4QFVA

Crystal structure of a unique ankyrin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MSMDIGKKLLEAARAGHDDSVEVLLKKGADINAKDNSGRTPLHVAALNGHLELVKLLLEKGADINARDMFGLTPLHTAASNGHLELVKLLLEKGADINARDEDGSTPLHLAASNGHLELVKLLLEKGADINAEDHSGTTPLHFAAKNGHLELVKLLLEKGADINASDFSGPTPLHSAAENGHLELVKLLLEKGADINARDKFGKTPFDLAIDNGNEDIAEVLQKAARSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A transcription blocker isolated from a designed repeat protein combinatorial library by in vivo functional screen.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords ANK-N5C-281
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4qfvA01
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4qfvA02
3V2OA 3NBNB 1G3NB 3TWXA 1YMPA 4JB8P 1K1AA 2RFMA 4HRMB 4O1PA 2V5QC 2P2CP 2XEHA 1YCSB 2BKKB 4ZHBA 1D9SA 2ETCA 4OAVB 2MYOA 1MYOA 1IXVA 3Q9NC 5EIBE 5ENTD 5FINA 3TWVA 5EILA 3TWUA 1IKND 5AQ7A 1UOHA 4N5QA 3NOCD 5CBNA 3EU9A 2J8SD 3IXEA 4J7WA 3JUEA 3V30A 3JXIA 3UI2A 1BU9A 4HI8A 3W9FA 4UUCA 5D66A 4HRLA 3DEOA 4C48B 4U8VD 5AARA 4K5AB 2XEEA 2ETAA 4BESA 5AQ9A 5CEAA 4BETA 3HRAA 3LVQE 3V31A 4J8YA 1N11A 1SVXA 1NFIE 4NIKA 3UXGA 4BEPA 2V4HC 1BI7B 4HLLA 5EYLA 5ENSD 1S70B 5ENRD 4B93B 4HI9A 1WG0A 1TR4A 3J5QB 4U95D 2HE0A 4O60A 1MX6A 4K5BA 5ENPD 4GPMA 2PNNA 2KXPC 4CYMD 2ETBA 4DX5D 2QYJA 2Y1LE 5EYPF 5JMND 1QYMA 4BERA 4Z68A 2F8XK 3AAAC 2XZTG 5ENQD 4DUIA 5AAOA 1OT8A 3TWTA 4DX1A 1MX2A 1YYHA 2XZDG 5ITZF 2VGEA 4QQIA 5CEDB 2A5EA 3ZU7B 5BXUA 1OY3D 1AP7A 4HQDA 2B0OE 3DEPA 5HKPA 2DVWA 3HG0D 1WDYA 2RFAA 3TWRA 3B7BA 1DC2A 4LNUD 3W9GA 4DRXE 2NYJA 4K5CA 5AN8A 3ZKJA 2JABA 2DZNA 4DX7D 4YDYA 4U8YD 3V2XA 5FIOA 3EHQA 3Q9UC 3C5RA 4HRNA 1DCQA 4G8LA 3T9KA 5KNGA 5KNHD 4ATZD 3JXJA 5CERB 3TWWA 3UTMA 5CECB 4OAUC 2ZGDA 2AJAA 1A5EA 1BI8B 3LJNA 5EIDA 3T8KA 2BKGA 4BSZB 5KWDA 3D9HA 3EHRA 5AQAA 1N0QA 4HNAD 4G8KA 4O1OA 3V79K 2QC9A 5BXOA 1MJ0A 5KBAA 1AWCB 3LVRE 1IHBA 2ZGGA 4QFVA 3F6QA 3NOGD 3ZUVB 4DX2A 4U96D 5EN5D 2KBXA 4LSZE 5HRYA 4A63B 4GMRA 3AJIA 3SO8A 3ZNGA 2Y0BG 4CZ2D 3J5PA 4F6RD 1N0RA 2F37A 4YDWA 3TWSA 4HBDA 2DWZA 5CBOA 4F1PA 5JA4D 4DX6D 3B95A 1K1BA 2XENA 4TUMA 1K3ZD 5HS0A 3TWQA 1BD8A 2F8YA 2FO1E 4RLYA 1MX4A 5ENOD 4LG6A 1SW6A 2L6BA 3KEAA 4HB5A 2DZOA 5AQBA 1BLXB 4ZFHA
chains in the Genus database with same CATH superfamily
1MHQA 3U9WA 3GYZA 4HOSA 4WWPA 3UQ3A 1EF1C 2XHEA 2WXIA 4BT9A 2P9LG 3D9IA 3EU9A 2GRLA 1BU9A 3LY7A 3HXFA 3CSFA 2WXMA 2Q7FA 5LFAA 3QARA 4U8VD 2ETAA 5FQ4A 3MYVA 1NFIE 2GRRB 2R2LA 4NIKA 3GZ1A 5FZQA 4U95D 3AS8A 4XI9A 4RQIA 3ESKA 4ANWA 3FTWA 4BERA 3RRUA 5D0QD 3R7QA 2XZDG 5CEDB 4H7XA 4XI0A 3HG0D 4G26A 4LNUD 4JPSA 1A17A 2NYJA 4RSYA 2R05A 4AEZC 1OUVA 2CFZA 1QNFA 1A5EA 2AJAA 2MRIA 1BI8B 3ZIMA 4I9CA 4XIFA 2X38A 3TXMA 1WY6A 5BXOA 1BPOA 2QFCA 4EHMA 3AG2E 4K03A 3FUEA 5JA4D 1FVFA 2XENA 3BG0B 4Q94A 4FADA 2WXPA 4GTOA 4E85A 3FH7A 3HYMB 2ETCA 4KT6B 2X6IA 4UWKA 4I6JA 2VGXA 5IY5E 4N2QA 3IXEA 5EDSA 3AG3E 4RG9A 3BQOA 4M7CA 1UN8A 2WPVA 1L5JA 3KEZA 4CDRA 1OCZE 2WXGA 2BUGA 1LF8A 5G05C 5G55A 1TN6A 2J09A 4XE0A 3D9MA 3T5VA 3D9OA 3E33A 4L7TA 4PUCA 4V3IA 5BXUA 3PEUB 3S7BA 5AN8A 4YDOA 4DX7D 4XKCA 3ZRHA 2FULA 4EPZA 1NP7A 5JJ7A 4FC8A 5EX3A 2VGXB 3CK9A 3P2BA 1ZU2A 1PAQA 5AYWD 1KT1A 5FTPA 4I6GA 3I4RB 3CV0A 4F6RD 4F1PA 2VSOE 4EZKA 3UT4A 2XPIA 5BW8C 3RO2A 4DLQA 4LEUA 3QB2A 1YMPA 4B94A 3CK7A 4FHJA 4B8AA 4BWRA 1HG5A 1ZBPA 2MYOA 1MYOA 1U2VG 4PDXA 1Z6TA 5HI7A 3PZDA 3C3OA 2PM7A 2XGMA 2IQCA 3UMVA 2IO2C 4J7WA 5LCWJ 3UM2A 3PH0C 1KT0A 1IHGA 1TN7A 3SZ7A 4C48B 3LY8A 3AU5A 2Y4TA 2LAHA 3UX4A 2WQ6A 3ASHA 1N4PA 4OYSA 2FEZA 4K5BA 4MKTA 2P58C 5EYPF 1PC2A 4GMJA 4U0ZA 3I4GA 5T3RA 2XS8A 3RRNB 3NF1A 4I1AA 3ASFA 3DSXA 3CSTA 3ULQA 3Q9UC 4HRNA 4I2WA 3OXLA 1H2UA 4TUUA 4DJAA 2E2EA 1X81A 4YDEA 4CGWA 3IHVA 4I43A 1EDUA 2WXLA 2WXFA 3ZUVB 3FUDA 2KZTB 2ZISA 3Q47B 5G05J 3SO8A 4APFA 4WWOA 5KJNA 4LRZA 4KXKB 3EJNA 1HS6A 1TJCA 3Q15A 4GYOA 1OXJA 2L6BA 4HB5A 5AQBA 3FU3A 3ULYA 1O1TA 3EUVA 1RW2A 4UI9C 2XS1A 4YNDA 3TWUA 2L6JA 3PZ4A 2HR2A 3VLFA 1HO8A 1D8DA 4KVMA 3JXIA 4BX9A 4AY6A 4HI8A 2HM8A 2EINE 2E0IA 3L82A 3QDNA 3T8MA 3PS6A 2XEEA 3LXUX 2F0YA 3HRAA 2AW6A 1N54A 3JUIA 4Q69A 4IRUA 3ZFWA 2CHWA 5G04J 2X3MA 2X6HA 3DSUA 2EILE 3FUNA 2HYZA 4N39A 4JHKA 2MHKA 2KZTA 3NAWA 2VGEA 3HHMA 4B8CB 3IV0A 4DRXE 3HDXA 1UJJA 1SA5A 5KNHD 3HXDA 3SD5A 2XCCA 5FZRA 3CQCB 1XNFA 3D9NA 2LAIA 3DXKG 2WM9A 3AG4E 4WNDA 4AY5A 4GMRA 3AJIA 3ASDA 3PUKA 4YDWA 5B1AE 1H19A 3MEKA 1UG3A 3CVVA 4TUMA 2GRNB 4LG6A 3MV2B 4A3VA 2V5QC 2KCVA 3Q49B 4NACA 1IKND 3QK0A 5CBNA 4TV3A 3RU0A 3DSSA 2OEVA 3V30A 3UI2A 4AJWA 4YVQC 3ML8A 1O1SA 4BETA 1K8KG 1DCEA 5D0OD 2KATA 3R9MA 1SVXA 2QY7A 3UXGA 3NZUA 4GZ3A 4AOFA 1FT2A 3L17A 1OWPA 4KZ0A 1E8YA 3LY9A 4B93B 4HVBA 4U8HA 2OV8A 2F8XK 4Z68A 3ZYQA 4BFRA 3FFLA 2M63A 5BPPA 3L9TA 3B7BA 3AS5A 3LS8A 1NI1A 2EIKE 2GGFA 3V2XA 4G8LA 1JCSA 3JXJA 3MV3B 3DRAA 1TJFA 3D9LA 4ACLA 2IFUA 3ABME 5CRUA 3FUIA 3V79K 3L6AA 1TNYA 1S64A 4JEUA 1KZOA 4EQFA 4U0SA 3D9JA 3SFYA 2VQ2A 3DPDA 4UWHA 2DWZA 2RG8A 2J4BA 1PY1A 3IEGA 4L1BA 2F8YA 1MX4A 4WNFA 2OOEA 3TWXA 3BEEA 4O1PA 2P2CP 2J07A 3C3QA 1HE8A 2VTBB 5EIBE 3E32A 2A5UA 4UWLA 2WXKA 2ZXWE 1NA0A 4AM9A 3CHQA 4APOA 4UUCA 4HRLA 5BT1A 2R59A 3ZW3A 4BTAA 5AARA 3CR3A 2VSYA 5CEAA 3FTYA 3PREA 4TRQA 4BTBA 3DPYA 4JVSA 3QJZA 4W9RA 3WG7E 3NB2A 3FTSA 3CHMA 1EYHA 2IOSA 1S0PA 4G11A 2GROB 5ARGA 1U3CA 3ZXPA 3I3NA 4UWFA 2Y69E 4IN3B 2RKKA 2WQHA 4JHRA 4FA6A 2DBAA 3TWWA 3UTMA 4OAUC 4RG6A 4BSZB 3PZ3A 1E8WA 3TXNA 1OCCE 3QWVA 4O1OA 1ELKA 4CCAA 1N52A 3NOGD 3ZNGA 4AP2A 4P29A 2WMNA 4EECA 2WXHA 5C2YA 5FZSA 3ZPJA 3MX3A 2AVPA 3ZEFA 3CK8A 1EPUA 2IOLA 5B1BE 2RD0A 1TN8A 3LJ3A 1YCSB 3GZSA 3I5PA 3MJWA 3DSWA 5FJYA 3FUMA 4GA0A 5ENTD 5FQ8A 3ONKA 4JA7A 4ILIA 2XPZA 3K9IA 3G2UA 2J8SD 3IBEA 5FWQA 3HIZA 2R02A 1OWMA 3PNTB 4BESA 1LD7A 2B6CA 3VLDA 3CKCA 1BI7B 4HLLA 4ACKA 2C2LA 4G24A 2KXPC 1YA0A 5JMND 4WNGA 4B0ZA 3CLJA 3RJVA 1E96B 1X5BA 5ITZF 4QQIA 4F7AA 3C98A 2RFAA 4JL0A 4GTMA 4FHKA 2JABA 4GZCA 3BUAA 3HVEA 5KNGA 2L0IA 3EIQC 4F3VA 3RRMB 3TG5A 3O48A 2Y0BG 2Y3AA 4J8SA 1Y8MA 5BV1A 4O6FA 1H6OA 4MS6A 2IJGX 3KEAA 1BLXB 1G3NB 1HU3A 2YQ8A 3EIJA 4GTSA 1MZCA 5JJTA 4Y6CA 1N4QA 4HS2A 2P9SG 3CIAA 4DPRA 1D8EA 4G25A 3L08A 3LVQE 4GTPA 2IF4A 5KJMA 4L2YA 5HQ8A 5LX8A 3CHRA 3FEXA 4ANVA 1HFAA 3J5QB 3Q7AA 3JYSA 3X2QE 5ENQD 5AJDA 4XKBA 4MRUA 1MX2A 4WWNA 1E7UA 3FU6A 2B0OE 3IHYA 3W9GA 4CRWA 1OWOA 1TNZA 2P9PG 3CHSA 2LXLA 3FUJA 3D9PA 3PZ2A 2CHZA 1Z3XA 2DIWA 3FTVA 3HXCA 2XRYA 4J8DA 2XCBA 4LCTA 4MLPA 4I2ZA 2ZGGA 3F6QA 2KBXA 5HRYA 3L22A 3PZ1A 4CZ2D 3FU0A 4GA2A 1FPPA 3LCAA 5EX0A 4WUYA 4GTRA 3SF4A 1FT1A 4RLYA 2ZIRA 1NA3A 2PQRA 4OVVA 3FU5A 4ZFHA 1B89A 2EQXA 5DIZA 4HOQA 4LNGA 3KD7A 3UPVA 5EILA 4JA9A 4CDMA 1O5MA 4HOTA 3FUHA 3W9FA 1TYQG 3MKRA 3CVYA 2BTDA 3L13A 5C1DA 2I6HA 2IONA 2LO6A 3V31A 3UIPC 2ILRA 2OVBA 4GTTA 1WG0A 4IULA 4GPMA 4DX5D 5CMYA 2Y1LE 4E6HA 3AS4A 1OT8A 1YYHA 3QWPA 2OVFA 3SBSA 2FBNA 1H6KA 1N4SA 3Q79A 1E7VA 3LEWA 1SZAA 3B7TA 1P5QA 1H0AA 1GW6A 3PDNA 3OXGA 4HXIA 3ZKJA 2V4LA 5T8IA 3ZHEB 2YNQA 3S7JA 1HX8A 1N0QA 1DNPA 3PRZA 2J9QA 5ARFA 4J8FA 4A55A 4NQ0A 3SFXA 2VGYA 2WXNA 3QC1A 4IYPA 4C9BB 2DYRE 2FO1E 4U0UA 3ASNE 1HXIA 2WXQA 4BSXA 4I1MA 3TGOA 1SZ9A 1N9AA 1NL4A 3UKRG 5G04C 4NURA 1JWFA 1XGWA 3OAWA 1QQEA 5D66A 4G23A 4U63A 5CHEE 4HLEA 2JEKA 2Y4UA 4J0UA 4JW1A 2FO7A 4EBAG 4GA1A 3U64A 3Q75A 3G2WA 3ZXSA 3FP3A 2WXOA 2IU1A 4KVOA 4UI9J 2XGSA 1FCHA 1UN9A 1OCOE 4EBAA 4CT0A 1IQUA 1QZ2A 4GCOA 3SHFA 3AAAC 4UQYA 1Z5SC 3PE4A 2AXVA 3UKUG 4ABNA 2CFUA 3T9KA 1E90A 3CQGB 5AIJA 4XEIG 3APDA 1N94A 1U3DA 1JWGA 5EIDA 2BKGA 3D9HA 3EHRA 4G8KA 3EHMA 4ILGA 4YVOA 2GW1A 4CT4A 1N0RA 3G2VA 1H2TC 4HBDA 3ZYLA 1UJKA 3C3RA 1BD8A 4GZ6A 4KYOB 4HORA 3R7RA 4L23A 4N2SA 3V2OA 3NBNB 1RZ4A 3LYAA 4F53A 3E4BA 4HRMB 4C0MA 3LDZA 3Q78A 4B89A 3JUEA 4Y6WA 3CHOA 4JZYA 3ML9A 3CVUA 3AG1E 3QAQA 2GRPB 5E76A 4LERA 1H6PA 5KJLA 5T4YA 2V4HC 3LKUA 4C0EA 3ASGA 4TXRA 5EYLA 4L2LA 1TR4A 2PQNA 2HE0A 2FI7A 1KPSB 4PH4B 5AAOA 4PS3A 3R9AB 4TXQA 2QZAA 2PZIA 5E75A 3RK6A 4HOUA 2OEWA 4N3CA 5A7DB 2DZNA 2NC9A 2YHEA 1N4RA 5CERB 2OCCE 1WM5A 3MA5A 4AV7A 2V5FA 4GB9A 3FEYA 3Q5MA 3ZVVA 1E8ZA 3DWLG 2QC9A 2A4ZA 2AXZA 2P9UG 4GTQA 5ANRA 3UT7A 5CCMA 2PM6A 4DI4A 2I9CA 5FT9A 1ELRA 3PNLB 3IKOB 2KC7A 3TJPA 3ASOE 4JXTA 5DBKA 4LNBA 4GPKA 3DSVA 4ILHB 2DZOA 3PE3A 4X8QA 3EDTB 1TNOA 4RVBA 2XEHA 4F1SA 4CGVA 3GW4A 1N95A 5AJLA 4AXHA 2I1JA 4N5CA 3ABLE 3SGHA 5JHAA 4MBGA 1IYGA 4BT8A 2BEDA 4N3BA 2ONDA 3HXBA 3BG1B 2L9BA 3UIOC 4FULA 3RSEG 3RO3A 2IY0C 3CHPA 5ENSD 1INZA 4O60A 2QYJA 1QYMA 2L0TB 4H7YA 3TWTA 5FQ7A 5CCLA 3G2SA 3TWRA 3SBTB 2LSVA 1TEZA 3FH8A 3T5XA 2P9IG 1JCQA 1JCRA 5CECB 1HH8A 1KZPA 3AU4A 3PEVB 2XPYA 4HNAD 1AWCB 3LVRE 1W3BA 3Q4AB 5EN5D 1Z3YA 4A63B 4LSZE 2VYIA 4KBQA 3FTZA 5G2NA 3O4ZA 2R5SA 3TWSA 5CBOA 2WXRA 5HS0A 5ENOD 3L54A 3FUFA 1SW6A 1JUQA 2J4DA 3KSLA 3DBSA 5J08A 3TL5A 5A23A 3D9KA 1IXVA 3JQ0A 5FINA 2EIME 3FTUA 1HZ4A 3UM1A 4BY6A 4PS8A 1HF8A 4A1SA 1S63A 3SFZA 3ULEG 3CVWA 3VTYA 3FTXA 2UY1B 2XGOA 4GAAA 4CEMA 5M72A 2BF0X 2LSUA 3ONLA 4HI9A 4I6EA 4UI9K 5ENPD 1KLXA 2I1KA 4CYMD 3EU5A 3ENEA 2UWJG 4GTVA 3B7UX 3FUKA 3APCA 3C72A 2YINA 3CEQA 3MKQB 4WAFA 3HXEA 3SQVA 3RAUA 3Q7FA 4ANXA 3MGBA 2PL2A 3CVLA 3TG4A 3URZA 3SY2A 4U8YD 4DK5A 1DCQA 4GMLA 3S7FA 3KSQA 3ZGQA 2DCPA 3OTNA 1SA4A 4L9PA 5KBAA 3SNXA 1OCRE 4I17A 4U04A 3J5PA 3PUJA 3NQPA 4UQXA 3CVPA 1E8XA 4DX6D 2J49A 3CGHA 5ENNA 2H6GA 3JQ1A 4FJZA 3VTXA 5H7PA 1K1AA 2RFMA 4ATGA 3ABKE 3S2AA 4ZHBA 2FF4A 4OAVB 4KZCA 4FLBA 4BX8A 3ZYKA 3TWVA 4LUNU 5LP0A 1UOHA 2CG2A 2V0PA 4J6IA 4U07A 4WNEA 1LD8A 3MCXA 2AWIA 4J8YA 1O1RA 1N11A 4D10C 3ISMC 3OXFA 4BEPA 4GYYA 4A1GA 1S70B 5ENRD 2JLBA 2PNNA 4A3TA 1OWLA 2ETBA 2EIJE 3CKBA 5B3SE 3CVQA 2GRMA 3APFA 4FP7A 4DX1A 5KCMA 1OY3D 4HQDA 2I2OA 2LUHA 2VSXE 3NZSA 2VJ8A 2WMOA 4N3AA 1DC2A 3E34A 4ANUA 3ZHEA 3G2TA 4CDNA 1SQMA 4M3OA 5FIOA 2ZU6B 4DI3A 2YHCA 5BNWA 3UUXA 4GZDA 2X6KA 3KS2A 3U66A 3QWWA 1MJ0A 1OWNA 4DX2A 4R7LA 1TNBA 3B7RL 2F37A 2KM4A 3SI5A 4DLOA 3B95A 2IO3C 4NRHB 1K3ZD 3MKQA 2LXMA 5FQ6A 2J08A 2HO1A 1D9SA 1VDYA 2UY1A 3Q9NC 3B7SA 3UT8A 4JC8A 5AQ7A 3D3MA 4N5QA 4AVXA 1V54E 3ZN3A 3FH5A 3QNKA 3N71A 1Y6IA 3DEOA 4I9EA 5LOZA 4URKA 2LNIA 4Q96A 2P9KG 3BU8A 2XQ0A 4EZJA 3EHNA 4OVUA 1MX6A 2WB2A 3PVLA 5CMWA 3HVEB 2DYSE 2XZTG 4DUIA 2C0MA 5JHBA 1LTXA 3ZU7B 1AP7A 4JEHA 3DEPA 5HKPA 2DVWA 1H2VC 1WDYA 2KCKA 4G2VA 2WVIA 1IQRA 5CRVA 1NZNA 4K5CA 4XZ4A 4YDYA 3EHQA 2XEVA 3Q73A 1HG2A 3LJNA 5KWDA 5AQAA 4GU5A 3RKVA 4U96D 4FU3A 2IEJA 5BV0A 1DVPA 3FULA 4GZ5A 4HFGA 3GZ2A 1QBQA 1K1BA 3ESLA 3CVXA 4K0RA 3B13A 2P9NG 4TXPA 2CHXA 1TNUA 3S7DA 2V8SE 4JB8P 2AXUA 5EKQD 2BKKB 3ZYMA 3UINC 3NOCD 2R03A 3FWVA 5ANLA 3QKYA 4XX5A 3TAXA 2NSZA 3DSTA 4K5AB 4G1TA 5AQ9A 2H6IA 2C0LA 3FDHA 4GCNA 4U7EB 3LPZA 2KCLA 2X6JA 4JD2G 1UW4B 4JHJA 2H6HA 3RIBA 2MOWA 3UM3A 5D2MC 2H6FA 5LCWC 2X6FA 4KMOA 5AENA 3FHEA 3VLEA 3E37A 3CVNA 2WQ7A 3UM0A 5J90A 4PS7A 4FLHA 2A5EA 2QYUA 5BUZA 5A6CA 3WXXA 3P1UA 4I1OB 5KJKA 5JJ6A 4UQZA 3DXMG 3JCKC 2VSNA 1JPLA 1MQSA 2GRQB 3C5RA 2XRZA 4ATZD 3E30A 2ZGDA 4UWGA 3T8KA 2VTBA 1FVHA 3MZLB 3U3WA 3L16A 1V55E 1Q2ZA 1ZB1A 2R17C 2CG3A 1IHBA 4QFVA 3FY4A 2WXJA 1WAO1 3QOUA 3U4TA 4GYWA 3TWQA 1ELWA 3KAEA 4ME2A 4FJYA 4AIFA 4J8EA 2NXPA 4EZLA
chains in the Genus database with same CATH topology
1B89A 3MV2B 3DBSA 2EQXA 4A3VA 5DIZA 1MHQA 3U9WA 5J08A 2V5QC 4HOQA 3GYZA 4HOSA 2KCVA 4WWPA 3UQ3A 3TL5A 3KD7A 5A23A 3Q49B 3D9KA 1IXVA 3JQ0A 3UPVA 1EF1C 2XHEA 5FINA 5EILA 4NACA 4HVBA 1IKND 2WXIA 3FTUA 4BT9A 3D9IA 1HZ4A 3QK0A 5CBNA 3EU9A 4JA9A 4BY6A 4CDMA 4PS8A 4TV3A 3RU0A 2GRLA 3V30A 4HOTA 1HF8A 3UI2A 1BU9A 3FUHA 3LY7A 4A1SA 4AJWA 3W9FA 3CSFA 4YVQC 3ML8A 2WXMA 2Q7FA 5LFAA 3MKRA 3QARA 3CVYA 4U8VD 3SFZA 2BTDA 3L13A 5C1DA 2ETAA 3CVWA 2I6HA 2IONA 4BETA 2LO6A 5FQ4A 3VTYA 3FTXA 2UY1B 3MYVA 3V31A 2XGOA 5D0OD 2KATA 4AY5A 4GAAA 4CEMA 1SVXA 1NFIE 2QY7A 4NIKA 3UXGA 2ILRA 2OVBA 3NZUA 4GZ3A 3GZ1A 5M72A 2BF0X 4AOFA 3L17A 2LSUA 5FZQA 1OWPA 4B93B 1E8YA 3LY9A 4HI9A 1WG0A 4U95D 3ONLA 4I6EA 3AS8A 4KZ0A 5ENPD 1KLXA 4IULA 2I1KA 4U8HA 4UI9K 4GPMA 4XI9A 4CYMD 4DX5D 3ESKA 5CMYA 2OV8A 2Y1LE 4ANWA 3FTWA 4BERA 4Z68A 2F8XK 4E6HA 3AS4A 3ENEA 2UWJG 5D0QD 3B7UX 1OT8A 3FUKA 3APCA 3R7QA 3RRUA 1YYHA 2YINA 2XZDG 3ZYQA 5CEDB 2OVFA 3CEQA 3MKQB 3QWPA 4H7XA 4XI0A 3SBSA 2FBNA 1H6KA 3FFLA 4BFRA 4WAFA 2M63A 1E7VA 3HG0D 4G26A 3LEWA 5BPPA 3B7BA 1SZAA 3B7TA 4ANXA 1P5QA 4LNUD 3MGBA 4JPSA 1A17A 2PL2A 1H0AA 1GW6A 3CVLA 3PDNA 3AS5A 2NYJA 3LS8A 4RSYA 3OXGA 2GGFA 4HXIA 3ZKJA 2V4LA 3TG4A 3URZA 4U8YD 3V2XA 4DK5A 5T8IA 1DCQA 4G8LA 3ZHEB 4AEZC 1OUVA 2YNQA 4GMLA 3JXJA 3MV3B 3S7FA 2CFZA 1TJFA 1QNFA 1A5EA 2AJAA 3D9LA 4ACLA 2MRIA 1BI8B 2IFUA 3ZIMA 3S7JA 3FUIA 3ZGQA 4I9CA 1HX8A 2DCPA 2X38A 3OTNA 4XIFA 1N0QA 1DNPA 3PRZA 1WY6A 3TXMA 3V79K 3L6AA 5BXOA 5KBAA 1BPOA 2J9QA 5ARFA 3SNXA 4J8FA 2QFCA 4JEUA 4A55A 4EQFA 4U0SA 3D9JA 4I17A 4U04A 4NQ0A 3J5PA 2VQ2A 3DPDA 3PUJA 3NQPA 2VGYA 4K03A 4UQXA 4UWHA 3CVPA 2DWZA 2RG8A 2J4BA 3FUEA 1E8XA 5JA4D 2WXNA 4DX6D 1FVFA 2J49A 3CGHA 3QC1A 4IYPA 2XENA 3BG0B 4Q94A 1PY1A 4C9BB 4FADA 5ENNA 3IEGA 4L1BA 2F8YA 2FO1E 3JQ1A 2WXPA 1MX4A 4U0UA 4FJZA 4WNFA 3VTXA 4E85A 1HXIA 2OOEA 2WXQA 4BSXA 3TWXA 3BEEA 4I1MA 1K1AA 2RFMA 4ATGA 4O1PA 4ZHBA 3S2AA 2P2CP 3FH7A 3HYMB 2J07A 2ETCA 2FF4A 4KT6B 3TGOA 4OAVB 4KZCA 2X6IA 1SZ9A 1HE8A 4FLBA 4BX8A 4UWKA 5EIBE 2VTBB 3ZYKA 3TWVA 4I6JA 4LUNU 5LP0A 1UOHA 2CG2A 2V0PA 2A5UA 2VGXA 5G04C 4N2QA 4UWLA 2WXKA 3IXEA 4NURA 1JWFA 1NA0A 1XGWA 4AM9A 5EDSA 4J6IA 4RG9A 3OAWA 1QQEA 3CHQA 4APOA 4UUCA 5D66A 4G23A 4HRLA 4U63A 5CHEE 2R59A 5BT1A 3ZW3A 2JEKA 4HLEA 2Y4UA 4U07A 4J0UA 4WNEA 5AARA 4BTAA 3CR3A 2VSYA 4JW1A 2FO7A 3MCXA 5CEAA 4EBAG 4GA1A 3U64A 2AWIA 3FTYA 3PREA 1UN8A 4J8YA 2WPVA 3G2WA 3ZXSA 1L5JA 3FP3A 4TRQA 4BTBA 1N11A 3KEZA 2WXOA 4D10C 4CDRA 2WXGA 2IU1A 4JVSA 2BUGA 3QJZA 3OXFA 4BEPA 1LF8A 4GYYA 4KVOA 2XGSA 4UI9J 5G05C 5G55A 4XE0A 2J09A 4A1GA 4W9RA 1FCHA 1UN9A 1S70B 5ENRD 3D9MA 3T5VA 2JLBA 4EBAA 2PNNA 4A3TA 3D9OA 1OWLA 4L7TA 2ETBA 4CT0A 3FTSA 1IQUA 1QZ2A 3CHMA 3CKBA 4GCOA 3SHFA 1EYHA 3AAAC 2IOSA 3CVQA 2GRMA 3APFA 1S0PA 4DX1A 4FP7A 5KCMA 4G11A 4PUCA 4EECA 4V3IA 4UQYA 5BXUA 1OY3D 5ARGA 4HQDA 1U3CA 2I2OA 3I3NA 2VSXE 3NZSA 2VJ8A 2WMOA 3PE4A 3PEUB 4N3AA 4UWFA 1DC2A 3S7BA 2AXVA 4ANUA 4IN3B 5AN8A 2WQHA 4DX7D 3G2TA 4JHRA 1SQMA 4XKCA 2CFUA 5FIOA 4M3OA 3ZHEA 2FULA 3ZRHA 4CDNA 2ZU6B 3T9KA 4DI3A 1E90A 4FA6A 3CQGB 5AIJA 2YHCA 3APDA 5BNWA 3TWWA 2DBAA 3UUXA 3UTMA 4OAUC 1NP7A 1U3DA 4GZDA 4EPZA 4RG6A 5JJ7A 1JWGA 5EIDA 2BKGA 4BSZB 2X6KA 3D9HA 3KS2A 4FC8A 3EHRA 1E8WA 3TXNA 3QWVA 4G8KA 5EX3A 4O1OA 2VGXB 3CK9A 3QWWA 3U66A 1MJ0A 3P2BA 1ZU2A 1PAQA 1ELKA 5AYWD 1OWNA 1N52A 3NOGD 4DX2A 4CCAA 4R7LA 1KT1A 3EHMA 5FTPA 3B7RL 3ZNGA 4AP2A 4ILGA 4P29A 4I6GA 2WMNA 2GW1A 3I4RB 4YVOA 4F6RD 3CV0A 1N0RA 2F37A 1H2TC 2KM4A 3G2VA 3SI5A 4CT4A 4HBDA 4F1PA 4DLOA 2WXHA 3ZYLA 1UJKA 3B95A 5C2YA 5FZSA 3ZPJA 4NRHB 1K3ZD 2VSOE 3MKQA 3UT4A 3MX3A 4EZKA 2AVPA 1BD8A 4GZ6A 2XPIA 4KYOB 5BW8C 3RO2A 4HORA 3ZEFA 5FQ6A 3CK8A 1EPUA 2J08A 3R7RA 4DLQA 2HO1A 4LEUA 4L23A 3QB2A 4N2SA 3V2OA 3NBNB 3LYAA 2IOLA 1YMPA 4F53A 4B94A 3E4BA 2RD0A 4HRMB 3CK7A 1D9SA 3LJ3A 4FHJA 1YCSB 4B8AA 4BWRA 1VDYA 1HG5A 4C0MA 3GZSA 1ZBPA 2MYOA 1MYOA 3I5PA 3MJWA 5FJYA 2UY1A 3Q9NC 3FUMA 3B7SA 5ENTD 4GA0A 3LDZA 1Z6TA 3ONKA 4PDXA 5FQ8A 3UT8A 4JA7A 4JC8A 4ILIA 5HI7A 5AQ7A 2XPZA 3PZDA 2PM7A 2XGMA 3D3MA 3K9IA 4N5QA 4AVXA 2IQCA 3G2UA 3UMVA 3ZN3A 2J8SD 4J7WA 3IBEA 5FWQA 4B89A 5LCWJ 3JUEA 4Y6WA 3CHOA 4JZYA 3FH5A 3ML9A 3PH0C 1KT0A 3CVUA 1IHGA 3QNKA 3HIZA 3QAQA 3N71A 3DEOA 4C48B 1Y6IA 4I9EA 3LY8A 5LOZA 3SZ7A 3AU5A 4URKA 1OWMA 3PNTB 4BESA 2LNIA 2Y4TA 5E76A 4LERA 4Q96A 5KJLA 2LAHA 3VLDA 5T4YA 3UX4A 2V4HC 3CKCA 2WQ6A 3ASHA 1BI7B 3LKUA 4C0EA 3ASGA 2XQ0A 4HLLA 5EYLA 4L2LA 4EZJA 4OYSA 1TR4A 3EHNA 2PQNA 4ACKA 2HE0A 4OVUA 1MX6A 4K5BA 2C2LA 2FEZA 2WB2A 4MKTA 2P58C 4G24A 2KXPC 3PVLA 1YA0A 2FI7A 5CMWA 5EYPF 5JMND 3HVEB 2XZTG 4WNGA 4DUIA 4B0ZA 3CLJA 5AAOA 1PC2A 2C0MA 4PH4B 1E96B 3RJVA 5CCMA 1X5BA 5ITZF 4GMJA 5JHBA 4QQIA 4PS3A 3R9AB 3ZU7B 4F7AA 1AP7A 4JEHA 3DEPA 5HKPA 3C98A 2DVWA 1H2VC 1WDYA 2RFAA 2KCKA 2PZIA 4G2VA 4U0ZA 2WVIA 3I4GA 1IQRA 4JL0A 5E75A 5T3RA 3RK6A 3RRNB 3NF1A 1NZNA 4K5CA 4HOUA 4FHKA 4I1AA 3ASFA 4N3CA 4XZ4A 2JABA 5A7DB 2DZNA 3CSTA 4GZCA 4YDYA 2NC9A 3ULQA 3EHQA 3Q9UC 4HRNA 2YHEA 3HVEA 2XEVA 4I2WA 5KNGA 3OXLA 5CERB 1H2UA 4TUUA 1HG2A 4DJAA 2E2EA 1WM5A 2L0IA 3MA5A 4AV7A 4CGWA 2V5FA 3LJNA 5KWDA 3IHVA 4GB9A 3EIQC 5AQAA 3FEYA 3Q5MA 3ZVVA 1E8ZA 4I43A 2QC9A 4GU5A 1EDUA 2A4ZA 2AXZA 2WXLA 3RKVA 4F3VA 3RRMB 2WXFA 3ZUVB 5ANRA 4U96D 3FUDA 3UT7A 2KZTB 4FU3A 2PM6A 3TG5A 3Q47B 3SO8A 3O48A 5G05J 4APFA 2Y0BG 2I9CA 2J4DA 4WWOA 5FT9A 4DI4A 1ELRA 3PNLB 3IKOB 2KC7A 4LRZA 5BV0A 4KXKB 5KJNA 1DVPA 2Y3AA 3FULA 3TJPA 4J8SA 4JXTA 3EJNA 5DBKA 1Y8MA 1HS6A 4GZ5A 4HFGA 1TJCA 3GZ2A 5BV1A 1K1BA 3ESLA 4O6FA 3CVXA 4K0RA 3Q15A 3B13A 4GYOA 4GPKA 4MS6A 2CHXA 4ABNA 4ILHB 2L6BA 2IJGX 3KEAA 4HB5A 2DZOA 5AQBA 3PE3A 1BLXB 3FU3A 3S7DA 3EDTB 1G3NB 2V8SE 4JB8P 1HU3A 4RVBA 2AXUA 2XEHA 5EKQD 2BKKB 3ZYMA 4F1SA 4CGVA 2YQ8A 3GW4A 3EIJA 5AJLA 4UI9C 4AXHA 4YNDA 5JJTA 3TWUA 2L6JA 2I1JA 2HR2A 4N5CA 4Y6CA 3VLFA 1HO8A 4HS2A 3NOCD 4KVMA 3FWVA 3SGHA 5JHAA 5ANLA 3JXIA 4BX9A 4AY6A 4HI8A 3CIAA 3QKYA 2HM8A 4XX5A 4DPRA 2E0IA 3QDNA 1IYGA 4BT8A 3T8MA 3PS6A 2NSZA 2ONDA 4G25A 4K5AB 4N3BA 2XEEA 3L08A 3LXUX 3TAXA 4G1TA 5AQ9A 3HRAA 3LVQE 2C0LA 2IF4A 3FDHA 4GCNA 3BG1B 5KJMA 2AW6A 2L9BA 3LPZA 1N54A 4L2YA 5HQ8A 2KCLA 5LX8A 2X6JA 3CHRA 3FEXA 4FULA 1UW4B 3JUIA 4JHJA 3RO3A 4Q69A 3RIBA 2MOWA 3CHPA 4IRUA 4ANVA 3ZFWA 5ENSD 1HFAA 5LCWC 3J5QB 5J90A 1INZA 2CHWA 4O60A 2X6FA 5G04J 3JYSA 2X3MA 2X6HA 4KMOA 5AENA 3FHEA 3FUNA 2QYJA 3VLEA 2HYZA 4N39A 1QYMA 2L0TB 4JHKA 3CVNA 4H7YA 5ENQD 2WQ7A 2KZTA 2MHKA 4PS7A 3TWTA 4XKBA 5AJDA 4MRUA 1MX2A 4WWNA 5FQ7A 5CCLA 2VGEA 4FLHA 2A5EA 1E7UA 3HHMA 5BUZA 3FU6A 2B0OE 4B8CB 3G2SA 5A6CA 3TWRA 3WXXA 3P1UA 4I1OB 3IV0A 5KJKA 5JJ6A 3IHYA 3SBTB 3W9GA 4DRXE 2LSVA 4UQZA 3JCKC 4CRWA 1OWOA 1TEZA 2VSNA 1JPLA 1MQSA 3HDXA 3FH8A 1UJJA 3C5RA 3CHSA 2XRZA 3T5XA 3FUJA 5KNHD 3D9PA 2CHZA 4ATZD 1Z3XA 3SD5A 2DIWA 3FTVA 5CECB 2ZGDA 2XRYA 1HH8A 2XCCA 4UWGA 3T8KA 2VTBA 1FVHA 4J8DA 2XCBA 3AU4A 3CQCB 3PEVB 2XPYA 3MZLB 4LCTA 5FZRA 1XNFA 4MLPA 4HNAD 3U3WA 3L16A 1AWCB 3D9NA 2R17C 2LAIA 3LVRE 1IHBA 2ZGGA 4QFVA 2CG3A 2WM9A 4I2ZA 3F6QA 1W3BA 3Q4AB 5EN5D 1Z3YA 2KBXA 4LSZE 5HRYA 4A63B 2VYIA 3FY4A 3L22A 4GMRA 3AJIA 4WNDA 3ASDA 3PUKA 4CZ2D 3FTZA 2WXJA 3FU0A 4GA2A 4KBQA 5G2NA 3O4ZA 3LCAA 4YDWA 2R5SA 3TWSA 5CBOA 1WAO1 1H19A 3MEKA 1UG3A 5EX0A 3QOUA 3CVVA 4TUMA 2WXRA 5HS0A 4WUYA 4GYWA 3TWQA 3U4TA 1ELWA 3SF4A 3KAEA 4RLYA 4ME2A 4FJYA 5ENOD 3L54A 4LG6A 3FUFA 4AIFA 1SW6A 4J8EA 2NXPA 1NA3A 2PQRA 4OVVA 4EZLA 3FU5A 1JUQA 4ZFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2O A;  3NBN B;  1G3N B;  3TWX A;  1YMP A;  4JB8 P;  1K1A A;  2RFM A;  4HRM B;  4O1P A;  2V5Q C;  2P2C P;  2XEH A;  1YCS B;  2BKK B;  4ZHB A;  1D9S A;  2ETC A;  4OAV B;  2MYO A;  1MYO A;  1IXV A;  3Q9N C;  5EIB E;  5ENT D;  5FIN A;  3TWV A;  5EIL A;  3TWU A;  1IKN D;  5AQ7 A;  1UOH A;  4N5Q A;  3NOC D;  5CBN A;  3EU9 A;  2J8S D;  3IXE A;  4J7W A;  3JUE A;  3V30 A;  3JXI A;  3UI2 A;  1BU9 A;  4HI8 A;  3W9F A;  4UUC A;  5D66 A;  4HRL A;  3DEO A;  4C48 B;  4U8V D;  5AAR A;  4K5A B;  2XEE A;  2ETA A;  4BES A;  5AQ9 A;  5CEA A;  4BET A;  3HRA A;  3LVQ E;  3V31 A;  4J8Y A;  1N11 A;  1SVX A;  1NFI E;  4NIK A;  3UXG A;  4BEP A;  2V4H C;  1BI7 B;  4HLL A;  5EYL A;  5ENS D;  1S70 B;  5ENR D;  4B93 B;  4HI9 A;  1WG0 A;  1TR4 A;  3J5Q B;  4U95 D;  2HE0 A;  4O60 A;  1MX6 A;  4K5B A;  5ENP D;  4GPM A;  2PNN A;  2KXP C;  4CYM D;  2ETB A;  4DX5 D;  2QYJ A;  2Y1L E;  5EYP F;  5JMN D;  1QYM A;  4BER A;  4Z68 A;  2F8X K;  3AAA C;  2XZT G;  5ENQ D;  4DUI A;  5AAO A;  1OT8 A;  3TWT A;  4DX1 A;  1MX2 A;  1YYH A;  2XZD G;  5ITZ F;  2VGE A;  4QQI A;  5CED B;  2A5E A;  3ZU7 B;  5BXU A;  1OY3 D;  1AP7 A;  4HQD A;  2B0O E;  3DEP A;  5HKP A;  2DVW A;  3HG0 D;  1WDY A;  2RFA A;  3TWR A;  3B7B A;  1DC2 A;  4LNU D;  3W9G A;  4DRX E;  2NYJ A;  4K5C A;  5AN8 A;  3ZKJ A;  2JAB A;  2DZN A;  4DX7 D;  4YDY A;  4U8Y D;  3V2X A;  5FIO A;  3EHQ A;  3Q9U C;  3C5R A;  4HRN A;  1DCQ A;  4G8L A;  3T9K A;  5KNG A;  5KNH D;  4ATZ D;  3JXJ A;  5CER B;  3TWW A;  3UTM A;  5CEC B;  4OAU C;  2ZGD A;  2AJA A;  1A5E A;  1BI8 B;  3LJN A;  5EID A;  3T8K A;  2BKG A;  4BSZ B;  5KWD A;  3D9H A;  3EHR A;  5AQA A;  1N0Q A;  4HNA D;  4G8K A;  4O1O A;  3V79 K;  2QC9 A;  5BXO A;  1MJ0 A;  5KBA A;  1AWC B;  3LVR E;  1IHB A;  2ZGG A;  4QFV A;  3F6Q A;  3NOG D;  3ZUV B;  4DX2 A;  4U96 D;  5EN5 D;  2KBX A;  4LSZ E;  5HRY A;  4A63 B;  4GMR A;  3AJI A;  3SO8 A;  3ZNG A;  2Y0B G;  4CZ2 D;  3J5P A;  4F6R D;  1N0R A;  2F37 A;  4YDW A;  3TWS A;  4HBD A;  2DWZ A;  5CBO A;  4F1P A;  5JA4 D;  4DX6 D;  3B95 A;  1K1B A;  2XEN A;  4TUM A;  1K3Z D;  5HS0 A;  3TWQ A;  1BD8 A;  2F8Y A;  2FO1 E;  4RLY A;  1MX4 A;  5ENO D;  4LG6 A;  1SW6 A;  2L6B A;  3KEA A;  4HB5 A;  2DZO A;  5AQB A;  1BLX B;  4ZFH A; 
#chains in the Genus database with same CATH topology
 1MHQ A;  3U9W A;  3GYZ A;  4HOS A;  4WWP A;  3UQ3 A;  1EF1 C;  2XHE A;  2WXI A;  4BT9 A;  2P9L G;  3D9I A;  3EU9 A;  2GRL A;  1BU9 A;  3LY7 A;  3HXF A;  3CSF A;  2WXM A;  2Q7F A;  5LFA A;  3QAR A;  4U8V D;  2ETA A;  5FQ4 A;  3MYV A;  1NFI E;  2GRR B;  2R2L A;  4NIK A;  3GZ1 A;  5FZQ A;  4U95 D;  3AS8 A;  4XI9 A;  4RQI A;  3ESK A;  4ANW A;  3FTW A;  4BER A;  3RRU A;  5D0Q D;  3R7Q A;  2XZD G;  5CED B;  4H7X A;  4XI0 A;  3HG0 D;  4G26 A;  4LNU D;  4JPS A;  1A17 A;  2NYJ A;  4RSY A;  2R05 A;  4AEZ C;  1OUV A;  2CFZ A;  1QNF A;  1A5E A;  2AJA A;  2MRI A;  1BI8 B;  3ZIM A;  4I9C A;  4XIF A;  2X38 A;  3TXM A;  1WY6 A;  5BXO A;  1BPO A;  2QFC A;  4EHM A;  3AG2 E;  4K03 A;  3FUE A;  5JA4 D;  1FVF A;  2XEN A;  3BG0 B;  4Q94 A;  4FAD A;  2WXP A;  4GTO A;  4E85 A;  3FH7 A;  3HYM B;  2ETC A;  4KT6 B;  2X6I A;  4UWK A;  4I6J A;  2VGX A;  5IY5 E;  4N2Q A;  3IXE A;  5EDS A;  3AG3 E;  4RG9 A;  3BQO A;  4M7C A;  1UN8 A;  2WPV A;  1L5J A;  3KEZ A;  4CDR A;  1OCZ E;  2WXG A;  2BUG A;  1LF8 A;  5G05 C;  5G55 A;  1TN6 A;  2J09 A;  4XE0 A;  3D9M A;  3T5V A;  3D9O A;  3E33 A;  4L7T A;  4PUC A;  4V3I A;  5BXU A;  3PEU B;  3S7B A;  5AN8 A;  4YDO A;  4DX7 D;  4XKC A;  3ZRH A;  2FUL A;  4EPZ A;  1NP7 A;  5JJ7 A;  4FC8 A;  5EX3 A;  2VGX B;  3CK9 A;  3P2B A;  1ZU2 A;  1PAQ A;  5AYW D;  1KT1 A;  5FTP A;  4I6G A;  3I4R B;  3CV0 A;  4F6R D;  4F1P A;  2VSO E;  4EZK A;  3UT4 A;  2XPI A;  5BW8 C;  3RO2 A;  4DLQ A;  4LEU A;  3QB2 A;  1YMP A;  4B94 A;  3CK7 A;  4FHJ A;  4B8A A;  4BWR A;  1HG5 A;  1ZBP A;  2MYO A;  1MYO A;  1U2V G;  4PDX A;  1Z6T A;  5HI7 A;  3PZD A;  3C3O A;  2PM7 A;  2XGM A;  2IQC A;  3UMV A;  2IO2 C;  4J7W A;  5LCW J;  3UM2 A;  3PH0 C;  1KT0 A;  1IHG A;  1TN7 A;  3SZ7 A;  4C48 B;  3LY8 A;  3AU5 A;  2Y4T A;  2LAH A;  3UX4 A;  2WQ6 A;  3ASH A;  1N4P A;  4OYS A;  2FEZ A;  4K5B A;  4MKT A;  2P58 C;  5EYP F;  1PC2 A;  4GMJ A;  4U0Z A;  3I4G A;  5T3R A;  2XS8 A;  3RRN B;  3NF1 A;  4I1A A;  3ASF A;  3DSX A;  3CST A;  3ULQ A;  3Q9U C;  4HRN A;  4I2W A;  3OXL A;  1H2U A;  4TUU A;  4DJA A;  2E2E A;  1X81 A;  4YDE A;  4CGW A;  3IHV A;  4I43 A;  1EDU A;  2WXL A;  2WXF A;  3ZUV B;  3FUD A;  2KZT B;  2ZIS A;  3Q47 B;  5G05 J;  3SO8 A;  4APF A;  4WWO A;  5KJN A;  4LRZ A;  4KXK B;  3EJN A;  1HS6 A;  1TJC A;  3Q15 A;  4GYO A;  1OXJ A;  2L6B A;  4HB5 A;  5AQB A;  3FU3 A;  3ULY A;  1O1T A;  3EUV A;  1RW2 A;  4UI9 C;  2XS1 A;  4YND A;  3TWU A;  2L6J A;  3PZ4 A;  2HR2 A;  3VLF A;  1HO8 A;  1D8D A;  4KVM A;  3JXI A;  4BX9 A;  4AY6 A;  4HI8 A;  2HM8 A;  2EIN E;  2E0I A;  3L82 A;  3QDN A;  3T8M A;  3PS6 A;  2XEE A;  3LXU X;  2F0Y A;  3HRA A;  2AW6 A;  1N54 A;  3JUI A;  4Q69 A;  4IRU A;  3ZFW A;  2CHW A;  5G04 J;  2X3M A;  2X6H A;  3DSU A;  2EIL E;  3FUN A;  2HYZ A;  4N39 A;  4JHK A;  2MHK A;  2KZT A;  3NAW A;  2VGE A;  3HHM A;  4B8C B;  3IV0 A;  4DRX E;  3HDX A;  1UJJ A;  1SA5 A;  5KNH D;  3HXD A;  3SD5 A;  2XCC A;  5FZR A;  3CQC B;  1XNF A;  3D9N A;  2LAI A;  3DXK G;  2WM9 A;  3AG4 E;  4WND A;  4AY5 A;  4GMR A;  3AJI A;  3ASD A;  3PUK A;  4YDW A;  5B1A E;  1H19 A;  3MEK A;  1UG3 A;  3CVV A;  4TUM A;  2GRN B;  4LG6 A;  3MV2 B;  4A3V A;  2V5Q C;  2KCV A;  3Q49 B;  4NAC A;  1IKN D;  3QK0 A;  5CBN A;  4TV3 A;  3RU0 A;  3DSS A;  2OEV A;  3V30 A;  3UI2 A;  4AJW A;  4YVQ C;  3ML8 A;  1O1S A;  4BET A;  1K8K G;  1DCE A;  5D0O D;  2KAT A;  3R9M A;  1SVX A;  2QY7 A;  3UXG A;  3NZU A;  4GZ3 A;  4AOF A;  1FT2 A;  3L17 A;  1OWP A;  4KZ0 A;  1E8Y A;  3LY9 A;  4B93 B;  4HVB A;  4U8H A;  2OV8 A;  2F8X K;  4Z68 A;  3ZYQ A;  4BFR A;  3FFL A;  2M63 A;  5BPP A;  3L9T A;  3B7B A;  3AS5 A;  3LS8 A;  1NI1 A;  2EIK E;  2GGF A;  3V2X A;  4G8L A;  1JCS A;  3JXJ A;  3MV3 B;  3DRA A;  1TJF A;  3D9L A;  4ACL A;  2IFU A;  3ABM E;  5CRU A;  3FUI A;  3V79 K;  3L6A A;  1TNY A;  1S64 A;  4JEU A;  1KZO A;  4EQF A;  4U0S A;  3D9J A;  3SFY A;  2VQ2 A;  3DPD A;  4UWH A;  2DWZ A;  2RG8 A;  2J4B A;  1PY1 A;  3IEG A;  4L1B A;  2F8Y A;  1MX4 A;  4WNF A;  2OOE A;  3TWX A;  3BEE A;  4O1P A;  2P2C P;  2J07 A;  3C3Q A;  1HE8 A;  2VTB B;  5EIB E;  3E32 A;  2A5U A;  4UWL A;  2WXK A;  2ZXW E;  1NA0 A;  4AM9 A;  3CHQ A;  4APO A;  4UUC A;  4HRL A;  5BT1 A;  2R59 A;  3ZW3 A;  4BTA A;  5AAR A;  3CR3 A;  2VSY A;  5CEA A;  3FTY A;  3PRE A;  4TRQ A;  4BTB A;  3DPY A;  4JVS A;  3QJZ A;  4W9R A;  3WG7 E;  3NB2 A;  3FTS A;  3CHM A;  1EYH A;  2IOS A;  1S0P A;  4G11 A;  2GRO B;  5ARG A;  1U3C A;  3ZXP A;  3I3N A;  4UWF A;  2Y69 E;  4IN3 B;  2RKK A;  2WQH A;  4JHR A;  4FA6 A;  2DBA A;  3TWW A;  3UTM A;  4OAU C;  4RG6 A;  4BSZ B;  3PZ3 A;  1E8W A;  3TXN A;  1OCC E;  3QWV A;  4O1O A;  1ELK A;  4CCA A;  1N52 A;  3NOG D;  3ZNG A;  4AP2 A;  4P29 A;  2WMN A;  4EEC A;  2WXH A;  5C2Y A;  5FZS A;  3ZPJ A;  3MX3 A;  2AVP A;  3ZEF A;  3CK8 A;  1EPU A;  2IOL A;  5B1B E;  2RD0 A;  1TN8 A;  3LJ3 A;  1YCS B;  3GZS A;  3I5P A;  3MJW A;  3DSW A;  5FJY A;  3FUM A;  4GA0 A;  5ENT D;  5FQ8 A;  3ONK A;  4JA7 A;  4ILI A;  2XPZ A;  3K9I A;  3G2U A;  2J8S D;  3IBE A;  5FWQ A;  3HIZ A;  2R02 A;  1OWM A;  3PNT B;  4BES A;  1LD7 A;  2B6C A;  3VLD A;  3CKC A;  1BI7 B;  4HLL A;  4ACK A;  2C2L A;  4G24 A;  2KXP C;  1YA0 A;  5JMN D;  4WNG A;  4B0Z A;  3CLJ A;  3RJV A;  1E96 B;  1X5B A;  5ITZ F;  4QQI A;  4F7A A;  3C98 A;  2RFA A;  4JL0 A;  4GTM A;  4FHK A;  2JAB A;  4GZC A;  3BUA A;  3HVE A;  5KNG A;  2L0I A;  3EIQ C;  4F3V A;  3RRM B;  3TG5 A;  3O48 A;  2Y0B G;  2Y3A A;  4J8S A;  1Y8M A;  5BV1 A;  4O6F A;  1H6O A;  4MS6 A;  2IJG X;  3KEA A;  1BLX B;  1G3N B;  1HU3 A;  2YQ8 A;  3EIJ A;  4GTS A;  1MZC A;  5JJT A;  4Y6C A;  1N4Q A;  4HS2 A;  2P9S G;  3CIA A;  4DPR A;  1D8E A;  4G25 A;  3L08 A;  3LVQ E;  4GTP A;  2IF4 A;  5KJM A;  4L2Y A;  5HQ8 A;  5LX8 A;  3CHR A;  3FEX A;  4ANV A;  1HFA A;  3J5Q B;  3Q7A A;  3JYS A;  3X2Q E;  5ENQ D;  5AJD A;  4XKB A;  4MRU A;  1MX2 A;  4WWN A;  1E7U A;  3FU6 A;  2B0O E;  3IHY A;  3W9G A;  4CRW A;  1OWO A;  1TNZ A;  2P9P G;  3CHS A;  2LXL A;  3FUJ A;  3D9P A;  3PZ2 A;  2CHZ A;  1Z3X A;  2DIW A;  3FTV A;  3HXC A;  2XRY A;  4J8D A;  2XCB A;  4LCT A;  4MLP A;  4I2Z A;  2ZGG A;  3F6Q A;  2KBX A;  5HRY A;  3L22 A;  3PZ1 A;  4CZ2 D;  3FU0 A;  4GA2 A;  1FPP A;  3LCA A;  5EX0 A;  4WUY A;  4GTR A;  3SF4 A;  1FT1 A;  4RLY A;  2ZIR A;  1NA3 A;  2PQR A;  4OVV A;  3FU5 A;  4ZFH A;  1B89 A;  2EQX A;  5DIZ A;  4HOQ A;  4LNG A;  3KD7 A;  3UPV A;  5EIL A;  4JA9 A;  4CDM A;  1O5M A;  4HOT A;  3FUH A;  3W9F A;  1TYQ G;  3MKR A;  3CVY A;  2BTD A;  3L13 A;  5C1D A;  2I6H A;  2ION A;  2LO6 A;  3V31 A;  3UIP C;  2ILR A;  2OVB A;  4GTT A;  1WG0 A;  4IUL A;  4GPM A;  4DX5 D;  5CMY A;  2Y1L E;  4E6H A;  3AS4 A;  1OT8 A;  1YYH A;  3QWP A;  2OVF A;  3SBS A;  2FBN A;  1H6K A;  1N4S A;  3Q79 A;  1E7V A;  3LEW A;  1SZA A;  3B7T A;  1P5Q A;  1H0A A;  1GW6 A;  3PDN A;  3OXG A;  4HXI A;  3ZKJ A;  2V4L A;  5T8I A;  3ZHE B;  2YNQ A;  3S7J A;  1HX8 A;  1N0Q A;  1DNP A;  3PRZ A;  2J9Q A;  5ARF A;  4J8F A;  4A55 A;  4NQ0 A;  3SFX A;  2VGY A;  2WXN A;  3QC1 A;  4IYP A;  4C9B B;  2DYR E;  2FO1 E;  4U0U A;  3ASN E;  1HXI A;  2WXQ A;  4BSX A;  4I1M A;  3TGO A;  1SZ9 A;  1N9A A;  1NL4 A;  3UKR G;  5G04 C;  4NUR A;  1JWF A;  1XGW A;  3OAW A;  1QQE A;  5D66 A;  4G23 A;  4U63 A;  5CHE E;  4HLE A;  2JEK A;  2Y4U A;  4J0U A;  4JW1 A;  2FO7 A;  4EBA G;  4GA1 A;  3U64 A;  3Q75 A;  3G2W A;  3ZXS A;  3FP3 A;  2WXO A;  2IU1 A;  4KVO A;  4UI9 J;  2XGS A;  1FCH A;  1UN9 A;  1OCO E;  4EBA A;  4CT0 A;  1IQU A;  1QZ2 A;  4GCO A;  3SHF A;  3AAA C;  4UQY A;  1Z5S C;  3PE4 A;  2AXV A;  3UKU G;  4ABN A;  2CFU A;  3T9K A;  1E90 A;  3CQG B;  5AIJ A;  4XEI G;  3APD A;  1N94 A;  1U3D A;  1JWG A;  5EID A;  2BKG A;  3D9H A;  3EHR A;  4G8K A;  3EHM A;  4ILG A;  4YVO A;  2GW1 A;  4CT4 A;  1N0R A;  3G2V A;  1H2T C;  4HBD A;  3ZYL A;  1UJK A;  3C3R A;  1BD8 A;  4GZ6 A;  4KYO B;  4HOR A;  3R7R A;  4L23 A;  4N2S A;  3V2O A;  3NBN B;  1RZ4 A;  3LYA A;  4F53 A;  3E4B A;  4HRM B;  4C0M A;  3LDZ A;  3Q78 A;  4B89 A;  3JUE A;  4Y6W A;  3CHO A;  4JZY A;  3ML9 A;  3CVU A;  3AG1 E;  3QAQ A;  2GRP B;  5E76 A;  4LER A;  1H6P A;  5KJL A;  5T4Y A;  2V4H C;  3LKU A;  4C0E A;  3ASG A;  4TXR A;  5EYL A;  4L2L A;  1TR4 A;  2PQN A;  2HE0 A;  2FI7 A;  1KPS B;  4PH4 B;  5AAO A;  4PS3 A;  3R9A B;  4TXQ A;  2QZA A;  2PZI A;  5E75 A;  3RK6 A;  4HOU A;  2OEW A;  4N3C A;  5A7D B;  2DZN A;  2NC9 A;  2YHE A;  1N4R A;  5CER B;  2OCC E;  1WM5 A;  3MA5 A;  4AV7 A;  2V5F A;  4GB9 A;  3FEY A;  3Q5M A;  3ZVV A;  1E8Z A;  3DWL G;  2QC9 A;  2A4Z A;  2AXZ A;  2P9U G;  4GTQ A;  5ANR A;  3UT7 A;  5CCM A;  2PM6 A;  4DI4 A;  2I9C A;  5FT9 A;  1ELR A;  3PNL B;  3IKO B;  2KC7 A;  3TJP A;  3ASO E;  4JXT A;  5DBK A;  4LNB A;  4GPK A;  3DSV A;  4ILH B;  2DZO A;  3PE3 A;  4X8Q A;  3EDT B;  1TNO A;  4RVB A;  2XEH A;  4F1S A;  4CGV A;  3GW4 A;  1N95 A;  5AJL A;  4AXH A;  2I1J A;  4N5C A;  3ABL E;  3SGH A;  5JHA A;  4MBG A;  1IYG A;  4BT8 A;  2BED A;  4N3B A;  2OND A;  3HXB A;  3BG1 B;  2L9B A;  3UIO C;  4FUL A;  3RSE G;  3RO3 A;  2IY0 C;  3CHP A;  5ENS D;  1INZ A;  4O60 A;  2QYJ A;  1QYM A;  2L0T B;  4H7Y A;  3TWT A;  5FQ7 A;  5CCL A;  3G2S A;  3TWR A;  3SBT B;  2LSV A;  1TEZ A;  3FH8 A;  3T5X A;  2P9I G;  1JCQ A;  1JCR A;  5CEC B;  1HH8 A;  1KZP A;  3AU4 A;  3PEV B;  2XPY A;  4HNA D;  1AWC B;  3LVR E;  1W3B A;  3Q4A B;  5EN5 D;  1Z3Y A;  4A63 B;  4LSZ E;  2VYI A;  4KBQ A;  3FTZ A;  5G2N A;  3O4Z A;  2R5S A;  3TWS A;  5CBO A;  2WXR A;  5HS0 A;  5ENO D;  3L54 A;  3FUF A;  1SW6 A;  1JUQ A;  2J4D A;  3KSL A;  3DBS A;  5J08 A;  3TL5 A;  5A23 A;  3D9K A;  1IXV A;  3JQ0 A;  5FIN A;  2EIM E;  3FTU A;  1HZ4 A;  3UM1 A;  4BY6 A;  4PS8 A;  1HF8 A;  4A1S A;  1S63 A;  3SFZ A;  3ULE G;  3CVW A;  3VTY A;  3FTX A;  2UY1 B;  2XGO A;  4GAA A;  4CEM A;  5M72 A;  2BF0 X;  2LSU A;  3ONL A;  4HI9 A;  4I6E A;  4UI9 K;  5ENP D;  1KLX A;  2I1K A;  4CYM D;  3EU5 A;  3ENE A;  2UWJ G;  4GTV A;  3B7U X;  3FUK A;  3APC A;  3C72 A;  2YIN A;  3CEQ A;  3MKQ B;  4WAF A;  3HXE A;  3SQV A;  3RAU A;  3Q7F A;  4ANX A;  3MGB A;  2PL2 A;  3CVL A;  3TG4 A;  3URZ A;  3SY2 A;  4U8Y D;  4DK5 A;  1DCQ A;  4GML A;  3S7F A;  3KSQ A;  3ZGQ A;  2DCP A;  3OTN A;  1SA4 A;  4L9P A;  5KBA A;  3SNX A;  1OCR E;  4I17 A;  4U04 A;  3J5P A;  3PUJ A;  3NQP A;  4UQX A;  3CVP A;  1E8X A;  4DX6 D;  2J49 A;  3CGH A;  5ENN A;  2H6G A;  3JQ1 A;  4FJZ A;  3VTX A;  5H7P A;  1K1A A;  2RFM A;  4ATG A;  3ABK E;  3S2A A;  4ZHB A;  2FF4 A;  4OAV B;  4KZC A;  4FLB A;  4BX8 A;  3ZYK A;  3TWV A;  4LUN U;  5LP0 A;  1UOH A;  2CG2 A;  2V0P A;  4J6I A;  4U07 A;  4WNE A;  1LD8 A;  3MCX A;  2AWI A;  4J8Y A;  1O1R A;  1N11 A;  4D10 C;  3ISM C;  3OXF A;  4BEP A;  4GYY A;  4A1G A;  1S70 B;  5ENR D;  2JLB A;  2PNN A;  4A3T A;  1OWL A;  2ETB A;  2EIJ E;  3CKB A;  5B3S E;  3CVQ A;  2GRM A;  3APF A;  4FP7 A;  4DX1 A;  5KCM A;  1OY3 D;  4HQD A;  2I2O A;  2LUH A;  2VSX E;  3NZS A;  2VJ8 A;  2WMO A;  4N3A A;  1DC2 A;  3E34 A;  4ANU A;  3ZHE A;  3G2T A;  4CDN A;  1SQM A;  4M3O A;  5FIO A;  2ZU6 B;  4DI3 A;  2YHC A;  5BNW A;  3UUX A;  4GZD A;  2X6K A;  3KS2 A;  3U66 A;  3QWW A;  1MJ0 A;  1OWN A;  4DX2 A;  4R7L A;  1TNB A;  3B7R L;  2F37 A;  2KM4 A;  3SI5 A;  4DLO A;  3B95 A;  2IO3 C;  4NRH B;  1K3Z D;  3MKQ A;  2LXM A;  5FQ6 A;  2J08 A;  2HO1 A;  1D9S A;  1VDY A;  2UY1 A;  3Q9N C;  3B7S A;  3UT8 A;  4JC8 A;  5AQ7 A;  3D3M A;  4N5Q A;  4AVX A;  1V54 E;  3ZN3 A;  3FH5 A;  3QNK A;  3N71 A;  1Y6I A;  3DEO A;  4I9E A;  5LOZ A;  4URK A;  2LNI A;  4Q96 A;  2P9K G;  3BU8 A;  2XQ0 A;  4EZJ A;  3EHN A;  4OVU A;  1MX6 A;  2WB2 A;  3PVL A;  5CMW A;  3HVE B;  2DYS E;  2XZT G;  4DUI A;  2C0M A;  5JHB A;  1LTX A;  3ZU7 B;  1AP7 A;  4JEH A;  3DEP A;  5HKP A;  2DVW A;  1H2V C;  1WDY A;  2KCK A;  4G2V A;  2WVI A;  1IQR A;  5CRV A;  1NZN A;  4K5C A;  4XZ4 A;  4YDY A;  3EHQ A;  2XEV A;  3Q73 A;  1HG2 A;  3LJN A;  5KWD A;  5AQA A;  4GU5 A;  3RKV A;  4U96 D;  4FU3 A;  2IEJ A;  5BV0 A;  1DVP A;  3FUL A;  4GZ5 A;  4HFG A;  3GZ2 A;  1QBQ A;  1K1B A;  3ESL A;  3CVX A;  4K0R A;  3B13 A;  2P9N G;  4TXP A;  2CHX A;  1TNU A;  3S7D A;  2V8S E;  4JB8 P;  2AXU A;  5EKQ D;  2BKK B;  3ZYM A;  3UIN C;  3NOC D;  2R03 A;  3FWV A;  5ANL A;  3QKY A;  4XX5 A;  3TAX A;  2NSZ A;  3DST A;  4K5A B;  4G1T A;  5AQ9 A;  2H6I A;  2C0L A;  3FDH A;  4GCN A;  4U7E B;  3LPZ A;  2KCL A;  2X6J A;  4JD2 G;  1UW4 B;  4JHJ A;  2H6H A;  3RIB A;  2MOW A;  3UM3 A;  5D2M C;  2H6F A;  5LCW C;  2X6F A;  4KMO A;  5AEN A;  3FHE A;  3VLE A;  3E37 A;  3CVN A;  2WQ7 A;  3UM0 A;  5J90 A;  4PS7 A;  4FLH A;  2A5E A;  2QYU A;  5BUZ A;  5A6C A;  3WXX A;  3P1U A;  4I1O B;  5KJK A;  5JJ6 A;  4UQZ A;  3DXM G;  3JCK C;  2VSN A;  1JPL A;  1MQS A;  2GRQ B;  3C5R A;  2XRZ A;  4ATZ D;  3E30 A;  2ZGD A;  4UWG A;  3T8K A;  2VTB A;  1FVH A;  3MZL B;  3U3W A;  3L16 A;  1V55 E;  1Q2Z A;  1ZB1 A;  2R17 C;  2CG3 A;  1IHB A;  4QFV A;  3FY4 A;  2WXJ A;  1WAO 1;  3QOU A;  3U4T A;  4GYW A;  3TWQ A;  1ELW A;  3KAE A;  4ME2 A;  4FJY A;  4AIF A;  4J8E A;  2NXP A;  4EZL A; 
#chains in the Genus database with same CATH homology
 1B89 A;  3MV2 B;  3DBS A;  2EQX A;  4A3V A;  5DIZ A;  1MHQ A;  3U9W A;  5J08 A;  2V5Q C;  4HOQ A;  3GYZ A;  4HOS A;  2KCV A;  4WWP A;  3UQ3 A;  3TL5 A;  3KD7 A;  5A23 A;  3Q49 B;  3D9K A;  1IXV A;  3JQ0 A;  3UPV A;  1EF1 C;  2XHE A;  5FIN A;  5EIL A;  4NAC A;  4HVB A;  1IKN D;  2WXI A;  3FTU A;  4BT9 A;  3D9I A;  1HZ4 A;  3QK0 A;  5CBN A;  3EU9 A;  4JA9 A;  4BY6 A;  4CDM A;  4PS8 A;  4TV3 A;  3RU0 A;  2GRL A;  3V30 A;  4HOT A;  1HF8 A;  3UI2 A;  1BU9 A;  3FUH A;  3LY7 A;  4A1S A;  4AJW A;  3W9F A;  3CSF A;  4YVQ C;  3ML8 A;  2WXM A;  2Q7F A;  5LFA A;  3MKR A;  3QAR A;  3CVY A;  4U8V D;  3SFZ A;  2BTD A;  3L13 A;  5C1D A;  2ETA A;  3CVW A;  2I6H A;  2ION A;  4BET A;  2LO6 A;  5FQ4 A;  3VTY A;  3FTX A;  2UY1 B;  3MYV A;  3V31 A;  2XGO A;  5D0O D;  2KAT A;  4AY5 A;  4GAA A;  4CEM A;  1SVX A;  1NFI E;  2QY7 A;  4NIK A;  3UXG A;  2ILR A;  2OVB A;  3NZU A;  4GZ3 A;  3GZ1 A;  5M72 A;  2BF0 X;  4AOF A;  3L17 A;  2LSU A;  5FZQ A;  1OWP A;  4B93 B;  1E8Y A;  3LY9 A;  4HI9 A;  1WG0 A;  4U95 D;  3ONL A;  4I6E A;  3AS8 A;  4KZ0 A;  5ENP D;  1KLX A;  4IUL A;  2I1K A;  4U8H A;  4UI9 K;  4GPM A;  4XI9 A;  4CYM D;  4DX5 D;  3ESK A;  5CMY A;  2OV8 A;  2Y1L E;  4ANW A;  3FTW A;  4BER A;  4Z68 A;  2F8X K;  4E6H A;  3AS4 A;  3ENE A;  2UWJ G;  5D0Q D;  3B7U X;  1OT8 A;  3FUK A;  3APC A;  3R7Q A;  3RRU A;  1YYH A;  2YIN A;  2XZD G;  3ZYQ A;  5CED B;  2OVF A;  3CEQ A;  3MKQ B;  3QWP A;  4H7X A;  4XI0 A;  3SBS A;  2FBN A;  1H6K A;  3FFL A;  4BFR A;  4WAF A;  2M63 A;  1E7V A;  3HG0 D;  4G26 A;  3LEW A;  5BPP A;  3B7B A;  1SZA A;  3B7T A;  4ANX A;  1P5Q A;  4LNU D;  3MGB A;  4JPS A;  1A17 A;  2PL2 A;  1H0A A;  1GW6 A;  3CVL A;  3PDN A;  3AS5 A;  2NYJ A;  3LS8 A;  4RSY A;  3OXG A;  2GGF A;  4HXI A;  3ZKJ A;  2V4L A;  3TG4 A;  3URZ A;  4U8Y D;  3V2X A;  4DK5 A;  5T8I A;  1DCQ A;  4G8L A;  3ZHE B;  4AEZ C;  1OUV A;  2YNQ A;  4GML A;  3JXJ A;  3MV3 B;  3S7F A;  2CFZ A;  1TJF A;  1QNF A;  1A5E A;  2AJA A;  3D9L A;  4ACL A;  2MRI A;  1BI8 B;  2IFU A;  3ZIM A;  3S7J A;  3FUI A;  3ZGQ A;  4I9C A;  1HX8 A;  2DCP A;  2X38 A;  3OTN A;  4XIF A;  1N0Q A;  1DNP A;  3PRZ A;  1WY6 A;  3TXM A;  3V79 K;  3L6A A;  5BXO A;  5KBA A;  1BPO A;  2J9Q A;  5ARF A;  3SNX A;  4J8F A;  2QFC A;  4JEU A;  4A55 A;  4EQF A;  4U0S A;  3D9J A;  4I17 A;  4U04 A;  4NQ0 A;  3J5P A;  2VQ2 A;  3DPD A;  3PUJ A;  3NQP A;  2VGY A;  4K03 A;  4UQX A;  4UWH A;  3CVP A;  2DWZ A;  2RG8 A;  2J4B A;  3FUE A;  1E8X A;  5JA4 D;  2WXN A;  4DX6 D;  1FVF A;  2J49 A;  3CGH A;  3QC1 A;  4IYP A;  2XEN A;  3BG0 B;  4Q94 A;  1PY1 A;  4C9B B;  4FAD A;  5ENN A;  3IEG A;  4L1B A;  2F8Y A;  2FO1 E;  3JQ1 A;  2WXP A;  1MX4 A;  4U0U A;  4FJZ A;  4WNF A;  3VTX A;  4E85 A;  1HXI A;  2OOE A;  2WXQ A;  4BSX A;  3TWX A;  3BEE A;  4I1M A;  1K1A A;  2RFM A;  4ATG A;  4O1P A;  4ZHB A;  3S2A A;  2P2C P;  3FH7 A;  3HYM B;  2J07 A;  2ETC A;  2FF4 A;  4KT6 B;  3TGO A;  4OAV B;  4KZC A;  2X6I A;  1SZ9 A;  1HE8 A;  4FLB A;  4BX8 A;  4UWK A;  5EIB E;  2VTB B;  3ZYK A;  3TWV A;  4I6J A;  4LUN U;  5LP0 A;  1UOH A;  2CG2 A;  2V0P A;  2A5U A;  2VGX A;  5G04 C;  4N2Q A;  4UWL A;  2WXK A;  3IXE A;  4NUR A;  1JWF A;  1NA0 A;  1XGW A;  4AM9 A;  5EDS A;  4J6I A;  4RG9 A;  3OAW A;  1QQE A;  3CHQ A;  4APO A;  4UUC A;  5D66 A;  4G23 A;  4HRL A;  4U63 A;  5CHE E;  2R59 A;  5BT1 A;  3ZW3 A;  2JEK A;  4HLE A;  2Y4U A;  4U07 A;  4J0U A;  4WNE A;  5AAR A;  4BTA A;  3CR3 A;  2VSY A;  4JW1 A;  2FO7 A;  3MCX A;  5CEA A;  4EBA G;  4GA1 A;  3U64 A;  2AWI A;  3FTY A;  3PRE A;  1UN8 A;  4J8Y A;  2WPV A;  3G2W A;  3ZXS A;  1L5J A;  3FP3 A;  4TRQ A;  4BTB A;  1N11 A;  3KEZ A;  2WXO A;  4D10 C;  4CDR A;  2WXG A;  2IU1 A;  4JVS A;  2BUG A;  3QJZ A;  3OXF A;  4BEP A;  1LF8 A;  4GYY A;  4KVO A;  2XGS A;  4UI9 J;  5G05 C;  5G55 A;  4XE0 A;  2J09 A;  4A1G A;  4W9R A;  1FCH A;  1UN9 A;  1S70 B;  5ENR D;  3D9M A;  3T5V A;  2JLB A;  4EBA A;  2PNN A;  4A3T A;  3D9O A;  1OWL A;  4L7T A;  2ETB A;  4CT0 A;  3FTS A;  1IQU A;  1QZ2 A;  3CHM A;  3CKB A;  4GCO A;  3SHF A;  1EYH A;  3AAA C;  2IOS A;  3CVQ A;  2GRM A;  3APF A;  1S0P A;  4DX1 A;  4FP7 A;  5KCM A;  4G11 A;  4PUC A;  4EEC A;  4V3I A;  4UQY A;  5BXU A;  1OY3 D;  5ARG A;  4HQD A;  1U3C A;  2I2O A;  3I3N A;  2VSX E;  3NZS A;  2VJ8 A;  2WMO A;  3PE4 A;  3PEU B;  4N3A A;  4UWF A;  1DC2 A;  3S7B A;  2AXV A;  4ANU A;  4IN3 B;  5AN8 A;  2WQH A;  4DX7 D;  3G2T A;  4JHR A;  1SQM A;  4XKC A;  2CFU A;  5FIO A;  4M3O A;  3ZHE A;  2FUL A;  3ZRH A;  4CDN A;  2ZU6 B;  3T9K A;  4DI3 A;  1E90 A;  4FA6 A;  3CQG B;  5AIJ A;  2YHC A;  3APD A;  5BNW A;  3TWW A;  2DBA A;  3UUX A;  3UTM A;  4OAU C;  1NP7 A;  1U3D A;  4GZD A;  4EPZ A;  4RG6 A;  5JJ7 A;  1JWG A;  5EID A;  2BKG A;  4BSZ B;  2X6K A;  3D9H A;  3KS2 A;  4FC8 A;  3EHR A;  1E8W A;  3TXN A;  3QWV A;  4G8K A;  5EX3 A;  4O1O A;  2VGX B;  3CK9 A;  3QWW A;  3U66 A;  1MJ0 A;  3P2B A;  1ZU2 A;  1PAQ A;  1ELK A;  5AYW D;  1OWN A;  1N52 A;  3NOG D;  4DX2 A;  4CCA A;  4R7L A;  1KT1 A;  3EHM A;  5FTP A;  3B7R L;  3ZNG A;  4AP2 A;  4ILG A;  4P29 A;  4I6G A;  2WMN A;  2GW1 A;  3I4R B;  4YVO A;  4F6R D;  3CV0 A;  1N0R A;  2F37 A;  1H2T C;  2KM4 A;  3G2V A;  3SI5 A;  4CT4 A;  4HBD A;  4F1P A;  4DLO A;  2WXH A;  3ZYL A;  1UJK A;  3B95 A;  5C2Y A;  5FZS A;  3ZPJ A;  4NRH B;  1K3Z D;  2VSO E;  3MKQ A;  3UT4 A;  3MX3 A;  4EZK A;  2AVP A;  1BD8 A;  4GZ6 A;  2XPI A;  4KYO B;  5BW8 C;  3RO2 A;  4HOR A;  3ZEF A;  5FQ6 A;  3CK8 A;  1EPU A;  2J08 A;  3R7R A;  4DLQ A;  2HO1 A;  4LEU A;  4L23 A;  3QB2 A;  4N2S A;  3V2O A;  3NBN B;  3LYA A;  2IOL A;  1YMP A;  4F53 A;  4B94 A;  3E4B A;  2RD0 A;  4HRM B;  3CK7 A;  1D9S A;  3LJ3 A;  4FHJ A;  1YCS B;  4B8A A;  4BWR A;  1VDY A;  1HG5 A;  4C0M A;  3GZS A;  1ZBP A;  2MYO A;  1MYO A;  3I5P A;  3MJW A;  5FJY A;  2UY1 A;  3Q9N C;  3FUM A;  3B7S A;  5ENT D;  4GA0 A;  3LDZ A;  1Z6T A;  3ONK A;  4PDX A;  5FQ8 A;  3UT8 A;  4JA7 A;  4JC8 A;  4ILI A;  5HI7 A;  5AQ7 A;  2XPZ A;  3PZD A;  2PM7 A;  2XGM A;  3D3M A;  3K9I A;  4N5Q A;  4AVX A;  2IQC A;  3G2U A;  3UMV A;  3ZN3 A;  2J8S D;  4J7W A;  3IBE A;  5FWQ A;  4B89 A;  5LCW J;  3JUE A;  4Y6W A;  3CHO A;  4JZY A;  3FH5 A;  3ML9 A;  3PH0 C;  1KT0 A;  3CVU A;  1IHG A;  3QNK A;  3HIZ A;  3QAQ A;  3N71 A;  3DEO A;  4C48 B;  1Y6I A;  4I9E A;  3LY8 A;  5LOZ A;  3SZ7 A;  3AU5 A;  4URK A;  1OWM A;  3PNT B;  4BES A;  2LNI A;  2Y4T A;  5E76 A;  4LER A;  4Q96 A;  5KJL A;  2LAH A;  3VLD A;  5T4Y A;  3UX4 A;  2V4H C;  3CKC A;  2WQ6 A;  3ASH A;  1BI7 B;  3LKU A;  4C0E A;  3ASG A;  2XQ0 A;  4HLL A;  5EYL A;  4L2L A;  4EZJ A;  4OYS A;  1TR4 A;  3EHN A;  2PQN A;  4ACK A;  2HE0 A;  4OVU A;  1MX6 A;  4K5B A;  2C2L A;  2FEZ A;  2WB2 A;  4MKT A;  2P58 C;  4G24 A;  2KXP C;  3PVL A;  1YA0 A;  2FI7 A;  5CMW A;  5EYP F;  5JMN D;  3HVE B;  2XZT G;  4WNG A;  4DUI A;  4B0Z A;  3CLJ A;  5AAO A;  1PC2 A;  2C0M A;  4PH4 B;  1E96 B;  3RJV A;  5CCM A;  1X5B A;  5ITZ F;  4GMJ A;  5JHB A;  4QQI A;  4PS3 A;  3R9A B;  3ZU7 B;  4F7A A;  1AP7 A;  4JEH A;  3DEP A;  5HKP A;  3C98 A;  2DVW A;  1H2V C;  1WDY A;  2RFA A;  2KCK A;  2PZI A;  4G2V A;  4U0Z A;  2WVI A;  3I4G A;  1IQR A;  4JL0 A;  5E75 A;  5T3R A;  3RK6 A;  3RRN B;  3NF1 A;  1NZN A;  4K5C A;  4HOU A;  4FHK A;  4I1A A;  3ASF A;  4N3C A;  4XZ4 A;  2JAB A;  5A7D B;  2DZN A;  3CST A;  4GZC A;  4YDY A;  2NC9 A;  3ULQ A;  3EHQ A;  3Q9U C;  4HRN A;  2YHE A;  3HVE A;  2XEV A;  4I2W A;  5KNG A;  3OXL A;  5CER B;  1H2U A;  4TUU A;  1HG2 A;  4DJA A;  2E2E A;  1WM5 A;  2L0I A;  3MA5 A;  4AV7 A;  4CGW A;  2V5F A;  3LJN A;  5KWD A;  3IHV A;  4GB9 A;  3EIQ C;  5AQA A;  3FEY A;  3Q5M A;  3ZVV A;  1E8Z A;  4I43 A;  2QC9 A;  4GU5 A;  1EDU A;  2A4Z A;  2AXZ A;  2WXL A;  3RKV A;  4F3V A;  3RRM B;  2WXF A;  3ZUV B;  5ANR A;  4U96 D;  3FUD A;  3UT7 A;  2KZT B;  4FU3 A;  2PM6 A;  3TG5 A;  3Q47 B;  3SO8 A;  3O48 A;  5G05 J;  4APF A;  2Y0B G;  2I9C A;  2J4D A;  4WWO A;  5FT9 A;  4DI4 A;  1ELR A;  3PNL B;  3IKO B;  2KC7 A;  4LRZ A;  5BV0 A;  4KXK B;  5KJN A;  1DVP A;  2Y3A A;  3FUL A;  3TJP A;  4J8S A;  4JXT A;  3EJN A;  5DBK A;  1Y8M A;  1HS6 A;  4GZ5 A;  4HFG A;  1TJC A;  3GZ2 A;  5BV1 A;  1K1B A;  3ESL A;  4O6F A;  3CVX A;  4K0R A;  3Q15 A;  3B13 A;  4GYO A;  4GPK A;  4MS6 A;  2CHX A;  4ABN A;  4ILH B;  2L6B A;  2IJG X;  3KEA A;  4HB5 A;  2DZO A;  5AQB A;  3PE3 A;  1BLX B;  3FU3 A;  3S7D A;  3EDT B;  1G3N B;  2V8S E;  4JB8 P;  1HU3 A;  4RVB A;  2AXU A;  2XEH A;  5EKQ D;  2BKK B;  3ZYM A;  4F1S A;  4CGV A;  2YQ8 A;  3GW4 A;  3EIJ A;  5AJL A;  4UI9 C;  4AXH A;  4YND A;  5JJT A;  3TWU A;  2L6J A;  2I1J A;  2HR2 A;  4N5C A;  4Y6C A;  3VLF A;  1HO8 A;  4HS2 A;  3NOC D;  4KVM A;  3FWV A;  3SGH A;  5JHA A;  5ANL A;  3JXI A;  4BX9 A;  4AY6 A;  4HI8 A;  3CIA A;  3QKY A;  2HM8 A;  4XX5 A;  4DPR A;  2E0I A;  3QDN A;  1IYG A;  4BT8 A;  3T8M A;  3PS6 A;  2NSZ A;  2OND A;  4G25 A;  4K5A B;  4N3B A;  2XEE A;  3L08 A;  3LXU X;  3TAX A;  4G1T A;  5AQ9 A;  3HRA A;  3LVQ E;  2C0L A;  2IF4 A;  3FDH A;  4GCN A;  3BG1 B;  5KJM A;  2AW6 A;  2L9B A;  3LPZ A;  1N54 A;  4L2Y A;  5HQ8 A;  2KCL A;  5LX8 A;  2X6J A;  3CHR A;  3FEX A;  4FUL A;  1UW4 B;  3JUI A;  4JHJ A;  3RO3 A;  4Q69 A;  3RIB A;  2MOW A;  3CHP A;  4IRU A;  4ANV A;  3ZFW A;  5ENS D;  1HFA A;  5LCW C;  3J5Q B;  5J90 A;  1INZ A;  2CHW A;  4O60 A;  2X6F A;  5G04 J;  3JYS A;  2X3M A;  2X6H A;  4KMO A;  5AEN A;  3FHE A;  3FUN A;  2QYJ A;  3VLE A;  2HYZ A;  4N39 A;  1QYM A;  2L0T B;  4JHK A;  3CVN A;  4H7Y A;  5ENQ D;  2WQ7 A;  2KZT A;  2MHK A;  4PS7 A;  3TWT A;  4XKB A;  5AJD A;  4MRU A;  1MX2 A;  4WWN A;  5FQ7 A;  5CCL A;  2VGE A;  4FLH A;  2A5E A;  1E7U A;  3HHM A;  5BUZ A;  3FU6 A;  2B0O E;  4B8C B;  3G2S A;  5A6C A;  3TWR A;  3WXX A;  3P1U A;  4I1O B;  3IV0 A;  5KJK A;  5JJ6 A;  3IHY A;  3SBT B;  3W9G A;  4DRX E;  2LSV A;  4UQZ A;  3JCK C;  4CRW A;  1OWO A;  1TEZ A;  2VSN A;  1JPL A;  1MQS A;  3HDX A;  3FH8 A;  1UJJ A;  3C5R A;  3CHS A;  2XRZ A;  3T5X A;  3FUJ A;  5KNH D;  3D9P A;  2CHZ A;  4ATZ D;  1Z3X A;  3SD5 A;  2DIW A;  3FTV A;  5CEC B;  2ZGD A;  2XRY A;  1HH8 A;  2XCC A;  4UWG A;  3T8K A;  2VTB A;  1FVH A;  4J8D A;  2XCB A;  3AU4 A;  3CQC B;  3PEV B;  2XPY A;  3MZL B;  4LCT A;  5FZR A;  1XNF A;  4MLP A;  4HNA D;  3U3W A;  3L16 A;  1AWC B;  3D9N A;  2R17 C;  2LAI A;  3LVR E;  1IHB A;  2ZGG A;  4QFV A;  2CG3 A;  2WM9 A;  4I2Z A;  3F6Q A;  1W3B A;  3Q4A B;  5EN5 D;  1Z3Y A;  2KBX A;  4LSZ E;  5HRY A;  4A63 B;  2VYI A;  3FY4 A;  3L22 A;  4GMR A;  3AJI A;  4WND A;  3ASD A;  3PUK A;  4CZ2 D;  3FTZ A;  2WXJ A;  3FU0 A;  4GA2 A;  4KBQ A;  5G2N A;  3O4Z A;  3LCA A;  4YDW A;  2R5S A;  3TWS A;  5CBO A;  1WAO 1;  1H19 A;  3MEK A;  1UG3 A;  5EX0 A;  3QOU A;  3CVV A;  4TUM A;  2WXR A;  5HS0 A;  4WUY A;  4GYW A;  3TWQ A;  3U4T A;  1ELW A;  3SF4 A;  3KAE A;  4RLY A;  4ME2 A;  4FJY A;  5ENO D;  3L54 A;  4LG6 A;  3FUF A;  4AIF A;  1SW6 A;  4J8E A;  2NXP A;  1NA3 A;  2PQR A;  4OVV A;  4EZL A;  3FU5 A;  1JUQ A;  4ZFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...