4QFVA

Crystal structure of a unique ankyrin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MSMDIGKKLLEAARAGHDDSVEVLLKKGADINAKDNSGRTPLHVAALNGHLELVKLLLEKGADINARDMFGLTPLHTAASNGHLELVKLLLEKGADINARDEDGSTPLHLAASNGHLELVKLLLEKGADINAEDHSGTTPLHFAAKNGHLELVKLLLEKGADINASDFSGPTPLHSAAENGHLELVKLLLEKGADINARDKFGKTPFDLAIDNGNEDIAEVLQKAARSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A transcription blocker isolated from a designed repeat protein combinatorial library by in vivo functional screen.
pubmed doi rcsb
molecule keywords ANK-N5C-281
molecule tags De novo protein
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4qfvA01
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4qfvA02
3ZU7B 5JMND 1UOHA 5ENRD 5EYLA 1BLXB 4U8VD 4O1OA 4U8YD 2ETAA 4BEPA 4F1PA 1K3ZD 2AJAA 3TWQA 5AARA 4DX7D 3JUEA 2ZGDA 1IXVA 1S70B 2DWZA 2XEEA 3Q9UC 2QYJA 2V4HC 4GMRA 4HRLA 1A5EA 2F8XK 5ITZF 5ENTD 4BESA 2DVWA 2ETBA 4U95D 1G3NB 4N5QA 3V31A 5EN5D 3EHRA 3T8KA 5KBAA 1WDYA 3AAAC 1K1BA 4DX5D 2P2CP 3DEPA 2DZOA 3TWVA 3UXGA 3TWTA 3Q9NC 5CEDB 4HB5A 4HLLA 3ZKJA 3KEAA 4QFVA 2KBXA 1MYOA 1N0RA 4G8KA 5AQ9A 1BI8B 1K1AA 4CZ2D 2A5EA 4LSZE 3SO8A 3F6QA 5CBOA 2V5QC 1AWCB 1DC2A 1N11A 4K5AB 1DCQA 2KXPC 3JXIA 4OAVB 3TWSA 5HKPA 5BXOA 3LVQE 1TR4A 2Y0BG 5KNGA 1MX2A 3DEOA 4G8LA 3C5RA 2ZGGA 4DX1A 3B7BA 2NYJA 3UTMA 4OAUC 2J8SD 4HI8A 3V2OA 4U96D 5FIOA 3NOGD 1SVXA 4BSZB 3V79K 4K5CA 2JABA 4ZFHA 2FO1E 4Z68A 4NIKA 4QQIA 2HE0A 3ZNGA 5BXUA 3JXJA 3IXEA 3J5QB 3J5PA 4DRXE 4HRNA 5FINA 4YDYA 4BERA 5EYPF 2XENA 4BETA 4DX6D 3D9HA 4HNAD 5ENPD 4B93B 2QC9A 4YDWA 3NBNB 4TUMA 5AAOA 4HBDA 3W9FA 2Y1LE 2PNNA 3ZUVB 4LNUD 5KNHD 1WG0A 3TWUA 3HG0D 4J7WA 4GPMA 4O1PA 5KWDA 2RFAA 1IKND 1YCSB 2XZDG 3EU9A 4RLYA 5CERB 4UUCA 2VGEA 5AQ7A 4DX2A 1N0QA 5AQAA 1AP7A 2RFMA 4A63B 5CECB 4LG6A 5CBNA 1YMPA 1D9SA 3B95A 1QYMA 5JA4D 2DZNA 1MJ0A 2XEHA 5ENSD 3T9KA 4F6RD 3LVRE 1BD8A 2B0OE 4HRMB 5EIBE 5ENOD 3NOCD 1IHBA 5HRYA 3EHQA 3UI2A 2ETCA 2L6BA 5CEAA 2F37A 2BKGA 4DUIA 1MX6A 5D66A 4K5BA 1BI7B 4O60A 2F8YA 3V30A 3HRAA 1BU9A 1OY3D 2MYOA 3LJNA 1OT8A 1SW6A 4ZHBA 4HQDA 5HS0A 4CYMD 4C48B 5EILA 1NFIE 1YYHA 2BKKB 4ATZD 4HI9A 3AJIA 5AN8A 5EIDA 3TWWA 4JB8P 4J8YA 1MX4A 2XZTG 3W9GA 3TWXA 3TWRA 3V2XA 5AQBA 5ENQD
chains in the Genus database with same CATH superfamily
4TXPA 3FUKA 3JUEA 1OCOE 3EIJA 4GAAA 1N4SA 4LUNU 3I5PA 3ONLA 5ARGA 3T5XA 3T8KA 3C3OA 3CV0A 3TAXA 3CVWA 1SQMA 3CQGB 3UXGA 5LFAA 3AS4A 2WXLA 2HYZA 1AWCB 5ENNA 4G26A 2GRPB 4TUUA 1ELRA 3B7BA 3RRNB 3V2OA 2NC9A 4K5CA 2Y3AA 1Y8MA 4FHKA 1UJKA 4XE0A 3FH8A 3I3NA 1H6OA 4GYWA 4RQIA 2WXKA 4NQ0A 3SBSA 1FT2A 1NA3A 3ZHEA 2ZXWE 2HO1A 3FUHA 3SF4A 2ONDA 2KC7A 2IONA 4ACKA 3EU5A 2FBNA 1XNFA 2R59A 3FUFA 4DX2A 4ANWA 2RD0A 5IY5E 2I1JA 2P9PG 1QYMA 3JQ0A 4GTRA 4CGVA 2EIME 4GZ5A 4WWNA 3ESLA 4EZJA 3NOCD 2E0IA 4KBQA 1NL4A 4DUIA 4OVVA 2LXMA 4Q69A 2WMNA 4HLEA 5J08A 5AYWD 2EILE 4NACA 5EILA 5AN8A 2C2LA 1MX4A 2F0YA 3FTSA 5JMND 3RU0A 3FH7A 4ATGA 1S0PA 3E33A 2V4HC 1LF8A 3PZ2A 2A5UA 2FF4A 2GRMA 3BU8A 4E6HA 3CK8A 3FP3A 3DEPA 2WXGA 3PE3A 3Q9NC 5G04C 1KT0A 3ABKE 5FZRA 5FQ4A 2R05A 4I1OB 1O1RA 5B1AE 5AQ9A 3SI5A 3F6QA 4Y6WA 1Z5SC 3LJ3A 4N39A 3TWSA 2P9SG 2YINA 3C72A 4HI8A 1JUQA 1V54E 3FUJA 2EIKE 3J5QB 2V0PA 3UUXA 3RSEG 2VJ8A 2KATA 4DLQA 3Q49B 2PNNA 3UT8A 3DSUA 5ANRA 4GTPA 5CCMA 1EF1C 5KWDA 3E37A 3CKCA 4GZ3A 3CVXA 4BT8A 5ARFA 4AY5A 3FULA 1D9SA 3Q47B 4HVBA 3FTYA 1XGWA 3ML8A 4AJWA 2VGXA 4F1SA 4C48B 4ANUA 4BTBA 3UM1A 4JB8P 2XPYA 4XI9A 3QWPA 1A17A 4J6IA 5DIZA 2CG2A 3FUMA 4FA6A 2DWZA 2ZIRA 3PZ3A 2R17C 5LX8A 2DVWA 3MZLB 4B89A 4N5QA 2GRNB 1HG2A 1Z3XA 4Y6CA 1P5QA 2J9QA 4I17A 2XS1A 1H2VC 3FUDA 1SA4A 5CCLA 3KEAA 5EDSA 5A7DB 3APCA 4G23A 2Y0BG 4IRUA 2WQ7A 4G8LA 3DPYA 4GA1A 3UIPC 3FTVA 2NYJA 3FTWA 3IXEA 2YHCA 4JD2G 3MCXA 2IU1A 4MLPA 3TL5A 3NZUA 5BV0A 4LNUD 3MX3A 1E8XA 4MRUA 2RFAA 1N4PA 5CERB 4FLHA 2PM6A 2LNIA 1N0QA 1EDUA 3VLFA 2IOLA 1TNZA 3PH0C 3TXMA 1B89A 3DXKG 3BUAA 2KZTA 2WXPA 4JHKA 4DPRA 3CHPA 2IO3C 3CHQA 3SQVA 2RKKA 1NFIE 3D9PA 3Q7FA 1TN8A 5DBKA 3W9GA 3FEYA 2GRQB 2IF4A 3OXGA 2P9NG 4JEHA 2QYUA 1K3ZD 2AJAA 3ASDA 4TXQA 1IXVA 3LKUA 2XPIA 5ITZF 4RSYA 1VDYA 4KYOB 4H7XA 3FFLA 4J8DA 4KMOA 4E85A 1HE8A 3ZFWA 2MOWA 2JLBA 2DCPA 3TWTA 4QFVA 4BX8A 1OCZE 4N2QA 5HKPA 5KNGA 1IYGA 1LTXA 3C5RA 4I1AA 3QOUA 1E7VA 1SVXA 4ZFHA 3AS8A 3FU3A 3PS6A 5FINA 2GRLA 4DX6D 5G55A 3TXNA 2LAHA 4GPMA 3CR3A 1E8ZA 4D10C 5AQAA 2RFMA 3BG1B 3D9NA 1NZNA 2XEHA 3DSSA 2R03A 4UWLA 3ASFA 3LY9A 3UM0A 1UG3A 3FDHA 2BEDA 3V30A 2F8YA 2R2LA 4AIFA 4GCOA 3TG4A 2VQ2A 4PH4B 4G11A 3LY8A 4GTQA 4I9EA 3QNKA 3AJIA 5FQ6A 4J8YA 2H6HA 3SD5A 3SFZA 3QARA 3BQOA 4WNDA 2ZGDA 2XEEA 4DK5A 1ZBPA 2ETBA 1TJFA 5FJYA 1H2TC 3JYSA 2J09A 5B1BE 4B8CB 4FJZA 1S64A 2DZOA 2J07A 4L2YA 2KM4A 2IJGX 4XX5A 5FQ7A 2WM9A 4IULA 1DNPA 1Z6TA 3PDNA 1HX8A 4PS7A 2XGMA 3B7TA 3PZ4A 1PAQA 4LRZA 4AP2A 4DX1A 3JUIA 4I9CA 2HE0A 3AG4E 1N95A 3N71A 3DXMG 4I6EA 2WPVA 4BERA 4NRHB 3L08A 2GRRB 5AAOA 3HG0D 1N54A 3ABME 3UPVA 2H6IA 1HH8A 4WNGA 2QY7A 3HVEA 4UI9J 3U9WA 2LSUA 3L16A 3CHRA 3BEEA 1KLXA 1KZPA 1ELKA 3P2BA 4EZLA 2I6HA 4MBGA 4N3CA 1QZ2A 4MS6A 2OEVA 4CT0A 4JHJA 1H6PA 4JL0A 5G04J 5EYLA 2ETAA 4KVMA 4DX7D 1MHQA 3SFXA 5ENTD 2JEKA 5CRVA 2I9CA 4HORA 1N4QA 4HOSA 1G3NB 1U2VG 4CDNA 1YA0A 3DWLG 4G2VA 5FZQA 4B8AA 4GTSA 2X38A 2EQXA 5HI7A 2XGOA 4J8SA 1E8WA 3L6AA 1SZ9A 3UX4A 1O5MA 3HHMA 2L0IA 1N0RA 4YVOA 4I1MA 2QFCA 2WQHA 3CEQA 3D9OA 3LVQE 2EINE 4OVUA 3DEOA 5D0OD 2VSOE 3UTMA 3ZHEB 2H6FA 2JABA 2XRYA 3PUJA 3U4TA 4CEMA 2WMOA 5BXUA 4L7TA 3HXDA 4YDYA 4ME2A 3NB2A 2DYRE 3P1UA 3D9HA 3D9JA 3ZUVB 4JA7A 4LNGA 4WAFA 2WXJA 3ZYQA 3EJNA 4I2ZA 4JZYA 2XZDG 3Q5MA 4UUCA 3CIAA 1E7UA 1IQUA 2WXFA 3IEGA 2PQNA 3Q73A 3KSQA 3QWVA 3NAWA 2V4LA 4F3VA 3DBSA 1DVPA 3L82A 4C0MA 1ELWA 2P9IG 3O48A 4N2SA 4JEUA 4KZCA 3EHNA 3ESKA 3U3WA 3DSVA 1HU3A 3VLDA 4CT4A 4WUYA 3TWRA 3CVNA 1UOHA 3HXEA 3CHSA 5ANLA 2QYJA 4HOTA 3SY2A 3MV2B 2WB2A 4ANVA 2C0MA 2IY0C 2M63A 5FTPA 2J49A 2LUHA 4F7AA 4PS8A 5BPPA 1HXIA 5FT9A 2GGFA 3Q7AA 5CRUA 1N11A 3FWVA 3D9IA 1KPSB 4JVSA 5CHEE 5JHAA 3FUNA 1HF8A 4BY6A 4L1BA 3CSFA 3DSWA 4EZKA 4U0SA 3PRZA 2E2EA 4UQXA 1H19A 1TYQG 2AXVA 3LCAA 2XENA 4WNFA 2OVBA 2QC9A 2WVIA 3JQ1A 3CVLA 3CK7A 3B7RL 1LD7A 3OXFA 3PEUB 3ASNE 3IBEA 1S63A 1TEZA 3B95A 2BF0X 2VGXB 4FLBA 4EHMA 2LSVA 1BD8A 4C0EA 5D66A 3R7QA 3UQ3A 2BTDA 2MYOA 3UM3A 3MEKA 4CDRA 4HI9A 4L2LA 2XZTG 2XPZA 5JJ6A 4U04A 1HZ4A 3TWQA 1S70B 2X6HA 4FULA 4DI4A 1TNUA 3QC1A 4PUCA 4Q94A 3V31A 5EN5D 1QQEA 1O1TA 2WXIA 2LXLA 5C2YA 2VTBA 4K0RA 1N94A 1Y6IA 3QK0A 4HLLA 4G8KA 3FU6A 1FT1A 4EECA 3D9KA 4JC8A 5D0QD 3ZW3A 4M3OA 4OAUC 3V79K 3MKRA 4JHRA 3FHEA 4QQIA 3JXJA 3NZSA 4HRNA 3MKQA 2CHZA 2DYSE 4U07A 4HNAD 4G24A 4IN3B 3HYMB 4YNDA 4BSXA 1NP7A 3EU9A 2KZTB 5B3SE 4KT6B 3CVPA 4CRWA 1OWOA 1TNOA 4LG6A 4XZ4A 3T9KA 1FCHA 3KEZA 5JJ7A 3UIOC 1BI7B 4GMLA 3SBTB 3MA5A 3CVYA 3ZXSA 5LCWJ 3RJVA 3K9IA 2BKKB 3R9MA 4EQFA 3ZPJA 4DI3A 3PREA 1NA0A 4F1PA 3LDZA 3C98A 3FTXA 3T5VA 4GMRA 1H0AA 3E34A 3L9TA 3EHRA 1OCCE 3B7SA 2FO7A 1KZOA 1IHGA 1TN6A 3LPZA 4JA9A 4CCAA 3ZKJA 3ZRHA 3S7BA 3L22A 1TR4A 2PM7A 3UM2A 3ML9A 4YDEA 4BX9A 4GTOA 5M72A 4C9BB 4B0ZA 4GA0A 3J5PA 5LP0A 2ILRA 3ZEFA 2CHWA 3VTXA 3IV0A 4HBDA 1SA5A 4J0UA 1RW2A 1EYHA 5BNWA 3KAEA 3IKOB 5CBNA 1YMPA 2UY1B 3FY4A 5ENSD 1DCEA 4U0ZA 2X6JA 2BKGA 1NI1A 2V8SE 2IO2C 2WXHA 3UKRG 2YNQA 5C1DA 4EPZA 4EBAA 3SGHA 2HM8A 4KXKB 3TWWA 4GB9A 5KJMA 1EPUA 5JHBA 3ASOE 4XEIG 2CG3A 2BUGA 4U8VD 3MGBA 5AARA 5EX0A 2KCKA 3HDXA 1PC2A 4TRQA 3ENEA 5KJLA 3MV3B 3ISMC 1UN8A 5CMYA 1FVFA 2VYIA 1JCSA 4DX5D 3SNXA 1JWGA 2AVPA 3B7UX 4JW1A 2VGYA 3E32A 3GYZA 3LS8A 1MYOA 3GW4A 4RVBA 2A4ZA 4IYPA 5FWQA 4GZ6A 2FULA 2L6JA 4ILIA 5BT1A 3S7FA 2WXQA 4U7EB 3IHVA 5AENA 4ACLA 3HVEB 4AY6A 3I4RB 5KNHD 1HG5A 3TWUA 1Z3YA 4WNEA 4O1PA 5BV1A 2EIJE 3CK9A 1H6KA 3C3QA 4GPKA 2OEWA 4RG6A 1D8EA 5AQ7A 4BT9A 4FU3A 4A63B 4AEZC 2XRZA 3CGHA 3ULEG 1OXJA 5JA4D 2B0OE 5H7PA 4HRMB 4URKA 3Q15A 5G05C 3CKBA 3UI2A 2C0LA 4ILGA 1BU9A 4CDMA 5FQ8A 4J8EA 3ABLE 4PS3A 5EIDA 4HS2A 2XEVA 3LYAA 1GW6A 3ZU7B 5ENRD 4P29A 3L13A 4BWRA 4BESA 3Q4AB 3SFYA 3KD7A 2FI7A 4UQZA 4TV3A 1QBQA 2P2CP 2OCCE 1HS6A 3CHMA 2ZU6B 4GZDA 2Y4TA 3RO2A 2KBXA 1E90A 4LCTA 1JCRA 2J4DA 3VTYA 2MHKA 2UWJG 1KT1A 4Z68A 3ZNGA 3D3MA 3DPDA 4A3VA 3KS2A 3U64A 5EYPF 4GCNA 1TNBA 4M7CA 4MKTA 2I2OA 4KVOA 4J7WA 4RLYA 4ANXA 4U8HA 3CVQA 2PZIA 2L6BA 4K5BA 4A3TA 3ZN3A 1OY3D 1RZ4A 3LJNA 1SW6A 4ZHBA 2X6FA 1YYHA 4N3BA 2QZAA 4ATZD 3CQCB 2XCCA 1WY6A 2XCBA 1TN7A 4B94A 2IFUA 1N52A 2RG8A 2B6CA 4A1GA 3UT4A 3HXFA 3EIQC 2KCLA 3R9AB 3AG1E 5T8IA 1JCQA 3Q75A 1MQSA 3FUIA 1H2UA 4HB5A 3AG3E 2VSNA 3UINC 4LSZE 3ZYMA 2X3MA 3FH5A 1DCQA 4I6GA 4OAVB 3SZ7A 3D9MA 3QWWA 2P9UG 2J8SD 4BSZB 3QKYA 3QDNA 2WQ6A 3ASGA 4DRXE 4BFRA 3NBNB 4ILHB 2VSYA 4TUMA 3AU5A 2IEJA 1WG0A 4UI9K 4AOFA 1WM5A 3S7JA 1YCSB 4HFGA 2P9KG 4J8FA 1HO8A 3AS5A 4UI9C 4L9PA 2DZNA 3GZ1A 4YVQC 3LVRE 3GZSA 4FC8A 1N9AA 5G2NA 2XHEA 5CEAA 1U3CA 1OUVA 4I43A 3HRAA 2H6GA 3IHYA 4GZCA 1OT8A 5A23A 4AV7A 2NXPA 5FZSA 3TWXA 5AJDA 3V2XA 5AQBA 4GTVA 3LEWA 1UN9A 2XS8A 4FHJA 1INZA 3R7RA 4L23A 1TJCA 4HRLA 2VTBB 3G2SA 4JXTA 4R7LA 4TXRA 4AVXA 3G2WA 3AAAC 1K1BA 3DSTA 3TWVA 2HR2A 3GZ2A 4HOUA 2DIWA 2A5EA 3L54A 5CBOA 4I6JA 4YDOA 1OWMA 3MKQB 3FU5A 1MX2A 2XQ0A 4DJAA 2YHEA 2CFZA 2DBAA 1QNFA 3I4GA 3NOGD 4U96D 4RG9A 5LOZA 2FO1E 3S2AA 1ZU2A 4LERA 5T4YA 4GYYA 2WXOA 4A1SA 4AXHA 3OTNA 3ZGQA 3ULQA 3HXCA 4UWFA 4BETA 4B93B 1X5BA 3HIZA 4Q96A 3W9FA 5AIJA 3RRMB 4U63A 4O6FA 1W3BA 2VGEA 1FVHA 4G1TA 3G2UA 1AP7A 2VSXE 3HXBA 4G25A 3ZIMA 2PQRA 4X8QA 5EIBE 2P58C 5HRYA 3L17A 4I2WA 4O60A 3CVUA 3RO3A 3WG7E 5HS0A 4GU5A 3ZVVA 2P9LG 3ONKA 4N3AA 3AU4A 4UWHA 5J90A 3NF1A 2KCVA 5ENQD 3RAUA 1OWLA 4U8YD 4BEPA 4NURA 1L5JA 3SHFA 2F8XK 4GA2A 4UWGA 5E76A 4APFA 4U95D 5KBAA 3UKUG 2X6IA 3EDTB 2X6KA 3O4ZA 1OCRE 4XI0A 5CEDB 3QB2A 3SO8A 4FP7A 3CVVA 5BXOA 3ZYKA 3PNLB 3FTUA 4GMJA 2R5SA 4XKBA 3KSLA 3VLEA 5BW8C 3DRAA 5FIOA 4A55A 4LNBA 3EHMA 4NIKA 4K03A 5G05J 3Q78A 4YDWA 2WXRA 1E8YA 3T8MA 5EKQD 1E96B 3LXUX 4KZ0A 3TGOA 4GTMA 3MJWA 3X2QE 3TG5A 4HOQA 1K8KG 1UW4B 2NSZA 4FADA 3URZA 1LD8A 4GYOA 4F6RD 1TNYA 2IOSA 5AJLA 3CLJA 1N4RA 2OOEA 3PUKA 5EX3A 1MX6A 2GROB 1X81A 3PVLA 2R02A 4BTAA 3C3RA 4HQDA 2ZISA 3APDA 4ABNA 5E75A 3CSTA 2AXUA 3S7DA 3FU0A 1OWPA 4O1OA 4N5CA 1WAO1 2XGSA 3ZYLA 4XIFA 3B13A 3OAWA 3RRUA 2FEZA 3TJPA 5A6CA 3G2TA 5D2MC 1WDYA 4WWOA 3UT7A 4PDXA 2CHXA 3PZ1A 3RKVA 3CHOA 3WXXA 2CFUA 2OVFA 4CZ2D 1UJJA 3FTZA 4W9RA 4JPSA 2ZGGA 3RIBA 4CGWA 3ZXPA 1HFAA 4OYSA 5CMWA 3PNTB 5KCMA 5ENPD 2Y1LE 2I1KA 2UY1A 4LEUA 5CECB 2PL2A 1JWFA 1U3DA 4V3IA 5KJKA 1JPLA 1MJ0A 3EUVA 1IHBA 3FEXA 3MYVA 3EHQA 2ETCA 1OWNA 4U0UA 5LCWC 2L9BA 4EBAG 4CYMD 2AXZA 2Q7FA 2WXMA 3PE4A 1BLXB 3Q9UC 4DLOA 1BPOA 3AG2E 3NQPA 1A5EA 2V5FA 3FUEA 3RK6A 2J4BA 2LO6A 3U66A 2AW6A 4UWKA 1BI8B 1K1AA 4APOA 2J08A 2V5QC 1DC2A 2OV8A 3ULYA 4K5AB 4AM9A 2KXPC 3JXIA 2LAIA 2YQ8A 2MRIA 5HQ8A 4UQYA 2L0TB 5JJTA 4WWPA 3E30A 4GTTA 3G2VA 4H7YA 1Q2ZA 3PEVB 3ASHA 1IQRA 2WXNA 5KJNA 2IQCA 3BG0B 5T3RA 1O1SA 3JCKC 3DSXA 3E4BA 3LY7A 4HXIA 3D9LA 2GW1A 1IKND 3Q79A 3UMVA 3OXLA 1ZB1A 1MZCA 3APFA 3PZDA 5ENOD 4FJYA 4XKCA 1V55E 3QJZA 2F37A 2Y69E 2Y4UA 5BUZA 3QAQA 4F53A 1D8DA 1SZAA 1FPPA 2AWIA 1PY1A
chains in the Genus database with same CATH topology
3PREA 3SD5A 3LEWA 3FUKA 3SFZA 1UN9A 1NA0A 4FHJA 1INZA 3QARA 4F1PA 3LDZA 3R7RA 3C98A 3JUEA 2ZGDA 4WNDA 2XEEA 4L23A 1TJCA 3FTXA 3T5VA 4DK5A 4HRLA 4GMRA 1ZBPA 1H0AA 3EIJA 2VTBB 3G2SA 4GAAA 4JXTA 4R7LA 4LUNU 4AVXA 2ETBA 3I5PA 3G2WA 3ONLA 5ARGA 1TJFA 3T5XA 5FJYA 3EHRA 3T8KA 1H2TC 3JYSA 3B7SA 2FO7A 3AAAC 3CV0A 3TAXA 3CVWA 1K1BA 2J09A 4B8CB 1SQMA 4FJZA 3CQGB 2DZOA 3TWVA 3UXGA 1IHGA 2J07A 4L2YA 2KM4A 3LPZA 2IJGX 5LFAA 4JA9A 4CCAA 3ZKJA 2HR2A 4XX5A 5FQ7A 3ZRHA 2WM9A 3GZ2A 4IULA 3AS4A 1DNPA 4HOUA 2DIWA 2WXLA 3S7BA 2A5EA 1Z6TA 3L54A 2HYZA 5CBOA 3PDNA 1HX8A 1AWCB 4I6JA 4PS7A 5ENNA 3L22A 4G26A 2XGMA 3B7TA 1OWMA 1TR4A 2PM7A 3FU5A 3MKQB 1MX2A 1PAQA 2XQ0A 4LRZA 4AP2A 4DJAA 3ML9A 4DX1A 4TUUA 1ELRA 3B7BA 2YHEA 3RRNB 2CFZA 2DBAA 3V2OA 4U96D 1QNFA 3NOGD 2NC9A 3I4GA 3JUIA 4K5CA 2FO1E 4RG9A 5LOZA 4I9CA 4BX9A 2Y3AA 1Y8MA 4FHKA 3S2AA 4C9BB 5M72A 1ZU2A 1UJKA 2HE0A 4XE0A 4LERA 5T4YA 3FH8A 3J5PA 3I3NA 4GA0A 4B0ZA 4GYYA 2WXOA 4A1SA 3N71A 4GYWA 4AXHA 2WXKA 3OTNA 4NQ0A 4I6EA 3ULQA 3ZGQA 3SBSA 2WPVA 4BERA 2ILRA 4UWFA 3ZEFA 4NRHB 5LP0A 1NA3A 3L08A 4BETA 4B93B 2CHWA 1X5BA 3ZHEA 3HIZA 2HO1A 3VTXA 5AAOA 3FUHA 3IV0A 4HBDA 3W9FA 4Q96A 3SF4A 2ONDA 2KC7A 2IONA 4ACKA 5AIJA 3RRMB 4J0UA 2FBNA 3HG0D 1XNFA 2R59A 4U63A 3FUFA 4O6FA 1N54A 3UPVA 1EYHA 5BNWA 1HH8A 2VGEA 4DX2A 1W3BA 4ANWA 1FVHA 4G1TA 3G2UA 1AP7A 4WNGA 2QY7A 2VSXE 3HVEA 2RD0A 3KAEA 2LSUA 3IKOB 5CBNA 1YMPA 2I1JA 4UI9J 3L16A 1QYMA 4G25A 2PQRA 2UY1B 3FY4A 3JQ0A 3ZIMA 5ENSD 4CGVA 4GZ5A 4WWNA 3ESLA 5EIBE 2P58C 3NOCD 4EZJA 5HRYA 2E0IA 3BEEA 3CHRA 4KBQA 1KLXA 3L17A 4I2WA 2X6JA 4U0ZA 2BKGA 4DUIA 4OVVA 1ELKA 2V8SE 4O60A 2WXHA 3P2BA 4Q69A 3CVUA 4EZLA 2WMNA 2I6HA 4N3CA 3RO3A 4HLEA 5J08A 2YNQA 5AYWD 5C1DA 1QZ2A 4MS6A 5HS0A 4GU5A 4NACA 3ZVVA 4EPZA 5EILA 4EBAA 3SGHA 2HM8A 3ONKA 4KXKB 4CT0A 5AN8A 4N3AA 3TWWA 4GB9A 5KJMA 1EPUA 2C2LA 3AU4A 4JHJA 4UWHA 1MX4A 5JHBA 5J90A 3NF1A 2KCVA 4JL0A 5ENQD 3FTSA 5G04J 5JMND 2CG3A 3RU0A 5EYLA 2BUGA 4U8VD 1OWLA 3FH7A 4U8YD 2ETAA 3MGBA 4BEPA 4KVMA 5AARA 4DX7D 4NURA 1MHQA 1S0PA 2KCKA 5EX0A 4ATGA 3HDXA 1L5JA 2V4HC 1PC2A 3SHFA 4TRQA 2F8XK 5ENTD 3ENEA 4GA2A 4UWGA 5E76A 4APFA 5KJLA 3MV3B 4U95D 2JEKA 2I9CA 1LF8A 4HORA 2A5UA 1UN8A 1G3NB 4HOSA 2FF4A 5CMYA 1FVFA 2GRMA 4CDNA 5KBAA 2VYIA 1YA0A 4G2VA 4E6HA 5FZQA 3CK8A 3FP3A 4B8AA 4DX5D 2X38A 3DEPA 2WXGA 3SNXA 3PE3A 1JWGA 2X6IA 2EQXA 3EDTB 5HI7A 2X6KA 2AVPA 3O4ZA 3Q9NC 2XGOA 4J8SA 4XI0A 5CEDB 1KT0A 3B7UX 4JW1A 5G04C 1E8WA 5FZRA 3L6AA 1SZ9A 3UX4A 2VGYA 3GYZA 3QB2A 5FQ4A 4I1OB 3HHMA 2L0IA 1MYOA 1N0RA 3GW4A 3LS8A 5AQ9A 4YVOA 4I1MA 4RVBA 2QFCA 3SO8A 2WQHA 3F6QA 3SI5A 4Y6WA 3LJ3A 2A4ZA 4IYPA 3CEQA 5FWQA 4FP7A 3CVVA 4N39A 3TWSA 5BXOA 3D9OA 3LVQE 3ZYKA 2YINA 3FTUA 3PNLB 4GMJA 4GZ6A 3DEOA 4OVUA 2R5SA 2FULA 2L6JA 5D0OD 2VSOE 4ILIA 4XKBA 3VLEA 3UTMA 5BW8C 3ZHEB 4HI8A 3S7FA 5BT1A 5FIOA 1JUQA 4A55A 2JABA 2XRYA 2WXQA 3PUJA 3U4TA 4CEMA 3EHMA 2WMOA 4NIKA 5BXUA 3FUJA 4L7TA 3J5QB 2V0PA 4K03A 3UUXA 5G05J 4YDYA 3IHVA 5AENA 4ME2A 2VJ8A 4ACLA 2KATA 3P1UA 3D9HA 3HVEB 3D9JA 4AY6A 4YDWA 2WXRA 4DLQA 3Q49B 3I4RB 3ZUVB 2PNNA 1E8YA 4JA7A 3UT8A 5KNHD 4WAFA 1HG5A 3TWUA 1Z3YA 2WXJA 4WNEA 5ANRA 3T8MA 5EKQD 4O1PA 3ZYQA 3EJNA 5CCMA 1E96B 5KWDA 1EF1C 3CK9A 3CKCA 4I2ZA 1H6KA 4GZ3A 2XZDG 4JZYA 5BV1A 3LXUX 4GPKA 3Q5MA 4KZ0A 4RG6A 4UUCA 3TGOA 5AQ7A 4BT9A 3CVXA 3CIAA 3MJWA 1E7UA 1IQUA 5ARFA 3TG5A 4FU3A 4AY5A 2WXFA 4A63B 4HOQA 4BT8A 4AEZC 1UW4B 2NSZA 3IEGA 2XRZA 4FADA 3FULA 1D9SA 3CGHA 2PQNA 3Q47B 5JA4D 3URZA 4GYOA 4F6RD 2IOSA 2B0OE 4URKA 4HRMB 3QWVA 5AJLA 3CLJA 3Q15A 5G05C 2V4LA 2OOEA 3CKBA 3UI2A 4F3VA 2C0LA 3DBSA 4HVBA 3PUKA 5EX3A 1MX6A 3PVLA 1DVPA 3FTYA 4ILGA 1XGWA 4C0MA 1BU9A 3ML8A 1ELWA 3O48A 4N2SA 4BTAA 4JEUA 4AJWA 4HQDA 2VGXA 4CDMA 5FQ8A 4KZCA 4C48B 3EHNA 4F1SA 3ESKA 4J8EA 4ANUA 3APDA 4BTBA 3U3WA 4PS3A 5EIDA 4HS2A 1HU3A 4JB8P 5E75A 3VLDA 2XPYA 2XEVA 4ABNA 4XI9A 4CT4A 3LYAA 3QWPA 1GW6A 3TWRA 3CSTA 4WUYA 1A17A 2AXUA 3ZU7B 3CVNA 4J6IA 3S7DA 1UOHA 5ENRD 3FU0A 5DIZA 4P29A 3CHSA 1OWPA 4O1OA 3L13A 4N5CA 4BWRA 5ANLA 2CG2A 3FUMA 4FA6A 2DWZA 2QYJA 1WAO1 2R17C 2XGSA 3ZYLA 4XIFA 4HOTA 3B13A 3MV2B 4BESA 3OAWA 2WB2A 5LX8A 3Q4AB 2DVWA 3MZLB 3RRUA 4B89A 3KD7A 2FI7A 4N5QA 2FEZA 3TJPA 4ANVA 5A6CA 3G2TA 1HG2A 4UQZA 1Z3XA 4TV3A 4Y6CA 1P5QA 1WDYA 4WWOA 2C0MA 2P2CP 3UT7A 2J9QA 4PDXA 2CHXA 2M63A 4I17A 1HS6A 3CHMA 5KJKA 5FTPA 2J49A 1H2VC 2ZU6B 3FUDA 4F7AA 3RKVA 3CHOA 4GZDA 4PS8A 5BPPA 2Y4TA 3RO2A 3KEAA 5CCLA 1HXIA 5EDSA 5FT9A 2KBXA 3WXXA 2CFUA 1E90A 2OVFA 4CZ2D 5A7DB 1UJJA 2GGFA 3APCA 3FTZA 4LCTA 2J4DA 1N11A 4W9RA 3FWVA 4G23A 3VTYA 2MHKA 3D9IA 2Y0BG 2UWJG 4JVSA 4IRUA 2WQ7A 4G8LA 4JPSA 2ZGGA 5CHEE 4GA1A 3RIBA 4CGWA 3FTVA 2NYJA 5JHAA 1KT1A 3FUNA 1HFAA 1HF8A 4BY6A 4L1BA 3CSFA 4Z68A 4EZKA 4U0SA 3PRZA 2E2EA 4UQXA 3ZNGA 3FTWA 3D3MA 3IXEA 1H19A 4OYSA 2YHCA 3DPDA 2AXVA 5CMWA 4A3VA 3MCXA 3KS2A 3U64A 2IU1A 3LCAA 5EYPF 3PNTB 4GCNA 2XENA 4WNFA 5KCMA 2OVBA 5ENPD 4MLPA 2QC9A 4MKTA 2I2OA 3TL5A 2Y1LE 2I1KA 2WVIA 3JQ1A 3NZUA 4LNUD 4KVOA 5BV0A 3MX3A 3CVLA 1E8XA 2UY1A 3CK7A 4J7WA 4MRUA 2RFAA 4RLYA 5CERB 4FLHA 3B7RL 2PM6A 3OXFA 3PEUB 4ANXA 4LEUA 4U8HA 2LNIA 1N0QA 3CVQA 3IBEA 5CECB 2PL2A 1JWFA 1TEZA 3B95A 1EDUA 1U3DA 4V3IA 2BF0X 2IOLA 3VLFA 1JPLA 2VGXB 1MJ0A 4FLBA 2LSVA 1BD8A 2PZIA 3PH0C 3TXMA 1IHBA 1B89A 3FEXA 3EHQA 3MYVA 2ETCA 2L6BA 2KZTA 4C0EA 2WXPA 4JHKA 4DPRA 5D66A 4K5BA 3R7QA 3ZN3A 4A3TA 3CHPA 1OY3D 2BTDA 2MYOA 3UQ3A 3LJNA 3CHQA 1OWNA 4U0UA 1SW6A 4ZHBA 5LCWC 2L9BA 4EBAG 4CYMD 2X6FA 3MEKA 1NFIE 1YYHA 4ATZD 4N3BA 2AXZA 4CDRA 2Q7FA 4HI9A 4L2LA 3D9PA 2WXMA 5DBKA 3PE4A 2XZTG 2XPZA 3W9GA 3CQCB 3FEYA 5JJ6A 2XCCA 1WY6A 2IF4A 3OXGA 4U04A 2XCBA 1BLXB 1HZ4A 4JEHA 1K3ZD 2AJAA 3TWQA 3ASDA 3Q9UC 4DLOA 1IXVA 1S70B 4B94A 1BPOA 2X6HA 4FULA 3LKUA 2IFUA 3NQPA 4PUCA 3QC1A 4DI4A 1A5EA 2XPIA 1N52A 2V5FA 5ITZF 2RG8A 4RSYA 3FUEA 1VDYA 4A1GA 4KYOB 4H7XA 3FFLA 4J8DA 3V31A 4Q94A 3RK6A 5EN5D 4KMOA 3EIQC 2KCLA 3UT4A 1QQEA 4E85A 3R9AB 2WXIA 5C2YA 5T8IA 1HE8A 3ZFWA 2MOWA 2JLBA 2J4BA 2DCPA 3TWTA 2VTBA 4K0RA 1MQSA 3FUIA 2LO6A 4HB5A 4HLLA 1H2UA 1Y6IA 3QK0A 4QFVA 2VSNA 4BX8A 3U66A 2AW6A 4G8KA 4UWKA 1BI8B 1K1AA 3FU6A 3U9WA 4APOA 4EECA 4LSZE 2J08A 2V5QC 1DC2A 2OV8A 3ZYMA 3D9KA 2X3MA 4K5AB 3FH5A 1DCQA 2KXPC 3JXIA 4JC8A 4I6GA 4OAVB 5D0QD 5HKPA 4AM9A 3ZW3A 3SZ7A 4N2QA 3D9MA 5KNGA 3QWWA 1IYGA 2LAIA 3C5RA 4I1AA 2YQ8A 2MRIA 5HQ8A 4M3OA 3QOUA 4UQYA 2L0TB 5JJTA 4OAUC 2J8SD 1E7VA 4BSZB 1SVXA 3V79K 4ZFHA 4WWPA 3MKRA 4JHRA 3QKYA 3QDNA 3FHEA 4QQIA 2WQ6A 3AS8A 3JXJA 3G2VA 3FU3A 3NZSA 3ASGA 4DRXE 4H7YA 4HRNA 3MKQA 5FINA 3PS6A 2CHZA 2GRLA 4BFRA 3PEVB 3ASHA 1IQRA 4U07A 2WXNA 4DX6D 5KJNA 4HNAD 2IQCA 3NBNB 3BG0B 4TUMA 2VSYA 4ILHB 4G24A 5G55A 3JCKC 5T3RA 3AU5A 3E4BA 3LY7A 4HXIA 4IN3B 3TXNA 3HYMB 1WG0A 4UI9K 4YNDA 1WM5A 3D9LA 2GW1A 2LAHA 4AOFA 4GPMA 3S7JA 1IKND 3CR3A 4BSXA 1YCSB 4HFGA 3EU9A 1NP7A 1E8ZA 2KZTB 4D10C 4J8FA 3UMVA 1HO8A 3AS5A 3OXLA 4KT6B 5AQAA 3CVPA 2RFMA 1OWOA 3BG1B 1NZNA 3D9NA 4UI9C 4CRWA 4LG6A 3APFA 4XZ4A 3PZDA 2DZNA 3GZ1A 2XEHA 3T9KA 4YVQC 3LVRE 3GZSA 4FC8A 5ENOD 5G2NA 2XHEA 4FJYA 4XKCA 1FCHA 3KEZA 5CEAA 1U3CA 3ASFA 2F37A 3LY9A 3QJZA 1OUVA 4UWLA 2Y4UA 5JJ7A 4I43A 1UG3A 3FDHA 1BI7B 5BUZA 2F8YA 3V30A 3QAQA 3HRAA 4GCOA 4GMLA 3SBTB 3MA5A 3IHYA 3TG4A 4AIFA 2VQ2A 4GZCA 4F53A 4PH4B 1OT8A 5A23A 1SZAA 4G11A 3CVYA 3ZXSA 5LCWJ 4AV7A 3LY8A 4I9EA 3RJVA 3K9IA 2BKKB 3QNKA 3AJIA 2NXPA 4EQFA 2AWIA 1PY1A 5FZSA 5FQ6A 4J8YA 3TWXA 3ZPJA 5AJDA 3V2XA 5AQBA 4DI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZU7 B;  5JMN D;  1UOH A;  5ENR D;  5EYL A;  1BLX B;  4U8V D;  4O1O A;  4U8Y D;  2ETA A;  4BEP A;  4F1P A;  1K3Z D;  2AJA A;  3TWQ A;  5AAR A;  4DX7 D;  3JUE A;  2ZGD A;  1IXV A;  1S70 B;  2DWZ A;  2XEE A;  3Q9U C;  2QYJ A;  2V4H C;  4GMR A;  4HRL A;  1A5E A;  2F8X K;  5ITZ F;  5ENT D;  4BES A;  2DVW A;  2ETB A;  4U95 D;  1G3N B;  4N5Q A;  3V31 A;  5EN5 D;  3EHR A;  3T8K A;  5KBA A;  1WDY A;  3AAA C;  1K1B A;  4DX5 D;  2P2C P;  3DEP A;  2DZO A;  3TWV A;  3UXG A;  3TWT A;  3Q9N C;  5CED B;  4HB5 A;  4HLL A;  3ZKJ A;  3KEA A;  4QFV A;  2KBX A;  1MYO A;  1N0R A;  4G8K A;  5AQ9 A;  1BI8 B;  1K1A A;  4CZ2 D;  2A5E A;  4LSZ E;  3SO8 A;  3F6Q A;  5CBO A;  2V5Q C;  1AWC B;  1DC2 A;  1N11 A;  4K5A B;  1DCQ A;  2KXP C;  3JXI A;  4OAV B;  3TWS A;  5HKP A;  5BXO A;  3LVQ E;  1TR4 A;  2Y0B G;  5KNG A;  1MX2 A;  3DEO A;  4G8L A;  3C5R A;  2ZGG A;  4DX1 A;  3B7B A;  2NYJ A;  3UTM A;  4OAU C;  2J8S D;  4HI8 A;  3V2O A;  4U96 D;  5FIO A;  3NOG D;  1SVX A;  4BSZ B;  3V79 K;  4K5C A;  2JAB A;  4ZFH A;  2FO1 E;  4Z68 A;  4NIK A;  4QQI A;  2HE0 A;  3ZNG A;  5BXU A;  3JXJ A;  3IXE A;  3J5Q B;  3J5P A;  4DRX E;  4HRN A;  5FIN A;  4YDY A;  4BER A;  5EYP F;  2XEN A;  4BET A;  4DX6 D;  3D9H A;  4HNA D;  5ENP D;  4B93 B;  2QC9 A;  4YDW A;  3NBN B;  4TUM A;  5AAO A;  4HBD A;  3W9F A;  2Y1L E;  2PNN A;  3ZUV B;  4LNU D;  5KNH D;  1WG0 A;  3TWU A;  3HG0 D;  4J7W A;  4GPM A;  4O1P A;  5KWD A;  2RFA A;  1IKN D;  1YCS B;  2XZD G;  3EU9 A;  4RLY A;  5CER B;  4UUC A;  2VGE A;  5AQ7 A;  4DX2 A;  1N0Q A;  5AQA A;  1AP7 A;  2RFM A;  4A63 B;  5CEC B;  4LG6 A;  5CBN A;  1YMP A;  1D9S A;  3B95 A;  1QYM A;  5JA4 D;  2DZN A;  1MJ0 A;  2XEH A;  5ENS D;  3T9K A;  4F6R D;  3LVR E;  1BD8 A;  2B0O E;  4HRM B;  5EIB E;  5ENO D;  3NOC D;  1IHB A;  5HRY A;  3EHQ A;  3UI2 A;  2ETC A;  2L6B A;  5CEA A;  2F37 A;  2BKG A;  4DUI A;  1MX6 A;  5D66 A;  4K5B A;  1BI7 B;  4O60 A;  2F8Y A;  3V30 A;  3HRA A;  1BU9 A;  1OY3 D;  2MYO A;  3LJN A;  1OT8 A;  1SW6 A;  4ZHB A;  4HQD A;  5HS0 A;  4CYM D;  4C48 B;  5EIL A;  1NFI E;  1YYH A;  2BKK B;  4ATZ D;  4HI9 A;  3AJI A;  5AN8 A;  5EID A;  3TWW A;  4JB8 P;  4J8Y A;  1MX4 A;  2XZT G;  3W9G A;  3TWX A;  3TWR A;  3V2X A;  5AQB A;  5ENQ D; 
#chains in the Genus database with same CATH topology
 4TXP A;  3FUK A;  3JUE A;  1OCO E;  3EIJ A;  4GAA A;  1N4S A;  4LUN U;  3I5P A;  3ONL A;  5ARG A;  3T5X A;  3T8K A;  3C3O A;  3CV0 A;  3TAX A;  3CVW A;  1SQM A;  3CQG B;  3UXG A;  5LFA A;  3AS4 A;  2WXL A;  2HYZ A;  1AWC B;  5ENN A;  4G26 A;  2GRP B;  4TUU A;  1ELR A;  3B7B A;  3RRN B;  3V2O A;  2NC9 A;  4K5C A;  2Y3A A;  1Y8M A;  4FHK A;  1UJK A;  4XE0 A;  3FH8 A;  3I3N A;  1H6O A;  4GYW A;  4RQI A;  2WXK A;  4NQ0 A;  3SBS A;  1FT2 A;  1NA3 A;  3ZHE A;  2ZXW E;  2HO1 A;  3FUH A;  3SF4 A;  2OND A;  2KC7 A;  2ION A;  4ACK A;  3EU5 A;  2FBN A;  1XNF A;  2R59 A;  3FUF A;  4DX2 A;  4ANW A;  2RD0 A;  5IY5 E;  2I1J A;  2P9P G;  1QYM A;  3JQ0 A;  4GTR A;  4CGV A;  2EIM E;  4GZ5 A;  4WWN A;  3ESL A;  4EZJ A;  3NOC D;  2E0I A;  4KBQ A;  1NL4 A;  4DUI A;  4OVV A;  2LXM A;  4Q69 A;  2WMN A;  4HLE A;  5J08 A;  5AYW D;  2EIL E;  4NAC A;  5EIL A;  5AN8 A;  2C2L A;  1MX4 A;  2F0Y A;  3FTS A;  5JMN D;  3RU0 A;  3FH7 A;  4ATG A;  1S0P A;  3E33 A;  2V4H C;  1LF8 A;  3PZ2 A;  2A5U A;  2FF4 A;  2GRM A;  3BU8 A;  4E6H A;  3CK8 A;  3FP3 A;  3DEP A;  2WXG A;  3PE3 A;  3Q9N C;  5G04 C;  1KT0 A;  3ABK E;  5FZR A;  5FQ4 A;  2R05 A;  4I1O B;  1O1R A;  5B1A E;  5AQ9 A;  3SI5 A;  3F6Q A;  4Y6W A;  1Z5S C;  3LJ3 A;  4N39 A;  3TWS A;  2P9S G;  2YIN A;  3C72 A;  4HI8 A;  1JUQ A;  1V54 E;  3FUJ A;  2EIK E;  3J5Q B;  2V0P A;  3UUX A;  3RSE G;  2VJ8 A;  2KAT A;  4DLQ A;  3Q49 B;  2PNN A;  3UT8 A;  3DSU A;  5ANR A;  4GTP A;  5CCM A;  1EF1 C;  5KWD A;  3E37 A;  3CKC A;  4GZ3 A;  3CVX A;  4BT8 A;  5ARF A;  4AY5 A;  3FUL A;  1D9S A;  3Q47 B;  4HVB A;  3FTY A;  1XGW A;  3ML8 A;  4AJW A;  2VGX A;  4F1S A;  4C48 B;  4ANU A;  4BTB A;  3UM1 A;  4JB8 P;  2XPY A;  4XI9 A;  3QWP A;  1A17 A;  4J6I A;  5DIZ A;  2CG2 A;  3FUM A;  4FA6 A;  2DWZ A;  2ZIR A;  3PZ3 A;  2R17 C;  5LX8 A;  2DVW A;  3MZL B;  4B89 A;  4N5Q A;  2GRN B;  1HG2 A;  1Z3X A;  4Y6C A;  1P5Q A;  2J9Q A;  4I17 A;  2XS1 A;  1H2V C;  3FUD A;  1SA4 A;  5CCL A;  3KEA A;  5EDS A;  5A7D B;  3APC A;  4G23 A;  2Y0B G;  4IRU A;  2WQ7 A;  4G8L A;  3DPY A;  4GA1 A;  3UIP C;  3FTV A;  2NYJ A;  3FTW A;  3IXE A;  2YHC A;  4JD2 G;  3MCX A;  2IU1 A;  4MLP A;  3TL5 A;  3NZU A;  5BV0 A;  4LNU D;  3MX3 A;  1E8X A;  4MRU A;  2RFA A;  1N4P A;  5CER B;  4FLH A;  2PM6 A;  2LNI A;  1N0Q A;  1EDU A;  3VLF A;  2IOL A;  1TNZ A;  3PH0 C;  3TXM A;  1B89 A;  3DXK G;  3BUA A;  2KZT A;  2WXP A;  4JHK A;  4DPR A;  3CHP A;  2IO3 C;  3CHQ A;  3SQV A;  2RKK A;  1NFI E;  3D9P A;  3Q7F A;  1TN8 A;  5DBK A;  3W9G A;  3FEY A;  2GRQ B;  2IF4 A;  3OXG A;  2P9N G;  4JEH A;  2QYU A;  1K3Z D;  2AJA A;  3ASD A;  4TXQ A;  1IXV A;  3LKU A;  2XPI A;  5ITZ F;  4RSY A;  1VDY A;  4KYO B;  4H7X A;  3FFL A;  4J8D A;  4KMO A;  4E85 A;  1HE8 A;  3ZFW A;  2MOW A;  2JLB A;  2DCP A;  3TWT A;  4QFV A;  4BX8 A;  1OCZ E;  4N2Q A;  5HKP A;  5KNG A;  1IYG A;  1LTX A;  3C5R A;  4I1A A;  3QOU A;  1E7V A;  1SVX A;  4ZFH A;  3AS8 A;  3FU3 A;  3PS6 A;  5FIN A;  2GRL A;  4DX6 D;  5G55 A;  3TXN A;  2LAH A;  4GPM A;  3CR3 A;  1E8Z A;  4D10 C;  5AQA A;  2RFM A;  3BG1 B;  3D9N A;  1NZN A;  2XEH A;  3DSS A;  2R03 A;  4UWL A;  3ASF A;  3LY9 A;  3UM0 A;  1UG3 A;  3FDH A;  2BED A;  3V30 A;  2F8Y A;  2R2L A;  4AIF A;  4GCO A;  3TG4 A;  2VQ2 A;  4PH4 B;  4G11 A;  3LY8 A;  4GTQ A;  4I9E A;  3QNK A;  3AJI A;  5FQ6 A;  4J8Y A;  2H6H A;  3SD5 A;  3SFZ A;  3QAR A;  3BQO A;  4WND A;  2ZGD A;  2XEE A;  4DK5 A;  1ZBP A;  2ETB A;  1TJF A;  5FJY A;  1H2T C;  3JYS A;  2J09 A;  5B1B E;  4B8C B;  4FJZ A;  1S64 A;  2DZO A;  2J07 A;  4L2Y A;  2KM4 A;  2IJG X;  4XX5 A;  5FQ7 A;  2WM9 A;  4IUL A;  1DNP A;  1Z6T A;  3PDN A;  1HX8 A;  4PS7 A;  2XGM A;  3B7T A;  3PZ4 A;  1PAQ A;  4LRZ A;  4AP2 A;  4DX1 A;  3JUI A;  4I9C A;  2HE0 A;  3AG4 E;  1N95 A;  3N71 A;  3DXM G;  4I6E A;  2WPV A;  4BER A;  4NRH B;  3L08 A;  2GRR B;  5AAO A;  3HG0 D;  1N54 A;  3ABM E;  3UPV A;  2H6I A;  1HH8 A;  4WNG A;  2QY7 A;  3HVE A;  4UI9 J;  3U9W A;  2LSU A;  3L16 A;  3CHR A;  3BEE A;  1KLX A;  1KZP A;  1ELK A;  3P2B A;  4EZL A;  2I6H A;  4MBG A;  4N3C A;  1QZ2 A;  4MS6 A;  2OEV A;  4CT0 A;  4JHJ A;  1H6P A;  4JL0 A;  5G04 J;  5EYL A;  2ETA A;  4KVM A;  4DX7 D;  1MHQ A;  3SFX A;  5ENT D;  2JEK A;  5CRV A;  2I9C A;  4HOR A;  1N4Q A;  4HOS A;  1G3N B;  1U2V G;  4CDN A;  1YA0 A;  3DWL G;  4G2V A;  5FZQ A;  4B8A A;  4GTS A;  2X38 A;  2EQX A;  5HI7 A;  2XGO A;  4J8S A;  1E8W A;  3L6A A;  1SZ9 A;  3UX4 A;  1O5M A;  3HHM A;  2L0I A;  1N0R A;  4YVO A;  4I1M A;  2QFC A;  2WQH A;  3CEQ A;  3D9O A;  3LVQ E;  2EIN E;  4OVU A;  3DEO A;  5D0O D;  2VSO E;  3UTM A;  3ZHE B;  2H6F A;  2JAB A;  2XRY A;  3PUJ A;  3U4T A;  4CEM A;  2WMO A;  5BXU A;  4L7T A;  3HXD A;  4YDY A;  4ME2 A;  3NB2 A;  2DYR E;  3P1U A;  3D9H A;  3D9J A;  3ZUV B;  4JA7 A;  4LNG A;  4WAF A;  2WXJ A;  3ZYQ A;  3EJN A;  4I2Z A;  4JZY A;  2XZD G;  3Q5M A;  4UUC A;  3CIA A;  1E7U A;  1IQU A;  2WXF A;  3IEG A;  2PQN A;  3Q73 A;  3KSQ A;  3QWV A;  3NAW A;  2V4L A;  4F3V A;  3DBS A;  1DVP A;  3L82 A;  4C0M A;  1ELW A;  2P9I G;  3O48 A;  4N2S A;  4JEU A;  4KZC A;  3EHN A;  3ESK A;  3U3W A;  3DSV A;  1HU3 A;  3VLD A;  4CT4 A;  4WUY A;  3TWR A;  3CVN A;  1UOH A;  3HXE A;  3CHS A;  5ANL A;  2QYJ A;  4HOT A;  3SY2 A;  3MV2 B;  2WB2 A;  4ANV A;  2C0M A;  2IY0 C;  2M63 A;  5FTP A;  2J49 A;  2LUH A;  4F7A A;  4PS8 A;  5BPP A;  1HXI A;  5FT9 A;  2GGF A;  3Q7A A;  5CRU A;  1N11 A;  3FWV A;  3D9I A;  1KPS B;  4JVS A;  5CHE E;  5JHA A;  3FUN A;  1HF8 A;  4BY6 A;  4L1B A;  3CSF A;  3DSW A;  4EZK A;  4U0S A;  3PRZ A;  2E2E A;  4UQX A;  1H19 A;  1TYQ G;  2AXV A;  3LCA A;  2XEN A;  4WNF A;  2OVB A;  2QC9 A;  2WVI A;  3JQ1 A;  3CVL A;  3CK7 A;  3B7R L;  1LD7 A;  3OXF A;  3PEU B;  3ASN E;  3IBE A;  1S63 A;  1TEZ A;  3B95 A;  2BF0 X;  2VGX B;  4FLB A;  4EHM A;  2LSV A;  1BD8 A;  4C0E A;  5D66 A;  3R7Q A;  3UQ3 A;  2BTD A;  2MYO A;  3UM3 A;  3MEK A;  4CDR A;  4HI9 A;  4L2L A;  2XZT G;  2XPZ A;  5JJ6 A;  4U04 A;  1HZ4 A;  3TWQ A;  1S70 B;  2X6H A;  4FUL A;  4DI4 A;  1TNU A;  3QC1 A;  4PUC A;  4Q94 A;  3V31 A;  5EN5 D;  1QQE A;  1O1T A;  2WXI A;  2LXL A;  5C2Y A;  2VTB A;  4K0R A;  1N94 A;  1Y6I A;  3QK0 A;  4HLL A;  4G8K A;  3FU6 A;  1FT1 A;  4EEC A;  3D9K A;  4JC8 A;  5D0Q D;  3ZW3 A;  4M3O A;  4OAU C;  3V79 K;  3MKR A;  4JHR A;  3FHE A;  4QQI A;  3JXJ A;  3NZS A;  4HRN A;  3MKQ A;  2CHZ A;  2DYS E;  4U07 A;  4HNA D;  4G24 A;  4IN3 B;  3HYM B;  4YND A;  4BSX A;  1NP7 A;  3EU9 A;  2KZT B;  5B3S E;  4KT6 B;  3CVP A;  4CRW A;  1OWO A;  1TNO A;  4LG6 A;  4XZ4 A;  3T9K A;  1FCH A;  3KEZ A;  5JJ7 A;  3UIO C;  1BI7 B;  4GML A;  3SBT B;  3MA5 A;  3CVY A;  3ZXS A;  5LCW J;  3RJV A;  3K9I A;  2BKK B;  3R9M A;  4EQF A;  3ZPJ A;  4DI3 A;  3PRE A;  1NA0 A;  4F1P A;  3LDZ A;  3C98 A;  3FTX A;  3T5V A;  4GMR A;  1H0A A;  3E34 A;  3L9T A;  3EHR A;  1OCC E;  3B7S A;  2FO7 A;  1KZO A;  1IHG A;  1TN6 A;  3LPZ A;  4JA9 A;  4CCA A;  3ZKJ A;  3ZRH A;  3S7B A;  3L22 A;  1TR4 A;  2PM7 A;  3UM2 A;  3ML9 A;  4YDE A;  4BX9 A;  4GTO A;  5M72 A;  4C9B B;  4B0Z A;  4GA0 A;  3J5P A;  5LP0 A;  2ILR A;  3ZEF A;  2CHW A;  3VTX A;  3IV0 A;  4HBD A;  1SA5 A;  4J0U A;  1RW2 A;  1EYH A;  5BNW A;  3KAE A;  3IKO B;  5CBN A;  1YMP A;  2UY1 B;  3FY4 A;  5ENS D;  1DCE A;  4U0Z A;  2X6J A;  2BKG A;  1NI1 A;  2V8S E;  2IO2 C;  2WXH A;  3UKR G;  2YNQ A;  5C1D A;  4EPZ A;  4EBA A;  3SGH A;  2HM8 A;  4KXK B;  3TWW A;  4GB9 A;  5KJM A;  1EPU A;  5JHB A;  3ASO E;  4XEI G;  2CG3 A;  2BUG A;  4U8V D;  3MGB A;  5AAR A;  5EX0 A;  2KCK A;  3HDX A;  1PC2 A;  4TRQ A;  3ENE A;  5KJL A;  3MV3 B;  3ISM C;  1UN8 A;  5CMY A;  1FVF A;  2VYI A;  1JCS A;  4DX5 D;  3SNX A;  1JWG A;  2AVP A;  3B7U X;  4JW1 A;  2VGY A;  3E32 A;  3GYZ A;  3LS8 A;  1MYO A;  3GW4 A;  4RVB A;  2A4Z A;  4IYP A;  5FWQ A;  4GZ6 A;  2FUL A;  2L6J A;  4ILI A;  5BT1 A;  3S7F A;  2WXQ A;  4U7E B;  3IHV A;  5AEN A;  4ACL A;  3HVE B;  4AY6 A;  3I4R B;  5KNH D;  1HG5 A;  3TWU A;  1Z3Y A;  4WNE A;  4O1P A;  5BV1 A;  2EIJ E;  3CK9 A;  1H6K A;  3C3Q A;  4GPK A;  2OEW A;  4RG6 A;  1D8E A;  5AQ7 A;  4BT9 A;  4FU3 A;  4A63 B;  4AEZ C;  2XRZ A;  3CGH A;  3ULE G;  1OXJ A;  5JA4 D;  2B0O E;  5H7P A;  4HRM B;  4URK A;  3Q15 A;  5G05 C;  3CKB A;  3UI2 A;  2C0L A;  4ILG A;  1BU9 A;  4CDM A;  5FQ8 A;  4J8E A;  3ABL E;  4PS3 A;  5EID A;  4HS2 A;  2XEV A;  3LYA A;  1GW6 A;  3ZU7 B;  5ENR D;  4P29 A;  3L13 A;  4BWR A;  4BES A;  3Q4A B;  3SFY A;  3KD7 A;  2FI7 A;  4UQZ A;  4TV3 A;  1QBQ A;  2P2C P;  2OCC E;  1HS6 A;  3CHM A;  2ZU6 B;  4GZD A;  2Y4T A;  3RO2 A;  2KBX A;  1E90 A;  4LCT A;  1JCR A;  2J4D A;  3VTY A;  2MHK A;  2UWJ G;  1KT1 A;  4Z68 A;  3ZNG A;  3D3M A;  3DPD A;  4A3V A;  3KS2 A;  3U64 A;  5EYP F;  4GCN A;  1TNB A;  4M7C A;  4MKT A;  2I2O A;  4KVO A;  4J7W A;  4RLY A;  4ANX A;  4U8H A;  3CVQ A;  2PZI A;  2L6B A;  4K5B A;  4A3T A;  3ZN3 A;  1OY3 D;  1RZ4 A;  3LJN A;  1SW6 A;  4ZHB A;  2X6F A;  1YYH A;  4N3B A;  2QZA A;  4ATZ D;  3CQC B;  2XCC A;  1WY6 A;  2XCB A;  1TN7 A;  4B94 A;  2IFU A;  1N52 A;  2RG8 A;  2B6C A;  4A1G A;  3UT4 A;  3HXF A;  3EIQ C;  2KCL A;  3R9A B;  3AG1 E;  5T8I A;  1JCQ A;  3Q75 A;  1MQS A;  3FUI A;  1H2U A;  4HB5 A;  3AG3 E;  2VSN A;  3UIN C;  4LSZ E;  3ZYM A;  2X3M A;  3FH5 A;  1DCQ A;  4I6G A;  4OAV B;  3SZ7 A;  3D9M A;  3QWW A;  2P9U G;  2J8S D;  4BSZ B;  3QKY A;  3QDN A;  2WQ6 A;  3ASG A;  4DRX E;  4BFR A;  3NBN B;  4ILH B;  2VSY A;  4TUM A;  3AU5 A;  2IEJ A;  1WG0 A;  4UI9 K;  4AOF A;  1WM5 A;  3S7J A;  1YCS B;  4HFG A;  2P9K G;  4J8F A;  1HO8 A;  3AS5 A;  4UI9 C;  4L9P A;  2DZN A;  3GZ1 A;  4YVQ C;  3LVR E;  3GZS A;  4FC8 A;  1N9A A;  5G2N A;  2XHE A;  5CEA A;  1U3C A;  1OUV A;  4I43 A;  3HRA A;  2H6G A;  3IHY A;  4GZC A;  1OT8 A;  5A23 A;  4AV7 A;  2NXP A;  5FZS A;  3TWX A;  5AJD A;  3V2X A;  5AQB A;  4GTV A;  3LEW A;  1UN9 A;  2XS8 A;  4FHJ A;  1INZ A;  3R7R A;  4L23 A;  1TJC A;  4HRL A;  2VTB B;  3G2S A;  4JXT A;  4R7L A;  4TXR A;  4AVX A;  3G2W A;  3AAA C;  1K1B A;  3DST A;  3TWV A;  2HR2 A;  3GZ2 A;  4HOU A;  2DIW A;  2A5E A;  3L54 A;  5CBO A;  4I6J A;  4YDO A;  1OWM A;  3MKQ B;  3FU5 A;  1MX2 A;  2XQ0 A;  4DJA A;  2YHE A;  2CFZ A;  2DBA A;  1QNF A;  3I4G A;  3NOG D;  4U96 D;  4RG9 A;  5LOZ A;  2FO1 E;  3S2A A;  1ZU2 A;  4LER A;  5T4Y A;  4GYY A;  2WXO A;  4A1S A;  4AXH A;  3OTN A;  3ZGQ A;  3ULQ A;  3HXC A;  4UWF A;  4BET A;  4B93 B;  1X5B A;  3HIZ A;  4Q96 A;  3W9F A;  5AIJ A;  3RRM B;  4U63 A;  4O6F A;  1W3B A;  2VGE A;  1FVH A;  4G1T A;  3G2U A;  1AP7 A;  2VSX E;  3HXB A;  4G25 A;  3ZIM A;  2PQR A;  4X8Q A;  5EIB E;  2P58 C;  5HRY A;  3L17 A;  4I2W A;  4O60 A;  3CVU A;  3RO3 A;  3WG7 E;  5HS0 A;  4GU5 A;  3ZVV A;  2P9L G;  3ONK A;  4N3A A;  3AU4 A;  4UWH A;  5J90 A;  3NF1 A;  2KCV A;  5ENQ D;  3RAU A;  1OWL A;  4U8Y D;  4BEP A;  4NUR A;  1L5J A;  3SHF A;  2F8X K;  4GA2 A;  4UWG A;  5E76 A;  4APF A;  4U95 D;  5KBA A;  3UKU G;  2X6I A;  3EDT B;  2X6K A;  3O4Z A;  1OCR E;  4XI0 A;  5CED B;  3QB2 A;  3SO8 A;  4FP7 A;  3CVV A;  5BXO A;  3ZYK A;  3PNL B;  3FTU A;  4GMJ A;  2R5S A;  4XKB A;  3KSL A;  3VLE A;  5BW8 C;  3DRA A;  5FIO A;  4A55 A;  4LNB A;  3EHM A;  4NIK A;  4K03 A;  5G05 J;  3Q78 A;  4YDW A;  2WXR A;  1E8Y A;  3T8M A;  5EKQ D;  1E96 B;  3LXU X;  4KZ0 A;  3TGO A;  4GTM A;  3MJW A;  3X2Q E;  3TG5 A;  4HOQ A;  1K8K G;  1UW4 B;  2NSZ A;  4FAD A;  3URZ A;  1LD8 A;  4GYO A;  4F6R D;  1TNY A;  2IOS A;  5AJL A;  3CLJ A;  1N4R A;  2OOE A;  3PUK A;  5EX3 A;  1MX6 A;  2GRO B;  1X81 A;  3PVL A;  2R02 A;  4BTA A;  3C3R A;  4HQD A;  2ZIS A;  3APD A;  4ABN A;  5E75 A;  3CST A;  2AXU A;  3S7D A;  3FU0 A;  1OWP A;  4O1O A;  4N5C A;  1WAO 1;  2XGS A;  3ZYL A;  4XIF A;  3B13 A;  3OAW A;  3RRU A;  2FEZ A;  3TJP A;  5A6C A;  3G2T A;  5D2M C;  1WDY A;  4WWO A;  3UT7 A;  4PDX A;  2CHX A;  3PZ1 A;  3RKV A;  3CHO A;  3WXX A;  2CFU A;  2OVF A;  4CZ2 D;  1UJJ A;  3FTZ A;  4W9R A;  4JPS A;  2ZGG A;  3RIB A;  4CGW A;  3ZXP A;  1HFA A;  4OYS A;  5CMW A;  3PNT B;  5KCM A;  5ENP D;  2Y1L E;  2I1K A;  2UY1 A;  4LEU A;  5CEC B;  2PL2 A;  1JWF A;  1U3D A;  4V3I A;  5KJK A;  1JPL A;  1MJ0 A;  3EUV A;  1IHB A;  3FEX A;  3MYV A;  3EHQ A;  2ETC A;  1OWN A;  4U0U A;  5LCW C;  2L9B A;  4EBA G;  4CYM D;  2AXZ A;  2Q7F A;  2WXM A;  3PE4 A;  1BLX B;  3Q9U C;  4DLO A;  1BPO A;  3AG2 E;  3NQP A;  1A5E A;  2V5F A;  3FUE A;  3RK6 A;  2J4B A;  2LO6 A;  3U66 A;  2AW6 A;  4UWK A;  1BI8 B;  1K1A A;  4APO A;  2J08 A;  2V5Q C;  1DC2 A;  2OV8 A;  3ULY A;  4K5A B;  4AM9 A;  2KXP C;  3JXI A;  2LAI A;  2YQ8 A;  2MRI A;  5HQ8 A;  4UQY A;  2L0T B;  5JJT A;  4WWP A;  3E30 A;  4GTT A;  3G2V A;  4H7Y A;  1Q2Z A;  3PEV B;  3ASH A;  1IQR A;  2WXN A;  5KJN A;  2IQC A;  3BG0 B;  5T3R A;  1O1S A;  3JCK C;  3DSX A;  3E4B A;  3LY7 A;  4HXI A;  3D9L A;  2GW1 A;  1IKN D;  3Q79 A;  3UMV A;  3OXL A;  1ZB1 A;  1MZC A;  3APF A;  3PZD A;  5ENO D;  4FJY A;  4XKC A;  1V55 E;  3QJZ A;  2F37 A;  2Y69 E;  2Y4U A;  5BUZ A;  3QAQ A;  4F53 A;  1D8D A;  1SZA A;  1FPP A;  2AWI A;  1PY1 A; 
#chains in the Genus database with same CATH homology
 3PRE A;  3SD5 A;  3LEW A;  3FUK A;  3SFZ A;  1UN9 A;  1NA0 A;  4FHJ A;  1INZ A;  3QAR A;  4F1P A;  3LDZ A;  3R7R A;  3C98 A;  3JUE A;  2ZGD A;  4WND A;  2XEE A;  4L23 A;  1TJC A;  3FTX A;  3T5V A;  4DK5 A;  4HRL A;  4GMR A;  1ZBP A;  1H0A A;  3EIJ A;  2VTB B;  3G2S A;  4GAA A;  4JXT A;  4R7L A;  4LUN U;  4AVX A;  2ETB A;  3I5P A;  3G2W A;  3ONL A;  5ARG A;  1TJF A;  3T5X A;  5FJY A;  3EHR A;  3T8K A;  1H2T C;  3JYS A;  3B7S A;  2FO7 A;  3AAA C;  3CV0 A;  3TAX A;  3CVW A;  1K1B A;  2J09 A;  4B8C B;  1SQM A;  4FJZ A;  3CQG B;  2DZO A;  3TWV A;  3UXG A;  1IHG A;  2J07 A;  4L2Y A;  2KM4 A;  3LPZ A;  2IJG X;  5LFA A;  4JA9 A;  4CCA A;  3ZKJ A;  2HR2 A;  4XX5 A;  5FQ7 A;  3ZRH A;  2WM9 A;  3GZ2 A;  4IUL A;  3AS4 A;  1DNP A;  4HOU A;  2DIW A;  2WXL A;  3S7B A;  2A5E A;  1Z6T A;  3L54 A;  2HYZ A;  5CBO A;  3PDN A;  1HX8 A;  1AWC B;  4I6J A;  4PS7 A;  5ENN A;  3L22 A;  4G26 A;  2XGM A;  3B7T A;  1OWM A;  1TR4 A;  2PM7 A;  3FU5 A;  3MKQ B;  1MX2 A;  1PAQ A;  2XQ0 A;  4LRZ A;  4AP2 A;  4DJA A;  3ML9 A;  4DX1 A;  4TUU A;  1ELR A;  3B7B A;  2YHE A;  3RRN B;  2CFZ A;  2DBA A;  3V2O A;  4U96 D;  1QNF A;  3NOG D;  2NC9 A;  3I4G A;  3JUI A;  4K5C A;  2FO1 E;  4RG9 A;  5LOZ A;  4I9C A;  4BX9 A;  2Y3A A;  1Y8M A;  4FHK A;  3S2A A;  4C9B B;  5M72 A;  1ZU2 A;  1UJK A;  2HE0 A;  4XE0 A;  4LER A;  5T4Y A;  3FH8 A;  3J5P A;  3I3N A;  4GA0 A;  4B0Z A;  4GYY A;  2WXO A;  4A1S A;  3N71 A;  4GYW A;  4AXH A;  2WXK A;  3OTN A;  4NQ0 A;  4I6E A;  3ULQ A;  3ZGQ A;  3SBS A;  2WPV A;  4BER A;  2ILR A;  4UWF A;  3ZEF A;  4NRH B;  5LP0 A;  1NA3 A;  3L08 A;  4BET A;  4B93 B;  2CHW A;  1X5B A;  3ZHE A;  3HIZ A;  2HO1 A;  3VTX A;  5AAO A;  3FUH A;  3IV0 A;  4HBD A;  3W9F A;  4Q96 A;  3SF4 A;  2OND A;  2KC7 A;  2ION A;  4ACK A;  5AIJ A;  3RRM B;  4J0U A;  2FBN A;  3HG0 D;  1XNF A;  2R59 A;  4U63 A;  3FUF A;  4O6F A;  1N54 A;  3UPV A;  1EYH A;  5BNW A;  1HH8 A;  2VGE A;  4DX2 A;  1W3B A;  4ANW A;  1FVH A;  4G1T A;  3G2U A;  1AP7 A;  4WNG A;  2QY7 A;  2VSX E;  3HVE A;  2RD0 A;  3KAE A;  2LSU A;  3IKO B;  5CBN A;  1YMP A;  2I1J A;  4UI9 J;  3L16 A;  1QYM A;  4G25 A;  2PQR A;  2UY1 B;  3FY4 A;  3JQ0 A;  3ZIM A;  5ENS D;  4CGV A;  4GZ5 A;  4WWN A;  3ESL A;  5EIB E;  2P58 C;  3NOC D;  4EZJ A;  5HRY A;  2E0I A;  3BEE A;  3CHR A;  4KBQ A;  1KLX A;  3L17 A;  4I2W A;  2X6J A;  4U0Z A;  2BKG A;  4DUI A;  4OVV A;  1ELK A;  2V8S E;  4O60 A;  2WXH A;  3P2B A;  4Q69 A;  3CVU A;  4EZL A;  2WMN A;  2I6H A;  4N3C A;  3RO3 A;  4HLE A;  5J08 A;  2YNQ A;  5AYW D;  5C1D A;  1QZ2 A;  4MS6 A;  5HS0 A;  4GU5 A;  4NAC A;  3ZVV A;  4EPZ A;  5EIL A;  4EBA A;  3SGH A;  2HM8 A;  3ONK A;  4KXK B;  4CT0 A;  5AN8 A;  4N3A A;  3TWW A;  4GB9 A;  5KJM A;  1EPU A;  2C2L A;  3AU4 A;  4JHJ A;  4UWH A;  1MX4 A;  5JHB A;  5J90 A;  3NF1 A;  2KCV A;  4JL0 A;  5ENQ D;  3FTS A;  5G04 J;  5JMN D;  2CG3 A;  3RU0 A;  5EYL A;  2BUG A;  4U8V D;  1OWL A;  3FH7 A;  4U8Y D;  2ETA A;  3MGB A;  4BEP A;  4KVM A;  5AAR A;  4DX7 D;  4NUR A;  1MHQ A;  1S0P A;  2KCK A;  5EX0 A;  4ATG A;  3HDX A;  1L5J A;  2V4H C;  1PC2 A;  3SHF A;  4TRQ A;  2F8X K;  5ENT D;  3ENE A;  4GA2 A;  4UWG A;  5E76 A;  4APF A;  5KJL A;  3MV3 B;  4U95 D;  2JEK A;  2I9C A;  1LF8 A;  4HOR A;  2A5U A;  1UN8 A;  1G3N B;  4HOS A;  2FF4 A;  5CMY A;  1FVF A;  2GRM A;  4CDN A;  5KBA A;  2VYI A;  1YA0 A;  4G2V A;  4E6H A;  5FZQ A;  3CK8 A;  3FP3 A;  4B8A A;  4DX5 D;  2X38 A;  3DEP A;  2WXG A;  3SNX A;  3PE3 A;  1JWG A;  2X6I A;  2EQX A;  3EDT B;  5HI7 A;  2X6K A;  2AVP A;  3O4Z A;  3Q9N C;  2XGO A;  4J8S A;  4XI0 A;  5CED B;  1KT0 A;  3B7U X;  4JW1 A;  5G04 C;  1E8W A;  5FZR A;  3L6A A;  1SZ9 A;  3UX4 A;  2VGY A;  3GYZ A;  3QB2 A;  5FQ4 A;  4I1O B;  3HHM A;  2L0I A;  1MYO A;  1N0R A;  3GW4 A;  3LS8 A;  5AQ9 A;  4YVO A;  4I1M A;  4RVB A;  2QFC A;  3SO8 A;  2WQH A;  3F6Q A;  3SI5 A;  4Y6W A;  3LJ3 A;  2A4Z A;  4IYP A;  3CEQ A;  5FWQ A;  4FP7 A;  3CVV A;  4N39 A;  3TWS A;  5BXO A;  3D9O A;  3LVQ E;  3ZYK A;  2YIN A;  3FTU A;  3PNL B;  4GMJ A;  4GZ6 A;  3DEO A;  4OVU A;  2R5S A;  2FUL A;  2L6J A;  5D0O D;  2VSO E;  4ILI A;  4XKB A;  3VLE A;  3UTM A;  5BW8 C;  3ZHE B;  4HI8 A;  3S7F A;  5BT1 A;  5FIO A;  1JUQ A;  4A55 A;  2JAB A;  2XRY A;  2WXQ A;  3PUJ A;  3U4T A;  4CEM A;  3EHM A;  2WMO A;  4NIK A;  5BXU A;  3FUJ A;  4L7T A;  3J5Q B;  2V0P A;  4K03 A;  3UUX A;  5G05 J;  4YDY A;  3IHV A;  5AEN A;  4ME2 A;  2VJ8 A;  4ACL A;  2KAT A;  3P1U A;  3D9H A;  3HVE B;  3D9J A;  4AY6 A;  4YDW A;  2WXR A;  4DLQ A;  3Q49 B;  3I4R B;  3ZUV B;  2PNN A;  1E8Y A;  4JA7 A;  3UT8 A;  5KNH D;  4WAF A;  1HG5 A;  3TWU A;  1Z3Y A;  2WXJ A;  4WNE A;  5ANR A;  3T8M A;  5EKQ D;  4O1P A;  3ZYQ A;  3EJN A;  5CCM A;  1E96 B;  5KWD A;  1EF1 C;  3CK9 A;  3CKC A;  4I2Z A;  1H6K A;  4GZ3 A;  2XZD G;  4JZY A;  5BV1 A;  3LXU X;  4GPK A;  3Q5M A;  4KZ0 A;  4RG6 A;  4UUC A;  3TGO A;  5AQ7 A;  4BT9 A;  3CVX A;  3CIA A;  3MJW A;  1E7U A;  1IQU A;  5ARF A;  3TG5 A;  4FU3 A;  4AY5 A;  2WXF A;  4A63 B;  4HOQ A;  4BT8 A;  4AEZ C;  1UW4 B;  2NSZ A;  3IEG A;  2XRZ A;  4FAD A;  3FUL A;  1D9S A;  3CGH A;  2PQN A;  3Q47 B;  5JA4 D;  3URZ A;  4GYO A;  4F6R D;  2IOS A;  2B0O E;  4URK A;  4HRM B;  3QWV A;  5AJL A;  3CLJ A;  3Q15 A;  5G05 C;  2V4L A;  2OOE A;  3CKB A;  3UI2 A;  4F3V A;  2C0L A;  3DBS A;  4HVB A;  3PUK A;  5EX3 A;  1MX6 A;  3PVL A;  1DVP A;  3FTY A;  4ILG A;  1XGW A;  4C0M A;  1BU9 A;  3ML8 A;  1ELW A;  3O48 A;  4N2S A;  4BTA A;  4JEU A;  4AJW A;  4HQD A;  2VGX A;  4CDM A;  5FQ8 A;  4KZC A;  4C48 B;  3EHN A;  4F1S A;  3ESK A;  4J8E A;  4ANU A;  3APD A;  4BTB A;  3U3W A;  4PS3 A;  5EID A;  4HS2 A;  1HU3 A;  4JB8 P;  5E75 A;  3VLD A;  2XPY A;  2XEV A;  4ABN A;  4XI9 A;  4CT4 A;  3LYA A;  3QWP A;  1GW6 A;  3TWR A;  3CST A;  4WUY A;  1A17 A;  2AXU A;  3ZU7 B;  3CVN A;  4J6I A;  3S7D A;  1UOH A;  5ENR D;  3FU0 A;  5DIZ A;  4P29 A;  3CHS A;  1OWP A;  4O1O A;  3L13 A;  4N5C A;  4BWR A;  5ANL A;  2CG2 A;  3FUM A;  4FA6 A;  2DWZ A;  2QYJ A;  1WAO 1;  2R17 C;  2XGS A;  3ZYL A;  4XIF A;  4HOT A;  3B13 A;  3MV2 B;  4BES A;  3OAW A;  2WB2 A;  5LX8 A;  3Q4A B;  2DVW A;  3MZL B;  3RRU A;  4B89 A;  3KD7 A;  2FI7 A;  4N5Q A;  2FEZ A;  3TJP A;  4ANV A;  5A6C A;  3G2T A;  1HG2 A;  4UQZ A;  1Z3X A;  4TV3 A;  4Y6C A;  1P5Q A;  1WDY A;  4WWO A;  2C0M A;  2P2C P;  3UT7 A;  2J9Q A;  4PDX A;  2CHX A;  2M63 A;  4I17 A;  1HS6 A;  3CHM A;  5KJK A;  5FTP A;  2J49 A;  1H2V C;  2ZU6 B;  3FUD A;  4F7A A;  3RKV A;  3CHO A;  4GZD A;  4PS8 A;  5BPP A;  2Y4T A;  3RO2 A;  3KEA A;  5CCL A;  1HXI A;  5EDS A;  5FT9 A;  2KBX A;  3WXX A;  2CFU A;  1E90 A;  2OVF A;  4CZ2 D;  5A7D B;  1UJJ A;  2GGF A;  3APC A;  3FTZ A;  4LCT A;  2J4D A;  1N11 A;  4W9R A;  3FWV A;  4G23 A;  3VTY A;  2MHK A;  3D9I A;  2Y0B G;  2UWJ G;  4JVS A;  4IRU A;  2WQ7 A;  4G8L A;  4JPS A;  2ZGG A;  5CHE E;  4GA1 A;  3RIB A;  4CGW A;  3FTV A;  2NYJ A;  5JHA A;  1KT1 A;  3FUN A;  1HFA A;  1HF8 A;  4BY6 A;  4L1B A;  3CSF A;  4Z68 A;  4EZK A;  4U0S A;  3PRZ A;  2E2E A;  4UQX A;  3ZNG A;  3FTW A;  3D3M A;  3IXE A;  1H19 A;  4OYS A;  2YHC A;  3DPD A;  2AXV A;  5CMW A;  4A3V A;  3MCX A;  3KS2 A;  3U64 A;  2IU1 A;  3LCA A;  5EYP F;  3PNT B;  4GCN A;  2XEN A;  4WNF A;  5KCM A;  2OVB A;  5ENP D;  4MLP A;  2QC9 A;  4MKT A;  2I2O A;  3TL5 A;  2Y1L E;  2I1K A;  2WVI A;  3JQ1 A;  3NZU A;  4LNU D;  4KVO A;  5BV0 A;  3MX3 A;  3CVL A;  1E8X A;  2UY1 A;  3CK7 A;  4J7W A;  4MRU A;  2RFA A;  4RLY A;  5CER B;  4FLH A;  3B7R L;  2PM6 A;  3OXF A;  3PEU B;  4ANX A;  4LEU A;  4U8H A;  2LNI A;  1N0Q A;  3CVQ A;  3IBE A;  5CEC B;  2PL2 A;  1JWF A;  1TEZ A;  3B95 A;  1EDU A;  1U3D A;  4V3I A;  2BF0 X;  2IOL A;  3VLF A;  1JPL A;  2VGX B;  1MJ0 A;  4FLB A;  2LSV A;  1BD8 A;  2PZI A;  3PH0 C;  3TXM A;  1IHB A;  1B89 A;  3FEX A;  3EHQ A;  3MYV A;  2ETC A;  2L6B A;  2KZT A;  4C0E A;  2WXP A;  4JHK A;  4DPR A;  5D66 A;  4K5B A;  3R7Q A;  3ZN3 A;  4A3T A;  3CHP A;  1OY3 D;  2BTD A;  2MYO A;  3UQ3 A;  3LJN A;  3CHQ A;  1OWN A;  4U0U A;  1SW6 A;  4ZHB A;  5LCW C;  2L9B A;  4EBA G;  4CYM D;  2X6F A;  3MEK A;  1NFI E;  1YYH A;  4ATZ D;  4N3B A;  2AXZ A;  4CDR A;  2Q7F A;  4HI9 A;  4L2L A;  3D9P A;  2WXM A;  5DBK A;  3PE4 A;  2XZT G;  2XPZ A;  3W9G A;  3CQC B;  3FEY A;  5JJ6 A;  2XCC A;  1WY6 A;  2IF4 A;  3OXG A;  4U04 A;  2XCB A;  1BLX B;  1HZ4 A;  4JEH A;  1K3Z D;  2AJA A;  3TWQ A;  3ASD A;  3Q9U C;  4DLO A;  1IXV A;  1S70 B;  4B94 A;  1BPO A;  2X6H A;  4FUL A;  3LKU A;  2IFU A;  3NQP A;  4PUC A;  3QC1 A;  4DI4 A;  1A5E A;  2XPI A;  1N52 A;  2V5F A;  5ITZ F;  2RG8 A;  4RSY A;  3FUE A;  1VDY A;  4A1G A;  4KYO B;  4H7X A;  3FFL A;  4J8D A;  3V31 A;  4Q94 A;  3RK6 A;  5EN5 D;  4KMO A;  3EIQ C;  2KCL A;  3UT4 A;  1QQE A;  4E85 A;  3R9A B;  2WXI A;  5C2Y A;  5T8I A;  1HE8 A;  3ZFW A;  2MOW A;  2JLB A;  2J4B A;  2DCP A;  3TWT A;  2VTB A;  4K0R A;  1MQS A;  3FUI A;  2LO6 A;  4HB5 A;  4HLL A;  1H2U A;  1Y6I A;  3QK0 A;  4QFV A;  2VSN A;  4BX8 A;  3U66 A;  2AW6 A;  4G8K A;  4UWK A;  1BI8 B;  1K1A A;  3FU6 A;  3U9W A;  4APO A;  4EEC A;  4LSZ E;  2J08 A;  2V5Q C;  1DC2 A;  2OV8 A;  3ZYM A;  3D9K A;  2X3M A;  4K5A B;  3FH5 A;  1DCQ A;  2KXP C;  3JXI A;  4JC8 A;  4I6G A;  4OAV B;  5D0Q D;  5HKP A;  4AM9 A;  3ZW3 A;  3SZ7 A;  4N2Q A;  3D9M A;  5KNG A;  3QWW A;  1IYG A;  2LAI A;  3C5R A;  4I1A A;  2YQ8 A;  2MRI A;  5HQ8 A;  4M3O A;  3QOU A;  4UQY A;  2L0T B;  5JJT A;  4OAU C;  2J8S D;  1E7V A;  4BSZ B;  1SVX A;  3V79 K;  4ZFH A;  4WWP A;  3MKR A;  4JHR A;  3QKY A;  3QDN A;  3FHE A;  4QQI A;  2WQ6 A;  3AS8 A;  3JXJ A;  3G2V A;  3FU3 A;  3NZS A;  3ASG A;  4DRX E;  4H7Y A;  4HRN A;  3MKQ A;  5FIN A;  3PS6 A;  2CHZ A;  2GRL A;  4BFR A;  3PEV B;  3ASH A;  1IQR A;  4U07 A;  2WXN A;  4DX6 D;  5KJN A;  4HNA D;  2IQC A;  3NBN B;  3BG0 B;  4TUM A;  2VSY A;  4ILH B;  4G24 A;  5G55 A;  3JCK C;  5T3R A;  3AU5 A;  3E4B A;  3LY7 A;  4HXI A;  4IN3 B;  3TXN A;  3HYM B;  1WG0 A;  4UI9 K;  4YND A;  1WM5 A;  3D9L A;  2GW1 A;  2LAH A;  4AOF A;  4GPM A;  3S7J A;  1IKN D;  3CR3 A;  4BSX A;  1YCS B;  4HFG A;  3EU9 A;  1NP7 A;  1E8Z A;  2KZT B;  4D10 C;  4J8F A;  3UMV A;  1HO8 A;  3AS5 A;  3OXL A;  4KT6 B;  5AQA A;  3CVP A;  2RFM A;  1OWO A;  3BG1 B;  1NZN A;  3D9N A;  4UI9 C;  4CRW A;  4LG6 A;  3APF A;  4XZ4 A;  3PZD A;  2DZN A;  3GZ1 A;  2XEH A;  3T9K A;  4YVQ C;  3LVR E;  3GZS A;  4FC8 A;  5ENO D;  5G2N A;  2XHE A;  4FJY A;  4XKC A;  1FCH A;  3KEZ A;  5CEA A;  1U3C A;  3ASF A;  2F37 A;  3LY9 A;  3QJZ A;  1OUV A;  4UWL A;  2Y4U A;  5JJ7 A;  4I43 A;  1UG3 A;  3FDH A;  1BI7 B;  5BUZ A;  2F8Y A;  3V30 A;  3QAQ A;  3HRA A;  4GCO A;  4GML A;  3SBT B;  3MA5 A;  3IHY A;  3TG4 A;  4AIF A;  2VQ2 A;  4GZC A;  4F53 A;  4PH4 B;  1OT8 A;  5A23 A;  1SZA A;  4G11 A;  3CVY A;  3ZXS A;  5LCW J;  4AV7 A;  3LY8 A;  4I9E A;  3RJV A;  3K9I A;  2BKK B;  3QNK A;  3AJI A;  2NXP A;  4EQF A;  2AWI A;  1PY1 A;  5FZS A;  5FQ6 A;  4J8Y A;  3TWX A;  3ZPJ A;  5AJD A;  3V2X A;  5AQB A;  4DI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...