA 1KFBA 1H50A 3ALFA 3TSMA 3DOPA 4KCVA 1V79A 2PRLA 3GLCA 4DNHA 5CEWA 1Q4WA 1DWIM 3A23A 1DL3A 3GFYA 1GVFA 1W1YA 3DFOA 2RFGA 1CXLA 1YDYA 1HP5A 1QOPA 3AMGA 1GVRA 3QMSA 2VR5A 4BEQA 2QZRA 5FD0A 1AA1B 1DJGA 1LZOA 4XX6A 9RUBA 5AHNA 3TWBA 1OIFA 3R0DA 4IPIA 1CTNA 2DSUA 2RJGA 1K7FA 1TA3A 1E6ZA 3NPVA 4JTTA 4MFDA 4F0HA 1WP6A 3WF2A 1S2UA 1V6XA 4Z1CA 4HPGA 2DSKA 2XUCA 3VGGA 1A0DA 4XD6A 3UNDA 4BI6A 1ZU8A 2C1HA 1OC5A 4MLRA 3VD3A 3B0PA 2DZVA 4M5PA 1P0KA 2Z27A 3SCUA 3EOUA 3R89A 1QI3A 3EXSA 4M51A 1XKYA 1BRLA 4IXHA 5C7VA 1C92A 3WH9A 4LTSA 3WK3A 1A5KC 3L66A 2AKZA 2PU1A 3PZIA 4LUSA 3VAVA 4AU0A 4MM1A 3KW3A 3VYLA 4KS0A 1JGMA 1SJBA 2PDCA 1DEDA 3P61A 4WHBA 1RK6A 2QLYA 3BJSA 1GTEA 3VFLA 4FSAA 3TMLA 3T09A 4G7EA 4WSKA 1FX6A 3KBMA 4C65A 2OODA 3WJXA 4DVOA 3L5MA 2C13A 2VVSA 1QNQA 3MI2A 2OXNA 1HKMA 2BB0A 1DQWA 4LUIA 3EPMA 4XQ6A 3OVGA 4BZYA 4EANA 1RP8A 2X41A 5AYIA 2EPNA 4FA3A 2QGYA 2PRHA 3N15A 3WH8A 4ALDA 1GVSA 7TIMA 3RMJA 4LJ3A 4QDWA 4GI8A 4RNJA 2GFTA 3HGSA 4DBSA 2JE8A 4OBTA 2XPKA 1L2QA 3M44A 3B0XA 4KCWA 1TVLA 4B4FA 5CG0A 1JGIA 3FS2A 4FXRA 1YTDA 4PBEA 3BG3A 1LBFA 1BRLB 1VLIA 4JNZA 4J27A 3D6NA 4FXSA 4JCMA 3Q67A 2JIWA 3LYEA 3GDLA 1IT0A 3SW6A 1OT2A 4G9PA 4H19A 1UUMA 5AC7A 1PHWA 1MRQA 2OO0A 1EL3A 2EO7A 2NQ5A 5M2FX 4NNAA 3UZ5A 4MY8A 1TIWA 4ZB5A 2ALDA 1DWJM 2DUXA 2WMGA 2WZEA 1X96A 1UWUA 2CESA 2HVMA 2Y8UA 2YYTA 4ZXLA 3DGBA 5A6BD 3HPAA 2ACRA 3QFWA 2FVMA 3QKZA 4IQDA 4J35A 4A8LA 1LP6A 1TR9A 4G7FA 1UCWA 3MSRA 4H2HA 4OOUA 3DI1A 4GZEA 2ATMA 3I3EA 1T8XA 1B2YA 2G8ZA 4W7WA 4HSHA 3ELFA 1CLXA 2YBUA 3NL6A 2YYUA 5FAJA 2VZOA 1I45A 3THQA 1I2PA 1TZZA 3G0SA 4ZFMA 2J25A 5EMKA 4DBEA 2VNCA 4FS9A 4HA0A 3UERA 1P6BA 1DYSA 5I07A 3ZT7A 3MANA 1JR1A 3VX1A 3IJDA 4M6PA 5F2MA 4IUGA 3WQOA 3HPFA 3PTMA 4CN1A 5DCBA 3SSZA 5REQB 5HMSA 1AFSA 4AY1A 5HA7A 1ZTVA 2Z7GA 4U3AA 1JNDA 2VRKA 2O9RA 1DJZA 2ISFA 1CLKA 3T2PA 3UXAA 3EWUA 1RLDA 2VR2A 1PIGA 1R3QA 3T44A 3S1XA 7PTDA 5FSEC 2WJDA 1WBJA 2QUTA 1Q5MA 2OEJA 3IUDA 4ZA0A 3JW7A 1DJYA 2FPYA 1PB0A 2V69A 5AN7A 1JUBA 4H9TA 3IJ9A 4IICA 2GYIA 3N34A 4XZ9A 3ARYA 3EWDA 1RBOB 1XL9A 4PCNA 5DFAA 4JEJA 2PMQA 1H49A 1UR4A 1XLLA 2PZNA 1KA9F 5HUPA 3IEBA 1BGAA 2PAJA 4IMEA 4WZHA 3TIMA 3R0KA 2ACUA 3A9BA 3R13A 3N9KA 2DSVA 4GQQA 1S5VA 1GG1A 2I16A 2G37A 3G1DA 4QNEA 1SMDA 3MKVA 2GDQA 1CT5A 5CPTA 3QXBA 4UMBA 3K4WA 1CI1A 3M0VA 1G4TA 3OLGA 1TFVA 3WQDA 4LY8A 5EA9A 3W2UA 4XB3A 3ABXA 2O9TA 3ZSTA 3XIMA 2WHKA 3WH6A 1OCJA 2BS9A 2NSOA 1BG4A 4UTHA 1W9DM 4QBXA 2QUVA 4IIBA 3QPYA 1EIBA 1KGWA 2FVLA 3W26A 2BOGX 1OY0A 3BPWA 1JZ2A 2VCAA 4YPJA 2YXXA 2QCLA 3O07A 4IIHA 2PTZA 4RPPA 3SQSA 1DHKA 2GVEA 1UBPC 2I14A 2FH6A 1O1HA 4E8DA 4JFSA 1Q7MA 1RV8A 3S83A 3I6RA 4U3CA 2YDQA 3N19B 2W0UA 4A05A 5EKYA 1UASA 1XLKA 4IX2A 4LBRA 3W27A 3E2VA 1SZFA 4RZBA 4FHAA 2ZX6A 2P8BA 3QC3A 1KBIA 4GUJA 3B8DA 2C19A 3W84A 3C0SA 3GTXA 4ZOEA 1NVMA 4GIEA 3ZR4A 1M01A 5BOFA 4GFIA 4PUWA 1H63A 2WJEA 1E72M 2BY2A 1JDAA 3WJWA 3GXPA 4C1NA 2J77A 1GUVA 4AG0A 4UNIA 4M6VA 1L6YA 1W1VA 1UG6A 1CGUA 3UZJA 1ISWA 1YNPA 5TQLA 3GAKA 1D7KA 3G1AA 4JIQA 1B54A 4TQTA 4WY0A 5H91A 5E0FA 3VNZA 1VPXA 3BAKA 3SUUA 3ICJA 1GG0A 7XIMA 1I4NA 1RBLA 1UR2A 3OA5A 1IR1A 4NX5A 3S2NA 3CPRA 1C9DA 1TTIA 1A5MC 5A8OA 3EMZA 1WX0A 5I3KA 5EGRA 4YXGA 2YL6A 3AIBA 3NSMA 1K8XA 3LV6A 2V8ZA 4UWMA 4TV6A 1AD1A 2PGRA 4YVVA 2G5WA 3K8LA 1O1ZA 1Q45A 1GQLA 3KCLA 3PBVA 3TTOA 2J62A 2NV1A 4IMCA 4JHOA 5JIWA 1OGSA 3T8QA 3CU2A 4O0KA 4BQ4A 5BWAA 4B5SA 3LNMA 4QDPA 2VT0A 2FJUB 5DMMA 3VOFA 4ICCX 1EP1A 3TW9A 1PZ2A 3ATZA 3UF9A 1RA0A 2W6RA 4X2PA 2OMAA 1JZ6A 3OYZA 3G22A 3IAPA 1F61A 5FF0A 4XAFA 2E6DA 2QCCA 4FX6M 5A2BA 1SZNA 3MSYA 1JZ5A 3ARQA 3H2FA 5CPMA 4J5NA 2VZUA 4PTDA 1JYWA 3KS6A 5ECUA 3HB9A 1HVQA 2E25A 4JHMA 1NWTA 3S2JA 1JULA 2YL5A 1ONRA 1UWRA 1BVZA 1WPCA 1VFSA 3TA6A 3UBPC 1H0IA 4MAVA 1AD4A 4NASA 4AX6A 2XJ7A 4CNOA 2Q8LA 1V6VA 3NQAA 1F2JA 3QZ6A 4HOXA 1NF7A 1KM0A 1FWGC 4C6IA 4XZIA 5A8PA 1TIMA 1GOIA 3LG3A 3AC0A 2JIEA 1EJTC 1WZLA 3N17A 3TV8A 1MWOA 4GNVA 3EEGA 2XVPA 2A7PA 1Z41A 1OC7A 2QS8A 3LDVA 4QG9A 4PTMA 3RLUA 1S38A 4Q4OA 3C2YA 2YZRA 5DXXA 5DX7A 4REQA 4IT1A 5D37A 4E0CA 1XIFA 3EOEA 1DOSA 1WDDA 4E8GA 4KEUA 4O0QA 5AYXA 4I5UA 1L6SA 4D6IA 3GUGA 4JXCA 2W91A 4EPBC 4NJHA 3OLIA 5ABFB 5I5RA 3M46A 1GEHA 1UKSA 3NZGA 4FR1A 2WNNA 1GQKA 4I5RA 1P43A 1SJDA 1DKWA 2Q71A 4N7QA 1B3WA 3M0IA 4HNVA 4JZ5A 3LPFA 1SJAA 1VFLA 3V36A 1WKEA 2JEQA 2YW4A 2OSYA 1OD8A 2RGLA 1FKWA 3W1PA 3MP4A 4Q4KA 2XZ9A 2DT1A 1GJUA 3UT0A 3LI0A 3MY9A 3LBMA 2WVSA 3RK8A 1Q7ZA 2B7QA 1E71M 4OECA 4NP7A 4Q7BA 4I6KA 3UCDA 1FHUA 3CUFA 4Q8NA 1BXBA 4NQ1A 4AVFA 2WJFA 1NQKA 3CL6A 1IF2A 3CAVA 1R38A 4H9ZA 5M5DA 4UOJA 3SY5A 1IXNA 3EX2A 4XBKA 2JKAA 4HA3A 4J2PA 1VJSA 1F6PA 1L8NA 1PDYA 4RE4A 4NAEB 5LSMA 3DHDA 5LA0A 1BEUA 4HHPA 1AH3A 1FA2A 3GXTA 3WY1A 2VXNA 1TQXA 1Y65A 2H3DA 4DAFA 2O4MA 7REQB 4Z42C 2VGFA 1J93A 4XWUA 2BBFA 4TU1A 4M8UA 4IQJA 5ABFA 4HPNA 3VX0A 8TIMA 4FP1A 1S2AA 3SRKA 1A3HA 4S39A 4U31A 3NYDA 1QMLA 4WXYA 1VGAA 3GVGA 1BWVA 2XINA 1TJ2A 2CXEA 4F2TA 3UY7A 3LPOA 3RU6A 4FNTA 3GNOA 3ZLGA 5A1AA 4GIYA 1JCTA 3NQDA 3GHTA 2XN2A 4PE8A 3KAOA 1E0XA 4N6EA 3FSTA 3QF0A 1LUCA 4DBWA 3AMCA 4PRWA 3J7HA 1OVDA 2V5JA 3VINA 3H2EA 4NXSA 3LENA 2WC4A 3C3UA 3V5FA 4TVUA 2XM2A 3BSGA 3AI0A 5TBOA 3TFCA 4XAZA 2YIHA 4H7VA 1X6LA 2PWFA 3QY7A 5BMXA 5CPOA 3UWYA 1TWSA 4GGHA 8RUCA 1PUDA 4YMZA 4G2DA 1EJ7L 4HA4A 3U2ZA 2NX1A 1ELSA 3WEMA 1GOOA 1K9DA 1SJCA 2CPUA 4NNBA 1AJ0A 1DJNA 2FZNA 3BCJA 1A50A 1UKOA 2CWNA 3BW3A 2J7BA 4WDTA 4H9MA 2IKJA 2HSAA 3AIEA 1VEMA 2BVTA 2Z4GA 3PZOA 2J78A 3APTA 4BQ5A 4D8ZA 3B06A 1NFPA 2Y7DA 3QTPA 3SUWA 1ZBWA 1ZJBA 3EDDA 4ATWA 2CHRA 3IK2A 3CXOA 2PE4A 1IXQA 3SI9A 2P50A 2RDUA 2Y7EA 5I23A 4C7GA 1BHGA 1XG3A 4AD4A 3L5AA 4ROPA 4TXEA 4A22A 3F4WA 2PDHA 2PDBA 2G41A 4RW5A 3L4TA 4PZVA 5EU9A 1YXDA 3A9IA 3FYOA 3EDFA 2EAWA 3GUWA 2DQXA 2CLIA 1EYEA 4D6DA 4HHMA 5D2TA 1U22A 1U1JA 5KTLA 2WQDA 4N2YA 1REQB 2F84A 3DFYA 3ZR5A 2Y88A 3W7KA 3TTYA 4LVDA 5HNTA 4AYSA 1ZRQA 4P8VA 3ITCA 1HIZA 1O12A 4JPGA 1TA3B 3GU1A 2UY4A 2KX9A 1YNQA 1TPB1 2QV5A 1E40A 1SSDA 2VEFA 2CC0A 3NGJA 1CXEA 4ZOBA 4GO9A 1I6NA 7A3HA 2X8RA 2VENA 1TYGA 1XUUA 3H6OA 3C2FA 4GQRA 2IXVA 3NQEA 2WXDM 5A6BA 2YCLB 3GAYA 1YE4A 2A3HA 3UY8A 4CCZA 3R6IA 2Y62A 1QBAA 3TC3A 2A79A 3BLIA 1MRAA 2J66A 3LQGA 3ZO9A 1UC4A 3GR4A 1P0EA 1ME8A 3UWEA 3N04A 1JYNA 1FP8A 4LUSB 7ODCA 2J75A 1TPEA 3VI2A 1GZ1A 3VNMA 3IS4A 2JKPA 1U5HA 4UTMA 4C6PA 1WE5A 3GU2A 4I6VA 1EC9A 2OOGA 2GJLA 4HOWA 4MWAE 3QY8A 2FZBA 4R3UA 3QZAA 3G8RA 3SN4A 3K4DA 3H7VA 2YB4A 4HJWA 1VEPA 3W7EA 1ZJIA 4M6QA 2QIIA 3GIPA 4YU1A 2VRJA 3W7LA 3M7SA 4DUVA 4ZQCA 1W5NA 4V1YA 5ENLA 1E0UA 4QEEA 3VKAA 3CUJA 6TIMA 2UY5A 2Y8VA 4MF4A 1PZ1A 5AHMA 1QXLA 4IGHA 3P6LA 2FGZA 1QVBA 3IUIA 4WOZA 4AW7A 2H9AB 3UJEA 1YMYA 3UWWA 3ZZ1A 4U4MA 2WCGA 2G3MA 1PV8A 3BVJA 3NR0A 1ZSXA 2NQ9A 1RBAA 3KVMA 2VEMA 1H41A 3C0QA 1W1TA 1BTCA 1XV8A 1P0DA 2DUZA 1J11A 3CV2A 6XIAA 4QGCA 2GGHA 3EKLA 4WXZA 1WDSA 1ZP3A 2YCLA 1UH3A 1R30A 3M0XA 4QQUA 1Q6EA 4DJED 1H5YA 4MAZA 2OLSA 3AU2A 1UP0A 4YHEA 2ZC1A 3DFSA 5E0KA 3TP4A 4KETA 1IT7A 3TW7A 1HW6A 4H01A 4FNPA 4B5WA 1QATA 3WUGA 2XIIA 5BXPA 1GOQA 3A13A 2YGYA 3LHUA 5I3GA 4AC1X 1SMAA 4V28A 2AMGA 4LCQA 4P7RA 4C6CA 1Q2RA 1POJA 3ZVIA 1KR0A 4LYQA 3THDA 4HYWA 1XIIA 3GIQA 1U5VA 3OLEA 4GVHA 1QW7A 3KVLA 3W7IA 4X2RA 4FLOA 4Z0JA 4CEUC 3N12A 1GQNA 3ITOA 4KFNA 2PTYA 2Q02A 2RUSA 2ZICA 3ITTA 1D3GA 1CEOA 2ZWYA 1RQHA 4LVAA 4GH1A 4O57A 1P7TB 1K3UA 1QO2A 1G4SA 3E0IA 4J2MA 2JBMA 2OX1A 1KFCA 4JYFA 1N8IA 3QH2A 4DJDC 3MA8A 3TYEA 4DYKA 4DJEC 3ARRA 4GZIA 4J40A 4RNFA 3R8HA 2E5BA 1T99A 7REQA 4NZ5A 1DE6A 4EE9A 3GKFA 1TPFA 1TWWA 3M6YA 4HA1A 4PULA 1E1CA 1U30A 5FF3A 4P8UA 3GG8A 4LPCA 2BVDA 1WUEA 5XINA 5CZKA 5A6AA 2YBTA 5FEXA 1UQZA 1Q6OA 3IARA 3D0CA 4GIAA 3T2QA 2VEGA 4JEQA 3B03A 1JFXA 3T42A 4XTDA 8XIMA 4X63A 2AL2B 4X9SA 3VILA 3CYVA 3T81A 4H7ZA 1H7XA 5FF7A 3NAVA 4J3ZA 4O52A 3N2MA 2H9AA 3VD5A 3RJYA 4O13A 5TNVA 2OZ3A 1T7LA 4RDZA 4JY9A 4G56A 4DELA 1VCFA 2L5HA 1X6UA 2YDSA 3IK4A 3PZVA 1YXYA 3PJWA 4L1GA 3IRSA 3OIHA 4A2SA 3HPSA 1HGWA 1KR1A 3W7OA 1TKKA 4ZXOA 3CYJA 2IQDA 4YLWA 2NUYA 4PMJA 2WMIB 2DJLA 1IIGA 4LBUA 3P60A 3QGKC 4O17A 4YTUA 2G95A 4POCA 3RCNA 2PWEA 3HV9A 4H9YA 4XAYA 4OWGA 1VBGA 4QHRA 4HK7A 1TV2A 4MPKA 2PTXA 2PD5A 1Q7QA 2FKPA 2OT1A 4M1RA 3WLPA 2FFIA 1J79A 4HVXA 4HZ8A 2NLIA 4NZ3A 4JTLA 1ODZA 3ORWA 2O9PA 3RIKA 4GX8A 3P8JA 1DIOA 2DH2A 2Y5JA 2XGBA 2D3NA 4KW2A 2HVOA 2J9XA 1Y5VA 3F03K 2J9YA 1ZJHA 2QCDB 2DIJA 4CD6A 1M7PA 2KAUC 5FJOA 2W63A 5K9DA 3E2QA 1WDWA 3OTRA 3AIWA 5D8ZA 2IXUA 1RR2A 1AK5A 3GVVA 2ZQ0A 1VS1A 2J6VA 1BYAA 1FWHC 2ANUA 1MEHA 1XD0A 3ZT6A 5C2XA 3MO7A 1W1ZA 1PCWA 1B3VA 2V2DA 1REQA 2WVTA 1OG6A 4Z1YA 3WL1A 1WYIA 2A3LA 1FWAC 3WD2A 3O6DA 2VGIA 5HQMA 3UG3A 2G96A 1LQ2A 4JTIA 2XM1A 2WB5A 2GGGA 2D2HA 3SCVA 4LT9A 4CCDA 4TUFA 1V3MA 3W7NA 2HS6A 3HFYA 4FB7A 4KT2A 2YLAA 3RF9A 4DO4A 1W3LA 4U28A 3PZTA 4LF2A 3QRHA 3OGRA 2C79A 4NZCA 1SW3A 5E9XA 4FI4A 1PL9A 4JKMA 5CPQA 5HINA 4IJBA 2EXOA 2AGKA 2BHZA 1I8JA 4R34A 3POHA 3UESA 4CGTA 3CIXA 3MKKA 3GW3A 2OELA 4ORMA 3MUIA 2WCAA 1HGYA 2JALA 2YBVA 4L7ZA 1A5OC 2QCDA 1KD0A 5DRCA 1HKKA 2QF8A 3NZQA 3N4AA 4F66A 4H1ZA 2F6XA 1UBSA 2VX6A 3KTXA 4RNHA 4XIMA 1E55A 1PVNA 4FLQA 1ONWA 3PUEA 1FWNA 3B0YA 4Q4PA 4GO8A 4WSJA 3TQVA 2X1UA 2WVUA 1AZ2A 3CAQA 2GJRA 4AD2A 1IIHA 3CWHA 3S3GA 2VDGA 1F73A 5T91A 1LLZA 4IL2A 6CGTA 5XIMA 4L6HA 4ATLA 1R5YA 4MJ4A 3CL7A 3VC5A 1RPXA 3HG2A 1UD6A 3AQUA 3VXGA 4WUIA 4MB4A 1O4UA 1K8CA 3WQ8A 3TJIA 3W29A 1J5SA 3VGFA 4NX0A 4DZAA 4L1XA 2B31A 3WBYA 1VFHA 3GFXA 4QR6A 2PWGA 4WK9A 4XIAA 3WD4A 3MU7A 4QAWA 1L6FA 3W87A 2EG8A 1FWTA 1H7OA 1SU5A 1W91A 3PJTA 4B2DD 3WELA 1EGVA 4QLKA 1XCFA 2H8XA 3CV1A 1BXNA 4Q8QA 5D4YA 1V0NA 2R1KA 5F2GA 1YX1A 3L2MA 5BYWA 2ZZ6A 3VCNA 1QU4A 4EXBA 3AUOA 1ISVA 2D0FA 3KBJA 1P6CA 2INZA 4RZ6A 3LD5A 3PFRA 8XIAA 5CZJA 1Q66A 2C71A 4KPLA 2ZZ2A 4J3SA 1ITXA 3FJ6A 3WQGA 2GJNA 3LXBA 1DJHA 1EC8A 3WLIA 1B3ZA 2D1ZA 4FF7A 3ZOAA 3TSBA 2BASA 5D2VA 3W76A 4B90A 3P67A 3HURA 1FVPA 1NFGA 2V63A 3C52A 3S6OA 2HISA 1CX9A 2Y7FA 4NJKA 5BU9A 2OO6A 4V27A 4US6A 4Q4SA 5G2IA 3QOMA 3W0KA 4DQWA 1UKPA 3GTIA 3S2MA 5JXQA 2J7GA 3IVTA 4NUWA 4ZO8A 4HOZA 6A3HA 4L1WA 2VTFA 1ZUAX 4UQ9A 3VDHA 2XTKA 3BMWA 3W75A 3TXVA 1VAHA 2OZ8A 4PEKA 3GC4A 3UJSA 3UJ2A 4GJIA 2ALRA 3CGTA 5E70A 1V51A 2D22A 3WUFA 2ZDRA 5D9NA 1IE7C 3R0UA 1NEYA 4F9DA 3EX1A 2X40A 4O18A 5TAOA 2QYGA 3O9NA 1UD5A 2V5DA 4MNLA 4E2DA 2BY3A 3GXMA 5D03A 5CJNA 4ICMA 3UG4A 1NIUA 3DG3A 3OPSA 4LFYA 4Y9OA 5U7SA 3S5SA 2ZTKA 1C90A 1FXPA 2VJXA 3PF3A 2ZXQA 3EX3A 4JS3A 4E3TA 1TWDA 4JYDA 3WQ6A 2ZXDA 4TTUA 4I7VA 4MWAC 1A5NC 2YCJA 4HPHA 4A35A 1YNYA 2Q3RA 5A6MA 3S2LA 5A2CA 3R79A 4U33A 2J79A 3JS3A 2WCSA 3ZVHB 3H7UA 8A3HA 3CIVA 4C91A 1Q65A 1TPVA 4E4FA 3MUCA 2DSWA 3ZYZA 4EACA 2AOSA 2G4JA 2OSXA 4M19A 5EB8A 4H2CA 3S6TA 1YLVA 3WZ0E 1HN1A 3OYXA 4M24A 3W71A 5HATA 1X8CA 1FWFC 1WKDA 4GQBA 1QI4A 1N82A 4Q8MA 2NWRA 3MZNA 3LZ3A 1YDNA 4I5XA 3MUXA 4PSRA 1H3GA 2PDWA 1PKYA 1V4YA 3C61A 2BY1A 1R3VA 4JR5A 4AIOA 3PWAA 1MO0A 1GOKA 1S5MA 3H53A 4RXGA 3FYPA 2PB1A 4P7LA 1LLWA 1X8FA 3RPTA 1ZP4A 2P0OA 2INEA 1DQUA 2CIPA 1KBBA 1XCWA 1JD7A 2PWUA 3IANA 5LGZA 4HTBA 4JQ3A 1GPFA 3ZFHA 1AW2A 4WQ6A 1RK5A 1KRAC 4CD7A 2VDIA 1PHQA 1NOWA 1E56A 1AVAA 2OEKA 3TTEA 5AHFA 2ZDSA 1YPFA 3QQWA 3S42A 1PZ3A 1G9HA 5K2ZA 4HU0A 4JTCA 5HR7A 3D5HA 3RU8X 1UA7A 1CZ1A 2PPGA 2EG6A 1FUYA 4JFVA 4M7SA 2CYGA 2VM8A 3BCDA 4K68A 4WF7A 5DMYA 3KE0A 4NU7A 5C0QA 4UZUA 1FWRA 2Z1XA 2QULA 1Q6LA 3ZT5A 2BSLA 4WLCA 5HWNA 1ZBVA 7TAAA 1C7SA 1OFRA 3RLVA 4AWEA 3LV5A