4QG7A

S.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
197
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 197
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qg7A00
3FMFA 2QORA 3JVUA 3RDPA 4Q1EA 1GM5A 5CLLA 2CVFA 2IXFA 3L0IB 1VCNA 5K8IA 3DKPA 2ZSEA 3QEJA 1C1YA 1R5BA 1NP6A 2PX3A 2QAJA 4MRPA 1CJVC 5LB4A 3B5JA 4BFTA 4GRAA 4G0NA 4O2LA 1OXVA 5BQ5A 1CJUC 2LWIA 1U9IA 4F4JA 4HUQA 1VHLA 3AH8A 4OQFA 4DLRA 3FOZA 1W49A 2F43B 3T1OA 2BMDA 3EC2A 3NBXX 1Z06A 1XZQA 4GDFA 4RZ2A 2VF7A 1IJEA 3KFXA 3CRRA 5GADl 1AM4D 3OAAD 1RYHA 3BD9A 4EIWA 1RC8A 1YZTA 4M2LA 5D3MB 2XAUA 5LB2A 4DIDA 3X1DA 4EKDA 4CEIA 2BBOA 3PUWA 3UMRA 1YE8A 3X1ZA 5JI2E 5DLQC 1Z2CA 2YNMA 1OIWA 1E0KA 4A0GA 4W5HA 3AVOA 4UXHA 3HPQA 4V0OA 3B60A 3GLHB 2PCJA 4JLKA 2QRNA 2PMKA 4QC2A 4CT4B 4K81B 1ZIPA 3OAAA 4YMTA 3TBKA 2RGXA 3M6AA 3AUYA 2H7VA 4JT2A 2ECKA 4LDJA 1HT2E 5AUPB 2GXSA 3GEHA 4LCBA 1HTWA 1KI7A 4YMSA 1JECA 3VX3A 3W90A 5CB8A 2GBLC 3LH5A 2REBA 1U8YA 1KZGB 3EIEA 1WA5A 2QPTA 3IKJA 1XMIA 1I4DD 4PZZA 3NVAA 2V6JA 1XTRA 2G77B 3IIKA 1Z0JA 2RGBA 4TLCA 1GZSA 4GZLA 4M4SA 2ONJA 4B76A 1ZIOA 4NBSA 5FUVA 1TUEA 4OYHA 3T06B 2X2FA 2HEIA 4PC1A 3KFVA 3EG5A 2QRZA 1X1RA 4QGFA 2W2XA 1Z6XA 4QOSA 1JR6A 2W6ID 1G9XA 4ILEA 3VKHA 3SNHA 5JHGB 1Z22A 1UF9A 3AVQA 2QMOA 3EX7C 2ZRIA 3EA0A 3QKRB 1PVOA 3IPXA 1G3UA 4C0KA 2X1VA 5FBRB 3LXXA 2JA1A 1ZCBA 3BJIC 3PR1A 1OH7A 2O52A 2VA8A 1CJTC 3MWYW 4RD6A 4TYYA 1FQKA 2FPMA 5C2JB 2W6IA 1NN1A 2CE2X 4KSBA 2WSSD 4DT1A 1Q1EA 3KJIA 3DL0A 2ZJ8A 4OK6A 3NHBA 4JLPA 2IHYA 3PJRA 1A7JA 3LXRA 1CR0A 3SN6A 4I1SA 2IHBA 3P1JA 3U3OA 1KI9A 1E2IA 3Q7PA 4GZMA 3OIVA 1DADA 3V4RA 4ZKEA 3DDCA 1IY2A 1AIPA 1ZUNB 2OSBA 3UG6A 1UEJA 1AS0A 2MMCA 5DN6D 2WSSA 2VEDA 1D9ZA 3AGQA 3DVLA 4GPTA 2WAYA 1U0HC 4MKIA 1T8TA 3Q9LA 3K70C 2P5TB 1S1CA 1C9KA 1ZP6A 2WBLC 1KI6A 2GRJA 4RJLA 2P0EA 5DIFA 4E03A 3DMDA 5A4JA 1L4UA 4M9SA 3PCRB 5P21A 4ZDWA 1E4VA 2VBCA 5DN6A 2PLRA 4AD8A 4LV6A 3MRSA 5DHFA 5JS7A 3FHCB 1VCOA 3NBFA 1YZQA 5TXGA 2FPLA 3WRXC 2REOA 3B1XA 3BE4A 1PUIA 5KNCA 1N6NA 2H17A 2A78A 1S96A 3HR8A 4TMXA 1DAFA 2GCOA 4MUAA 1GG2A 3F5FA 1UPTA 4P33A 1VMAA 2IYSA 4BFWA 5LDDC 5H1YA 1ZM7A 4A9AA 4HAZA 1KK1A 4HATA 3LWNA 2ODEA 4OI1A 2ORIA 4Z1MD 2BV3A 4NU0A 5GJWC 2WOJA 5FFMA 1IBRA 5L3VA 1IXZA 4DUGD 1F60A 1EFHA 4O25A 4LJ6A 2D62A 1ZMXA 4JKIA 2DCUA 1QVAA 4ARZA 3DOFA 3CWQA 3I92A 4HLDA 4LGMA 2ZITA 5JWOA 3AF3A 1E2NA 3KB1A 5EP3A 3OEED 3VR3A 2V1XA 4AKIA 3NDBB 1E9BA 2ZRDA 4PC6A 4Z1MA 2GBLA 4MGKR 3ADBA 2ZETA 3PENA 4DUGA 1XXHE 4IDQA 4B6FA 2ZI3A 5G3YA 4DXAA 2IC5A 2H8KA 1RIFA 1PLKA 1P9NA 1Y3AA 2WOOA 3CPHA 3EIQA 3H86A 1TNDA 1W48A 4TTPA 2F1HA 3OEEA 1IN4A 4LJ9A 1MRSA 5DH9A 4OL0A 3EPHA 2D74A 3ONWA 4LJ8A 3ZVLA 4R7ZA 3ZZTA 1TF2A 2X2EA 2XNSA 3OIUA 4WAUA 2GK7A 3A6PC 3Q8XB 4BWYA 1QHHB 2XJ4A 3OIWA 3CNNA 3FKSD 4Q9IA 3RAPR 5FTKA 3CIOA 1OIVA 1Z0DA 4PHGA 4ZV4A 3ND8A 3OESA 4NTZA 3W8RA 4XSHA 3PITA 1QBKC 3MWKA 4NHOA 1HA3A 4HYYA 1VCMA 1ZU4A 3S1AA 5EE5B 5B2ZA 4M21A 2FN4A 3ZQJA 2RGNC 3FKSA 1KK3A 3K70D 3TVTA 2R6FA 4ABYA 4QJ5A 3SYNA 1XFAA 1S3SA 4EJSC 1GRQA 4MA4A 5KHOC 3HR7A 1IONA 5EP1A 2ASEA 1COWD 2GZHA 2HLDD 3KTAB 1TTTA 4EFNA 1YRAA 3N2EA 4DCUA 3BK7A 4RZUA 1Q20A 3P26A 1T6NA 1CKEA 3I3SR 4KBGA 1XDBA 2BMEA 4XWAA 5JZVA 1P9WA 2ZYTX 1YZLA 4WOPA 5JWRA 4AI6A 5HKKD 5IDVA 1Q0UA 5EQTA 5DISB 1KHTA 2DYKA 1S2MA 3CR8A 3KJHA 1TF7A 3AEZA 1G17A 1LS1A 1G8HA 1COWA 2BJWA 2VL7A 2HLDA 3BFXA 5TVKA 3ZD7A 3UANA 1D6JA 2BMJA 5KDOA 1RRFA 5AJWA 3I4LA 3VR6A 4JLBA 4YC7A 1H8HD 4L9SA 1KMQA 2ZJBA 1P2SA 3EPKA 2BVNA 1M6NA 4IOLA 1P4SA 5HZHA 3THYB 5HKKA 1ONBA 2YWFA 2YOGA 3V00A 1W2HA 4OI4A 1E9EA 1UDXA 1GDDA 4P0TA 1KY3A 2DFLA 4M53A 2VP4A 1MO5A 3KUDA 5KDDA 4IJMA 3SJBA 1H8HA 4A8JB 4C0HA 4CVNA 5F2EA 4S35A 5J40A 1SVMA 2W2VA 1GKYA 2X77A 2C8VA 4K8OA 2PJZA 3IPYA 3GP8A 4GSYA 1RRGA 2VO1A 3SJCA 4KJZA 4LK2A 2EFHB 2DFTA 1RRCA 4PPNA 4D6PA 2OAP1 2CL0X 4FCVA 3UK6A 2GVDC 3QOFA 4TMKA 4B44A 4NYIQ 1T5IA 4U7DA 4RD0A 2C03A 1G6HA 2I1QA 4G1UC 4Z8XA 4U5XA 4FMDF 1CF4A 1IQPA 1JPJA 5FOSA 3GLGB 5FPHA 1NLZA 1IN7A 4HAYA 4Y0AA 2ZE6A 3FGNA 3JZMA 3T1QA 4WBSA 4NE2A 4NYMQ 4CYMA 3T35A 1XPUA 4HZIA 1HEIA 5JJLA 3A8TA 1CS4C 4ZI2A 1KDOA 4BZPA 2PX0A 4IDNA 4IFEA 3WHKA 1DAKA 2DHRA 5HPYB 1T3SA 1EWRA 2DFKB 3A1WA 4DLTA 1G4UR 3AVXA 3DEFA 2GA8A 2H5EA 1CR2A 4PC3A 4US1R 3RS7A 2F6RA 5UKDA 1BOFA 5TDHA 2JLZA 4F4IA 2YKGA 2Z83A 721PA 3MD0A 4B3BA 2ZTSA 3MJRA 1YR9A 3F3YA 1CJKC 5A5GA 4QRHA 2Q21A 4HDOB 2O8CA 5EE9A 3QY0A 1ESNA 1A2BA 3IQXA 2C9OA 2ZUBA 4LZZA 4MITA 5AJVB 2AD1A 4FCWA 4RD4A 1R0ZA 2P2LA 4WZAE 3VMFA 1DO2A 1AGRA 2VIIA 1UDWA 4ZCLA 4EJSA 1RFLA 2ODWA 4M1KA 4N3NA 1ZM3A 2HCJB 4D82A 2NG1A 3R9XA 4JVSB 5FOTA 2ZRPA 3LRPA 3UMFA 3O47A 1SQ5A 3GLIB 1I2DA 2FFAA 2IYYA 3OEHD 1LV7A 4G5RA 4QFMA 3NEYA 2O8BA 1Z0IA 1EFCA 1RYFA 2OBLA 3AP3A 4AK9A 1EXMA 4YDSA 1QG2A 2JLYA 1E4YA 1YR6A 2P5SA 1D5CA 2ZR7A 2RGCA 4MGYR 5E4FA 3VQTA 1XD2A 3OFND 4ZCMA 4DC9A 3ZVRA 1JXOA 4CF7A 3OEHA 4Z51A 4KI0A 1QZXA 4C7OA 3TIFA 3U6KA 4D4JA 1IXSB 2ZE8A 4DIEA 2HF9A 4MRVA 3VFDA 2AKAB 1KOFA 4RFVA 3L8YA 1IM2A 1OFUX 1KDTA 1WF3A 2BIFA 2WJJA 1KYIA 1TX4B 3OFNA 2ZEJA 3U5ZB 2ZI4A 4QGHA 1KO4A 2H18A 2WHXA 4JBWA 4P4SB 2H16A 2WIBA 4IVPA 3VKGA 1RPZA 2CE7A 2P3SA 4V0LA 4DLWA 2GXAA 4DSTA 2HT1A 4ZCIA 1L4YA 3NHAA 4RFSB 4PSVA 3WXMA 1E9CA 1LTQA 3BWDD 4UNPA 1OB5A 3VR2A 1JEEA 2IEZA 1QHGA 3LBIA 5JECA 1ZAKA 3TNFA 2O8EB 4ZIRA 2FFBA 3BFVA 3L0PA 3AKEA 4M1OA 4IOJA 3SR0A 3AKDA 5C18A 3FPAA 2EFEB 4NCIA 2G0NA 4HB4A 2KBFA 3LW7A 1F6BA 1KTVA 4UNNA 3EPJA 4IDPA 4P31A 3C5CA 3CRW1 3TQCA 1VTKA 3DHWC 3O8RA 2XB4A 1SHKA 1Q44A 3K9GA 1P73A 2YVUA 1DO0A 3TUJC 3A1SA 2ZJAA 1Z29A 2B21A 5FPYA 3B85A 4KODA 2IT1A 1IJFA 1CP2A 3AF1A 4QGGA 4C3ZA 2JJ1D 4KO8A 3A1TA 3QPWA 1Z6GA 3CBQA 3ZIAD 3CW2A 3U3MA 1YZUA 1UEIA 2DBYA 2G1KA 1KI2A 2J0VA 2IS6A 1XXHA 1M7BA 1CLUA 2QMUA 3AVPA 1T5LA 3NXSA 3U7EB 4Q4AB 2GESA 1QG4A 4CW7A 2J0UA 2O8DB 3RANA 2CHQA 2ZYUX 4BEBA 5KNBA 2Q0HA 5AUQA 4IOKA 3WY9A 2JJ1A 3GLFB 4CEJB 2QP9X 3ZIAA 1JALA 3NC0C 4US0R 3PUYA 3R7WA 1G21E 3CM0A 1EK0A 5DI9A 1GNPA 2IK8A 5SZKB 1ZINA 4WZBE 2PH1A 5CLQA 4U02A 2A30A 2JASA 1G8GA 2ZYVX 3DO6A 4L5BA 3A4MA 2AWNA 1J99A 4A6PA 4H1VA 2CL7X 4DVGA 3ZVMA 3R8FA 5CYPA 3IGFA 2F3TA 1KMHA 2ANBA 1FMLA 1DE0A 3HPRA 4Z8YA 1WXQA 4C9BA 1N0VC 2VHCA 4YMUA 2N46A 1K5DA 3TSWA 3H2YA 1N6HA 3H4MA 2CL6X 4JIMA 5KSOA 2OT3B 4D81A 2QU8A 2ZSFA 3KJEA 4EDHA 3GJ8A 3QIAA 4B34A 2CK3D 2BHRA 3KXIA 1SXJB 3MUFA 1DG3A 2XX3A 1WRBA 2ZPTX 3VNVA 2C04A 3UPUA 4YXWD 3GLHE 2IXGA 2GEDA 1HV8A 4LHXA 4JSTA 2AWOA 4TZ0A 1LW7A 2QN6A 1Y63A 2DR3A 3W6OA 1FUUA 1HURA 4C2TA 3T61A 1XJ0A 4DB4A 5B57C 2CK3A 2OE2A 3AP1A 3I61A 4URXR 1N5IA 3EARA 3GCGA 3FWYA 2W6JD 3P20A 1NSTA 3GPLA 4YXWA 5G40A 1IY0A 4RFSA 3VHXA 5AUNB 1XZPA 4WIAA 2W2TA 2QSYA 2FA9A 2FNAA 3AKYA 2RCNA 4XVUA 5IRCD 3EW9A 1D8TA 1H65A 1F48A 2ZRMA 3NG1A 4AG5A 4I1VA 2W6JA 5C4MA 3EA5A 2G83A 2Z4SA 2B92A 3W9YA 1JQJC 4LJ5A 3Q5DA 3AF2A 2HXYA 3PVSA 4M1WA 2KJQA 1QHNA 2RMKA 2HXSA 4HZUA 5KYKA 1NNEA 1SKYB 4B3DA 1XD8A 1VYVA 2V9PA 1XWIA 4X8OA 3LNCA 1W0JD 3B78A 4MRSA 1DPFA 4H1UA 2E1RA 3IEVA 1F5NA 2OFOA 3I8SA 1G19A 1HUQA 2B8WA 1YR8A 2AK2A 3EC1A 3T15A 1Z0FA 1OH8A 1ODFA 1YJ5A 2FF7A 2IYLD 4N0DA 1WB9A 1KI8A 2OHFA 3THWB 4TLDA 3DOEA 4MDEA 3AF4A 2IS4A 5A0FA 5EZ6B 1W0JA 3K0SA 1KSFX 1U8AA 3WYAA 1DAGA 2JDID 2CNWD 2O8DA 1N6PA 3QI2A 4CEJA 1NLFA 4B6EA 2YV5A 3I1FA 2V3CC 2PBRA 5M04A 1LY1A 4V0KA 1NVVQ 4A92A 2FU5C 4LY6A 5FI0B 2JLWA 3W3AA 2BBWA 1KZ7B 1OXUA 2HV8A 1J7KA 3QBTA 3SS8A 4D0NA 3K0EA 2XXAB 4FN5A 1KO8A 2JDIA 2CNWA 4N0EA 1GUAA 2FEOA 1R8SA 4NZYA 3AVWA 1NIJA 1U0JA 2JLXA 4NDZA 4EPXA 4DCSA 3U4QB 1OXXK 2A5DA 3CZQA 3U44A 1AQYA 2I1VB 4MGZR 5E7JA 2GF9A 3FYHA 3BH0A 2FEMA 2CHVA 1X1SA 1M34E 2DFNA 2QP4A 3DM9B 4EQ6A 3MG9A 2WICA 3IO3A 4PQFA 4A2WA 1XU4A 2C78A 3HU1A 3MAAC 4MKGA 3K0FB 1E98A 1FX0B 3RSLA 1CR1A 3ETLA 5IT5A 1P72A 1OV4A 1ZNXA 4QBIA 2QSZA 1JAHA 3E1SA 3I72A 3MWLA 1TQ2A 4OJQA 1L8QA 5EJEA 2VP5A 2OUKA 1M1YE 2AL7A 2CBZA 3C5HA 2JGNA 4JBYA 3LDAA 4DSNA 2EWVA 5KPJA 1R5OA 2IYUA 5DI3B 4FD2A 4II7A 2DWQA 4TSFD 3HYTA 3QXCA 4RD1A 1VIYA 4LJ7A 2YC2C 2PZEA 4JLDA 4A6XA 2OV2A 3CUEF 2C9CA 3HYRA 3ADDA 3E70C 4YDHB 1OLOA 1W1WA 1II0A 2GNOA 1W36B 1W4BA 1E99A 3D31A 2LKDA 4A36A 2A9KA 421PA 5GJBA 1P7CA 2ZJ5A 4OI0A 4FMCB 4TSFA 4AYWA 5DNYB 2HJVA 4Q7MB 2BCJQ 2C9YA 2ZJYA 4F4CA 2OBNA 1SZPA 1Q21A 3HP1A 3IIMA 3EAQA 5CITA 1OH5A 2EQBA 2UKDA 5HZKA 4MYHA 2KBEA 4KHZA 1F2TA 4DKXA 2RH5A 4C0JA 1BO6A 4Q7KA 2HDNB 4PFSA 2D7DA 1SHZA 1A4RA 1T9HA 4JL8A 1E2FA 1TADA 4HAUA 5BWMA 2VRWA 1OKKD 2QM8A 2HUPA 1BYUA 2GAOA 1XCGB 2XZOA 4GOJA 5CIQA 4QBFA 3AQ4A 2F9MA 4G5SA 3SJZA 1UBCA 3X1YA 4Q21A 1CXZA 1P9RA 1E0JA 4LOAA 3TW8B 4QM6A 2ZAOA 3LFUA 5GJCA 1VIAA 4G5GA 3SYLA 2BM1A 2QAGB 1I2MA 3DZDA 1OKKA 2RHMA 2AK3A 4D80A 1Z8FA 4LI0A 1UJ2A 4L8GA 1U98A 5AK0A 3WNCA 3RS2A 3CZPA 1HH4A 2ERYA 2A5JA 4EFLA 4D0LB 2QG6A 1P62B 2CJWA 5JSZB 4GMXA 5LD2C 2JJ8A 2X19A 3Q85A 4NYJR 5GVSA 1OW3B 3LY5A 1Q3TA 3M0EA 2G3YA 4FXPA 2PEYA 3C8UA 2IWHA 2H1LA 3HU3A 2OXRA 5LD2B 1M2OB 2W0SA 3RWMB 5DHAA 1JBKA 4IFBA 4NL4H 3TSZA 1I4LD 4RCZA 1NF3A 4UXJA 3KKPA 3VU9B 3AVUA 3TRFA 3TKLA 3THXB 4B3CA 2IL1A 2O8FB 4ON9A 1R2QA 2QM7A 4QNRA 4EUNA 5BN4A 1G6OA 3QQ5A 4JMPA 2IYVA 4I81A 4XOIA 3U44B 1ZM9A 2NPFA 3WP1B 3KB2A 2ZRNA 4DBLC 2ORVA 4PHTA 1AZSC 4NCKA 2IBMA 1FMJA 1Q3HA 2QROA 4WXPA 2F43A 2FWRA 4CEHB 1UKZA 4TYNA 3B9QA 1FFHA 2CCKA 4A1FA 3PV0A 3OHMA 4HDCA 2QT1A 1L2TA 3GLGE 1ZM4A 1Q1BA 1Z07A 3LQQA 5D3MA 1FNNA 4Q66C 3WBKA 2ZI7A 3ICEA 3DKVA 1JNYA 2IUUA 3TR0A 3GMTA 2R6DA 4RY2A 2F55A 2YZ2A 1N6RA 3GLHA 4JL5A 1OIXA 4L9WA 3CRVA 3ZDQA 2FOLA 4C0BA 1XEWX 2EU8A 4IVQA 1NRJB 2P6NA 4IRUB 4BRUA 1GRNA 2OBMA 1YKSA 3VR4A 5JFGA 4WVFA 2NPIA 3W8NA 1T0HB 2Y8EA 4DB2A 3H84A 4PPQA 2ATXA 4G01B 1KO1A 1NN0A 3M1IA 2VSOA 3LAWA 4XVRA 1UKYA 1G5PA 1VG1A 1DOAA 1Z47A 2BEJA 4DLYA 5J4YA 3NH9A 3LX8A 1TEVA 4CRWB 3IDQA 4DDVA 1G16A 2VHQA 4JVMA 2IS1A 4PO9A 4RVCA 4BZXA 1TQDA 2HYDA 1GRRA 3TUIC 4I4LA 3GFTA 4M22A 3U3KA 3KKOA 1UKVY 3QKRA 4M1TA 5CK5A 1TU3A 2OESA 1ZUHA 1XCPA 3A36A 1N2CE 4TL6A 2B6HA 4ACAA 1HQYE 2EFCB 4Q4HB 4TQ9A 3GLIE 1E9DA 2YWGA 3CH5A 2OXCA 4BZQA 5JSZA 2JATA 1LVGA 4AC9A 2PCLA 3G82C 3QKSB 3EWAA 2HJGA 2BCGY 4JJZA 1ZC4A 2WMNB 1GTVA 1Z5ZA 2ZRAA 3QF7A 4TLBA 1VECA 3K1JA 4M1MA 4JLNA 4PX9A 3LBHA 1NMXA 1P2VA 1MH1A 3HJNA 3B13B 4C2UA 3VU9A 2Z5FA 1IN5A 1LFDB 4A0RA 3CWZA 2B7CA 3EZ6A 2DPXA 4W7SA 5DSZA 1R7RA 5LPNA 2QTVB 4Z54A 2O0HA 4Q1BA 2NIPA 3NH6A 2Z4RA 3W6PA 1N0UA 3QEOA 4OQXA 1ZD9A 2G0TA 4HLCA 3TSOA 5JRJA 4HSEA 1XEXB 3SOPA 2G1JA 3EZ2A 2C99A 3R9IA 3SQWA 2VP0A 1Z2AA 2ZQ5A 1TQ6A 1XTKA 3RRMA 2ZRBA 4MUBA 4ASUD 4QKQA 4JL6A 4JVLA 3GFPA 3A1UA 2NO7A 3VX4A 2JAQA 1VG9B 4PC2A 1SVWA 3VTKA 2BM0A 3B7GA 2QBYB 1G3QA 4M8NE 2ZS9A 4M0LA 4FIDA 2C95A 3GJ5A 1H8ED 4ESHA 4XTRA 3TQFA 4B2IA 2RGAA 4GBMA 1SVOA 4ASUA 5EXSA 4PXAA 1P6XA 3CH4B 4V0NA 5KTYA 3TAUA 2WIAA 4BQSA 3ECCA 1N6OA 1QVRA 3BH6A 1KJWA 1E0SA 4HI0E 3EZ7A 5G53C 5BYJA 4A8JC 1S1MA 3B1ZA 3MWJA 2MSDB 1J2JA 4ERNA 2IEYA 2QI9C 1H8EA 4LPKA 4DWJA 2GKSA 1NKTA 1IAQA 3LA6A 1GIAA 5FOUA 1FQJA 1JJ7A 2CLDX 1ZBDA 3E2IA 4X8LA 3U6BA 3AP2A 4BE7B 4EAQA 2WAXA 1T0JB 1W5SA 1X6VA 5IHPA 4B43A 1AS2A 4R2IA 3CF0A 3K0AB 4LSGA 5EXPA 3UWOA 3I32A 4AURA 1GWNA 3VNUA 2W0MA 3U60B 3RC8A 1CRQA 3CLVA 4B3FX 1LNZA 2V7QD 2XJ9A 4EPVA 4DCVA 1XTIA 2GDJA 1Z08A 2GJ9A 3L82B 4EPRA 2NZJA 2V54A 3FB4A 1DAIA 3GJ6A 4KYUA 1NY6A 3GLFE 3C7KA 2R65A 5FBQB 4TMZA 3KKNA 1MT0A 3OE7A 3VAAA 4QHTA 4PR0A 2Q6TA 1GKUB 2V7QA 3O8DA 3LVRE 3A4NA 1NY5A 4C0QC 1UFQA 4AKHA 1QDEA 1NVUQ 3BIFA 1ZC3A 1QHHA 3QKSA 3ZS8A 4PZLA 4GI7A 3WMGA 3T5DA 2VH5R 1G7TA 2ZIAA 2F1RA 2N42A 5C4GB 3MFYA 2FE4A 3KQHA 2AXPA 3IQWA 3MGCA 3I62A 2CXXA 4D25A 3AGPA 2LKCA 1C4OA 4LYHA 5EXXA 1HYQA 1ZJ6A 3W3ZB 4C0LA 1YZKA 1ZUIA 4W5JA 4AYTA 2FGJA 1FNMA 4RSGA 4WXRA 1B23P 2WPDD 1SXJE 5HCIA 3EIHA 4ZO4A 4Q4LA 5TMPA 1R4AA 1Z6TA 5B58C 3KTAA 1E2LA 1XMVA 4TTQA 3VR1A 3Q3JB 2DWOA 4QJ3A 4OK5A 4BECA 4IDOA 3K8YA 1P3JA 1OHHD 2KI5A 3ZD6A 2WPDA 1IY1A 4GFDA 5FOVA 5HE8A 2QP3A 2RGDA 1Q1QA 4PC7A 4NH0A 3TK1A 3M4YA 1JEDA 1R0XA 1XEWY 1OHHA 3D8BA 3O8CA 2O5VA 1KI4A 1KSJA 4QHSA 4AKEA 3THYA 2GXQA 4LHWA 3CRQA 2JLVA 1ZM2A 4TTRA 3X1WA 2AXNA 3PIRA 4V0ME 1T91A 3N5CA 1II8B 4PAMA 4QBGB 3WP0A 4C0AC 2BJVA 2ONKA 4A8JA 1GL7A 1SKYE 3ASYA 3QKUA 4X8HA 1R10A 4KFRA 4D4KA 2G88A 2QNRA 2XZPA 4BEJA 1MABB 3C14C 1II9A 1W2GA 3K0AA 4HLUC 3SQXA 4YLGA 3SC3A 1VG8A 3ZGXA 4DLXA 3NIBA 2J59A 3PEVA 2ZS7A 1E2EA 1LS6A 1S9HA 2DY1A 1NN5A 1JJVA 1AS3A 2QEQA 4KU4A 3K09C 4LRWA 3UIEA 3ZQ6A 4IVRA 4AG6A 1BYIA 1HE1C 3BC1A 3BRWD 2JCSA 1OYWA 4QM7A 4NYJQ 2V4ZA 1G291 2NOAA 5EUMA 2YWEA 1GILA 1A1VA 3GLGA 1IN6A 4NMMA 4IDHA 3PEWA 4B3XA 3CX7A 3U7FB 4L4UA 2B7BA 3QSYA 4IXMA 1US8B 3K0CC 2ANCA 1U99A 1K6MA 5CM9C 1A82A 5HE9A 1R0YA 1NVWQ 1YU9A 1NKSA 821PA 2MMGA 2A2ZA 4YMVA 4KFSA 1E2KA 4A2QA 5JRZA 2VP2A 2OCPA 5J47A 4PAQA 1P2TA 1OYYA 3NWJA 2D2EA 5CJ2A 3QVUA 3AKCA 4ZKDA 3KZ1E 5J4VA 2WJHA 5DYIA 3A4LA 1ZU5A 5TARA 1OB2A 5JBQA 4LYFA 4B48A 3C4JA 4LHZA 4MYCA 3KQLA 4TQUS 5EE3A 4W5WA 1PV4A 3TH5A 3KKQA 2CHGA 3CB4A 2AHOA 1N6IA 2FX3A 1MO3A 1G41A 1RJ9B 1YZNA 2OLJA 5JEEA 3NC1C 1J70A 5CM8B 4W9MC 1E79D 4B47A 1G5TA 1OFHA 1XF9A 1MOZA 2R8RA 1DEKA 3CPJB 5KSPA 3QUSA 4C0SA 1DTSA 4B2LA 3C16C 2D3WA 5AJYA 1NN3A 2CCGA 2BKEA 2VHJA 3N2IA 4X8MA 1KIMA 3AVVA 2NO9A 4PHFA 3GLIA 4IOMA 2LCFA 2OG2A 1XJQA 3D6TB 5TY0A 1E3MA 2WTUA 2GJKA 2WJYA 1E79A 3PG5A 4RD2A 5FTLA 1MV5A 4LHYA 2ZRGA 1WQ1R 2XOKD 1SVKA 1ZVQA 2OZEA 5H70A 4ACBA 1AZTA 1SXJC 3B8HA 5FOWA 1N5KA 4JBXA 2BWJA 1VHTA 1FPMA 1CIPA 1F2UB 3TMKA 2N1BA 1AK2A 1BIFA 4S2EA 3L0OA 4HB2A 4FWTA 3CF6R 4FMDB 1M7HA 3CONA 3OZXA 2XOKA 1G64A 1XRJA 1E2HA 1EFTA 1MABA 2CLCX 5G3ZA 2J45A 3HU2A 4KVAA 2KB0A 4FCTA 4BLPA 1ZCAA 5GVRA 2MSCB 3MJHA 1G3RA 2C2HA 2J7KA 4G5QA 3ZS9A 4P4SA 5FR1A 1WBDA 3NDPA 5E95A 2Q9AA 4HLUA 4J0QA 1Z0AA 3SFVA 1NBMD 2Q9BA 4LYAA 3RWOA 1XMJA 4A82A 3K09A 3R20A 5K8TA 5F98A 1D2NA 1E9FA 4JT4A 5EUQB 4Q01A 4KLNA 4Q1FA 2F9LA 3T1TA 3X1XA 5FPSA 2TMKA 2CMKA 4Q1DA 2ERXA 2O8EA 4LJAA 3GQBA 1GL9B 3QJYA 5BN5A 4GL2A 1NBMA 2FSGA 1NJFA 5G41A 2ZAMA 3K0CA 2J5XA 4XWKA 4AY2A 1RE0A 2ZSAA 5SZIA 2VF8A 3LVQE 5LBIA 3REFA 1BS1A 2ZI5A 5KPDA 3CF2A 1ELOA 2XEXA 3CNLA 4AIIA 1E2QA 1UBFA 4TYWA 1VDZA 4IEIA 4HUQB 4URZR 5AJZA 1P75A 2FZLA 4BRWA 2A5FA 5DYGA 3GD7A 3KXKA 3BB4A 4JLAA 2BBTA 1ZW6A 2GHIA 2QMHA 4A0HA 2E9SA 1MR3F 2J46A 4P3YA 3RVBA 1NLYA 1U90A 4Q4AA 4Q7LA 4TN1A 1G7SA 3GLFA 2V6IA 2NTYC 4JVNA 1ZD1A 3TAHA 1X8KA 2FSFA 4OQLA 3WHLA 2WKPA 3E5HA 3ASZA 3AM1A 3REGA 4URVR 1SGWA 2PL3A 3RS3A 1DS6A 1FW6A 5FUXA 2FG5A 3I73A 3GFOA 2FPKA 2NMVA 3K9HA 4JLVA 1VYTA 1SXJD 1W4AA 4KV9A 3MSXA 4A4DA 1Q22A 4PO8A 1T8UA 3BOSA 1QHSA 4LC1A 3WMEA 2X8AA 1D9XA 5EE0A 3THOA 5ELXA 4RD3A 2ZXUA 3FMIA 1N6KA 2ODBA 2D7CA 3U3RA 4IKEA 4LJYA 4QJ4A 3LD9A 5FBWB 1XJCA 1SXJA 2IX3A 2QGZA 3X2SA 2WKRA 1XB2A 3ZJYA 3UXMA 5DO9A 1FTNA 4LJ4A 2QMEA 3WNBA 1KK2A 3IIJA 2PJRA 3PUXA 3U3JA 3TJZA 2PZGA 3KKMA 4FW9A 2K5UA 5E3HA 2PT5A 1BMFD 1XTQA 2HT6A 3MMPA 4Q9LA 4HB0A 1RRPA 3FTQA 2VP9A 4NYIR 3TR5A 1Z6AA 2IYTA 2ZJOA 4OQNA 4D4MA 3L43A 3QXHA 1OT3A 2H57A 3PQCA 1MO4A 5BN3A 4DSUA 1FOEB 4F91B 4DT1B 3LW8A 4TYQA 1S4QA 3N70A 3U7GA 2QE7D 4KYIB 2J3EA 4LWZA 2H92A 3NTUA 3U61B 5FI1B 1W36C 3B1WA 4NYMR 3RABA 2GAAA 1BMFA 5J4HA 1QHYA 3A37A 1CJMA 1CTQA 2L0XA 2RAPA 3IUYA 3L2OB 1KAOA 3TVDA 1E1QD 2WWWA 2XTMA 2ATVA 5JHHB 4O3MA 1NI3A 4RCYA 4V0MA 1KJYA 4IHQA 3RC3A 4PO1A 2QTFA 1KO5A 1JR3D 2J87A 2QE7A 4XVQA 4TMWA 2OCAA 5D3QA 4PAOA 1NSFA 1KI6B 2EFGA 4POAA 1E1QA 4DDWA 2UZIR 1E69A 4M1SA 1S3GA 1K8RA 3L0SA 4P4TA 1E2MA 1JR3A 1E2DA 4Q9KA 3QE0A 1W4CA 4Q4JB 4BUJA 3J81k 3THWA 1XD9A 3UWKA 3FVQA 4TMVA 2XTZA 1P2UA 2JLSA 4F38A 3C41J 2JLRA 2OCBA 3U2QA 2OM2A 3DMNA 3IHLA 1XTJA 2GCOB 3QNUA 4UJ5A 4DJTA 4BLOA 5CDFE 1KNXA 2GZDA 2Z6VA 4XD7D 2C96A 2QAGC 2VP6A 3EASA 2BDTA 3SBDA 4NONA 1BH2A 2JLQA 1GL6A 2QY9A 1XMSA 1TPZA 4GP7A 1E0AA 2E87A 4OI2A 1N3BA 1OJLA 2GETA 2QGNA 4ITRC 1JXMA 2QPOA 2VTKA 2Z0MA 3ADKA 3HWSA 4QNMA 2WJVA 4B33A 2XXAA 5AUOB 3EXAA 2ZVPX 121PA 4DLUA 1D2MA 4ARZB 4KITB 1KKLA 3H0KA 4MGIR 2XITA 3RLFA 4ZPXA 2AN9A 1GNQA 4XD7A 4I1OA 4DHEA 2IF0A 1M8PA 3D3QA 2AX4A 4PPFA 3U4QA 2XB2A 3QXSA 4B32A 4DEXA 1JQLB 4RKEA 2PEZA 3A1VA 4WZ6A 3RRNA 2ZRFA 1CU1A 4DRZA 2QT0A 4DSOA 1A2KC 4LC0A 4DLSA 2WV9A 3BXZA 4TLAA 4OJKA 2FV8A 4F92B 3TE6A 3W5JA 2GJ8A 1WE2A 4BLSA 2KSQA 4NCHA 2FSIA 1O3YA 1XP8A 3K0FA 3GJ4A 3TLXA 1FX0A 2FSHA 3Q72A 3VHLB 5FBLB 4GNKA 4IW3B 1GNRA 2WZQA 3WMFA 4ZDKA 3FHTA 1W5TA 4UNSA 4OHZA 2QL6A 1G8PA 2ZUCA 1ANKA 2GJAA 4NKRA 2FH5B 3RS4A 1W36D 3H1TA 1KO7A 3FKQA 1O87A 4DLVA 1MKYA 1UADA 5DI3A 3T1VA 3P32A 4G3XA 4I1UA 1G3IA 3ZVNA 2IS2A 4KLZA 4YQFA 4L16A 3TW4A 2C77A 3B6EA 4PZYA 4ZDJA 5J4KA 1EESA 1N0WA 1R6BX 3S1AB 2FMXA 1KNQA 2ZYWX 2FZ4A 2ZRKA 4Q03A 2WSMA 2QA5A 2Q3HA 3QENA 4MYTA 5KSZA 3KXLA 4Q7JB 3C15C 3PEUA 1WDTA 2EWWA 1TEXA 2EYQA 5IK2D 1E9AA 4CZ2A 4GP6A 5JS8A 5EP4A 1N5LA 6Q21A 2VHUA 4ZI3A 4MRRA 1OFTA 4Q1AA 2NO6A 1NVXQ 4D0GA 3PXGA 3B9PA 5JMTA 1OPXA 1SVSA 3KX2A 1DVRA 4PQRA 3K70B 4MKHA 3QG5A 1NL3A 1Z28A 2HCBA 4OBEA 4JLOA 2BC9A 1GAJA 2P67A 1E32A 2VPPA 5IK2A 3V4FA 2WMOB 1CBUA 4Q4JA 1S0UA 4XWOA 3SZRA 1W4RA 2ZREA 1FTSA 4TYPA 4PSAA 4QBHA 5JI3E 2Q3MA 4OKSA 1L7VC 4HAWA 1S8FA 1UBGA 2IYXA 1P5ZB 1NMYA 3QG1A 4HB3A 1G8FA 1KDPA 2YOFA 2VLIA 2RB4A 2R9VA 4KBFA 4QXAA 4TLEA 1DELA 2J1LA 2QAGA 2IUTA 4K46A 4D26A 2A5YB 1R5NA 2VYFA 3BS4A 2Z43A 3AVYA 1P60A 2ZU6A 4JLMA 4TT3D 1YQTA 4E07A 1E1RD 1Q1ZA 1SULA 2J9RA 3OF5A 2R2AA 3DZ8A 5FL3A 5FUWA 2R44A 3GEEA 4LPSA 4Y0VA 2QQ0A 3EPLA 1U94A 1ZD8A 3IHWA 4DCNA 5FOXA 2ZSDA 4OQMA 5KOYA 4TT3A 5GJVC 1D2EA 2ZRJA 2YOHA 1QHXA 3I8XA 3AVTA 3BGWA 4TMTA 1E1RA 1E2GA 2IYZA 1GVNB 3THXA 2AFIE 3GEIA 2O8FA 4CDGA 3RYTC 3BBPA 1GOTA 2ORWA 2CVHA 2F7SA 3AV0B 2WWIA 1KSHA 4BGDA 2SHKA 4LBVA 4MDFA 2ZANA 5KNDA 5C1BA 2YINC 1K5GA 1E9SA 1T3HA 4L15A 4PANA 3T5GA 2XZLA 1OFIA 2O0JA 3DM5A 1DARA 2GK6A 1G4AE 2AFHE 2CDNA 1MO6A 3IEUA 3F0TA 4DDUA 2V8OA 1EX7A 2ZU0C 1TMKA 2IA5A 1FP7A 4CEHA 1XBTA 2RGGA 4FMBB 3LLMA 4BLQA 4JZKA 1AQUA 3SFZA 3GJXC 5AR1A 3OIYA 1W0KD 4UXIA 5DE3A 2O8CB 2I4IA 1HY3A 2B8TA 5JWHA 1G18A 2ZUDA 2XTNA 3EZFA 2W58A 4LBZA 1P61B 1V5WA 2D4HA 4Q00A 2GCNA 5FH9A 3L8ZA 4EJSB 3WNDA 5L3QB 2AD5A 1KI1A 4A0FA 1NBME 4UNQA 4HLQB 1N25A 2REXB 1MRNA 3BFKA 3FE2A 4TQAA 4AWXA 3BH7A 5CIWA 4XTCS 4BLRA 1W0KA 1ZNZA 4MQBA 1I4TD 1X86B 3NBYC 3EWSA 1PLJA 4NCJA 1WMSA 1KJZA 3B2EA 4BPBA 3CKLA 2VSFA 4A15A 4FI3C 3MLEA 1KGDA 1OXTA 4N1AA 4NCNA 2O8BB 2W83A 1X8LA 1W7AA 2D06A 4KSCA 1G7CA 2WVJA 1EWQA 4HAVA 3R9WA 4JS0A 3NKVA 2Q3FA 2F3RA 3G0HA 3OE7D 4OHVA 1G5RA 1E6CA 1PZNA 1FUKA 2HF8A 1XD2B 2O0KA 4Q18A 1M7GA 2G9NA 1CR4A 2JLUA 2FFHA 1TQ4A 3QF4B 3B1YA 1NVVR 2F1JA 3SI7A 4F93B 1E2JA 3RS5A 3CO5A 4R71A 2QUZA 4C7OB 4US2R 2PZFA 3CX6A 2GXUA 3IILA 5EP2A 3RRYA 3D7MA 2ZS8A 4WA7A 4P32A 1ZRHA 3K53A 1IXRC 4JLJA 3T34A 3TUZC 2HYIC 2A5GA 2OAQ1 1WP9A 1X3SA 3O8BA 2IYQA 1XCMA 4Q4HA 1Z0KA 2CEAA 2Q9CA 2C98A 1U8ZA 4P4UA 2CLSA 2JEOA 1CEEA 2IUSA 3LO5A 8OHMA 3SU8A 4HEJA 4URUR 4NP6A 4DCTA 1RKBA 1SVIA 3W6NA 1EX6A 3RHFA 5FR2A 2ZSBA 4M1YA 1IHUA 1XTSA 2WJGA 4F7WA 3QXJA 1G8YA 4V03A 1NMZA 1VCIA 4LBYA 4JYBA 2GILA 2AKYA 4A2PA 4FWIB 5AJXA 5CB6A 2GWHA 4BLTA 3CR7A 5EXTA 4UNRA 2ZRHA 3PUZA 5CDFA 4EPWA 2DB3A 4ZIRB 2R6GA 3P27A 1NG1A 1RW4A 1XEXA 2GEVA 1R8QA 3B82A 3SDZA 2FFQA 4U00A 1E96A 1YVDA 1OSNA 2NO0A 5SZHB 1W44A 3I5YA 3WBJA 1AJEA 2C5LA 4BFVA 4HAXA 2BMFA 1KI3A 4B75A 3KDSE 4QG7A 1FL9A 4KFTA 2QBYA 2KE5A 1XPRA 3LQRA 3FDIA 1UKEA 3GJ0A 4B2PA 4JJKA 1WCV1 1PUJA 3HDTA 5FPTA 4M9QA 4RZ3A 3KL4A 3FMPB 1F3OA 2QQEA 3LX5A 2RGNA 3WRYC 4BASA 4B74A 2WWYA 1XXHB 2JIZD 1DAEA 521PA 5L3QA 5KU1A 5L3RA 2A3RA 2ZR0A 4QHYA 1G7RA 1JI0A 2YJTD 3GJ7A 5B64A 2J0UB 1N6LA 2EW1A 2GTPA 4MYUA 4B35A 1DAMA 3K9LA 1G1MA 2GCPA 3IBYA 4BFUA 2GEUA 3ZLJA 2IF2A 3R7WB 2XGJA 4Q47A 3GJ3A 4ZDIA 4LUCA 4R9UC 4Q02A 3FFBA 4RKFA 2JIZA 1TF5A 3QPVA 3RS0A 3ND9A 3SJAA 1TU4A 2J0QA 2OFWA 1ETUA 3A58B 4LYJA 2OCYC 4XJXA 1KMHB 2D2FA 1JR3E 2IWRA 2G6BA 4BFXA 2P6UA 3QF4A 3BORA 4CGZA 621PA 1ESMA 2ZRCA 2ZRLA 2ODNA 1W46A 3R8CA 5C46F 2ZROA 2BEKA 2QENA 1B0UA 2OLKA 3AF0A 5HTKA 3LBNA 2NQ2C 4MKFA 1ZNYA 1Q12A 1OXSC 2ZR9A 1X8JA 4H9GA 3KQNA 2BBSA 1J90A 1SVLA 5J4LA 5L3SB 1E9RA 2NZ8A 4NPHA 4HUTA 4LX0A 1E2PA 1E94E 5JJKA 4C4PA 2FDCA 1JB1A 4BFZA 5H8WA 1OF1A 221PA 5FUYA 4DLZA 5FPKA 3PFIA 1AKEA 4XH9B 3ZH9B 3UKDA 4HDQB 1T4GA 1Q57A 3G5UA 2WWFA 5FTNA 5FBVB 1WBBA 5FTMA 1TUIA 3Q5EA 4KCGA 1YRBA 3PEYA 1RVDA 1NJGA 3SE0A 2ZE7A 1VPLA 1J8MF 4URWR 2ZJZA 1AGPA 1V43A 4Q19A 1SKQA 4C30A 4B73A 2IYWA 2VQSA 4DZZA 5K8LA 1G20E 1JPNA 2DWPA 2FGKA 4PTLA 5AWFC 1UM8A 3QXXA 2MSEB 4LBWA 3WYFA 3AB3A 5B30A 1EFRD 1FP6A 4HZUB 1NG9A 2BOVA 4WW0A 5H68A 4UKDA 2NGRA 1YHNA 4BFYA 3PUVA 4PSKA 5FL7D 4URYR 2J41A 4OHWA 4IXNA 3LV8A 1Z83A 1NIPA 3DPUA 3QPUA 2OFXA 3SHWA 1R0WA 2QTHA 3TGPA 3QBVA 4FMCF 1EFRA 5J5CA 1VYUA 5JCZA 1U81A 1A5TA 5JLJA 1U0LA 5CJPA 3SHFA 1TAGA 1M74A 5DGXA 2XSZD 4Q48A 5FL7A 1T3LA 4OK3A 2QPAA 3RSOA 1LB1B 5IF9A 1J8YF 4JKYA 2OEPA 4DEYA 2IXEA 1II8A 2WJIA 4XIGS 4M9ZA 1RZ3A 3VR5A 2PT7A 3CX8A 4RZXA 4E5UA 2FJUA 3QKTA 4Q9HA 4Q9JA 1XEFA 5F9HA 2UZ3A 4EPYA 5JEDA 1IN8A 4B3GA 3BB3A 4UJ3A 1KKMA 2VHTA 4DDTA 2ZI6A 1G3MA 2XSZA 4GOXA 1ZNWA 5HCNA 4OHYA 2R6AA 1BKDR 2I3BA 1PLLA 3QVVA 4TL8A 1GITA 5EZ5A 3KUCA 3UMSA 1CULC 2EYUA 2YYZA 3ZZ0A 2GF0A 4PHHA 2ZM5A 2YHSA 2A7QA 3WYGA 4TZ6A 1DG1G 2WWXA 2GZAA 3F8TA 3FHOA 2WKQA 4EQ6B 1AN0A 3P4XA 1US8A 5K8UA 4CT5A 1ZYUA 2YC4C 3RRZA 5KDLA 3W5IA 5L3SA 5JJIA 3CRMA 3ADCA 2GJSA 2WWGA 3UG7A 2XNDD 2RHDA 5BW8A 2J0SA 2F1IA 3K9NA 1U9IC 3KQKA 2W00A 1XNJA 1VG0B 3KJGA 5F9FA 4Q5IA 2PMDA 1KDRA 4PPGA 2RGEA 1XPOA 3AUXA 2BKUA 5CK4A 3W34A 1Z63A 4O0MA 2OILA 2RKOA 4JYCA 3BERA 2NO1A 3P4YA 1XX6A 2XNDA 3CPEA 1RJ9A 1QRAA 2QZ4A 5KUTA 3U7HB 1OH6A 3UATA 3IBGA 2KWIA 4KFUA 4QL3A 3T12A 3IO5A 5FTJA 4D2IA 1N5JA 4LV5B 4TL7A 2J7PD 3VKWA 2VSXA 4CEIB 2UVQA 3CNOA 3MCAA 2PLFA 1GSIA 3FFAA 3SBEA 2R6CA 2JJ2D 3LLUA 4QGAA 2YWHA 4TL9A 3NEJA 4YMWA 1YR7A 2GVZC 1U2RA 2ZE5A 3FMOB 4KAXA 5SZJA 4EPTA 5L8VA 4ESVA 2V1UA 2IYRA 1W47A 4JSYA 1JAIA 2ZJ2A 3I5XA 1LF5A 3BB1A 1AKYA 1FZQA 1KAGA 4I99A 1F2TB 3JZAA 1IOZA 1S9DA 2J7PA 4LHVA 5ANRB 1KY2A 3ICQB 1DAHA 5BXQC 2JJ2A 2OO7A 2CCJA 5TV2A 1AA9A 4R98A 1KSGA 2AR7A 3SEAA 4KXFB 4E09A 1DBSA 1HE8B 4FINA 2WWHA 4AYXA 4BFSA 3NBZC 4E22A 1Z3IX 4R2HA 4LV8B 1F2UA 3EZ9A 2R62A 1OE0A 1CRPA 1HT1E 2P6RA 1KK0A 5KSYA 4IEEA 2WM9B 4MRNA 4B71A 3SYKA 4M9XA 2IW3A 1QHIA 4GMDA 4Q1CA 4OHXA 4G5OA 5TB5A 4GOKA 1EG7A 4O2RA 3BAFA 2P65A 4AKGA 1VKJA 5E7MA 2ZI9A 5EE1A 5F3WB 4KVGA 4D4LA 5JCPA 1GP2A 4CIDA 4UQOA 1UBEA 2CJWB 2EFDB 1PJRA 1Z6YA 1HQCA 4TWZA 3ZZUA 2ZVQX 1UAAA 3ZYCA 5KO2A 4PQYA 1YZGA 4V02A 1GKIA 1LF0A 1EGAA 1TL7C 2EVWX 1GFIA 3JVVA 5E7IA 1EFUA 3V9PA 4XSGA 4EFMA 3KQUA 3RNLA 3Q7QA 5BYKA 4MH0R 5HR5A 4YONB 1QF9A 5CYOA 2V55B 4GT1A 3B1VA
chains in the Genus database with same CATH superfamily
1NQXA 3JVUA 4PWZA 1EFPB 5BN4B 4BUCA 4BNZA 3WRVA 3WOVA 4O1HA 3VKUA 4IMIB 2ADMA 4W8HA 1R5BA 1AMNA 2PX3A 4QVKA 2PE5A 4M0FA 5LB4A 3B5JA 5DN9A 3V46A 4B0OA 5ER9A 1O95A 4O2LA 4CLHA 3DW1X 2XNKA 1DX6A 3AJ9A 4QSMA 4HUQA 3BJEA 1Z25A 2RHTA 3WWYA 2X9VA 2YNMD 3EB9A 3FOZA 2F43B 2A6PA 3T1OA 1E7SA 1UPXA 3GRPA 1CRLA 3NFRA 4JP2A 3GLKA 3AESA 5K0TA 1KJIA 4IIJF 1U6JA 1AM4D 1JGTA 1QLJA 1TCBA 5IKMA 1ND6A 3ZWQA 1A9QA 3OX2A 1S2OA 4CEIA 4MXDA 4H27A 1OXKB 3N7UA 2DPHA 1C1XA 2G04A 1M54A 3AJ8A 2IY9A 1IBKB 1SXQA 2GTIA 1IEWA 2OECA 4J2TA 1J21A 2FQXA 4H35A 3SQNA 4V0OA 1G0NA 3GLHB 4OXXA 1XMOB 1NONA 2QRNA 3L1VA 4QC2A 4Y1RA 4IO1A 5I9SA 4CT4B 1FDOA 1ZIPA 4IGEA 2XXJA 2WUDA 3G2PA 3TBKA 1Z0UA 1FP4B 3AUYA 1EWTA 5B1IA 4BX9A 2XV1A 4I55B 4BC1A 2FZGA 1UKCA 4QYIA 2J0EA 2QUKA 3W78A 1UMCA 1W94A 1STOA 1NQ5A 3VX3A 4DIUA 1RAIA 1JQEA 4FNAA 4ZJUA 1KZGB 3IKJA 1WA5A 2QPTA 1PYOA 1FYFA 1ZZGA 1U0TA 2V6JA 2B36A 2YZ7A 3NVAA 1NI4A 1HZJA 1GZSA 1M8KA 3UB2A 2FPIB 1MOSA 3D2AA 2DPMA 3AHGA 2X2FA 2JF0A 5B2FA 3IV9A 1YDWA 4CR6A 1X1RA 5I9IA 4XQGA 2JIDA 4QXRA 5KYUA 1Z6XA 1EUZA 2FPPB 1QQAA 2QMOA 1G20A 2F67A 2Q6VA 1PVOA 1OX4B 1PNOA 3HH8A 1ECBA 2IHJA 3ESRA 3CLUC 4LC9A 2GYVA 1T6BY 2QL9A 3IC5A 3QVGA 1VHWA 3RUCA 3M89A 4OQEA 2JA1A 4CQMA 3URMA 1UBNA 2BHSA 5IYZF 5EOVA 3MWYW 4ZEMA 5T6MA 3H9QA 4R2MA 3FSEA 4AZ0B 1JAXA 2W6IA 2ZWIA 3V97A 5C2JB 1NN1A 2CE2X 3PF9A 4G86A 4L95C 1MB3A 4KSBA 1PEDA 5SICE 3KJIA 3NWBA 3I45A 2G5PA 1MZPA 3LXRA 4DPMA 1CR0A 4FUQA 4I1SA 3FNGA 5SY9A 2GEKA 1X80B 4RWEA 1TO1E 2XW6A 1DADA 4X6XA 1BE8A 1WG8A 2C4MA 2XHZA 3CF4A 3V4RA 5EKTA 1IY2A 1PZEA 1ZUNB 1R18A 3MCVA 3JWEA 3ZDBA 1CUFA 2O07A 1VJDA 1AS0A 5MN5A 1OWOA 2Z8YM 1H2FA 3M6MD 4I14A 3EVGA 4U0JA 3WGTA 1U0HC 4WOBA 1KQFA 1B93A 1GCUA 2VPQA 1BJRE 5HF9A 3RTEA 4YCCA 1ULBA 2P5TB 3UF0A 2JS7A 3I8OA 3A32A 1UPBA 4QUIA 5L95A 4M99A 4E03A 2P0EA 3D4IA 2GYUA 3PIIA 4QXQA 1GZUA 1OAKA 5E9AA 4GE0A 1L4UA 3AZQA 4KGZA 4E1AA 1D0VA 2V7BA 3LL7A 5P21A 2YMLA 1E4VA 3ZLTA 3HA2A 3E1GA 1PTKA 3JQEA 4P3XA 3WGVA 3Q8MA 3M7IA 3ZWCA 2EBUA 1Y80A 5LZ8A 3MRSA 1GKKA 3K9WA 3UV3A 2JGLA 3MW8A 1VSUA 7MHTA 3PGA1 2FY8A 3R44A 1R15A 1C1DA 4W5TA 2REOA 3BE4A 3JW8A 1NU6A 1N6NA 2H17A 1J8QA 5KHAA 4KR7A 4TMXA 5EN4A 2IBTA 3H1AA 1O54A 3EG9A 3G7NA 2O3SA 4B4UA 4UDXX 1BU8A 3ISJA 4P33A 4CLDA 2IYSA 4BFWA 4EECA 3PNSA 1BE6A 1KK1A 3PYMA 5C8YA 3RROA 4BE9A 3JAKA 2ODEA 3DCJA 4AS3A 1Y33E 5GJWC 2VDQB 2WOJA 5FFMA 1NQTA 3E6AA 3ZZ1A 2B9EA 1SUAA 4G41A 4EUHA 4HDNB 5KTTA 5L3VA 2D62A 2TRSB 1DZIA 1ZMXA 3KO8A 4ARVA 1TO2E 1QVAA 4UC0A 2ZB2A 3DZFA 3RAEC 2FQWA 4YAFA 4CM1A 3PA8A 1JBEA 1Y9JA 4Y3UA 3VDRA 4R05A 1RR6A 3AF3A 1E2NA 2VDNB 5EP3A 1CY1A 3T7RA 5JSFA 1THZA 4AJ2A 1ORVA 3VR3A 2V1XA 2I66A 3HO1A 1VPWA 1E9BA 4CG3A 1ZJZA 1I7DA 3EYWA 4PC6A 1D1SA 2HLHA 4MGKR 2ZETA 3TLMA 1E6EA 1QSGA 4QNNA 4YCJA 4AZWA 3ZWKA 4IDQA 3WIUA 3CBGA 5G3YA 1D2RA 1I3MA 4BU0A 4J0FA 3LOQA 1ORDA 3RQIA 1LGYA 1JHPA 1Y3AA 3CPHA 3H86A 5AK3A 2QDXA 3GMSA 4G0UA 2CLIB 5C8DA 1Q7GA 4NU6A 1VJTA 4BS9A 4LJ9A 1MRSA 2Y1DA 2R86A 3EWNA 1YL7A 1W5AA 1X94A 3CS3A 1YR1A 3W06A 1CFJA 3WLSA 1ZHHA 4K0KB 1CIJA 3NAMA 3K73O 4L28A 4R7ZA 3RUPA 1TF2A 2XNSA 4I8DA 5FOQA 3AEQA 4WAUA 4GKAA 3A6PC 3Q8XB 4GBJA 3V00A 4C1NA 4BV8A 1WMEA 2YMMA 5FTKA 2FLKA 3CIOA 1BVYF 3IEIA 3RG2A 3BWXA 1OIVA 2CUKA 3AI1A 3R5HA 5DTIA 2VSNA 3CSUA 1YVEI 2EQ5A 3FUWA 3INRA 4WNYA 4X9XA 2H00A 2ZIXA 3RLIA 3A1CA 1QP0A 3W8RA 4S0ZA 4PQGA 3MWKA 1HA3A 2GM3A 4KPUB 2J67A 4EMSA 4H6PA 2SKCA 2B2XA 4M21A 4AAYA 1PG0A 1H9AA 3G2LA 3WL7A 4CFZA 3N8DA 1W0CA 3P9ZA 2AXEA 4YT2A 3IKVA 2MSLA 1S3SA 2V3WA 4FX5A 4YQEA 3DT8A 1YB2A 3S55A 4PV7A 1JYSA 1IONA 3HB9A 5F7OA 4MCIA 5EP1A 5DF1A 1U7XA 2X9NA 2HLDD 2A58A 1FSSA 1O9BA 1K6JA 2CMDA 1C0IA 3KZXA 5BSFA 4GEKA 1ONPA 4DCUA 4JA2A 3VR6D 2L18A 3E2MA 3D3EA 1TLLA 2NTNA 3SAJA 1DBIA 1LW6E 3PXCX 5K03A 2BHLA 1ECLA 1YZLA 2AYYA 2PS9A 5HKKD 5EQTA 2ENWA 1KHTA 3I12A 4RDCA 1N2OA 4RQUA 5DISB 3TD2A 1LK7A 2E5FA 3B3FA 1XQ9A 3AEZA 3AB7A 5CYFA 4ZCPA 1XVLA 1COWA 3BFXA 3ZD7A 4EHFA 2GT1A 4R9NA 3W6UA 3UANA 3PHHA 1QZUA 2A14A 5KDOA 1UINA 2PMBA 3R5SA 4FFLA 2JI8A 5BSHA 2JD0A 4JLBA 3FDZA 1VKHA 4MR8B 1KMQA 2ZJBA 1HDCA 1HZZC 1MGOA 1M6NA 2YWDA 3RK4A 3T54A 1T8YA 2K4MA 1ONBA 3M81A 4UTPA 1JZSA 1QBGA 2G07A 1PR0A 2PRZA 2YOGA 3P4UA 4LQ4A 5BR8B 1HNZB 5KVSA 3T52A 1W2HA 1GJRA 4OI4A 2UVPB 4QTTB 4JI5B 2BUBA 3OKCA 4DQLA 4P0TA 2X5OA 1KY3A 4M53A 4JU9A 4D8UA 2DBVO 4P38A 3BWMA 1VP3A 2QYTA 4IJMA 3SJBA 2CBXA 1YZYA 5F2EA 1EU1A 1T4CB 5J40A 2Z6AA 2VTEA 3MNFA 2X77A 3M9XA 3G68A 2D1YA 4U6QA 3WSWA 2F90A 4Z0TA 4AN1A 3GP8A 4TV9F 1RRGA 1JDBC 2RHLA 4QELA 1IVYA 3S5JA 5GIOE 1DDOA 2J6CA 4PPNA 4R2XA 2QLMA 4D6PA 4RJJA 1CP3A 3H3XA 1RPAA 3UK6A 1GAEO 1WW3A 3QOFA 4E12A 3PYXA 4F86A 4PX5A 3UJDA 3U39A 3JTMA 3T3NA 2P2ZA 2A57A 2C03A 2NP6A 1FUYB 1H1TA 2I1QA 4G1UC 4U5XA 3K1AB 3OCXA 1CF4A 4G4IA 2FR1A 4EGAA 2RFLA 4QULA 3GGJA 3EAGA 3B53X 4YMHA 2UV8A 3TLEA 3JZMA 3KELA 1BFUA 3BSWA 1P1KA 2JCYA 3ECAA 4M38A 3DBVO 2PMWB 3BXHA 1PNTA 3F3KA 4HZIA 4MYRA 1HEIA 2ZYSA 3A8TA 5BOSB 4ZI2A 3CLTD 4BZPA 4IIJA 4IDNA 3R6DA 2AOTB 2W6CX 4IFEA 3SSMA 1Y3FE 2DHRA 3WHKA 5IAKA 1EWRA 2QRUA 4DCJA 1NYTA 4CFSA 1BJKA 4K40A 4YRZA 1VLMA 2EX0A 3SF8A 4LYEA 2F6RA 3E7DA 3WNZA 5KWIA 1T9GR 3SXJA 3DLBA 2P9CA 4G8BA 3E9YA 4O1IA 5K3FB 3QVSA 4PCLA 5KYTA 2ZSIA 1A97A 5IABA 1ADGA 3NRBA 2FMIA 1HF3A 2H1WA 4AT1A 1K2VN 1AQ6A 1P1CA 1CJKC 4J7XA 3A4VA 1YOBA 2CNKA 2DGDA 4GZ5A 4HDOB 2O8CA 3QY0A 2JFXA 3QHAA 4MITA 2ZUBA 4JQOA 3P45A 3QWBA 3BXXA 4DWWA 1R0ZA 5IJXA 4WZAE 2GBCA 1G6KA 2WTMA 2JFFA 5JH7A 1FXSA 1P7VA 1TZBA 1M2KA 3G0BA 2G80A 4M1KA 5IJAA 2VTVA 3S2GA 4HDMB 4N3NA 1CUSA 5ICFA 3NP7A 5K6AC 2IPAB 2OYCA 3T7IA 5BVGB 1Y0BA 1X92A 5FOTA 1FXWA 3LRPA 3ZZNA 3OZGA 3C87A 1HPLA 5JXWA 1N2CB 2C31A 1U0RA 2OV4A 4KQWA 4LMAA 3GLIB 1EVZA 5E7QA 1N7IA 2FFAA 2IYYA 4LDAA 4UOEA 2DXIA 4QFMA 2A35A 3CZ9A 5BMVF 1RYFA 3AP3A 4AK9A 1A76A 2B8EA 2EP7A 4YDSA 3CWCA 3UUEA 1TT5B 3V8MA 3K0KA 5LQKA 3VPCA 1D5CA 4X92A 4PQEA 3AJDA 1WSBA 1XD2A 2Y0PA 1EEXB 3U48A 3VQTA 1LJ8A 1WBJB 2GUGA 4MVJI 4DC9A 3AV3A 4ZCMA 5IYZA 1P5JA 4N48A 4MROA 3BN3A 5AK6A 1C8LA 1EIZA 2GNAA 4IDFA 3PDUA 1TKBA 3KYCB 3CTMA 4RHYA 4C5AA 1SKUA 1JG4A 1YMUA 4J4TA 2NPOA 3U6KA 3FA2A 4DIEA 1FVHA 1VPVA 1JS1X 2HF9A 1Q95A 2POQX 2YWJA 4GHWA 4R1UA 3RC9A 3DLHA 2H2AA 4M0DA 2PSEA 1IM2A 1FNSA 1WMAA 3BYZA 4M9RA 4KXMA 2BIFA 2WJJA 5DGDA 3U5ZB 5CFRA 4XE5A 4DCPA 1BQ3A 3ISVA 2VPXA 9MHTA 1EEHA 3OG9A 4M0UA 3C3EA 3VO1A 2H18A 1B76A 2GOYA 2PNFA 3RGWS 1M8FA 5ECGC 4IVPA 4GOMD 3A14A 3EDCA 4Q6BA 2HMVA 1GUZA 2CE7A 3RS9A 1PTJA 1QCYA 2P3SA 4MVXA 3GEPA 1YRYE 1ECCA 1EVYA 1P45A 4DIOA 1FFXA 4D3DA 4FJ1A 1LTQA 4BKOA 3TJRA 2IEZA 1L1QA 4FWBA 3WWPA 4DNXA 3NLLA 1JJBA 4KK4A 4R3NA 3TNFA 5JMWA 4NZNA 1KF0A 2OAEA 2PLAA 1VBFA 4NF2A 4A5OA 5HS6A 2XDQB 1CR6A 3MILA 4CKZA 2WTUA 3ZK9A 2OKCA 4HB4A 5AW1A 1RI2A 3LW7A 4II3A 2Q6LA 1KTVA 2XUAA 1VJ5A 4EB6A 2OGSA 2XD4A 4RZQA 4N18A 4N76A 4IDPA 4P31A 3C5CA 5FADA 1VTKA 5TC4A 3O8RA 1PVVA 4GX5A 5KNBA 3LYUA 4OHOA 1CQZA 3TXAA 5FWYA 3P71T 4I1PA 2J9YB 5TLSA 2NU8B 2HJSA 4OUDB 5KNBH 1Z29A 3JD4A 2WF5A 5FPYA 4C3ZA 2V7GA 3S2ZA 4HWTA 2JJ1D 2PVSA 1NTOA 2L69A 4KQGA 1Z6GA 2MHCA 3P2YA 1PFVA 2P9JA 3N8NA 1GUDA 4Y9RA 5LVAA 5KYXB 1XXHA 1MP0A 1CLUA 3AHJA 4R2JA 3U5TA 4G97A 1T5LA 3U7EB 2FWMX 2JGJA 1QCZA 4Q4AB 4O4HF 2HTFA 2QL5A 2VJAA 1QG4A 3PICA 4CW7A 4CKBA 5D1HA 3PDIB 1X1DA 4MJXA 2O8DB 4WLVA 2CHQA 2ZYUX 3N0RA 3OEYA 2Q0HA 1Z37A 1W35A 3OF3A 4K5QA 1BXGA 4OOEA 3E05A 3L6RA 4YGXB 5F1PA 1JALA 4OD0A 3E48A 1Y3IA 2FCAA 3IE2A 3NC0C 5ALMA 2EEPA 5FP0A 2JG3A 5ITSA 1D6MA 1SCUB 4ADSG 5EESA 1Z17A 4YRRA 5IULC 4LHEA 4X3CA 4QTYA 2JBWA 3JD3A 1T9GS 1GNPA 2XVYA 3F97A 4Q3BA 4WZBE 1DKRA 1MHPA 5CLQA 1NZJA 4U02A 2A30A 1USIA 3P0RA 2HK8A 2Z8YA 3GUVA 2AWNA 1J99A 4RJTA 5H81A 2WABA 4C20A 4YRNA 4QM7A 1WXQA 4TWJA 2Y0DA 1XDGA 1XZAA 2ISSD 4R8LA 5D5QA 5KSOA 3ONVA 4UBLA 3LZ6A 4Z7OB 1MW8X 4CGYA 3IQZA 3QIAA 4EZBA 1XZJA 2ID9A 3OQ1A 1M2VB 1QWOA 3E82A 3WHIA 4X44A 3CSDA 2A88A 1F6WA 1V9LA 2CVOA 4Z4CA 1WSDA 4JB8A 3E3LA 4NJOA 4HDRB 4MYDA 3I6YA 2D00A 4TZ0A 2JCVA 1ZCJA 4QU5A 3S40A 1Y63A 3UFBA 1PU2A 4EATA 3QEMB 3SEZA 3CY6A 2JAXA 3P0IA 3W6OA 4BXOA 2P4SA 3WLJA 1XJ0A 3VM6A 2OE2A 3HRHA 1U31A 1VDMA 1TYBE 3I61A 3EOZA 3GCGA 4XYGA 2W6JD 3P9NA 6REQB 5DULA 1ID1A 3L7JA 4YXWA 5KQSA 1CUVA 2G40A 1ZK3A 5AT1A 2BZ0A 4ONEA 4RHXA 5IKXA 3G8CA 3K30A 3HKCA 4PGHA 1B8OA 2QSYA 2W2TA 4U7GA 4D56A 5THKA 1O08A 3HGQA 5G1OA 2FNAA 2UZ4A 3AKYA 3OLYA 3UV6A 3V2HA 4EHJA 5IVIA 2JVIA 4BVHA 3EW9A 3ZV3A 1D8TA 4GXRA 1H65A 3MTJA 3WIDA 3IB6A 4G0YA 3MUNA 4AG5A 1A8SA 4M0EA 3O4HA 2XBUA 1ZHFA 4HQLA 4XJSA 3W9YA 3H83A 3L93A 1K63A 1QRRA 5AVWA 5E9QA 3Q5DA 3AF2A 4X95A 3WBFA 1NXWA 2FP4B 2YYSA 3PVSA 4ID9A 4M1WA 4BNUA 4UPVA 4N41A 1ZXXA 2MJLA 3HYCA 3H9GA 2RMKA 4N6NA 4EG0A 3QEAZ 5KYKA 5EFOA 1ONNA 3K20A 2VYQA 1NNEA 1XD8A 1VYVA 2GD6A 1XWIA 5EZQA 2A84A 1R0BA 3VU0A 2V9ZA 4H1UA 4MZDA 5KMGB 1E92A 1NW8A 1F5NA 3MMZA 4CIXA 3RRJA 2CLMB 3NVDA 1OH8A 3EC1A 3PX2A 1Z0FA 1DQPA 3LPAA 2FF7A 4CMEA 4N0DA 5CDYA 5JZ9A 2YY5A 4MDEA 4TLDA 1P29A 1UP7A 2WDZA 2IS4A 1O03A 3KB8A 2H4XA 3WWCA 1U8AA 1DAGA 4HOYA 5KNLA 1N6PA 2FAXA 4CEJA 1PVDA 1XDUA 1YZFA 4KO1S 4B6EA 4ENSA 5IJ0B 1NP3A 1TM5E 1GGFA 3I1FA 1R6DA 3IYLW 1UDCA 3ZWOA 3CUVA 2PL5A 3FYUB 4LDZA 5DM1A 1O89A 4ZXPA 4RK5A 4X63A 4LY6A 2M1ZA 4RY0A 4RY9A 3W3AA 4UAGA 4PZDA 4A92A 4CM4A 1EP9A 2ZBGA 1ZL2A 5HFAA 3TLGB 3W3AH 2OV6A 2CBGA 4OX9Y 2QLNA 3VOBA 1YACA 3I0MA 4N0EA 3IAXA 4NFSA 4V0QA 1R8SA 3FUUA 2Q5HA 4PZ0A 4R51A 1U0JA 2JLXA 2XXBA 3R24A 1IATA 1H05A 2Z9BA 3IJRA 3L1JA 1GUBA 3G17A 4X3PA 3WGQA 3E5MA 3L7NA 1NQOA 2A5DA 4CM9D 1QGUB 4DMLA 4EJ0A 4MGZR 3B6ZA 4QATA 5JDIA 3S8YA 4BMZA 1G0OA 2Z58A 3BH0A 4JFAA 2VYNA 3HYNA 2YRXA 4QSHA 1I0IA 1V26A 1HDGO 4MLDA 5BYBA 3DM9B 1XRNA 2XBLA 2NSLA 2SCUB 2ZFUA 3JD0A 3D5EA 1AC5A 2YJGA 1XU4A 2C78A 2R79A 3D0RA 4R31A 5CXXA 3K0FB 5TQVA 1ENYA 3FOEC 1R6VA 4OBXA 5JJKA 1IYZA 4H2DA 4DMHA 2GCIA 1DBVO 1UWCA 4FYYA 1ZNXA 4X20B 1ZWKA 4LAFA 1R4ZA 5D6OA 3ZHBA 2RB5A 4YUXA 4L0QA 4QIHA 2CLLB 2QS9A 5H3CA 1VRCA 4OJQA 4R7GA 1M1YE 2O2XA 3VSEA 3HDVA 4GXQA 1NC1A 5BWNA 2JGNA 3LDAA 1EQAA 2JAHA 4Z2YA 3D2LA 4BNJA 2Q1WA 2IYUA 3MZ0A 4FD2A 2J4CA 5DI3B 3HYTA 3PQ7A 3D7LA 1QF7A 1FU4A 4R0NA 4RD1A 1VIYA 3QYAA 4P7BA 4Y9DA 5T3YA 1Q1GA 4JLDA 5BUSA 5TMBA 5KX5A 3NNDA 1M2WA 2WAMA 3AINA 2PDAA 3DYBA 3MMXA 3HYRA 2YXPX 2FJPA 2QJTA 1NR1A 3E70C 4YDHB 4KE7A 1W1WA 1ZK1A 1M10A 1Z26A 2HLPA 1W4BA 3RIXA 5C5EA 1M0EA 1E1YA 3MS7A 5BMVA 5E3JA 2LKDA 2A9KA 1Z6QA 4KB5A 1P7CA 1Z4QA 2ZJ5A 1PD0A 4P80A 2Y9PB 2WV7A 2Y1EA 4BV3A 4O4LB 1UQUA 4YB8A 5BRAA 2HJVA 5NLLA 5C1DA 3DXXA 4J0IA 3WGJA 4DV3B 5LBUA 2LDXA 2H1CA 3U56A 1QOPB 4OYLA 4N0QA 4MGHA 2HI0A 2EQBA 1OH5A 3WK4A 3WLOA 4TV8F 5KZMB 3PHJA 1PDOA 6ADHA 1W34A 4KRYA 1H2HA 1C2TA 1VFNA 4XPZA 4W63A 1BO6A 4YYEA 1TC1A 4R4JA 3D7SA 3MS2A 2GPYA 4ZT5A 5GPBA 3CSSA 1PIWA 1YFKA 1T9HA 2J33A 4JL8A 1SWVA 4EUEA 2VJYA 1T3TA 2Z2YA 3MCZA 4MWDA 5JD3A 3NV7A 3TXYA 2IHKA 3HC7A 2YJ4A 3UGKA 1PX0A 2GAOA 1XCGB 3OY2A 3PNPA 2W2LD 3DR3A 4X6LA 3AQ4A 2XUIA 5ALSA 2UUAB 3A10A 3WFZA 1CHDA 4PX3A 3SJZA 3ZE2B 1FUIA 3DULA 2VSQA 3W4KA 4HYQA 2FG6C 1CXZA 3FNRA 1E0JA 4WCDA 2AC7A 3NHYA 4QUEA 4GVPA 4U0KA 3HCEA 4FBLA 3LFUA 4CKYA 1SUWA 2PG3A 3EIOA 1T2UA 3JQ9C 5GJCA 3JQBA 1CY8A 4RPLA 4YRIA 2QAGB 1I2MA 1FFSA 2O2JA 4PLVA 3ANYB 5A4MS 5T3UA 2XDWA 1UJ2A 1IHDA 2EXXA 3FNFA 1U98A 4L8GA 5AK0A 3WNCA 2IPLA 1POXA 3KEMA 3Q1KA 4NOJA 2HJ9A 3ED1A 1MIOB 4AJJA 1L4BA 2IHZA 3DR5A 1ZOOA 4LXHA 1FVOA 2GO7A 2HK6A 4E15A 2B1IA 1IJBA 3FTNA 4UPDA 3ZK7A 4GMXA 4OGWA 5LD2C 3E5RA 2YVKA 1OW3B 5CRIA 4JR1A 4CMKA 3ABSB 2IKSA 1CHNA 2G3YA 3TTWA 1RAEA 3MTAA 4XXHA 1WDKA 3D4NA 4G2NA 4OJTA 3C8UA 4JFRA 2DP4E 2H1LA 2NV2B 3HU3A 2J32A 2O20A 2PUWA 1M2OB 2QI9F 2W0SA 1WD7A 2GZ1A 5F73A 2WRZA 4MPRA 4NL4H 2ZCUA 2Y3IA 1I4LD 4RCZA 1NF3A 1PR9A 1ZJ5A 2YS6A 3TRFA 3GD5A 3OQHA 4B3CA 2ZTVA 5A2GA 2DLNA 2QM7A 3LUFA 4EUNA 2P68A 1BVUA 4JMPA 5BSUA 2IIBA 3C3YA 1CVLA 1ZM9A 3WP1B 1E60A 2WU8A 3GBPA 1DQZA 2ZRNA 1G21A 2BGUA 4EG6A 2GBGA 3FCUB 3HTXA 2VR1A 3U62A 2B1GA 2OZLB 2IBMA 5A5VA 1B0AA 3NJRA 3E61A 1Q3HA 3DBLB 2FWRA 4CM8A 1LK5A 1H0RA 2O48X 4CEHB 4E3ZA 2OC4A 2CHUA 4N54A 2XT9A 4TYNA 3N28A 2ZQZA 2QD3A 4RTNA 1IZ8A 3OHMA 3GLGE 2QT1A 3BULA 5LJIA 1ZM4A 4YAWA 1Z07A 5D3MA 4C6RA 4CF4A 1DJOA 4Q66C 3WV4A 5YASA 2C82A 1JHVA 5B5SA 5AM0A 2NVUA 3BSYA 4YRCA 4A3SA 4YNBA 4B83A 2WUEA 3VR4D 1VLVA 3EEOA 4ZI7B 2YZ2A 3AOEA 1DIOB 3QFHA 2XYVA 2EL7A 2FPWA 3SZMA 3MT8A 1BOOA 4CHTA 1Q92A 4L9WA 2BFBA 2Q07A 2Q2OA 3CRVA 3ITKA 4HJRA 2JZOA 1AX9A 1NBWB 3TFQA 4EX7A 3ROMA 3ZR4B 1MEJA 4C0BA 4JP5A 2BLNA 4N7RA 1XFDA 1K66A 3HB7A 3QYJA 4XCQA 5M3BA 1YIDA 4EGFA 3Q3GE 4JGGA 4O1MA 1ZR2A 3SYTA 3PUKA 2CSUA 1LSUA 1ZMTA 3B3AA 3FLEA 4MVJG 2NPIA 5JFGA 2IZ7A 4UEOA 1T0HB 4PPQA 4G01B 5KWSA 2BFEA 2Y1OA 5AKIA 4PM4A 2QYHA 1T0PA 3M1IA 3I4FA 3JPYA 4LVCA 4WXYB 4B4VA 4UD2A 2ID8A 1RMQA 2QN3A 2WVHA 3LAWA 1KQNA 4MUFA 1UKYA 1Y1RA 1NJ5A 1VG1A 3FGPA 4FN4A 2PZAA 1Z47A 2BEJA 4M0MA 5J4YA 1Z8NA 2NSJA 2VDVE 4LNUA 4XCXA 5TPWA 5H9VA 4DDVA 1G16A 4JVMA 2VJBA 4RSRA 2SKDA 2H31A 3HCFA 2HYDA 2CB0A 4N40A 1NUAA 1RKXA 4JB0A 4MIEA 4M7OA 4PLZA 4UHHA 2BFWA 3SHQA 3KKOA 1GZ7A 2MOKA 4M1TA 3LHIA 4FYXA 1CY6A 1TU3A 4IZ6A 2YIDA 2CNDA 1ZUHA 1O96A 2AC4A 3E3MA 4QOEA 2WR8A 3ICWA 4MCJA 1HQYE 3ZKWB 4F9FA 1NUHA 4IUYA 1EFDN 4MUHA 4BZQA 1SU6A 4U2DA 2OXCA 4UUPA 4AC9A 2PCLA 3O3MB 3PEEA 2XY4A 3EWAA 3QKSB 3VYVA 5AKLA 2I29A 3DVAB 4BO0A 2HJGA 2BZSA 3GDHA 5ALFA 3UJAA 4COKA 4JI4B 4NJMB 1NNLA 1N78A 5J58A 1XRMA 2XGSA 3LTEA 1GTVA 2V7VA 3NM4A 3QF7A 4IDGA 2PUJA 4IIFA 4YUYA 1Q7CA 2FZVA 4I4TF 3EXEA 1ZMBA 3ELYA 5JNTA 2ZULA 1P2VA 4KNWA 2JRCA 5B4UA 3B13B 1RYMA 3CG4A 2Z5FA 5ICEA 3HR4A 4EY7A 1BQ4A 3EDQA 3EZ6A 3F6SA 4GC5A 4N7JA 1O97D 1R7RA 2OO3A 2PVCA 2QTVB 3L5OA 2KQUA 3N2LA 1LX6A 1RC1A 2XQGA 2WTNA 1G5HA 3NH6A 3QEOA 3PR3A 4MQFA 4OQXA 5DP1A 1I4OA 3A9SA 4MAAA 3RC1A 1X9GA 3SQWA 1G5IA 2PUAA 1AT1A 3RRMA 1I2ZA 3HB5X 4KR6A 1NOIA 3PD1A 1B0PA 4P36A 4JL6A 1L4LA 4ND7A 1USGA 4PZCA 4XB1A 3U0BA 3NAQA 4HEA1 4L6CA 3ZE8A 2HSDA 4BU1A 3A1UA 4EG4A 1F2DA 4CUJA 2QBYB 4L4ZA 3C8MA 2JL1A 3RUEA 5LDGA 2C95A 2XMCA 5ALTA 3EXIB 1GAWA 2NU9A 4W8OA 1FY2A 4GBMA 1SVOA 3OX4A 4KLRA 1YR3A 3AR4A 5JROA 3JYLA 5FJJA 3TAUA 2WIAA 4X1KB 1SUBA 2EGGA 3BHNA 1M34A 4ND8A 2EKZA 1N6OA 1QVRA 4XWYA 1YDHA 4RVOA 5BYJA 4PU0A 3S99A 3V2IA 3SXUB 4EJ6A 1ECJA 3IB3A 3MWJA 1BCRB 2CUTA 4LPKA 4DWJA 4IIVA 3TAXA 2QTLA 1GIAA 3GA7A 3MTIA 1UOEA 4WLEA 3NKFA 1L5HB 2HD4A 3SBOA 2A7XA 2QYOA 1RXYA 3RTCA 2M9MA 2ZTUA 1U7DA 4O5OA 4BE7B 4EAQA 2V7TA 1N7JA 2ZWOA 5JLAA 3FPFA 1T0JB 2FB9A 2X3FA 3CF0A 1JAZA 1IMJA 3T7SA 3ZZMA 3OBIA 3I32A 5BUCA 5IDWA 1UBJS 4X3OA 3CLVA 1O77A 3SLGA 1IUNA 4B3JA 3G1TA 2DPGA 3L82B 5EIEA 1P39A 4C4ZA 2B4AA 3IBTA 3T5CA 3AYZB 1DAIA 3V4OA 1T8RA 3CE6A 1P7YA 5G2OA 1HLPA 1P0QA 4K9QA 2R65A 4DNQA 2GYYA 2WM2A 4AQYB 4HHEA 4TMZA 2F8SA 1QTNA 2BYTA 2W9XA 3I04A 2B37A 3WWDA 1GZ5A 2V7QA 3D3WB 4HNAA 2BZ1A 4EY4A 3A4NA 1NY5A 3I42A 5I9TA 2RJNA 3HVJA 5DHUA 2JARA 3WAKA 1QHHA 4ISBA 4PZLA 4QJIA 1G7TA 3V7WA 2ZIAA 4MEBA 2HZ7A 2XD9A 3DWIA 3RADC 3F5DA 2FE4A 4EF5A 2AXPA 3IQWA 3KQHA 3DH0A 2CXXA 3Q3VA 2VC2B 4D25A 2NSYA 4Y2YA 5EEHA 3IR5A 2UU9B 5FLEX 5EXXA 5LPNA 5EINA 4DV0B 2JD1A 3HDGA 5ERYA 4C0LA 1YZKA 1ZUIA 2JFPA 3AY7A 3P9PA 1XRQA 3TBHA 4WXRA 5J5AA 4PN7A 1B23P 3T99A 5HK8A 3CX3A 3ZUPA 3O7WA 2JPDA 3A1DA 3DHNA 4ZO4A 1PCXA 4LJKA 3L0YA 3VNSA 5DWVA 2BPOA 1XAJA 3G1UA 3RHSA 3PWTA 4OJNA 2HMUA 1MAVA 2PY6A 3KTAA 4Z99A 4NU8X 5FUMA 2C1ZA 1NUUA 3EGIA 4QJ3A 3MC1A 4OMUA 1F3LA 1ZRSA 4OVKA 3Q9NA 1LQ2A 4X0EA 2KI5A 2A92A 2R7AA 4YBRA 1USWA 3VUFA 4E30A 2ZKIA 4GFDA 4KAJA 4KMRA 5M2QA 4QASA 4WNCA 1FYVA 2YCBA 1K7CA 4KDRA 4AY3A 3LDHA 4HD8A 3OJCA 3WYBA 4PC7A 3TK1A 2RI6A 2FWBA 1JEDA 3DTYA 3C3DA 2Q4DA 3DQQA 5EIHA 1T5DX 4BDSA 4MW6A 1L3BA 4TROA 5AI9A 3PZBA 2JLBA 2B34A 1KI4A 3AEKA 3THYA 1A7AA 1KZ9A 2EZUA 1PWYE 4QU0A 3H1EA 3OKPA 4YTEA 3GCDA 1XL0A 1BGVA 4D8YA 1JDSA 1SN7A 2X42A 1U80A 5DTRA 1D2CA 2WU0A 3FYDA 3V8BA 5I7VA 4P3NA 3X1WA 1HLGA 1T91A 3MM4A 3N5CA 8MHTA 3PDHA 3KK0A 4EVIA 2VDOB 1G2QA 1LI4A 2V6GA 2AFIB 1ZS9A 3DE5X 4A8JA 1KP3A 3H9CA 2I6QA 3C6MA 2AG8A 3KUXA 2XUOA 4KFRA 4GI2A 3H1FA 4M7WA 4D45A 2JIRA 2FG7C 1AXEA 4X84A 4HVAA 4XEUA 2ATCA 3NETA 2ZBFA 4HEA6 4WK2B 1MABB 1NOJA 1VJGA 4ZVVA 1EIWA 1PZMA 4WI1A 4YV7A 3NIBA 2DKFA 2J4FA 5HIAA 3GP3A 4GVXA 4XKJA 3R5KA 2QEQA 4LRWA 3AERB 3SIWA 1JLRA 2Z2XA 1EK1A 3A7EA 2WZCA 3BC1A 4NI5A 1E3TA 2IV2X 1AQIA 1I13A 1OYWA 4R7TA 3EUFA 4L74A 1MQSA 4YP7A 1BWQA 5AVXA 2BP7A 1G291 1D6NA 2NOAA 1K7FB 2BGGA 3QUBA 4YYZA 3QVWA 3C45A 2JKYA 4NARA 1NBIA 3HV2A 1ADCA 4JGIA 3GH1A 4LDNA 2ZSUA 3H04A 1PI3A 2PO7A 2ID4A 1PR3A 3AEXA 1XJ5A 4IXMA 1TK3A 1US8B 1RWMA 1WX1A 2P2SA 3B1KA 3K0CC 3DAPA 2Q8PA 4LCEA 4RPIA 1R4NB 3N86A 1AB6A 2LP4Y 5IJWA 2A0YA 2I71A 1XKXA 1V95A 5HHTA 3KR2A 2MMGA 5DYYA 4HQ0A 2Y4OA 1OFUA 3ZNPA 4QFCA 5JRZA 1EGMB 2IUYA 2OCPA 2VP2A 3LKZA 4QLAA 1RLTA 4TPKA 4X64B 3OPVA 4M86A 2CXOA 5FB3A 3UA4A 1UT8A 4NS4A 2WT9A 2WJHA 4QBKA 4ZCRA 4G4SP 1ZU5A 2HB6A 1XVUA 4LA4A 3L7MA 3TPFA 1DUSA 4DTCA 5JAMA 1EG2A 1R0SA 1Z8DA 3TOVA 5AW4A 1HTTA 4J43A 2WIFA 4LHZA 4QQKA 2H65A 4G9BA 4TQUS 3RK0A 3K1TA 4CMEC 1W52X 1SKAA 1N6IA 5L3ZA 5HMMA 1G41A 1YZNA 2H8GA 5BY2A 4D0RA 4J3FA 5D3KA 3NALA 3L79A 4HGOA 4HKTA 4RA6A 1D03A 4WESA 1J70A 4CV0A 3U4HA 2G5CA 4B4DA 5F2NA 3PGMA 3WIOA 1PJAA 1R0RE 2FN8A 4V2IA 2HO5A 2R8RA 2K2WA 5B1SA 4NBLA 1QTQA 1KFBB 4O33A 3CPJB 4OHBA 1P5RA 2FUG1 3QUSA 5TMDA 1DTSA 2ENUA 3ZTYA 4HFRA 2H3EA 5CMLA 4EEKA 3UXHA 2D3WA 2D3TA 2Q5QA 2VHJA 1JHMA 3X43A 3ZDEA 2P9QA 1KIMA 1MLDA 1OZGA 1PZGA 1PNQA 3RSQA 2M6RA 3IBSA 1CWUA 1YJQA 5FTLA 3ICOA 2W4IA 5T4BA 2WQ6A 2WAAA 1PGOA 1OMOA 1CE8A 2ZRGA 3TPCA 1WQ1R 4F2HA 2OZEA 1B3RA 1QAOA 2HRQA 1AZTA 1R1DA 4EVSA 1ML4A 3B8HA 1R27A 3LDGA 1RJDA 2C7BA 3AZPA 4F2GA 5A4FS 1F2UB 1W1UA 4RPJA 1AK2A 2AVDA 4E94A 1EP2B 1LJUA 4BP1A 2B2NA 4FWTA 3FLBA 3I6BA 1SC6A 4I4TA 3EGVA 3E58A 2QRVA 1FNCA 2XOKA 3C6KA 1P4GA 3LWBA 4C4AA 5FBKA 3TLAA 3UT0A 2YV1A 3L6UA 3LT2A 3O74A 4KVAA 4NV1A 4UM7A 4F11A 2H1OA