4QFVA

Crystal structure of a unique ankyrin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MSMDIGKKLLEAARAGHDDSVEVLLKKGADINAKDNSGRTPLHVAALNGHLELVKLLLEKGADINARDMFGLTPLHTAASNGHLELVKLLLEKGADINARDEDGSTPLHLAASNGHLELVKLLLEKGADINAEDHSGTTPLHFAAKNGHLELVKLLLEKGADINASDFSGPTPLHSAAENGHLELVKLLLEKGADINARDKFGKTPFDLAIDNGNEDIAEVLQKAARSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A transcription blocker isolated from a designed repeat protein combinatorial library by in vivo functional screen.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords ANK-N5C-281
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4qfvA01
1.25.40.960 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4qfvA02
3JUEA 2V4HC 2AJAA 2ZGGA 1OT8A 1YCSB 1YYHA 3EHRA 1K3ZD 4BETA 1UOHA 3UXGA 1QYMA 3W9GA 1MX6A 1S70B 4N5QA 3HRAA 1IKND 3UTMA 1BD8A 1N0QA 2XZDG 2A5EA 2KXPC 1MX4A 1WDYA 3TWQA 5CBNA 5EIDA 3IXEA 1MYOA 5KNGA 1BLXB 1IXVA 4Z68A 3JXIA 5BXUA 1DCQA 4K5CA 4LNUD 5AQAA 3EHQA 4DX5D 5CEAA 4QFVA 4OAUC 2Y0BG 4LG6A 4HBDA 5EYLA 2F8XK 5FINA 3TWXA 4O1OA 3ZKJA 3LVQE 4DUIA 3TWUA 5EN5D 2FO1E 2HE0A 4O1PA 4A63B 2KBXA 1BU9A 1YMPA 4YDYA 3V79K 1WG0A 4CZ2D 5AAOA 3V31A 5AQ9A 1A5EA 3V2XA 3TWRA 4RLYA 4CYMD 5CERB 2BKKB 2QC9A 2ETBA 2F8YA 2V5QC 3NOGD 5EIBE 2RFAA 2XEHA 1SVXA 2B0OE 4DX2A 3T8KA 2F37A 1N0RA 5FIOA 4ATZD 4BESA 4GMRA 3AJIA 4O60A 3ZUVB 4K5AB 4ZHBA 4LSZE 1AWCB 3J5QB 4NIKA 3TWVA 4BERA 5JA4D 3TWTA 3DEOA 4DX6D 2RFMA 3V30A 2PNNA 5ENTD 5AARA 4OAVB 5ENQD 1D9SA 1NFIE 1K1BA 3Q9NC 5ENRD 4B93B 3F6QA 2QYJA 2ZGDA 2DZNA 1G3NB 3D9HA 5ENPD 4U8VD 4DRXE 4HB5A 5AN8A 4HQDA 3DEPA 4BEPA 4K5BA 5ITZF 1IHBA 2DZOA 3V2OA 3B95A 2MYOA 3NOCD 4TUMA 3LJNA 4HRNA 3C5RA 5AQ7A 4C48B 2DWZA 1MX2A 5D66A 5ENSD 4G8LA 5KBAA 2BKGA 1K1AA 4F1PA 3TWWA 4BSZB 4UUCA 4DX1A 5HRYA 3LVRE 5EILA 5AQBA 2J8SD 3AAAC 4HLLA 1BI7B 3B7BA 3SO8A 3W9FA 3HG0D 3TWSA 1DC2A 4J7WA 1OY3D 5KNHD 2VGEA 4YDWA 2XZTG 5HKPA 2ETCA 2ETAA 3T9KA 4HNAD 4HRMB 2XENA 4U96D 1AP7A 4JB8P 4HRLA 1BI8B 3JXJA 4HI8A 3UI2A 5CBOA 4HI9A 5EYPF 1SW6A 2L6BA 1N11A 5ENOD 5JMND 1MJ0A 3KEAA 4QQIA 5KWDA 3ZU7B 2DVWA 3NBNB 4U95D 3ZNGA 4ZFHA 5CECB 3J5PA 2NYJA 3Q9UC 5BXOA 4J8YA 2JABA 4U8YD 4F6RD 4GPMA 3EU9A 4DX7D 2XEEA 5HS0A 2Y1LE 2P2CP 1TR4A 5CEDB 4G8KA
chains in the Genus database with same CATH superfamily
4JA9A 3CK7A 2ZGGA 1YYHA 3AS5A 3SFZA 3UTMA 1W3BA 1NI1A 1ZB1A 4B8CB 2Y0BG 1JCQA 4GMLA 3MX3A 2VTBB 5G05J 3PREA 3KEZA 1HU3A 3AG3E 1X81A 2XEVA 1N52A 2KZTA 4NIKA 3TWVA 2J4DA 4ANWA 4X8QA 2WQ6A 1UG3A 2LAHA 3SGHA 4LERA 5KJLA 3OXFA 3Q9NC 4G25A 2WVIA 4M7CA 2ZGDA 4GTSA 5ENPD 4WWNA 4HB5A 5KJMA 4JC8A 4PS7A 1KT0A 4N5CA 2X6FA 3HXDA 4BX9A 2BKGA 2MOWA 3C72A 1OWOA 3ZHEA 2WXQA 3W9FA 4J7WA 1GW6A 3CVLA 4CDMA 2WXJA 4JPSA 5FQ6A 3MGBA 2GRQB 4EPZA 1L5JA 3QNKA 3ZEFA 3E34A 3DWLG 3W9GA 2P9LG 1BD8A 3UIOC 2KXPC 1WDYA 4B0ZA 3LY8A 2R59A 3GZSA 3BG0B 3PZ4A 1O1TA 1Z3YA 3TWUA 3NZUA 4O1PA 4GAAA 4TRQA 1TYQG 3UM0A 4BX8A 4UWKA 1H6OA 2YHEA 4J6IA 2OEWA 3E4BA 5D0QD 4LSZE 1A17A 3PNLB 4BERA 4B94A 3CK9A 2RFMA 3I4RB 3D9JA 3QARA 3U4TA 5ANRA 5E75A 4YDOA 2OV8A 2R05A 3RAUA 3AG2E 1DCEA 3UINC 1ELRA 4Q69A 1PAQA 2DIWA 3CEQA 2H6GA 1EF1C 2DZOA 3ZN3A 3MZLB 1H2VC 1K1AA 4DX1A 1TN7A 2RD0A 3JQ1A 3CQCB 1FVHA 4HOUA 1BI8B 3UPVA 5LX8A 1E8ZA 5EKQD 3E30A 3KD7A 3HXFA 4GA0A 4U04A 4DLQA 3LEWA 3ZPJA 2V4HC 2GRPB 4JA7A 1YCSB 4B89A 2H6IA 2QY7A 1OWPA 3LCAA 5BPPA 3OTNA 5LP0A 1MYOA 3K9IA 5AQAA 4C9BB 4P29A 5ANLA 2XS8A 5C1DA 2XRZA 2ZXWE 2IY0C 1QQEA 1WG0A 3ZVVA 4NRHB 3TWRA 3ZGQA 4GU5A 3CK8A 5G04C 2Y3AA 4I6JA 3CVVA 1E96B 1TNBA 4D10C 3KSLA 2IONA 5FQ8A 3I3NA 1UW4B 5ENTD 3DPDA 4MS6A 4PS8A 3CHQA 1G3NB 5HI7A 1QZ2A 4WNGA 3G2UA 3LJNA 1SA5A 3CVUA 1MQSA 3ONKA 4UUCA 2IO2C 3LJ3A 5JJ7A 3HG0D 2GRNB 4I1AA 1H2UA 3QK0A 5EYPF 2DVWA 3BG1B 4ATGA 3VLDA 1OXJA 3UT7A 2LNIA 3MEKA 1H19A 3JUEA 3EHRA 3R9AB 1HS6A 2WXPA 3GYZA 5ENNA 3UX4A 2PL2A 4UWFA 3CSTA 4LNUD 2MRIA 1KT1A 3PRZA 4LG6A 4A1SA 4EZLA 3QWWA 5EN5D 1N9AA 1N4QA 5JJ6A 5T4YA 4CDRA 2VYIA 3HXCA 1BU9A 3SQVA 2L6JA 2WXGA 2ONDA 3V2XA 2XEHA 2B0OE 4U0ZA 4CT4A 3UUXA 3MKQA 3SZ7A 5B3SE 4A55A 4B8AA 4AOFA 2Q7FA 3D3MA 1H6PA 2LSUA 3PZ3A 1OUVA 5JHBA 3DXMG 2C0LA 5E76A 2HM8A 3V2OA 3B95A 4HVBA 4V3IA 4C48B 3ZYLA 1TNUA 3BU8A 4IN3B 2FF4A 3SNXA 1OY3D 3G2SA 4ANUA 3TL5A 3AU4A 4HLEA 3Q15A 3FUFA 2FI7A 3S7BA 4U96D 5AIJA 1SW6A 3FTZA 4U7EB 3B7TA 4XZ4A 3WG7E 2WXFA 2VTBA 2LO6A 2NYJA 4K03A 4N2SA 1KPSB 1Q2ZA 3ULQA 4DX7D 5HS0A 4O6FA 3JQ0A 3S7FA 4Q94A 1OT8A 1S63A 3LXUX 4J8DA 4MBGA 3ASHA 3FU5A 1TJCA 5CCMA 5KCMA 3ZHEB 3RRMB 3L17A 4BFRA 3TWXA 4O1OA 3ZKJA 1LTXA 1HXIA 4GZCA 3CVPA 3PS6A 1IHGA 2RFAA 3D9OA 3AJIA 4BT9A 2B6CA 3QAQA 3AS4A 1LD7A 4KYOB 3L6AA 4GTRA 3R7QA 2J9QA 4OAVB 4LNGA 1NFIE 4YDEA 4I17A 4I1MA 4M3OA 3N71A 2KATA 5J08A 2XRYA 3APDA 2FBNA 5AN8A 3PE4A 4K5BA 3QC1A 3FTWA 1S0PA 1TNYA 4U0UA 5FZSA 2L0TB 5FQ4A 5AQBA 4MLPA 1JPLA 3JCKC 4G23A 4XKBA 1D8DA 4HI8A 3UI2A 4KT6B 3KEAA 3RIBA 5IY5E 5CECB 3HXEA 5LOZA 3E32A 3ZYQA 3IHYA 3PEVB 3RU0A 2A4ZA 4BETA 3UXGA 1QYMA 4AEZC 3FDHA 1S70B 3U66A 1E8YA 5A7DB 3G2WA 1MX4A 4G2VA 2E2EA 4UI9C 3UKUG 3SHFA 5BW8C 2QFCA 5D0OD 4YVOA 3FH5A 3RSEG 2HE0A 2DYSE 4FA6A 2ILRA 4LEUA 2BKKB 4A3VA 4I6EA 2JLBA 3FEXA 3S7JA 4BESA 3ZXPA 4RQIA 3UQ3A 2XPZA 1PC2A 5JA4D 4WWOA 2VGXA 4GTVA 4XEIG 5AJDA 5BT1A 4GCNA 2KC7A 4U8VD 1OCOE 3ESKA 4XE0A 3TJPA 2V4LA 4G8LA 4L7TA 2EQXA 1U2VG 5CCLA 2WQHA 4F1PA 5A23A 2CFUA 3ULYA 2YNQA 5EILA 2DYRE 4FJYA 3B7BA 3SO8A 3L16A 4YDWA 3G2TA 4UWLA 4GZ6A 4FJZA 5JMND 2AXZA 2ZIRA 1QBQA 3KAEA 3OXGA 2XGSA 2R17C 3RO2A 3S7DA 1NZNA 3DSVA 4I2ZA 1SZAA 1JUQA 3WXXA 2BUGA 3ASFA 4APFA 4BT8A 3D9NA 3QB2A 4DX5D 3JYSA 4AM9A 3CVXA 3VTYA 1WAO1 5FINA 3L9TA 4DI3A 2JEKA 4XX5A 3FFLA 3CHOA 1X5BA 1O5MA 5AAOA 2P9PG 3D9LA 1V55E 1Z6TA 1NA0A 2WXOA 1SVXA 4O60A 2OEVA 1JCSA 5EX3A 3TWTA 4DX6D 4FC8A 3UT4A 1N94A 4GTPA 5FWQA 3FUDA 2DZNA 5G55A 5M72A 3MV3B 1BPOA 3RO3A 2KM4A 2X6IA 2UY1B 3GZ1A 2DWZA 4URKA 4PUCA 1Y6IA 4FHJA 3L22A 2GGFA 3QWPA 4AY5A 1NL4A 5FTPA 2AXVA 2XZTG 2IEJA 3QOUA 4HNAD 2R2LA 3FU6A 2XENA 1V54E 4DJAA 1P5QA 3ASDA 4DI4A 5ENOD 1MJ0A 5B1AE 3SI5A 3ZW3A 3PNTB 1WM5A 1SQMA 2KCKA 3CR3A 2I9CA 1N0QA 4JEUA 3PUKA 4J8SA 2GRRB 3Q78A 2CG3A 5KNGA 3D9IA 3VLEA 1UN9A 3ML9A 2NC9A 3IEGA 1H0AA 2PQNA 4HOQA 2I2OA 3ESLA 4WNEA 4WNFA 3SFYA 2PQRA 3CKCA 2X6KA 1INZA 4FULA 4Y6CA 3ENEA 3FTXA 3IHVA 2WXRA 3CKBA 5ENRD 4N3AA 4B93B 1K8KG 4PDXA 2YQ8A 3PEUB 1KZOA 4TUMA 4AJWA 5AQ7A 3HXBA 5G2NA 3ABKE 4N3CA 3TWWA 3ZRHA 3TG4A 2J8SD 2OOEA 1TEZA 2BF0X 3O48A 4I9EA 3S2AA 4GZ5A 5T3RA 2WQ7A 2EIJE 3LDZA 4XIFA 3KSQA 5CBOA 2P58C 3FTYA 3EJNA 1HE8A 3ZU7B 3ZNGA 2FEZA 2JABA 4ANVA 4WWPA 2RG8A 1EPUA 4N2QA 3D9KA 5AJLA 4WAFA 2J07A 4UQXA 1E90A 2A5EA 3PE3A 4JHJA 3E33A 3NB2A 4Z68A 5LFAA 3EHQA 3R7RA 2KCVA 4L1BA 4YNDA 3KS2A 1EYHA 3RRNB 2PM7A 5A6CA 5CERB 2XGOA 3I4GA 2XQ0A 4RG9A 5EIBE 2AXUA 4MKTA 2C2LA 3AU5A 3Q79A 3ZXSA 3J5QB 4WUYA 5KJNA 4XI0A 4LNBA 4RSYA 3ABME 1HG2A 4CEMA 4N39A 3OAWA 4L9PA 4GZDA 4CDNA 3TG5A 4L2YA 3APCA 3DEPA 3OXLA 1HH8A 2XHEA 5FZQA 4KBQA 4HRNA 4TUUA 1KZPA 1HF8A 4AVXA 2XPYA 2IOSA 4GMJA 5T8IA 3B7RL 4TV3A 1SZ9A 2XCBA 5DBKA 3DRAA 2X3MA 3MYVA 3TXMA 3PDNA 1ZU2A 1Y8MA 2XEEA 3QWVA 2Y1LE 4AP2A 3NF1A 3CGHA 3T5VA 1OCZE 2XCCA 4G24A 1MHQA 3HYMB 2CHXA 1FPPA 4FHKA 4UI9J 3QKYA 5BXUA 2HYZA 3BEEA 4QFVA 2F8XK 1OCRE 2UY1A 4OVUA 4YDYA 3L08A 2NSZA 3MKRA 5AQ9A 4RLYA 1E7VA 3GZ2A 4BWRA 1H2TC 1JCRA 4U07A 4J8EA 3U3WA 1IYGA 2LUHA 4JZYA 4U8HA 4Y6WA 3SFXA 3V30A 1U3DA 2AVPA 3APFA 1K1BA 1UJKA 1TN8A 3F6QA 3ML8A 4EHMA 3Q5MA 3X2QE 2P9KG 2L9BA 3RKVA 3C3RA 3NOCD 2BEDA 1UN8A 2UWJG 2CHWA 3R9MA 4BSZB 3D9MA 3B7SA 1HX8A 2Y4UA 5B1BE 4KMOA 2GRMA 2VGEA 2ETCA 1O1RA 2ETAA 4GTOA 3T9KA 2YINA 3Q49B 3ZFWA 4HRLA 2KCLA 3ONLA 4HI9A 3B7UX 1TNOA 3UM1A 3TXNA 2AWIA 5BXOA 4F6RD 2WMOA 1B89A 4HXIA 1VDYA 4UWGA 3CLJA 2IOLA 3MJWA 4GTQA 4JD2G 3UT8A 1FVFA 3Q4AB 1ELWA 3FTSA 1N95A 2QYUA 4ME2A 3FWVA 3PZDA 2DBAA 4YVQC 1DVPA 5KJKA 2R03A 3HVEA 3LVQE 4GB9A 3SBSA 2H6FA 1E8XA 4KZ0A 4A1GA 3V31A 5DIZA 2QC9A 2ETBA 2WB2A 4R7LA 4HOTA 3P1UA 3FP3A 5FIOA 1S64A 1UJJA 2HO1A 2C0MA 4I6GA 3LY9A 3O4ZA 2AW6A 4L23A 5AARA 3URZA 4GYOA 4DLOA 2J08A 2EINE 4BSXA 3D9HA 3FUKA 4HOSA 2WXKA 4BEPA 1IHBA 2XGMA 3HVEB 5ENSD 3EUVA 1OWNA 4FADA 4A3TA 4NQ0A 2P9SG 5CHEE 4EQFA 3RK6A 5HRYA 3LPZA 4ILIA 3T5XA 1DNPA 4GYYA 5HKPA 4W9RA 2XPIA 4JB8P 2P9NG 3JXJA 3FTUA 4FP7A 3PUJA 2BTDA 4ABNA 5BUZA 4U8YD 3Q75A 1XGWA 2GRLA 1HO8A 4TXRA 2Y69E 3PH0C 5CEDB 2LXLA 1UOHA 4NACA 4UWHA 3HHMA 2V5FA 5ARGA 4I9CA 5C2YA 4KVOA 2XS1A 3JXIA 3DSSA 3BQOA 2X6JA 1D8EA 2WM9A 4HBDA 4Q96A 3DXKG 2M63A 4F1SA 3EIJA 4CT0A 3P2BA 5AENA 4KVMA 4FLBA 4UQYA 1IQUA 4CYMD 1EDUA 1JWFA 3T8KA 2IF4A 4PH4B 5ARFA 4EBAA 3DSUA 4OVVA 3SY2A 3QJZA 3CHRA 1N4PA 1FT1A 5H7PA 3FTVA 3L13A 1FCHA 2QYJA 5CMWA 4F7AA 1E8WA 5ITZF 1LF8A 4ACKA 2J09A 4GYWA 2I6HA 4F3VA 1RZ4A 4GZ3A 3FUEA 4F53A 4I43A 3AG1E 3SF4A 3FUNA 2WXHA 1N11A 5JHAA 5KWDA 4QQIA 5G04J 3U64A 4GPMA 4U0SA 5FZRA 3CVWA 2WXLA 2VSNA 4BY6A 2X38A 4GA2A 5CRVA 3TGOA 4IULA 2XZDG 4TXPA 1TJFA 3PVLA 3DSXA 1DCQA 4OAUC 1NP7A 4DUIA 5FJYA 2IFUA 2E0IA 3UM3A 2KBXA 2HR2A 2Y4TA 5BV0A 2I1KA 4LRZA 3TAXA 3HDXA 3EHNA 1OCCE 3PZ2A 1ELKA 3NOGD 4APOA 4ATZD 2R02A 4WNDA 4GMRA 1MZCA 3U9WA 2L0IA 3ZUVB 3UKRG 2IJGX 3UIPC 3FUIA 2OCCE 2OVBA 2PNNA 3MCXA 4E85A 4AY6A 1N4SA 1U3CA 4JHKA 3VTXA 2H6HA 4DRXE 4DK5A 3AG4E 5J90A 1NA3A 4JVSA 3T8MA 2WXMA 4AV7A 3IV0A 2EIKE 3FUHA 4J8FA 3DSWA 3LKUA 2KZTB 3GW4A 4XI9A 2GW1A 3Q47B 2MHKA 1LD8A 4I2WA 3FUMA 4HRMB 4BTAA 2QZAA 3NAWA 2EILE 3FULA 3FH8A 2IU1A 2ZISA 3VLFA 3ZYKA 1H6KA 3LY7A 2CG2A 4ZFHA 3EU9A 1HZ4A 5EDSA 3CVYA 3SD5A 3NQPA 4EZKA 3FY4A 1K3ZD 2EIME 3Q7FA 5FT9A 4N5QA 3UMVA 3UM2A 1O1SA 3DBSA 4CGVA 3ASOE 5CEAA 3EDTB 3ASGA 4GPKA 1OWMA 2X6HA 4MRUA 3SBTB 3L82A 2VSXE 2VGYA 3AS8A 3CHMA 3MV2B 3FHEA 2RKKA 4OYSA 4ZHBA 1AWCB 3CVQA 3Q7AA 4G26A 5AYWD 3DEOA 4GTTA 4DPRA 3FUJA 2ZU6B 3FEYA 4K0RA 5EX0A 3MA5A 4CRWA 3CHPA 5BV1A 4JHRA 1HG5A 3I5PA 5BNWA 1MX2A 1Z5SC 2WMNA 2P9IG 5KBAA 4CCAA 4BTBA 2IQCA 3ISMC 2WXIA 1DC2A 5KNHD 2I1JA 4N3BA 3HIZA 4ILHB 4ANXA 4EZJA 3RRUA 1JWGA 2VJ8A 1SA4A 4NURA 3FU0A 3NBNB 2WPVA 4U95D 3ZIMA 4H7XA 3DPYA 4J8YA 3RJVA 2AJAA 1KLXA 1N54A 1MX6A 3HRAA 2YHCA 1IKND 1PY1A 4L2LA 2V8SE 4ILGA 3ZYMA 2LSVA 3IXEA 1BLXB 1IXVA 4K5CA 4XKCA 2GROB 2J4BA 3CSFA 5EYLA 4UQZA 4RG6A 2FO1E 1OWLA 2R5SA 1YA0A 4RVBA 1YMPA 3V79K 1N4RA 1E7UA 4PS3A 4CZ2D 2VQ2A 2IO3C 2F8YA 3CVNA 2F37A 1IQRA 1FT2A 3CHSA 5LCWC 4HS2A 3CV0A 2PZIA 4IRUA 4LUNU 2A5UA 2LAIA 5CMYA 4CGWA 1D9SA 3ASNE 4E6HA 2NXPA 4FLHA 1ZBPA 4EECA 1TN6A 2FULA 4HQDA 2FO7A 4TXQA 5D66A 4AXHA 5D2MC 1WY6A 3LVRE 4HLLA 1BI7B 4HORA 1QNFA 3CIAA 3E37A 4H7YA 4EBAG 4JW1A 2WXNA 4J0UA 4JEHA 3EIQC 3BUAA 3J5PA 4ACLA 3Q9UC 4KZCA 4UI9K 3Q73A 2V0PA 4C0EA 1TNZA 2P2CP 5JJTA 4G8KA 3LS8A 2VGXB 2OVFA 2PM6A 3TWQA 5CBNA 3NZSA 5EIDA 3EU5A 5FQ7A 3G2VA 4G1TA 4AIFA 1XNFA 4G11A 4KXKB 3B13A 2VSOE 4A63B 2F0YA 3ULEG 3IBEA 1A5EA 3L54A 3EHMA 2J49A 1Z3XA 3ABLE 3C98A 2V5QC 4DX2A 1N0RA 4LCTA 4K5AB 2DCPA 4GCOA 3LYAA 4I1OB 3C3OA 5HQ8A 1HFAA 2LXMA 4JXTA 3JUIA 4JL0A 5G05C 3IKOB 4HFGA 3D9PA 2MYOA 4U63A 3DSTA 3C5RA 3PZ1A 2VSYA 3FH7A 5CRUA 3AAAC 4GA1A 3TWSA 3QDNA 3FU3A 2P9UG 3MKQB 1AP7A 4GTMA 5LCWJ 1RW2A 3CQGB 4FU3A 3C3QA 2CFZA 2L6BA 4C0MA 2CHZA 4IYPA 1TR4A 5ENQD
chains in the Genus database with same CATH topology
2WXLA 4JA9A 4Q94A 4N2QA 2VSNA 4BY6A 3CK7A 2X38A 2ZGGA 1OT8A 1YYHA 3D9KA 3AS5A 5AJLA 4WAFA 3LXUX 4J8DA 3SFZA 4GA2A 3TGOA 3UTMA 2J07A 4IULA 4UQXA 1E90A 1W3BA 2XZDG 2A5EA 3PE3A 4JHJA 3ASHA 1TJFA 3FU5A 3PVLA 4Z68A 1TJCA 5CCMA 5KCMA 1DCQA 3ZHEB 5LFAA 3EHQA 3RRMB 4OAUC 2Y0BG 4B8CB 1NP7A 3L17A 4BFRA 3TWXA 4O1OA 3ZKJA 4GMLA 3R7RA 4DUIA 2KCVA 3MX3A 4L1BA 1HXIA 2IFUA 3KS2A 4YNDA 5FJYA 2E0IA 4GZCA 2VTBB 3CVPA 1EYHA 2KBXA 2HR2A 2Y4TA 3PREA 2PM7A 3KEZA 5G05J 2I1KA 3RRNB 5BV0A 5A6CA 3PS6A 1HU3A 4LRZA 3TAXA 3HDXA 3EHNA 4DK5A 5CERB 2XGOA 3I4GA 1IHGA 1ELKA 2XQ0A 3NOGD 4RG9A 5EIBE 2RFAA 2AXUA 4MKTA 2C2LA 2XEVA 4ATZD 1N52A 3AU5A 3D9OA 4APOA 4WNDA 4GMRA 3AJIA 4BT9A 3ZUVB 2L0IA 3U9WA 2KZTA 2IJGX 3ZXSA 3J5QB 4NIKA 3TWVA 2J4DA 3QAQA 4ANWA 3AS4A 4WUYA 5KJNA 3FUIA 1UG3A 4KYOB 5KJMA 3L6AA 2WQ6A 2PNNA 2LAHA 2OVBA 3R7QA 2J9QA 3SGHA 4LERA 4XI0A 5KJLA 4OAVB 3MCXA 3OXFA 4E85A 1NFIE 3Q9NC 4G25A 4I17A 4I1MA 4RSYA 4AY6A 1HG2A 1U3CA 2WVIA 4CEMA 4M3OA 3N71A 2KATA 4JHKA 4N39A 2ZGDA 3OAWA 3VTXA 5ENPD 5J08A 4WWNA 4DRXE 4GZDA 4CDNA 3TG5A 4HB5A 2XRYA 3APDA 2FBNA 4L2YA 5AN8A 3APCA 3DEPA 3PE4A 3OXLA 1HH8A 1NA3A 4K5BA 2XHEA 4JVSA 5FZQA 5J90A 4KBQA 3T8MA 4JC8A 4PS7A 4HRNA 3FTWA 3QC1A 1KT0A 4N5CA 1S0PA 4TUUA 2X6FA 2WXMA 4U0UA 4AV7A 4BX9A 3IV0A 2BKGA 1HF8A 2MOWA 3FUHA 4J8FA 5FZSA 2L0TB 5FQ4A 4AVXA 1OWOA 2XPYA 3LKUA 5AQBA 2KZTB 3GW4A 2IOSA 4GMJA 5T8IA 3B7RL 4MLPA 2WXQA 3ZHEA 4XI9A 2GW1A 3W9FA 3Q47B 4TV3A 4J7WA 1GW6A 2MHKA 4I2WA 3FUMA 1SZ9A 3CVLA 1JPLA 2XCBA 5DBKA 4HRMB 3JCKC 4G23A 4XKBA 4BTAA 4CDMA 3FULA 4HI8A 3UI2A 2IU1A 3FH8A 3VLFA 2X3MA 3MYVA 4KT6B 3ZYKA 2WXJA 1H6KA 3KEAA 4JPSA 3TXMA 3LY7A 2CG2A 3RIBA 4ZFHA 5CECB 3MGBA 5FQ6A 3PDNA 1ZU2A 3EU9A 1HZ4A 5EDSA 1Y8MA 2XEEA 3QWVA 3CVYA 2Y1LE 4AP2A 3SD5A 3NF1A 3CGHA 4EPZA 5LOZA 3ZYQA 3T5VA 3IHYA 1L5JA 3NQPA 3PEVB 2XCCA 2A4ZA 3QNKA 4BETA 3FY4A 4G24A 1K3ZD 3RU0A 3ZEFA 3UXGA 4EZKA 1MHQA 1QYMA 3W9GA 3FDHA 4AEZC 5FT9A 1S70B 4N5QA 3HYMB 2CHXA 3U66A 1BD8A 1E8YA 5A7DB 3UMVA 2KXPC 3G2WA 1MX4A 1WDYA 4G2VA 4FHKA 4UI9J 2E2EA 4UI9C 4B0ZA 3QKYA 5BXUA 2HYZA 3DBSA 3LY8A 4CGVA 5CEAA 3BEEA 3EDTB 4QFVA 3ASGA 3SHFA 4GPKA 2R59A 5BW8C 3GZSA 2F8XK 3BG0B 1Z3YA 1OWMA 3TWUA 2QFCA 2UY1A 2X6HA 3FH5A 3NZUA 5D0OD 4MRUA 4YVOA 2HE0A 4O1PA 4GAAA 4YDYA 4OVUA 3L08A 4TRQA 3SBTB 2NSZA 3MKRA 5AQ9A 4FA6A 2ILRA 4RLYA 4LEUA 1E7VA 2BKKB 3GZ2A 2VSXE 4A3VA 4I6EA 4BWRA 4BX8A 2VGYA 2JLBA 4UWKA 3AS8A 3CHMA 2YHEA 1H2TC 4J6IA 3MV2B 4BESA 3FEXA 3S7JA 3E4BA 4U07A 3FHEA 5D0QD 4OYSA 4ZHBA 4LSZE 4J8EA 1AWCB 3UQ3A 2XPZA 1A17A 3U3WA 3CVQA 1PC2A 3PNLB 4BERA 5JA4D 4G26A 4B94A 4JZYA 5AYWD 4U8HA 3DEOA 4WWOA 4DPRA 2VGXA 3CK9A 2RFMA 4Y6WA 3V30A 3FUJA 1U3DA 3I4RB 2AVPA 2ZU6B 3D9JA 3FEYA 3QARA 4K0RA 3APFA 5AJDA 5ANRA 5EX0A 3MA5A 1K1BA 3U4TA 1UJKA 5BT1A 4CRWA 5E75A 2OV8A 3CHPA 3F6QA 4GCNA 3ML8A 5BV1A 1ELRA 3Q5MA 4JHRA 2KC7A 4U8VD 4Q69A 1PAQA 2DIWA 3CEQA 1HG5A 3ESKA 3I5PA 1EF1C 2L9BA 3RKVA 2DZOA 4XE0A 3ZN3A 3NOCD 2V4LA 3TJPA 5BNWA 1MX2A 2WMNA 4G8LA 4L7TA 1UN8A 5KBAA 2UWJG 2EQXA 3MZLB 4CCAA 1H2VC 2CHWA 2WQHA 1K1AA 4F1PA 4BSZB 2CFUA 3D9MA 5A23A 4DX1A 5CCLA 2YNQA 5EILA 3B7SA 4BTBA 1HX8A 2IQCA 2Y4UA 4FJYA 2RD0A 4KMOA 3B7BA 3SO8A 3JQ1A 3L16A 2WXIA 1DC2A 2GRMA 5KNHD 3CQCB 1FVHA 2VGEA 4HOUA 4YDWA 2ETCA 2ETAA 2I1JA 4N3BA 3T9KA 3HIZA 2YINA 4ILHB 3G2TA 3Q49B 4ANXA 4UWLA 4EZJA 3ZFWA 4HRLA 4GZ6A 1BI8B 3RRUA 1IYGA 2KCLA 3ONLA 3UPVA 5LX8A 4HI9A 1JWGA 2VJ8A 4FJZA 4NURA 3FU0A 5JMND 2AXZA 1E8ZA 3B7UX 3NBNB 5EKQD 4U95D 2WPVA 3ZIMA 3TXNA 2AWIA 4H7XA 5BXOA 4J8YA 4F6RD 3KD7A 4GA0A 3KAEA 4U04A 2WMOA 1B89A 4DLQA 4HXIA 3OXGA 3RJVA 2XGSA 1VDYA 2R17C 3RO2A 3LEWA 4UWGA 3ZPJA 3S7DA 1NZNA 2V4HC 2AJAA 3CLJA 4JA7A 1YCSB 4I2ZA 2IOLA 3MJWA 1KLXA 1N54A 1SZAA 1JUQA 4B89A 1MX6A 2QY7A 3WXXA 3HRAA 2YHCA 1IKND 1OWPA 1PY1A 2BUGA 2V8SE 3ASFA 3LCAA 4ILGA 4L2LA 5BPPA 3ZYMA 3OTNA 3UT8A 5LP0A 1FVFA 3Q4AB 1ELWA 4APFA 4BT8A 3FTSA 3D9NA 2LSVA 3IXEA 1MYOA 4ME2A 3K9IA 3FWVA 1BLXB 3PZDA 1IXVA 3QB2A 2DBAA 4YVQC 5AQAA 4K5CA 4C9BB 4DX5D 4XKCA 1DVPA 3JYSA 2J4BA 4AM9A 4P29A 5KJKA 3CSFA 5ANLA 3CVXA 5EYLA 1WAO1 3VTYA 3HVEA 5FINA 3LVQE 5C1DA 4UQZA 2XRZA 4DI3A 4RG6A 4GB9A 2JEKA 4XX5A 3SBSA 2FO1E 1OWLA 3CHOA 1QQEA 1X5BA 2R5SA 3FFLA 1YA0A 1E8XA 4KZ0A 4RVBA 1YMPA 3V79K 4N2SA 1WG0A 4PS3A 1E7UA 4A1GA 4CZ2D 5AAOA 3V31A 3ZVVA 3D9LA 3TWRA 4NRHB 3ZGQA 1Z6TA 1NA0A 5DIZA 2VQ2A 4GU5A 2QC9A 2ETBA 2WB2A 2F8YA 2WXOA 3CK8A 4R7LA 4HOTA 3CVNA 5G04C 1SVXA 2Y3AA 2F37A 5FIOA 3FP3A 3P1UA 1IQRA 4I6JA 1E96B 1UJJA 3CVVA 4D10C 4O60A 2HO1A 2C0MA 3CHSA 4I6GA 2IONA 4HS2A 5LCWC 3LY9A 3TWTA 5EX3A 5FQ8A 3CV0A 3I3NA 3O4ZA 4DX6D 2PZIA 4IRUA 1UW4B 2AW6A 4LUNU 5ENTD 3DPDA 2A5UA 2LAIA 5AARA 4L23A 4FC8A 5CMYA 1D9SA 3URZA 3UT4A 4CGWA 4MS6A 4GYOA 4DLOA 4E6HA 2J08A 5FWQA 2NXPA 4PS8A 3CHQA 4BSXA 3FUDA 4FLHA 2DZNA 1G3NB 3D9HA 1ZBPA 4EECA 5G55A 5HI7A 3FUKA 5M72A 4HOSA 1QZ2A 4HQDA 2FULA 4WNGA 2WXKA 4BEPA 3MV3B 2FO7A 1BPOA 1IHBA 2XGMA 3RO3A 3HVEB 3G2UA 2KM4A 2X6IA 3LJNA 2UY1B 3GZ1A 3CVUA 2DWZA 5D66A 5ENSD 1OWNA 4URKA 4PUCA 4FADA 4AXHA 1MQSA 4A3TA 3ONKA 1Y6IA 4FHJA 4NQ0A 4UUCA 1WY6A 5CHEE 3L22A 4EQFA 3RK6A 2GGFA 5HRYA 3LVRE 3QWPA 3LPZA 4ILIA 4HLLA 1BI7B 3LJ3A 4AY5A 1QNFA 3HG0D 3T5XA 5JJ7A 4HORA 3CIAA 1DNPA 5FTPA 2AXVA 5HKPA 2XZTG 4H7YA 4GYYA 4W9RA 4HNAD 3QOUA 2XPIA 4I1AA 3FU6A 4EBAG 2XENA 4JW1A 1H2UA 2WXNA 4JB8P 1P5QA 3QK0A 3JXJA 4DJAA 3ASDA 3CVWA 4J0UA 4DI4A 5EYPF 4JEHA 3FTUA 5ENOD 1MJ0A 4FP7A 3EIQC 2DVWA 3PUJA 2BTDA 3J5PA 4ACLA 3Q9UC 3BG1B 4KZCA 3SI5A 4U8YD 3VLDA 4ABNA 4ATGA 5BUZA 3ZW3A 4UI9K 1XGWA 2GRLA 1HO8A 2LNIA 2V0PA 1WM5A 3PNTB 3UT7A 4C0EA 2P2CP 3MEKA 5CEDB 3PH0C 1SQMA 4G8KA 3JUEA 1H19A 2KCKA 5JJTA 3CR3A 3LS8A 3EHRA 2VGXB 3R9AB 1UOHA 2OVFA 2I9CA 4NACA 2PM6A 4UWHA 1N0QA 3HHMA 2V5FA 3PUKA 4J8SA 4JEUA 3TWQA 5CBNA 1HS6A 2WXPA 3GYZA 3NZSA 4I9CA 5EIDA 5ENNA 5ARGA 3UX4A 5FQ7A 2PL2A 2CG3A 5C2YA 5KNGA 4KVOA 3JXIA 4UWFA 3CSTA 4LNUD 2MRIA 2X6JA 1KT1A 2WM9A 3PRZA 3G2VA 4LG6A 4A1SA 4HBDA 4Q96A 4EZLA 3D9IA 4G1TA 3VLEA 1UN9A 4AIFA 3QWWA 1XNFA 2M63A 4G11A 5EN5D 4KXKB 4F1SA 5JJ6A 3ML9A 5T4YA 3B13A 3EIJA 4CT0A 4CDRA 3P2BA 5AENA 4A63B 2VSOE 2VYIA 1BU9A 4KVMA 4FLBA 2L6JA 2WXGA 4UQYA 2NC9A 3IEGA 3IBEA 1A5EA 2ONDA 3V2XA 1IQUA 1H0AA 2PQNA 3EHMA 3L54A 4CYMD 4HOQA 1EDUA 2J49A 1Z3XA 2I2OA 3C98A 2V5QC 3ESLA 1JWFA 2XEHA 4WNEA 4WNFA 2B0OE 4DX2A 3T8KA 2PQRA 1N0RA 3CKCA 4U0ZA 2IF4A 4LCTA 4PH4B 2X6KA 5ARFA 4CT4A 4EBAA 4K5AB 1INZA 4OVVA 3UUXA 3MKQA 4FULA 4Y6CA 2DCPA 4GCOA 3SZ7A 3LYAA 3QJZA 3ENEA 4A55A 3FTXA 3IHVA 4AOFA 2WXRA 3CHRA 4B8AA 3CKBA 4I1OB 2Q7FA 5HQ8A 5ENRD 3D3MA 4N3AA 4B93B 3FTVA 3L13A 2LSUA 1FCHA 1HFAA 4JXTA 1OUVA 3JUIA 2QYJA 4JL0A 5G05C 5CMWA 5JHBA 4F7AA 4PDXA 2C0LA 3IKOB 1E8WA 2YQ8A 3PEUB 3S7FA 5ITZF 4HFGA 5E76A 2HM8A 1LF8A 3V2OA 3B95A 2MYOA 4TUMA 3D9PA 4ACKA 4U63A 4HVBA 3C5RA 5AQ7A 4C48B 4V3IA 4AJWA 3ZYLA 2J09A 5G2NA 4N3CA 3TWWA 2VSYA 4GYWA 2I6HA 3ZRHA 3TG4A 4F3VA 3FH7A 4IN3B 2J8SD 2OOEA 4GZ3A 3AAAC 2BF0X 4GA1A 1TEZA 2FF4A 3FUEA 3SNXA 3O48A 4I9EA 3TWSA 3S2AA 3QDNA 3FU3A 1OY3D 3G2SA 4F53A 4ANUA 4GZ5A 4I43A 3TL5A 5T3RA 2WQ7A 3AU4A 4HLEA 3Q15A 3SF4A 3FUFA 3LDZA 3FUNA 3MKQB 2FI7A 3S7BA 4U96D 1AP7A 2WXHA 3CQGB 4FU3A 4XIFA 5AIJA 5LCWJ 5CBOA 2P58C 2CFZA 3FTYA 1SW6A 3FTZA 2L6BA 1N11A 5KWDA 3EJNA 5JHAA 4QQIA 3B7TA 3ZU7B 1HE8A 2WXFA 4XZ4A 3ZNGA 5G04J 2LO6A 2NYJA 2FEZA 4K03A 4C0MA 2JABA 2VTBA 3U64A 3ULQA 4GPMA 2CHZA 4U0SA 4DX7D 5HS0A 5FZRA 4O6FA 4ANVA 4IYPA 3JQ0A 4WWPA 2RG8A 1EPUA 1TR4A 5ENQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUE A;  2V4H C;  2AJA A;  2ZGG A;  1OT8 A;  1YCS B;  1YYH A;  3EHR A;  1K3Z D;  4BET A;  1UOH A;  3UXG A;  1QYM A;  3W9G A;  1MX6 A;  1S70 B;  4N5Q A;  3HRA A;  1IKN D;  3UTM A;  1BD8 A;  1N0Q A;  2XZD G;  2A5E A;  2KXP C;  1MX4 A;  1WDY A;  3TWQ A;  5CBN A;  5EID A;  3IXE A;  1MYO A;  5KNG A;  1BLX B;  1IXV A;  4Z68 A;  3JXI A;  5BXU A;  1DCQ A;  4K5C A;  4LNU D;  5AQA A;  3EHQ A;  4DX5 D;  5CEA A;  4QFV A;  4OAU C;  2Y0B G;  4LG6 A;  4HBD A;  5EYL A;  2F8X K;  5FIN A;  3TWX A;  4O1O A;  3ZKJ A;  3LVQ E;  4DUI A;  3TWU A;  5EN5 D;  2FO1 E;  2HE0 A;  4O1P A;  4A63 B;  2KBX A;  1BU9 A;  1YMP A;  4YDY A;  3V79 K;  1WG0 A;  4CZ2 D;  5AAO A;  3V31 A;  5AQ9 A;  1A5E A;  3V2X A;  3TWR A;  4RLY A;  4CYM D;  5CER B;  2BKK B;  2QC9 A;  2ETB A;  2F8Y A;  2V5Q C;  3NOG D;  5EIB E;  2RFA A;  2XEH A;  1SVX A;  2B0O E;  4DX2 A;  3T8K A;  2F37 A;  1N0R A;  5FIO A;  4ATZ D;  4BES A;  4GMR A;  3AJI A;  4O60 A;  3ZUV B;  4K5A B;  4ZHB A;  4LSZ E;  1AWC B;  3J5Q B;  4NIK A;  3TWV A;  4BER A;  5JA4 D;  3TWT A;  3DEO A;  4DX6 D;  2RFM A;  3V30 A;  2PNN A;  5ENT D;  5AAR A;  4OAV B;  5ENQ D;  1D9S A;  1NFI E;  1K1B A;  3Q9N C;  5ENR D;  4B93 B;  3F6Q A;  2QYJ A;  2ZGD A;  2DZN A;  1G3N B;  3D9H A;  5ENP D;  4U8V D;  4DRX E;  4HB5 A;  5AN8 A;  4HQD A;  3DEP A;  4BEP A;  4K5B A;  5ITZ F;  1IHB A;  2DZO A;  3V2O A;  3B95 A;  2MYO A;  3NOC D;  4TUM A;  3LJN A;  4HRN A;  3C5R A;  5AQ7 A;  4C48 B;  2DWZ A;  1MX2 A;  5D66 A;  5ENS D;  4G8L A;  5KBA A;  2BKG A;  1K1A A;  4F1P A;  3TWW A;  4BSZ B;  4UUC A;  4DX1 A;  5HRY A;  3LVR E;  5EIL A;  5AQB A;  2J8S D;  3AAA C;  4HLL A;  1BI7 B;  3B7B A;  3SO8 A;  3W9F A;  3HG0 D;  3TWS A;  1DC2 A;  4J7W A;  1OY3 D;  5KNH D;  2VGE A;  4YDW A;  2XZT G;  5HKP A;  2ETC A;  2ETA A;  3T9K A;  4HNA D;  4HRM B;  2XEN A;  4U96 D;  1AP7 A;  4JB8 P;  4HRL A;  1BI8 B;  3JXJ A;  4HI8 A;  3UI2 A;  5CBO A;  4HI9 A;  5EYP F;  1SW6 A;  2L6B A;  1N11 A;  5ENO D;  5JMN D;  1MJ0 A;  3KEA A;  4QQI A;  5KWD A;  3ZU7 B;  2DVW A;  3NBN B;  4U95 D;  3ZNG A;  4ZFH A;  5CEC B;  3J5P A;  2NYJ A;  3Q9U C;  5BXO A;  4J8Y A;  2JAB A;  4U8Y D;  4F6R D;  4GPM A;  3EU9 A;  4DX7 D;  2XEE A;  5HS0 A;  2Y1L E;  2P2C P;  1TR4 A;  5CED B;  4G8K A; 
#chains in the Genus database with same CATH topology
 4JA9 A;  3CK7 A;  2ZGG A;  1YYH A;  3AS5 A;  3SFZ A;  3UTM A;  1W3B A;  1NI1 A;  1ZB1 A;  4B8C B;  2Y0B G;  1JCQ A;  4GML A;  3MX3 A;  2VTB B;  5G05 J;  3PRE A;  3KEZ A;  1HU3 A;  3AG3 E;  1X81 A;  2XEV A;  1N52 A;  2KZT A;  4NIK A;  3TWV A;  2J4D A;  4ANW A;  4X8Q A;  2WQ6 A;  1UG3 A;  2LAH A;  3SGH A;  4LER A;  5KJL A;  3OXF A;  3Q9N C;  4G25 A;  2WVI A;  4M7C A;  2ZGD A;  4GTS A;  5ENP D;  4WWN A;  4HB5 A;  5KJM A;  4JC8 A;  4PS7 A;  1KT0 A;  4N5C A;  2X6F A;  3HXD A;  4BX9 A;  2BKG A;  2MOW A;  3C72 A;  1OWO A;  3ZHE A;  2WXQ A;  3W9F A;  4J7W A;  1GW6 A;  3CVL A;  4CDM A;  2WXJ A;  4JPS A;  5FQ6 A;  3MGB A;  2GRQ B;  4EPZ A;  1L5J A;  3QNK A;  3ZEF A;  3E34 A;  3DWL G;  3W9G A;  2P9L G;  1BD8 A;  3UIO C;  2KXP C;  1WDY A;  4B0Z A;  3LY8 A;  2R59 A;  3GZS A;  3BG0 B;  3PZ4 A;  1O1T A;  1Z3Y A;  3TWU A;  3NZU A;  4O1P A;  4GAA A;  4TRQ A;  1TYQ G;  3UM0 A;  4BX8 A;  4UWK A;  1H6O A;  2YHE A;  4J6I A;  2OEW A;  3E4B A;  5D0Q D;  4LSZ E;  1A17 A;  3PNL B;  4BER A;  4B94 A;  3CK9 A;  2RFM A;  3I4R B;  3D9J A;  3QAR A;  3U4T A;  5ANR A;  5E75 A;  4YDO A;  2OV8 A;  2R05 A;  3RAU A;  3AG2 E;  1DCE A;  3UIN C;  1ELR A;  4Q69 A;  1PAQ A;  2DIW A;  3CEQ A;  2H6G A;  1EF1 C;  2DZO A;  3ZN3 A;  3MZL B;  1H2V C;  1K1A A;  4DX1 A;  1TN7 A;  2RD0 A;  3JQ1 A;  3CQC B;  1FVH A;  4HOU A;  1BI8 B;  3UPV A;  5LX8 A;  1E8Z A;  5EKQ D;  3E30 A;  3KD7 A;  3HXF A;  4GA0 A;  4U04 A;  4DLQ A;  3LEW A;  3ZPJ A;  2V4H C;  2GRP B;  4JA7 A;  1YCS B;  4B89 A;  2H6I A;  2QY7 A;  1OWP A;  3LCA A;  5BPP A;  3OTN A;  5LP0 A;  1MYO A;  3K9I A;  5AQA A;  4C9B B;  4P29 A;  5ANL A;  2XS8 A;  5C1D A;  2XRZ A;  2ZXW E;  2IY0 C;  1QQE A;  1WG0 A;  3ZVV A;  4NRH B;  3TWR A;  3ZGQ A;  4GU5 A;  3CK8 A;  5G04 C;  2Y3A A;  4I6J A;  3CVV A;  1E96 B;  1TNB A;  4D10 C;  3KSL A;  2ION A;  5FQ8 A;  3I3N A;  1UW4 B;  5ENT D;  3DPD A;  4MS6 A;  4PS8 A;  3CHQ A;  1G3N B;  5HI7 A;  1QZ2 A;  4WNG A;  3G2U A;  3LJN A;  1SA5 A;  3CVU A;  1MQS A;  3ONK A;  4UUC A;  2IO2 C;  3LJ3 A;  5JJ7 A;  3HG0 D;  2GRN B;  4I1A A;  1H2U A;  3QK0 A;  5EYP F;  2DVW A;  3BG1 B;  4ATG A;  3VLD A;  1OXJ A;  3UT7 A;  2LNI A;  3MEK A;  1H19 A;  3JUE A;  3EHR A;  3R9A B;  1HS6 A;  2WXP A;  3GYZ A;  5ENN A;  3UX4 A;  2PL2 A;  4UWF A;  3CST A;  4LNU D;  2MRI A;  1KT1 A;  3PRZ A;  4LG6 A;  4A1S A;  4EZL A;  3QWW A;  5EN5 D;  1N9A A;  1N4Q A;  5JJ6 A;  5T4Y A;  4CDR A;  2VYI A;  3HXC A;  1BU9 A;  3SQV A;  2L6J A;  2WXG A;  2OND A;  3V2X A;  2XEH A;  2B0O E;  4U0Z A;  4CT4 A;  3UUX A;  3MKQ A;  3SZ7 A;  5B3S E;  4A55 A;  4B8A A;  4AOF A;  2Q7F A;  3D3M A;  1H6P A;  2LSU A;  3PZ3 A;  1OUV A;  5JHB A;  3DXM G;  2C0L A;  5E76 A;  2HM8 A;  3V2O A;  3B95 A;  4HVB A;  4V3I A;  4C48 B;  3ZYL A;  1TNU A;  3BU8 A;  4IN3 B;  2FF4 A;  3SNX A;  1OY3 D;  3G2S A;  4ANU A;  3TL5 A;  3AU4 A;  4HLE A;  3Q15 A;  3FUF A;  2FI7 A;  3S7B A;  4U96 D;  5AIJ A;  1SW6 A;  3FTZ A;  4U7E B;  3B7T A;  4XZ4 A;  3WG7 E;  2WXF A;  2VTB A;  2LO6 A;  2NYJ A;  4K03 A;  4N2S A;  1KPS B;  1Q2Z A;  3ULQ A;  4DX7 D;  5HS0 A;  4O6F A;  3JQ0 A;  3S7F A;  4Q94 A;  1OT8 A;  1S63 A;  3LXU X;  4J8D A;  4MBG A;  3ASH A;  3FU5 A;  1TJC A;  5CCM A;  5KCM A;  3ZHE B;  3RRM B;  3L17 A;  4BFR A;  3TWX A;  4O1O A;  3ZKJ A;  1LTX A;  1HXI A;  4GZC A;  3CVP A;  3PS6 A;  1IHG A;  2RFA A;  3D9O A;  3AJI A;  4BT9 A;  2B6C A;  3QAQ A;  3AS4 A;  1LD7 A;  4KYO B;  3L6A A;  4GTR A;  3R7Q A;  2J9Q A;  4OAV B;  4LNG A;  1NFI E;  4YDE A;  4I17 A;  4I1M A;  4M3O A;  3N71 A;  2KAT A;  5J08 A;  2XRY A;  3APD A;  2FBN A;  5AN8 A;  3PE4 A;  4K5B A;  3QC1 A;  3FTW A;  1S0P A;  1TNY A;  4U0U A;  5FZS A;  2L0T B;  5FQ4 A;  5AQB A;  4MLP A;  1JPL A;  3JCK C;  4G23 A;  4XKB A;  1D8D A;  4HI8 A;  3UI2 A;  4KT6 B;  3KEA A;  3RIB A;  5IY5 E;  5CEC B;  3HXE A;  5LOZ A;  3E32 A;  3ZYQ A;  3IHY A;  3PEV B;  3RU0 A;  2A4Z A;  4BET A;  3UXG A;  1QYM A;  4AEZ C;  3FDH A;  1S70 B;  3U66 A;  1E8Y A;  5A7D B;  3G2W A;  1MX4 A;  4G2V A;  2E2E A;  4UI9 C;  3UKU G;  3SHF A;  5BW8 C;  2QFC A;  5D0O D;  4YVO A;  3FH5 A;  3RSE G;  2HE0 A;  2DYS E;  4FA6 A;  2ILR A;  4LEU A;  2BKK B;  4A3V A;  4I6E A;  2JLB A;  3FEX A;  3S7J A;  4BES A;  3ZXP A;  4RQI A;  3UQ3 A;  2XPZ A;  1PC2 A;  5JA4 D;  4WWO A;  2VGX A;  4GTV A;  4XEI G;  5AJD A;  5BT1 A;  4GCN A;  2KC7 A;  4U8V D;  1OCO E;  3ESK A;  4XE0 A;  3TJP A;  2V4L A;  4G8L A;  4L7T A;  2EQX A;  1U2V G;  5CCL A;  2WQH A;  4F1P A;  5A23 A;  2CFU A;  3ULY A;  2YNQ A;  5EIL A;  2DYR E;  4FJY A;  3B7B A;  3SO8 A;  3L16 A;  4YDW A;  3G2T A;  4UWL A;  4GZ6 A;  4FJZ A;  5JMN D;  2AXZ A;  2ZIR A;  1QBQ A;  3KAE A;  3OXG A;  2XGS A;  2R17 C;  3RO2 A;  3S7D A;  1NZN A;  3DSV A;  4I2Z A;  1SZA A;  1JUQ A;  3WXX A;  2BUG A;  3ASF A;  4APF A;  4BT8 A;  3D9N A;  3QB2 A;  4DX5 D;  3JYS A;  4AM9 A;  3CVX A;  3VTY A;  1WAO 1;  5FIN A;  3L9T A;  4DI3 A;  2JEK A;  4XX5 A;  3FFL A;  3CHO A;  1X5B A;  1O5M A;  5AAO A;  2P9P G;  3D9L A;  1V55 E;  1Z6T A;  1NA0 A;  2WXO A;  1SVX A;  4O60 A;  2OEV A;  1JCS A;  5EX3 A;  3TWT A;  4DX6 D;  4FC8 A;  3UT4 A;  1N94 A;  4GTP A;  5FWQ A;  3FUD A;  2DZN A;  5G55 A;  5M72 A;  3MV3 B;  1BPO A;  3RO3 A;  2KM4 A;  2X6I A;  2UY1 B;  3GZ1 A;  2DWZ A;  4URK A;  4PUC A;  1Y6I A;  4FHJ A;  3L22 A;  2GGF A;  3QWP A;  4AY5 A;  1NL4 A;  5FTP A;  2AXV A;  2XZT G;  2IEJ A;  3QOU A;  4HNA D;  2R2L A;  3FU6 A;  2XEN A;  1V54 E;  4DJA A;  1P5Q A;  3ASD A;  4DI4 A;  5ENO D;  1MJ0 A;  5B1A E;  3SI5 A;  3ZW3 A;  3PNT B;  1WM5 A;  1SQM A;  2KCK A;  3CR3 A;  2I9C A;  1N0Q A;  4JEU A;  3PUK A;  4J8S A;  2GRR B;  3Q78 A;  2CG3 A;  5KNG A;  3D9I A;  3VLE A;  1UN9 A;  3ML9 A;  2NC9 A;  3IEG A;  1H0A A;  2PQN A;  4HOQ A;  2I2O A;  3ESL A;  4WNE A;  4WNF A;  3SFY A;  2PQR A;  3CKC A;  2X6K A;  1INZ A;  4FUL A;  4Y6C A;  3ENE A;  3FTX A;  3IHV A;  2WXR A;  3CKB A;  5ENR D;  4N3A A;  4B93 B;  1K8K G;  4PDX A;  2YQ8 A;  3PEU B;  1KZO A;  4TUM A;  4AJW A;  5AQ7 A;  3HXB A;  5G2N A;  3ABK E;  4N3C A;  3TWW A;  3ZRH A;  3TG4 A;  2J8S D;  2OOE A;  1TEZ A;  2BF0 X;  3O48 A;  4I9E A;  3S2A A;  4GZ5 A;  5T3R A;  2WQ7 A;  2EIJ E;  3LDZ A;  4XIF A;  3KSQ A;  5CBO A;  2P58 C;  3FTY A;  3EJN A;  1HE8 A;  3ZU7 B;  3ZNG A;  2FEZ A;  2JAB A;  4ANV A;  4WWP A;  2RG8 A;  1EPU A;  4N2Q A;  3D9K A;  5AJL A;  4WAF A;  2J07 A;  4UQX A;  1E90 A;  2A5E A;  3PE3 A;  4JHJ A;  3E33 A;  3NB2 A;  4Z68 A;  5LFA A;  3EHQ A;  3R7R A;  2KCV A;  4L1B A;  4YND A;  3KS2 A;  1EYH A;  3RRN B;  2PM7 A;  5A6C A;  5CER B;  2XGO A;  3I4G A;  2XQ0 A;  4RG9 A;  5EIB E;  2AXU A;  4MKT A;  2C2L A;  3AU5 A;  3Q79 A;  3ZXS A;  3J5Q B;  4WUY A;  5KJN A;  4XI0 A;  4LNB A;  4RSY A;  3ABM E;  1HG2 A;  4CEM A;  4N39 A;  3OAW A;  4L9P A;  4GZD A;  4CDN A;  3TG5 A;  4L2Y A;  3APC A;  3DEP A;  3OXL A;  1HH8 A;  2XHE A;  5FZQ A;  4KBQ A;  4HRN A;  4TUU A;  1KZP A;  1HF8 A;  4AVX A;  2XPY A;  2IOS A;  4GMJ A;  5T8I A;  3B7R L;  4TV3 A;  1SZ9 A;  2XCB A;  5DBK A;  3DRA A;  2X3M A;  3MYV A;  3TXM A;  3PDN A;  1ZU2 A;  1Y8M A;  2XEE A;  3QWV A;  2Y1L E;  4AP2 A;  3NF1 A;  3CGH A;  3T5V A;  1OCZ E;  2XCC A;  4G24 A;  1MHQ A;  3HYM B;  2CHX A;  1FPP A;  4FHK A;  4UI9 J;  3QKY A;  5BXU A;  2HYZ A;  3BEE A;  4QFV A;  2F8X K;  1OCR E;  2UY1 A;  4OVU A;  4YDY A;  3L08 A;  2NSZ A;  3MKR A;  5AQ9 A;  4RLY A;  1E7V A;  3GZ2 A;  4BWR A;  1H2T C;  1JCR A;  4U07 A;  4J8E A;  3U3W A;  1IYG A;  2LUH A;  4JZY A;  4U8H A;  4Y6W A;  3SFX A;  3V30 A;  1U3D A;  2AVP A;  3APF A;  1K1B A;  1UJK A;  1TN8 A;  3F6Q A;  3ML8 A;  4EHM A;  3Q5M A;  3X2Q E;  2P9K G;  2L9B A;  3RKV A;  3C3R A;  3NOC D;  2BED A;  1UN8 A;  2UWJ G;  2CHW A;  3R9M A;  4BSZ B;  3D9M A;  3B7S A;  1HX8 A;  2Y4U A;  5B1B E;  4KMO A;  2GRM A;  2VGE A;  2ETC A;  1O1R A;  2ETA A;  4GTO A;  3T9K A;  2YIN A;  3Q49 B;  3ZFW A;  4HRL A;  2KCL A;  3ONL A;  4HI9 A;  3B7U X;  1TNO A;  3UM1 A;  3TXN A;  2AWI A;  5BXO A;  4F6R D;  2WMO A;  1B89 A;  4HXI A;  1VDY A;  4UWG A;  3CLJ A;  2IOL A;  3MJW A;  4GTQ A;  4JD2 G;  3UT8 A;  1FVF A;  3Q4A B;  1ELW A;  3FTS A;  1N95 A;  2QYU A;  4ME2 A;  3FWV A;  3PZD A;  2DBA A;  4YVQ C;  1DVP A;  5KJK A;  2R03 A;  3HVE A;  3LVQ E;  4GB9 A;  3SBS A;  2H6F A;  1E8X A;  4KZ0 A;  4A1G A;  3V31 A;  5DIZ A;  2QC9 A;  2ETB A;  2WB2 A;  4R7L A;  4HOT A;  3P1U A;  3FP3 A;  5FIO A;  1S64 A;  1UJJ A;  2HO1 A;  2C0M A;  4I6G A;  3LY9 A;  3O4Z A;  2AW6 A;  4L23 A;  5AAR A;  3URZ A;  4GYO A;  4DLO A;  2J08 A;  2EIN E;  4BSX A;  3D9H A;  3FUK A;  4HOS A;  2WXK A;  4BEP A;  1IHB A;  2XGM A;  3HVE B;  5ENS D;  3EUV A;  1OWN A;  4FAD A;  4A3T A;  4NQ0 A;  2P9S G;  5CHE E;  4EQF A;  3RK6 A;  5HRY A;  3LPZ A;  4ILI A;  3T5X A;  1DNP A;  4GYY A;  5HKP A;  4W9R A;  2XPI A;  4JB8 P;  2P9N G;  3JXJ A;  3FTU A;  4FP7 A;  3PUJ A;  2BTD A;  4ABN A;  5BUZ A;  4U8Y D;  3Q75 A;  1XGW A;  2GRL A;  1HO8 A;  4TXR A;  2Y69 E;  3PH0 C;  5CED B;  2LXL A;  1UOH A;  4NAC A;  4UWH A;  3HHM A;  2V5F A;  5ARG A;  4I9C A;  5C2Y A;  4KVO A;  2XS1 A;  3JXI A;  3DSS A;  3BQO A;  2X6J A;  1D8E A;  2WM9 A;  4HBD A;  4Q96 A;  3DXK G;  2M63 A;  4F1S A;  3EIJ A;  4CT0 A;  3P2B A;  5AEN A;  4KVM A;  4FLB A;  4UQY A;  1IQU A;  4CYM D;  1EDU A;  1JWF A;  3T8K A;  2IF4 A;  4PH4 B;  5ARF A;  4EBA A;  3DSU A;  4OVV A;  3SY2 A;  3QJZ A;  3CHR A;  1N4P A;  1FT1 A;  5H7P A;  3FTV A;  3L13 A;  1FCH A;  2QYJ A;  5CMW A;  4F7A A;  1E8W A;  5ITZ F;  1LF8 A;  4ACK A;  2J09 A;  4GYW A;  2I6H A;  4F3V A;  1RZ4 A;  4GZ3 A;  3FUE A;  4F53 A;  4I43 A;  3AG1 E;  3SF4 A;  3FUN A;  2WXH A;  1N11 A;  5JHA A;  5KWD A;  4QQI A;  5G04 J;  3U64 A;  4GPM A;  4U0S A;  5FZR A;  3CVW A;  2WXL A;  2VSN A;  4BY6 A;  2X38 A;  4GA2 A;  5CRV A;  3TGO A;  4IUL A;  2XZD G;  4TXP A;  1TJF A;  3PVL A;  3DSX A;  1DCQ A;  4OAU C;  1NP7 A;  4DUI A;  5FJY A;  2IFU A;  2E0I A;  3UM3 A;  2KBX A;  2HR2 A;  2Y4T A;  5BV0 A;  2I1K A;  4LRZ A;  3TAX A;  3HDX A;  3EHN A;  1OCC E;  3PZ2 A;  1ELK A;  3NOG D;  4APO A;  4ATZ D;  2R02 A;  4WND A;  4GMR A;  1MZC A;  3U9W A;  2L0I A;  3ZUV B;  3UKR G;  2IJG X;  3UIP C;  3FUI A;  2OCC E;  2OVB A;  2PNN A;  3MCX A;  4E85 A;  4AY6 A;  1N4S A;  1U3C A;  4JHK A;  3VTX A;  2H6H A;  4DRX E;  4DK5 A;  3AG4 E;  5J90 A;  1NA3 A;  4JVS A;  3T8M A;  2WXM A;  4AV7 A;  3IV0 A;  2EIK E;  3FUH A;  4J8F A;  3DSW A;  3LKU A;  2KZT B;  3GW4 A;  4XI9 A;  2GW1 A;  3Q47 B;  2MHK A;  1LD8 A;  4I2W A;  3FUM A;  4HRM B;  4BTA A;  2QZA A;  3NAW A;  2EIL E;  3FUL A;  3FH8 A;  2IU1 A;  2ZIS A;  3VLF A;  3ZYK A;  1H6K A;  3LY7 A;  2CG2 A;  4ZFH A;  3EU9 A;  1HZ4 A;  5EDS A;  3CVY A;  3SD5 A;  3NQP A;  4EZK A;  3FY4 A;  1K3Z D;  2EIM E;  3Q7F A;  5FT9 A;  4N5Q A;  3UMV A;  3UM2 A;  1O1S A;  3DBS A;  4CGV A;  3ASO E;  5CEA A;  3EDT B;  3ASG A;  4GPK A;  1OWM A;  2X6H A;  4MRU A;  3SBT B;  3L82 A;  2VSX E;  2VGY A;  3AS8 A;  3CHM A;  3MV2 B;  3FHE A;  2RKK A;  4OYS A;  4ZHB A;  1AWC B;  3CVQ A;  3Q7A A;  4G26 A;  5AYW D;  3DEO A;  4GTT A;  4DPR A;  3FUJ A;  2ZU6 B;  3FEY A;  4K0R A;  5EX0 A;  3MA5 A;  4CRW A;  3CHP A;  5BV1 A;  4JHR A;  1HG5 A;  3I5P A;  5BNW A;  1MX2 A;  1Z5S C;  2WMN A;  2P9I G;  5KBA A;  4CCA A;  4BTB A;  2IQC A;  3ISM C;  2WXI A;  1DC2 A;  5KNH D;  2I1J A;  4N3B A;  3HIZ A;  4ILH B;  4ANX A;  4EZJ A;  3RRU A;  1JWG A;  2VJ8 A;  1SA4 A;  4NUR A;  3FU0 A;  3NBN B;  2WPV A;  4U95 D;  3ZIM A;  4H7X A;  3DPY A;  4J8Y A;  3RJV A;  2AJA A;  1KLX A;  1N54 A;  1MX6 A;  3HRA A;  2YHC A;  1IKN D;  1PY1 A;  4L2L A;  2V8S E;  4ILG A;  3ZYM A;  2LSV A;  3IXE A;  1BLX B;  1IXV A;  4K5C A;  4XKC A;  2GRO B;  2J4B A;  3CSF A;  5EYL A;  4UQZ A;  4RG6 A;  2FO1 E;  1OWL A;  2R5S A;  1YA0 A;  4RVB A;  1YMP A;  3V79 K;  1N4R A;  1E7U A;  4PS3 A;  4CZ2 D;  2VQ2 A;  2IO3 C;  2F8Y A;  3CVN A;  2F37 A;  1IQR A;  1FT2 A;  3CHS A;  5LCW C;  4HS2 A;  3CV0 A;  2PZI A;  4IRU A;  4LUN U;  2A5U A;  2LAI A;  5CMY A;  4CGW A;  1D9S A;  3ASN E;  4E6H A;  2NXP A;  4FLH A;  1ZBP A;  4EEC A;  1TN6 A;  2FUL A;  4HQD A;  2FO7 A;  4TXQ A;  5D66 A;  4AXH A;  5D2M C;  1WY6 A;  3LVR E;  4HLL A;  1BI7 B;  4HOR A;  1QNF A;  3CIA A;  3E37 A;  4H7Y A;  4EBA G;  4JW1 A;  2WXN A;  4J0U A;  4JEH A;  3EIQ C;  3BUA A;  3J5P A;  4ACL A;  3Q9U C;  4KZC A;  4UI9 K;  3Q73 A;  2V0P A;  4C0E A;  1TNZ A;  2P2C P;  5JJT A;  4G8K A;  3LS8 A;  2VGX B;  2OVF A;  2PM6 A;  3TWQ A;  5CBN A;  3NZS A;  5EID A;  3EU5 A;  5FQ7 A;  3G2V A;  4G1T A;  4AIF A;  1XNF A;  4G11 A;  4KXK B;  3B13 A;  2VSO E;  4A63 B;  2F0Y A;  3ULE G;  3IBE A;  1A5E A;  3L54 A;  3EHM A;  2J49 A;  1Z3X A;  3ABL E;  3C98 A;  2V5Q C;  4DX2 A;  1N0R A;  4LCT A;  4K5A B;  2DCP A;  4GCO A;  3LYA A;  4I1O B;  3C3O A;  5HQ8 A;  1HFA A;  2LXM A;  4JXT A;  3JUI A;  4JL0 A;  5G05 C;  3IKO B;  4HFG A;  3D9P A;  2MYO A;  4U63 A;  3DST A;  3C5R A;  3PZ1 A;  2VSY A;  3FH7 A;  5CRU A;  3AAA C;  4GA1 A;  3TWS A;  3QDN A;  3FU3 A;  2P9U G;  3MKQ B;  1AP7 A;  4GTM A;  5LCW J;  1RW2 A;  3CQG B;  4FU3 A;  3C3Q A;  2CFZ A;  2L6B A;  4C0M A;  2CHZ A;  4IYP A;  1TR4 A;  5ENQ D; 
#chains in the Genus database with same CATH homology
 2WXL A;  4JA9 A;  4Q94 A;  4N2Q A;  2VSN A;  4BY6 A;  3CK7 A;  2X38 A;  2ZGG A;  1OT8 A;  1YYH A;  3D9K A;  3AS5 A;  5AJL A;  4WAF A;  3LXU X;  4J8D A;  3SFZ A;  4GA2 A;  3TGO A;  3UTM A;  2J07 A;  4IUL A;  4UQX A;  1E90 A;  1W3B A;  2XZD G;  2A5E A;  3PE3 A;  4JHJ A;  3ASH A;  1TJF A;  3FU5 A;  3PVL A;  4Z68 A;  1TJC A;  5CCM A;  5KCM A;  1DCQ A;  3ZHE B;  5LFA A;  3EHQ A;  3RRM B;  4OAU C;  2Y0B G;  4B8C B;  1NP7 A;  3L17 A;  4BFR A;  3TWX A;  4O1O A;  3ZKJ A;  4GML A;  3R7R A;  4DUI A;  2KCV A;  3MX3 A;  4L1B A;  1HXI A;  2IFU A;  3KS2 A;  4YND A;  5FJY A;  2E0I A;  4GZC A;  2VTB B;  3CVP A;  1EYH A;  2KBX A;  2HR2 A;  2Y4T A;  3PRE A;  2PM7 A;  3KEZ A;  5G05 J;  2I1K A;  3RRN B;  5BV0 A;  5A6C A;  3PS6 A;  1HU3 A;  4LRZ A;  3TAX A;  3HDX A;  3EHN A;  4DK5 A;  5CER B;  2XGO A;  3I4G A;  1IHG A;  1ELK A;  2XQ0 A;  3NOG D;  4RG9 A;  5EIB E;  2RFA A;  2AXU A;  4MKT A;  2C2L A;  2XEV A;  4ATZ D;  1N52 A;  3AU5 A;  3D9O A;  4APO A;  4WND A;  4GMR A;  3AJI A;  4BT9 A;  3ZUV B;  2L0I A;  3U9W A;  2KZT A;  2IJG X;  3ZXS A;  3J5Q B;  4NIK A;  3TWV A;  2J4D A;  3QAQ A;  4ANW A;  3AS4 A;  4WUY A;  5KJN A;  3FUI A;  1UG3 A;  4KYO B;  5KJM A;  3L6A A;  2WQ6 A;  2PNN A;  2LAH A;  2OVB A;  3R7Q A;  2J9Q A;  3SGH A;  4LER A;  4XI0 A;  5KJL A;  4OAV B;  3MCX A;  3OXF A;  4E85 A;  1NFI E;  3Q9N C;  4G25 A;  4I17 A;  4I1M A;  4RSY A;  4AY6 A;  1HG2 A;  1U3C A;  2WVI A;  4CEM A;  4M3O A;  3N71 A;  2KAT A;  4JHK A;  4N39 A;  2ZGD A;  3OAW A;  3VTX A;  5ENP D;  5J08 A;  4WWN A;  4DRX E;  4GZD A;  4CDN A;  3TG5 A;  4HB5 A;  2XRY A;  3APD A;  2FBN A;  4L2Y A;  5AN8 A;  3APC A;  3DEP A;  3PE4 A;  3OXL A;  1HH8 A;  1NA3 A;  4K5B A;  2XHE A;  4JVS A;  5FZQ A;  5J90 A;  4KBQ A;  3T8M A;  4JC8 A;  4PS7 A;  4HRN A;  3FTW A;  3QC1 A;  1KT0 A;  4N5C A;  1S0P A;  4TUU A;  2X6F A;  2WXM A;  4U0U A;  4AV7 A;  4BX9 A;  3IV0 A;  2BKG A;  1HF8 A;  2MOW A;  3FUH A;  4J8F A;  5FZS A;  2L0T B;  5FQ4 A;  4AVX A;  1OWO A;  2XPY A;  3LKU A;  5AQB A;  2KZT B;  3GW4 A;  2IOS A;  4GMJ A;  5T8I A;  3B7R L;  4MLP A;  2WXQ A;  3ZHE A;  4XI9 A;  2GW1 A;  3W9F A;  3Q47 B;  4TV3 A;  4J7W A;  1GW6 A;  2MHK A;  4I2W A;  3FUM A;  1SZ9 A;  3CVL A;  1JPL A;  2XCB A;  5DBK A;  4HRM B;  3JCK C;  4G23 A;  4XKB A;  4BTA A;  4CDM A;  3FUL A;  4HI8 A;  3UI2 A;  2IU1 A;  3FH8 A;  3VLF A;  2X3M A;  3MYV A;  4KT6 B;  3ZYK A;  2WXJ A;  1H6K A;  3KEA A;  4JPS A;  3TXM A;  3LY7 A;  2CG2 A;  3RIB A;  4ZFH A;  5CEC B;  3MGB A;  5FQ6 A;  3PDN A;  1ZU2 A;  3EU9 A;  1HZ4 A;  5EDS A;  1Y8M A;  2XEE A;  3QWV A;  3CVY A;  2Y1L E;  4AP2 A;  3SD5 A;  3NF1 A;  3CGH A;  4EPZ A;  5LOZ A;  3ZYQ A;  3T5V A;  3IHY A;  1L5J A;  3NQP A;  3PEV B;  2XCC A;  2A4Z A;  3QNK A;  4BET A;  3FY4 A;  4G24 A;  1K3Z D;  3RU0 A;  3ZEF A;  3UXG A;  4EZK A;  1MHQ A;  1QYM A;  3W9G A;  3FDH A;  4AEZ C;  5FT9 A;  1S70 B;  4N5Q A;  3HYM B;  2CHX A;  3U66 A;  1BD8 A;  1E8Y A;  5A7D B;  3UMV A;  2KXP C;  3G2W A;  1MX4 A;  1WDY A;  4G2V A;  4FHK A;  4UI9 J;  2E2E A;  4UI9 C;  4B0Z A;  3QKY A;  5BXU A;  2HYZ A;  3DBS A;  3LY8 A;  4CGV A;  5CEA A;  3BEE A;  3EDT B;  4QFV A;  3ASG A;  3SHF A;  4GPK A;  2R59 A;  5BW8 C;  3GZS A;  2F8X K;  3BG0 B;  1Z3Y A;  1OWM A;  3TWU A;  2QFC A;  2UY1 A;  2X6H A;  3FH5 A;  3NZU A;  5D0O D;  4MRU A;  4YVO A;  2HE0 A;  4O1P A;  4GAA A;  4YDY A;  4OVU A;  3L08 A;  4TRQ A;  3SBT B;  2NSZ A;  3MKR A;  5AQ9 A;  4FA6 A;  2ILR A;  4RLY A;  4LEU A;  1E7V A;  2BKK B;  3GZ2 A;  2VSX E;  4A3V A;  4I6E A;  4BWR A;  4BX8 A;  2VGY A;  2JLB A;  4UWK A;  3AS8 A;  3CHM A;  2YHE A;  1H2T C;  4J6I A;  3MV2 B;  4BES A;  3FEX A;  3S7J A;  3E4B A;  4U07 A;  3FHE A;  5D0Q D;  4OYS A;  4ZHB A;  4LSZ E;  4J8E A;  1AWC B;  3UQ3 A;  2XPZ A;  1A17 A;  3U3W A;  3CVQ A;  1PC2 A;  3PNL B;  4BER A;  5JA4 D;  4G26 A;  4B94 A;  4JZY A;  5AYW D;  4U8H A;  3DEO A;  4WWO A;  4DPR A;  2VGX A;  3CK9 A;  2RFM A;  4Y6W A;  3V30 A;  3FUJ A;  1U3D A;  3I4R B;  2AVP A;  2ZU6 B;  3D9J A;  3FEY A;  3QAR A;  4K0R A;  3APF A;  5AJD A;  5ANR A;  5EX0 A;  3MA5 A;  1K1B A;  3U4T A;  1UJK A;  5BT1 A;  4CRW A;  5E75 A;  2OV8 A;  3CHP A;  3F6Q A;  4GCN A;  3ML8 A;  5BV1 A;  1ELR A;  3Q5M A;  4JHR A;  2KC7 A;  4U8V D;  4Q69 A;  1PAQ A;  2DIW A;  3CEQ A;  1HG5 A;  3ESK A;  3I5P A;  1EF1 C;  2L9B A;  3RKV A;  2DZO A;  4XE0 A;  3ZN3 A;  3NOC D;  2V4L A;  3TJP A;  5BNW A;  1MX2 A;  2WMN A;  4G8L A;  4L7T A;  1UN8 A;  5KBA A;  2UWJ G;  2EQX A;  3MZL B;  4CCA A;  1H2V C;  2CHW A;  2WQH A;  1K1A A;  4F1P A;  4BSZ B;  2CFU A;  3D9M A;  5A23 A;  4DX1 A;  5CCL A;  2YNQ A;  5EIL A;  3B7S A;  4BTB A;  1HX8 A;  2IQC A;  2Y4U A;  4FJY A;  2RD0 A;  4KMO A;  3B7B A;  3SO8 A;  3JQ1 A;  3L16 A;  2WXI A;  1DC2 A;  2GRM A;  5KNH D;  3CQC B;  1FVH A;  2VGE A;  4HOU A;  4YDW A;  2ETC A;  2ETA A;  2I1J A;  4N3B A;  3T9K A;  3HIZ A;  2YIN A;  4ILH B;  3G2T A;  3Q49 B;  4ANX A;  4UWL A;  4EZJ A;  3ZFW A;  4HRL A;  4GZ6 A;  1BI8 B;  3RRU A;  1IYG A;  2KCL A;  3ONL A;  3UPV A;  5LX8 A;  4HI9 A;  1JWG A;  2VJ8 A;  4FJZ A;  4NUR A;  3FU0 A;  5JMN D;  2AXZ A;  1E8Z A;  3B7U X;  3NBN B;  5EKQ D;  4U95 D;  2WPV A;  3ZIM A;  3TXN A;  2AWI A;  4H7X A;  5BXO A;  4J8Y A;  4F6R D;  3KD7 A;  4GA0 A;  3KAE A;  4U04 A;  2WMO A;  1B89 A;  4DLQ A;  4HXI A;  3OXG A;  3RJV A;  2XGS A;  1VDY A;  2R17 C;  3RO2 A;  3LEW A;  4UWG A;  3ZPJ A;  3S7D A;  1NZN A;  2V4H C;  2AJA A;  3CLJ A;  4JA7 A;  1YCS B;  4I2Z A;  2IOL A;  3MJW A;  1KLX A;  1N54 A;  1SZA A;  1JUQ A;  4B89 A;  1MX6 A;  2QY7 A;  3WXX A;  3HRA A;  2YHC A;  1IKN D;  1OWP A;  1PY1 A;  2BUG A;  2V8S E;  3ASF A;  3LCA A;  4ILG A;  4L2L A;  5BPP A;  3ZYM A;  3OTN A;  3UT8 A;  5LP0 A;  1FVF A;  3Q4A B;  1ELW A;  4APF A;  4BT8 A;  3FTS A;  3D9N A;  2LSV A;  3IXE A;  1MYO A;  4ME2 A;  3K9I A;  3FWV A;  1BLX B;  3PZD A;  1IXV A;  3QB2 A;  2DBA A;  4YVQ C;  5AQA A;  4K5C A;  4C9B B;  4DX5 D;  4XKC A;  1DVP A;  3JYS A;  2J4B A;  4AM9 A;  4P29 A;  5KJK A;  3CSF A;  5ANL A;  3CVX A;  5EYL A;  1WAO 1;  3VTY A;  3HVE A;  5FIN A;  3LVQ E;  5C1D A;  4UQZ A;  2XRZ A;  4DI3 A;  4RG6 A;  4GB9 A;  2JEK A;  4XX5 A;  3SBS A;  2FO1 E;  1OWL A;  3CHO A;  1QQE A;  1X5B A;  2R5S A;  3FFL A;  1YA0 A;  1E8X A;  4KZ0 A;  4RVB A;  1YMP A;  3V79 K;  4N2S A;  1WG0 A;  4PS3 A;  1E7U A;  4A1G A;  4CZ2 D;  5AAO A;  3V31 A;  3ZVV A;  3D9L A;  3TWR A;  4NRH B;  3ZGQ A;  1Z6T A;  1NA0 A;  5DIZ A;  2VQ2 A;  4GU5 A;  2QC9 A;  2ETB A;  2WB2 A;  2F8Y A;  2WXO A;  3CK8 A;  4R7L A;  4HOT A;  3CVN A;  5G04 C;  1SVX A;  2Y3A A;  2F37 A;  5FIO A;  3FP3 A;  3P1U A;  1IQR A;  4I6J A;  1E96 B;  1UJJ A;  3CVV A;  4D10 C;  4O60 A;  2HO1 A;  2C0M A;  3CHS A;  4I6G A;  2ION A;  4HS2 A;  5LCW C;  3LY9 A;  3TWT A;  5EX3 A;  5FQ8 A;  3CV0 A;  3I3N A;  3O4Z A;  4DX6 D;  2PZI A;  4IRU A;  1UW4 B;  2AW6 A;  4LUN U;  5ENT D;  3DPD A;  2A5U A;  2LAI A;  5AAR A;  4L23 A;  4FC8 A;  5CMY A;  1D9S A;  3URZ A;  3UT4 A;  4CGW A;  4MS6 A;  4GYO A;  4DLO A;  4E6H A;  2J08 A;  5FWQ A;  2NXP A;  4PS8 A;  3CHQ A;  4BSX A;  3FUD A;  4FLH A;  2DZN A;  1G3N B;  3D9H A;  1ZBP A;  4EEC A;  5G55 A;  5HI7 A;  3FUK A;  5M72 A;  4HOS A;  1QZ2 A;  4HQD A;  2FUL A;  4WNG A;  2WXK A;  4BEP A;  3MV3 B;  2FO7 A;  1BPO A;  1IHB A;  2XGM A;  3RO3 A;  3HVE B;  3G2U A;  2KM4 A;  2X6I A;  3LJN A;  2UY1 B;  3GZ1 A;  3CVU A;  2DWZ A;  5D66 A;  5ENS D;  1OWN A;  4URK A;  4PUC A;  4FAD A;  4AXH A;  1MQS A;  4A3T A;  3ONK A;  1Y6I A;  4FHJ A;  4NQ0 A;  4UUC A;  1WY6 A;  5CHE E;  3L22 A;  4EQF A;  3RK6 A;  2GGF A;  5HRY A;  3LVR E;  3QWP A;  3LPZ A;  4ILI A;  4HLL A;  1BI7 B;  3LJ3 A;  4AY5 A;  1QNF A;  3HG0 D;  3T5X A;  5JJ7 A;  4HOR A;  3CIA A;  1DNP A;  5FTP A;  2AXV A;  5HKP A;  2XZT G;  4H7Y A;  4GYY A;  4W9R A;  4HNA D;  3QOU A;  2XPI A;  4I1A A;  3FU6 A;  4EBA G;  2XEN A;  4JW1 A;  1H2U A;  2WXN A;  4JB8 P;  1P5Q A;  3QK0 A;  3JXJ A;  4DJA A;  3ASD A;  3CVW A;  4J0U A;  4DI4 A;  5EYP F;  4JEH A;  3FTU A;  5ENO D;  1MJ0 A;  4FP7 A;  3EIQ C;  2DVW A;  3PUJ A;  2BTD A;  3J5P A;  4ACL A;  3Q9U C;  3BG1 B;  4KZC A;  3SI5 A;  4U8Y D;  3VLD A;  4ABN A;  4ATG A;  5BUZ A;  3ZW3 A;  4UI9 K;  1XGW A;  2GRL A;  1HO8 A;  2LNI A;  2V0P A;  1WM5 A;  3PNT B;  3UT7 A;  4C0E A;  2P2C P;  3MEK A;  5CED B;  3PH0 C;  1SQM A;  4G8K A;  3JUE A;  1H19 A;  2KCK A;  5JJT A;  3CR3 A;  3LS8 A;  3EHR A;  2VGX B;  3R9A B;  1UOH A;  2OVF A;  2I9C A;  4NAC A;  2PM6 A;  4UWH A;  1N0Q A;  3HHM A;  2V5F A;  3PUK A;  4J8S A;  4JEU A;  3TWQ A;  5CBN A;  1HS6 A;  2WXP A;  3GYZ A;  3NZS A;  4I9C A;  5EID A;  5ENN A;  5ARG A;  3UX4 A;  5FQ7 A;  2PL2 A;  2CG3 A;  5C2Y A;  5KNG A;  4KVO A;  3JXI A;  4UWF A;  3CST A;  4LNU D;  2MRI A;  2X6J A;  1KT1 A;  2WM9 A;  3PRZ A;  3G2V A;  4LG6 A;  4A1S A;  4HBD A;  4Q96 A;  4EZL A;  3D9I A;  4G1T A;  3VLE A;  1UN9 A;  4AIF A;  3QWW A;  1XNF A;  2M63 A;  4G11 A;  5EN5 D;  4KXK B;  4F1S A;  5JJ6 A;  3ML9 A;  5T4Y A;  3B13 A;  3EIJ A;  4CT0 A;  4CDR A;  3P2B A;  5AEN A;  4A63 B;  2VSO E;  2VYI A;  1BU9 A;  4KVM A;  4FLB A;  2L6J A;  2WXG A;  4UQY A;  2NC9 A;  3IEG A;  3IBE A;  1A5E A;  2OND A;  3V2X A;  1IQU A;  1H0A A;  2PQN A;  3EHM A;  3L54 A;  4CYM D;  4HOQ A;  1EDU A;  2J49 A;  1Z3X A;  2I2O A;  3C98 A;  2V5Q C;  3ESL A;  1JWF A;  2XEH A;  4WNE A;  4WNF A;  2B0O E;  4DX2 A;  3T8K A;  2PQR A;  1N0R A;  3CKC A;  4U0Z A;  2IF4 A;  4LCT A;  4PH4 B;  2X6K A;  5ARF A;  4CT4 A;  4EBA A;  4K5A B;  1INZ A;  4OVV A;  3UUX A;  3MKQ A;  4FUL A;  4Y6C A;  2DCP A;  4GCO A;  3SZ7 A;  3LYA A;  3QJZ A;  3ENE A;  4A55 A;  3FTX A;  3IHV A;  4AOF A;  2WXR A;  3CHR A;  4B8A A;  3CKB A;  4I1O B;  2Q7F A;  5HQ8 A;  5ENR D;  3D3M A;  4N3A A;  4B93 B;  3FTV A;  3L13 A;  2LSU A;  1FCH A;  1HFA A;  4JXT A;  1OUV A;  3JUI A;  2QYJ A;  4JL0 A;  5G05 C;  5CMW A;  5JHB A;  4F7A A;  4PDX A;  2C0L A;  3IKO B;  1E8W A;  2YQ8 A;  3PEU B;  3S7F A;  5ITZ F;  4HFG A;  5E76 A;  2HM8 A;  1LF8 A;  3V2O A;  3B95 A;  2MYO A;  4TUM A;  3D9P A;  4ACK A;  4U63 A;  4HVB A;  3C5R A;  5AQ7 A;  4C48 B;  4V3I A;  4AJW A;  3ZYL A;  2J09 A;  5G2N A;  4N3C A;  3TWW A;  2VSY A;  4GYW A;  2I6H A;  3ZRH A;  3TG4 A;  4F3V A;  3FH7 A;  4IN3 B;  2J8S D;  2OOE A;  4GZ3 A;  3AAA C;  2BF0 X;  4GA1 A;  1TEZ A;  2FF4 A;  3FUE A;  3SNX A;  3O48 A;  4I9E A;  3TWS A;  3S2A A;  3QDN A;  3FU3 A;  1OY3 D;  3G2S A;  4F53 A;  4ANU A;  4GZ5 A;  4I43 A;  3TL5 A;  5T3R A;  2WQ7 A;  3AU4 A;  4HLE A;  3Q15 A;  3SF4 A;  3FUF A;  3LDZ A;  3FUN A;  3MKQ B;  2FI7 A;  3S7B A;  4U96 D;  1AP7 A;  2WXH A;  3CQG B;  4FU3 A;  4XIF A;  5AIJ A;  5LCW J;  5CBO A;  2P58 C;  2CFZ A;  3FTY A;  1SW6 A;  3FTZ A;  2L6B A;  1N11 A;  5KWD A;  3EJN A;  5JHA A;  4QQI A;  3B7T A;  3ZU7 B;  1HE8 A;  2WXF A;  4XZ4 A;  3ZNG A;  5G04 J;  2LO6 A;  2NYJ A;  2FEZ A;  4K03 A;  4C0M A;  2JAB A;  2VTB A;  3U64 A;  3ULQ A;  4GPM A;  2CHZ A;  4U0S A;  4DX7 D;  5HS0 A;  5FZR A;  4O6F A;  4ANV A;  4IYP A;  3JQ0 A;  4WWP A;  2RG8 A;  1EPU A;  1TR4 A;  5ENQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...