4QG7A

S.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
197
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 82
structure length 197
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qg7A00
1HEIA 1RZ3A 3QXSA 4DIEA 4NH0A 1E3MA 5KHOC 1JNYA 1ONBA 1XTQA 2WM9B 2IHYA 1ZU4A 1YZGA 4BLRA 1G64A 3WHLA 1PV4A 2CCKA 4G01B 2B7BA 4JLDA 5FL7D 2AKYA 3T1QA 1WA5A 3HDTA 4XD7D 2RGBA 1HT2E 2ONKA 2HT6A 5TV2A 1Z47A 4Q4JB 4O2LA 4HLUA 2DWOA 4D25A 4FXPA 4DT1B 2J1LA 1F2TA 1XP8A 1M1YE 4CT5A 1D5CA 2G3YA 4TT3D 4KYIB 1AKYA 2D74A 4FWIB 5LBIA 2HF9A 4KFRA 2H7VA 3NEJA 5E95A 4V0NA 5JJKA 1VTKA 2IF2A 2P6UA 1T0JB 3PFIA 1KK1A 3PUWA 4G3XA 1IXSB 3AKEA 3BB1A 2HDNB 5EUMA 2CJWB 2KBFA 2HJVA 3PIRA 4GDFA 4TMKA 2BBWA 2X8AA 3B8HA 1YQTA 3CX6A 1W4RA 1ZBDA 4JKYA 4WAUA 3UKDA 4YMUA 3KJHA 3TE6A 4ERNA 3LDAA 5EJEA 5JWOA 5FUWA 2GJ9A 1V43A 4YQFA 4Y0AA 2FFQA 4UXHA 2I1QA 1W0JA 1GP2A 2ZJ8A 2FPKA 4HUTA 2WSMA 4YMVA 3EPKA 1KO1A 2ANCA 1KY3A 1QBKC 2G83A 2RHMA 2QTHA 4ARZA 1G16A 4P4TA 4PC7A 4Q1BA 2QROA 2A3RA 2VBCA 3DM9B 3ZDQA 3LA6A 1R8QA 2EFDB 3RS7A 2NMVA 2H92A 4RFSB 4PPFA 1M6NA 3ND9A 2V3CC 1JPJA 1L4UA 2HCBA 4FMBB 4IEIA 4F7WA 2X1VA 5FPHA 4NBSA 1MT0A 2MMGA 3HPRA 4QOSA 1KZGB 4UXIA 1TU4A 3CF0A 3U60B 1P9NA 4KODA 4NYIR 3C41J 2TMKA 3K53A 3J81k 1G3QA 1OFTA 4P3YA 3UWKA 2MSCB 2CE2X 3KFXA 4YONB 4TYNA 4D4JA 3KL4A 2Z43A 1LY1A 1N5IA 1Q21A 1CU1A 2QMUA 3B7GA 4M0LA 4TSFD 5P21A 2CHGA 5JMTA 2OCAA 1E0SA 2ZSFA 3A6PC 4HB3A 2JJ2A 4C3ZA 5DHAA 2C98A 4BEBA 3KQUA 1DG1G 2FNAA 1Z6TA 3PXGA 3PEWA 2WV9A 1A7JA 3CIOA 3FMIA 1GG2A 1IN4A 3BB4A 4N3NA 3OIVA 4UNSA 3MWJA 1S1MA 3CPHA 4Z1MD 3B2EA 2DCUA 4BFZA 1LW7A 2C8VA 3RS5A 3VQTA 4C0SA 4W5JA 4LPKA 1V5WA 1N5KA 1RRPA 3R7WB 2PL3A 4BECA 5E4FA 4XWOA 1QHIA 2RGXA 1J90A 1PLKA 5DI3B 4OYHA 4LY6A 3VR3A 4C9BA 4DDTA 3B1YA 2IEZA 5IHPA 1KHTA 3LBHA 1NVXQ 5EZ5A 3ZZUA 5HKKD 2OESA 3OAAA 3RRZA 3CZPA 3ADBA 3KQHA 3PJRA 2WVJA 2W6ID 1NN0A 2BHRA 4EPWA 4D26A 2QRNA 5GADl 2JJ8A 2ZYTX 5GVSA 1HQCA 3K09C 5IF9A 2C96A 5J40A 1QHGA 5BQ5A 4MGIR 1SZPA 1UFQA 1YKSA 1XU4A 2UZ3A 5KTYA 3OEHD 2DFLA 3FPAA 3DMDA 1P6XA 1U8YA 1MABA 2ZE8A 4YLGA 4ZCLA 1MABB 2JLUA 3EIHA 4DC9A 1J2JA 4LGMA 3BJIC 4OQLA 1CIPA 3BK7A 521PA 4C0AC 1W44A 2CLDX 2JDIA 3LW7A 1XMVA 5BW8A 3DDCA 1NMYA 2C03A 3QBTA 1JXMA 2G0TA 3M6AA 1CBUA 4XVRA 2D2EA 1RKBA 3GEEA 4IOMA 3I8SA 3RSOA 4XSHA 4AYWA 2VLIA 2R8RA 2PCLA 1EFTA 3AVTA 1WRBA 2Z6VA 4DLSA 1HE1C 3B1XA 2QBYA 4NE2A 3GJ3A 1NKTA 2HJGA 3EC2A 4GMXA 3SU8A 1G3IA 1RPZA 4PAMA 1F60A 2Q9BA 2BMDA 2BM0A 2G6BA 5UKDA 5GVRA 2VSXA 3GLHB 1EFRD 3H1TA 3QXJA 2CL6X 4IVRA 1NBMA 1TX4B 2NTYC 2IYQA 3EIQA 3OIUA 4LJYA 4NCKA 4TL6A 1XMSA 1G18A 1KO7A 4A8JB 4IOKA 5FBRB 3OEHA 1IXZA 2FFHA 1MO4A 4DSOA 2QAGB 2ORIA 2HXSA 2NO1A 2F1IA 3OESA 4GRAA 1OH5A 1G3MA 3QXXA 4LV5B 4NU0A 5FPKA 1SKQA 3R9WA 2QE7D 4US0R 2C9OA 2D7CA 3KTAB 4NDZA 3O8DA 1UBGA 3K0AB 4BGDA 4PSVA 1SXJE 2ODEA 3GJ8A 4ZIRA 5TARA 1W36D 3GLGB 2W58A 1M34E 4XOIA 1SHZA 1Z6XA 1FP7A 4DEXA 3U7FB 1XBTA 5J4HA 1G8HA 3CH5A 3VKWA 1Q22A 1P3JA 1M2OB 2DHRA 3MJRA 2ZI9A 4NPHA 5JJIA 3BOSA 1BYUA 1LNZA 1E99A 1QDEA 1KOFA 4ZDIA 4IFBA 2F1RA 4JLOA 1E98A 3UXMA 2H5EA 2O8EA 3T15A 4FMCF 2GAOA 1N6HA 3QF7A 1KK3A 4A1FA 3JZAA 4O3MA 1LB1B 3VKGA 4TN1A 4EDHA 2QNRA 4DCNA 1XXHE 4V0MA 1U2RA 4F92B 3DM5A 3IEVA 3AF4A 4GOXA 3DZDA 1CKEA 1ZYUA 1YJ5A 2J0UA 3K1JA 4BZXA 4TSFA 1OKKA 5F9HA 1OHHA 5L3QA 2AXNA 2EFCB 2FMXA 3PG5A 4Q02A 4Q9KA 3WMEA 2DBYA 2JLWA 1OYWA 3DMNA 1OJLA 3I5XA 5BWMA 2ZSEA 2ZAMA 2ZS7A 5EE3A 4M22A 2GESA 1C9KA 2VSFA 2NGRA 3EA5A 2PMKA 4DIDA 1J8MF 1HUQA 4IVPA 2LCFA 1GKYA 2GXQA 5IK2A 3AF3A 1VG9B 3NTUA 4Q4AB 4ILEA 4TT3A 1J8YF 3VX3A 4DCUA 4WVFA 2OUKA 3TQFA 2FSFA 5EQTA 5IRCD 4C0LA 1FL9A 4Q9IA 2C9CA 4CRWB 2RGNA 1I2MA 1UDWA 2JJ1D 2CL7X 3F0TA 5FL7A 1FP6A 3JVVA 5JBQA 4GPTA 1KDRA 4RCZA 1WQ1R 3T35A 1FPMA 2HLDA 4LJ6A 2AX4A 5CYOA 2ZUBA 4I81A 1CEEA 1KI2A 3NHAA 4KITB 2HXYA 1C4OA 721PA 4WBSA 1D6JA 4NCNA 3SHFA 2CHQA 1VCNA 4NONA 4D81A 4ZDJA 4DDVA 1KAOA 4OQMA 2A9KA 1Z22A 1ZIPA 3AKCA 5EP4A 2H8KA 2W2XA 2ZI3A 2IYXA 2XAUA 2QTFA 4RD4A 1OH6A 1XD8A 4YMTA 4MA4A 4XIGS 5IT5A 4XSGA 3GLFB 2E1RA 4QGGA 3IO5A 2WMOB 4ITRC 3IPYA 3W34A 5H68A 1P7CA 5FI1B 4KV9A 1RYFA 1XJCA 3I92A 1YZQA 2EVWX 5HZHA 4M53A 4QHYA 5J4KA 3QKTA 2V7QD 3BAFA 4M1MA 3L82B 3ND8A 2QG6A 2QQEA 3SJAA 3SNHA 1RVDA 4A0FA 1FNMA 4U02A 3VTKA 3P26A 1BH2A 1Q1ZA 1WCV1 3HR8A 3TSOA 4B3XA 2CHVA 6Q21A 3OEEA 2IS4A 1ETUA 3HYRA 4CEJA 1Z0AA 4D80A 5KOYA 2N1BA 4WZ6A 4ZIRB 3GPLA 5JRZA 2YVUA 1II8A 3DHWC 3FYHA 5HZKA 4LWZA 2RHDA 2JGNA 5KSZA 2W2TA 2CEAA 1N3BA 1NVVQ 1S2MA 4LBWA 1ZP6A 4TYPA 2W2VA 2R6CA 4POAA 3PEYA 3CNOA 4E5UA 2PZFA 4MYHA 2XNSA 3P1JA 1NSTA 5DI9A 1KNQA 2JJ1A 2E87A 5CJ2A 5E7IA 1A5TA 2FGJA 3B6EA 3ZIAA 821PA 4Q4HB 3P4YA 1XEXB 4PPGA 3BH6A 5LDDC 3KKQA 4IOLA 4OK3A 4S35A 2YHSA 3O8RA 2BBTA 4ZCMA 1LVGA 4JBYA 3LD9A 4HB4A 1YZUA 4QGFA 1E9SA 3FTQA 4DLWA 2GEVA 5JFGA 2R6FA 1IAQA 1Z08A 3WP0A 4OQXA 2NO9A 3QXHA 4NYJQ 1UJ2A 4B3DA 4RKEA 1NG9A 1U99A 1DO2A 1MO6A 4JLPA 4DSTA 2XZOA 1OKKD 3C5CA 4GP7A 4PQYA 2R2AA 2PBRA 3HP1A 1FNNA 1NN5A 5CYPA 3E2IA 3N2IA 1AGPA 2WICA 4PHGA 2Z5FA 4JT4A 3W6PA 2O8BB 3R9IA 4A2WA 2OT3B 4QHSA 2HYIC 5CK5A 5FTLA 2J0UB 1TU3A 4HAVA 4DEYA 1AZSC 4A4DA 1CJMA 3AVXA 4RKFA 4W5WA 1HT1E 4AG6A 3IO3A 2G0NA 2GAAA 1GIAA 4XVUA 1G5TA 2J46A 2ZI7A 5H1YA 2OV2A 5L3VA 1FW6A 1SXJC 2IS1A 2R62A 1J70A 3LXXA 1T5IA 3GCGA 3A1SA 2GILA 4HLCA 1KO4A 1AGRA 1E9EA 4K8OA 1UKYA 3GP8A 4R2HA 4OQFA 1Q1QA 2PH1A 4LHYA 2BKUA 4PR0A 4Q4LA 4JKIA 1H65A 1ZNYA 1JEEA 3AV0B 4D4MA 2QT1A 2REBA 2P0EA 8OHMA 2J0QA 3I73A 3I5YA 2GCPA 5HR5A 4LV6A 3BERA 1ZCAA 2W6JA 2DWQA 1PLJA 5SZIA 4QKQA 4RSGA 1WF3A 2IEYA 1P72A 2CVHA 3QVUA 4Q9HA 3PQCA 4QBHA 3UANA 2DFNA 1WDTA 1CR2A 2AWOA 1U0LA 3RSLA 4A15A 2CCGA 1U90A 2EYQA 3FMPB 1TMKA 4MQBA 2RAPA 1Z0JA 3TAUA 5E7JA 4RY2A 1JXOA 2ERXA 3D3QA 2OO7A 5AJYA 3C5HA 3SYKA 4AKGA 1QHXA 4LC0A 1KSJA 2F55A 1US8B 3NH9A 1G41A 4LI0A 2QORA 3O8CA 3V4RA 4AKEA 1KKLA 4LJ4A 5EP1A 2WWGA 2X2FA 1GAJA 3K0EA 2FX3A 3TR0A 1ZM7A 3N70A 2JDID 2PZGA 4RFVA 1OSNA 1GL6A 1OXSC 5A4JA 2Q21A 1D2EA 2JLQA 2VSOA 5ANRB 3K0CA 2WIBA 2XNDD 2BC9A 2O0HA 2FV8A 2HEIA 5GJVC 3A1UA 1FTSA 1NVUQ 1DG3A 3Q9LA 4BLSA 1E0KA 3KQKA 4Q4HA 3NH6A 3G5UA 1N0VC 3V00A 2NQ2C 5BYKA 1R0YA 4PHTA 2JA1A 3C14C 4GMDA 2C04A 1F48A 1SVLA 4RVCA 3GJ4A 2VL7A 2ZEJA 5LB4A 2WOOA 2ZANA 1U0JA 5L3SB 4ZKEA 1R0XA 3CX7A 3EZ6A 1H8HA 4B6EA 1JECA 4HUQB 1RRCA 1E96A 2GBLC 2REXB 4CEJB 3EC1A 1E1QD 2JLSA 4EQ6B 2CXXA 2GK7A 3K9NA 3QKSB 4Q4JA 421PA 3GJ0A 4DB2A 2ZE6A 1TNDA 4Z8XA 2WPDA 2IS6A 1OXVA 5K8TA 3TJZA 4JYCA 2JJ2D 4R2IA 5F9FA 1E2MA 5FFMA 4A92A 4F38A 2GJSA 1NIPA 1M8PA 4UJ5A 1GDDA 3KKPA 5TVKA 3DL0A 4BFVA 4QJ4A 2IYLD 2FFAA 3EZ7A 3RABA 4E09A 4EKDA 3ZVNA 4FMDF 4CIDA 4DHEA 3BRWD 3B1VA 1KKMA 2IYSA 2ZRJA 2QENA 3QKSA 4HYYA 3SYLA 4LOAA 4DCTA 2ZJZA 3TBKA 4LDJA 5KDLA 1YZLA 3KJGA 4A6PA 1OLOA 3W6OA 1TPZA 2XZPA 2WKPA 4GT1A 4HUQA 2PX3A 1FUKA 1S4QA 2IYWA 2OCBA 3A1VA 2WWIA 4BLOA 2NO0A 1X86B 3BFVA 4IFEA 2ASEA 1GNRA 3HU3A 1DELA 1NL3A 2ODWA 2OXRA 3ICQB 4KJZA 1K6MA 4GI7A 5GJCA 3AUXA 1Q20A 2YOHA 3A4MA 5B58C 1VKJA 5J47A 3LY5A 4B33A 3OFND 4RZUA 4KYUA 4LYFA 2F3RA 5JLJA 1XPRA 4WZAE 1BO6A 1E9DA 2IUSA 1W0JD 5AUQA 1JR3D 1KAGA 2AN9A 4ON9A 4ARZB 1YHNA 2AKAB 4TTQA 3OIYA 2PT5A 1AZTA 1F2UA 1JALA 3HWSA 4P4UA 4PHHA 5HE8A 5E3HA 1NKSA 5L3RA 3REFA 2ZRIA 1J99A 1AA9A 3UMSA 1P61B 4PSAA 5TB5A 2B7CA 1TAGA 2VHCA 3P4XA 2DB3A 5B2ZA 2WSSD 2K5UA 1VHLA 4BRWA 5DNYB 3D31A 2FOLA 2ZRDA 2IF0A 4IOJA 4JLKA 4EJSA 2RKOA 4TZ0A 2YZ2A 1UM8A 2F1JA 1G7TA 3GLGE 3THXB 2HYDA 2OLKA 3VR4A 1OF1A 2H17A 1VPLA 4TYYA 4HAZA 2FWRA 1UBCA 2ZVQX 3G82C 2A5GA 4B74A 4GZMA 3U44A 1XZQA 1JJ7A 3MUFA 5L8VA 4G1UC 3N5CA 4OJKA 4I4LA 3QENA 3K70D 4URWR 1CJUC 1VIAA 2ANBA 4V0KA 2DWPA 2RB4A 3IHWA 3I72A 3VHLB 4IEEA 3CZQA 3FFAA 4KFTA 1JJVA 1E9CA 5FTMA 3BFKA 3U3MA 4KHZA 4Q18A 1YU9A 1CR1A 2JCSA 3NHBA 2IA5A 4GNKA 2XNDA 5JHGB 1HQYE 4JSYA 1CS4C 1G7CA 1QZXA 2W83A 4LJ8A 5FTJA 2V6IA 3SI7A 4C30A 2ZYUX 2AD5A 1XDBA 5M04A 3U3RA 1VG1A 1PLLA 3MRSA 1HV8A 2Q3MA 1N6IA 1FMJA 1SVKA 2P5TB 4IDHA 4TMWA 2O8BA 2R65A 4A0GA 2O8CB 4ZDWA 2GZAA 2ZRPA 1E2JA 1R6BX 4I1VA 3TIFA 2PT7A 2HV8A 1TUIA 4Q1DA 1E2NA 1OFIA 3F3YA 4D4LA 3C4JA 1ZM2A 1XEWX 2QAGA 3H84A 2J5XA 4FD2A 4R7ZA 1B23P 4PHFA 5AJZA 1QVRA 3X1DA 1QRAA 3IIJA 4PQFA 4XWAA 3Q5EA 5DIFA 5DN6A 4BFSA 4JMPA 4URXR 2BBSA 3KDSE 1GVNB 1U98A 2ZITA 2ZRCA 2BM1A 4KBGA 4FI3C 2CMKA 3L0IB 4KAXA 4L9SA 3B9QA 1YR9A 3ZZTA 2QMOA 1NF3A 4MRPA 4B3CA 2V7QA 2WJJA 4DRZA 1U8ZA 3KKOA 3NC1C 5IDVA 3GLHA 1DARA 3MG9A 1SKYE 3TSZA 3LVQE 3N2EA 5CK4A 4ZCIA 2W6JD 1NP6A 2FZ4A 3KTAA 4RZ3A 1BYIA 3X1XA 1DAHA 2YWGA 5CM8B 4C0KA 5HTKA 5E7MA 1FUUA 3IQXA 4BFUA 2WJIA 3ADKA 1Z6YA 4QRHA 4C7OA 1T8TA 1XCGB 2ZJ2A 3AGQA 2CCJA 4G0NA 3U2QA 2ZJAA 3IIKA 1VCIA 3SBDA 4DLZA 2WJVA 1E2EA 1AS0A 1VG8A 3L0SA 4GZLA 1ZM4A 5K8LA 4HDQB 5KPDA 3U3KA 4CT4B 2XEXA 4II7A 3SZRA 2WWYA 1G291 1WBDA 1W47A 2NPIA 2VRWA 1NY5A 2A5DA 4LSGA 1XTRA 2OFXA 1R7RA 1SGWA 4KVGA 4JVLA 2P3SA 5A0FA 4ZKDA 3CNLA 3AEZA 2HLDD 3LWNA 5LB2A 1DAGA 4ZI3A 1H8ED 3AF1A 1Z29A 1AQYA 3GQBA 3JVUA 2GCOA 121PA 2Z4SA 4LUCA 1T6NA 2ZR0A 2ZI6A 2J3EA 2EU8A 3CUEF 4BFWA 2JIZA 4C7OB 2GXAA 4DLYA 4JVMA 3EXAA 3W90A 1W48A 2YKGA 4EFMA 1XJ0A 2GWHA 4F93B 1XD9A 5IK2D 4IJMA 3FHOA 2WAYA 4LV8B 1TQ6A 3U3OA 1LS1A 5CIQA 4Q47A 2D06A 1O3YA 1UEIA 1ZNWA 5DO9A 4FCTA 1OV4A 1DAEA 3NBYC 2R44A 3UG7A 2GNOA 5JECA 1AS3A 2Q9CA 2VP0A 4Q48A 4B3GA 3C7KA 3KXLA 1ZNZA 3FMOB 1QHNA 4OL0A 4EPTA 2NG1A 2QT0A 3M0EA 4M2LA 1WBBA 5AWFC 2WJGA 2IXEA 4G5OA 3T61A 3OFNA 1KDPA 1IQPA 1FTNA 2KE5A 3ICEA 1G9XA 1GNPA 1KSHA 3THWB 1GL7A 2ZU6A 1ZIOA 2LWIA 1EG7A 4DUGD 3JZMA 3GLIE 1CXZA 4M9QA 1Q44A 1PJRA 1BMFD 1D9ZA 1II9A 1P60A 1W4AA 3F8TA 3IQWA 1SVWA 3TVTA 2X19A 4OKSA 3BC1A 2ERYA 4TLCA 1XXHA 1AK2A 3AVPA 4PQRA 1KSGA 2O8DB 4BFXA 3QEJA 1KYIA 2CVFA 4OQNA 4MYCA 4AYXA 4CGZA 5FOVA 1R0ZA 2X2EA 1E9FA 2ZVPX 3BIFA 4H9GA 4QL3A 4P32A 4V0LA 2QPAA 2PEZA 5HPYB 5TMPA 3PV0A 1FQKA 1E2KA 5EXTA 4QG7A 2YC2C 5FPYA 1QHHB 4F4IA 2ODBA 2FN4A 2VHQA 3VAAA 1DS6A 2ZJ5A 4A36A 2WPDD 4HSEA 4NCJA 1M7GA 3ETLA 4DVGA 3FHCB 3LLUA 1E1QA 3SQWA 4OI1A 1UEJA 1VECA 4P0TA 4CYMA 4IW3B 3SFVA 2R6GA 4OHXA 4F4JA 1H8HD 1FX0B 3AKYA 3EZ9A 4EAQA 1DOAA 2XTNA 2ZXUA 1E2HA 1VYTA 2RGNC 5ELXA 3GLGA 1U81A 2QL6A 1R2QA 2V9PA 4AI6A 4EPXA 1VG0B 2DPXA 4RD3A 4NCIA 3AVWA 1JQLB 1XNJA 2F7SA 2A7QA 2H1LA 5KDDA 3L0PA 3U5ZB 3PEUA 4B3FX 3KUDA 4UNRA 3VU9A 4ASUA 3FKSD 4JSTA 3WY9A 4TQ9A 3GJ5A 1II0A 4TLDA 3ZLJA 1OE0A 1L8QA 3W6NA 1E9BA 2XTZA 2GKSA 1WB9A 3LLMA 4DLUA 3MFYA 4HAUA 4LBYA 4AG5A 4AC9A 1RJ9B 2VP5A 3LW8A 3GLFE 3ZS8A 1XJQA 2GF0A 2OCPA 4MYTA 1G3UA 1E94E 1SVMA 1W5TA 3SC3A 3HU2A 2HF8A 4IXMA 2QP3A 3MSXA 2OAP1 2OAQ1 4O2RA 3D6TB 3RS4A 2AK3A 2ZRFA 1MO3A 4BLPA 1HURA 3SHWA 2L0XA 1K5DA 3TKLA 5B64A 1KMQA 1TF5A 1OB5A 2QSYA 3AVVA 3MWLA 1PUIA 1XCPA 4JJKA 5HCNA 3RWMB 4U00A 4A8JA 1E69A 1E9AA 3CF2A 2ZYWX 3LX8A 1E2FA 4LC1A 4ZO4A 5C46F 2N42A 2IX3A 3SYNA 2UVQA 3AF2A 1OFHA 4RD0A 1OH8A 1FFHA 2F1HA 2OHFA 4JLAA 1BIFA 1Q57A 4JL5A 2XXAA 3TSWA 4M1SA 2ZR9A 1AS2A 1NN1A 4W5HA 2WWFA 3QUSA 5C2JB 4D6PA 5L3SA 3TUJC 1MKYA 2VP4A 3ZS9A 2JLXA 3AP1A 1Z6AA 4FINA 2YINC 5EE9A 4NHOA 1NBME 4PXAA 1JB1A 2QGNA 1KJWA 3DKVA 3FE2A 1Q1BA 4TLBA 3PVSA 1SKYB 1E2IA 4PTLA 3RRMA 3SE0A 2XOKA 5CITA 3TK1A 3FDIA 5SZHB 3GMTA 1ODFA 1QVAA 3QOFA 3K70B 4MKHA 2G77B 3OIWA 1SVIA 3FMFA 1IXRC 2ONJA 2IC5A 2WAXA 3B82A 3P20A 2E9SA 2BEJA 3CX8A 4TMVA 5KUTA 4DDWA 3Q5DA 4EFNA 3CRRA 1J7KA 2PJZA 3WP1B 3CNNA 4MDFA 3W3AA 1R5NA 4Q1EA 1XFAA 4TL7A 1W4CA 3A1TA 2C77A 2VA8A 1VYUA 4NTZA 4A82A 2F43B 2BBOA 1Q12A 3EZ2A 5DLQC 4QM6A 5J4YA 5BXQC 1WP9A 2R9VA 3EG5A 4X8HA 2QMEA 1S1CA 4MYUA 4B6FA 2OEPA 5SZKB 3VR5A 2EFEB 1RJ9A 4D0LB 4ESHA 2J0SA 3R7WA 4BWYA 1D8TA 1SXJD 2V1XA 5DE3A 3TMKA 3OE7D 1XMIA 3KX2A 2QQ0A 5G53C 3VMFA 2ZUCA 2O8FB 3ONWA 2ZE7A 4QFMA 1EGAA 2V8OA 3AH8A 2FGKA 4RFSA 2W00A 1P9WA 3WNBA 1VCOA 3EW9A 1X8JA 3I1FA 4OBEA 3CLVA 2A5FA 3FFBA 1GKUB 5FUVA 2O8FA 1MV5A 3ZGXA 3LAWA 4LCBA 5CDFA 3RS3A 4O0MA 1N6LA 2OFOA 1OXTA 2ZJYA 5K8IA 2PX0A 3FGNA 3PR1A 4TYQA 1KO8A 4BASA 3OAAD 4HZUB 4JVNA 4DBLC 1P5ZB 2GXUA 2OFWA 3NVAA 2DY1A 3TGPA 1WMSA 2QI9C 5EXSA 4QM7A 3AVUA 4NCHA 4L9WA 2NPFA 4IRUB 3UMFA 2IYVA 4JLBA 3C8UA 2EYUA 1Z0DA 4M1TA 3GLIB 1Z83A 3KJEA 1KSFX 4HDOB 3EPHA 3W3ZB 3B85A 3HYTA 1DEKA 2IYUA 3OEED 3Q3JB 2EFGA 1MR3F 4QJ5A 4IKEA 1EWQA 621PA 1EESA 1I4TD 1F3OA 1EX7A 3CF6R 3HJNA 2O5VA 4TMZA 1E2LA 1FOEB 2NZ8A 2IWHA 3WRXC 4B2LA 4IDOA 2D3WA 4G5QA 1Y3AA 4KLZA 1Z06A 3FWYA 2GK6A 5KSPA 2GVZC 1RFLA 5JSZA 5DYIA 2OG2A 1G19A 1UF9A 3SDZA 4QGHA 2I4IA 2ZS8A 2Y8EA 4XJXA 2IL1A 4K81B 4E07A 1U9IC 2PEYA 3LQRA 4HLDA 3TRFA 5TY0A 1P9RA 4X8MA 3HU1A 1TQDA 4MGYR 3LFUA 3I61A 4FMDB 1IN6A 4EIWA 1E79A 2C9YA 2BJWA 2BWJA 4PO1A 1W2GA 5JWHA 2JASA 1RIFA 1JEDA 5C4GB 5FH9A 2ZM5A 1L7VC 3ZZ0A 5JWRA 5C1BA 1Z5ZA 3CRW1 1M7HA 1U94A 2GCNA 3ASYA 4ACBA 4CEIB 1SULA 1ZRHA 1Q0UA 1XRJA 2IHBA 4DCSA 5F2EA 1L2TA 2A2ZA 2ZJOA 4B32A 1XPOA 1KMHA 3CRMA 1A82A 3CRQA 4LYJA 3AM1A 3TLXA 1UKZA 2C78A 3U61B 3ADCA 2QP9X 2P6NA 2NO7A 4JIMA 1OH7A 1Z8FA 2A5YB 5FOSA 2XB4A 4G5SA 4R9UC 2VEDA 3RDPA 1I2DA 2CK3A 2WMNB 1K8RA 4MGKR 1GM5A 3NXSA 2I1VB 3AF0A 1GZSA 4GBMA 3QF4B 4PANA 2JLZA 1XTKA 5C18A 1KMHB 1DAIA 1Z28A 3M4YA 5TDHA 1W0KD 1K5GA 2FF7A 3X1ZA 2QPTA 3V9PA 1VCMA 4PO9A 5B57C 3QE0A 5J4VA 4J0QA 1A2KC 3HR7A 2ZRAA 3NC0C 3H86A 2QUZA 3NKVA 1X8KA 2OLJA 3IILA 5JHHB 1NSFA 3VHXA 2ATVA 3BE4A 2Z83A 4DSNA 5FPSA 2GCOB 1ZINA 1LTQA 1OHHD 2CE7A 1S9HA 2MSDB 2AHOA 1ESNA 1SQ5A 2JIZD 3RAPR 3AP3A 3WNCA 4PZLA 1X3SA 2AR7A 4ZV4A 2W0SA 2WOJA 4B34A 4L5BA 4LJAA 2WWXA 2FEOA 2QTVB 2P6RA 2CLSA 2IYRA 4UNQA 4WXRA 1QHHA 4JLNA 1KI6A 1W7AA 1COWA 3MGCA 2YC4C 4M1YA 2DYKA 3BORA 3IEUA 1IJFA 4URUR 1M7BA 5EP2A 2XITA 4LJ7A 1G20E 4Q4AA 4CEHA 2WJYA 4W7SA 2RH5A 2GZDA 1JQJC 1O87A 3DO6A 5D3QA 5EXXA 3AP2A 4MUAA 2V1UA 1P2VA 2XSZA 2O52A 1NVWQ 5FOWA 4DXAA 4ZI2A 2I3BA 4UJ3A 5KSYA 4DLXA 2FJUA 1ZD1A 2CDNA 3B5JA 1XF9A 2P5SA 2RMKA 2ZRNA 4X8OA 3BS4A 2LKCA 2Z4RA 3LH5A 5DH9A 1GRQA 2GA8A 1XTIA 2YOFA 2YOGA 3SS8A 3GFPA 2GJ8A 4OHZA 5KO2A 1S96A 1W1WA 3CW2A 1XD2B 1TADA 4TMTA 3CR8A 2YWHA 4Q1FA 1DTSA 2J0VA 3TUZC 3I4LA 3U4QA 2ZU0C 4LPSA 1RRGA 2WKQA 1UPTA 2A30A 4F4CA 2O8DA 2EQBA 1JR3E 4I1OA 2ZUDA 5GJWC 2OZEA 1L4YA 3D8BA 2EWVA 3M1IA 2BIFA 2ZSDA 4N0DA 4CZ2A 1UDXA 5AUOB 2V6JA 1HTWA 1P75A 2ZS9A 3FKQA 3NBXX 1KDOA 3SFZA 4TQAA 2V4ZA 3CPEA 4CW7A 4GOKA 4DJTA 1T8UA 4LHWA 4M8NE 5FPTA 4TQUS 1IN8A 5FTNA 2H16A 4Z51A 4XTRA 1QHSA 1P4SA 1S9DA 2WTUA 2J41A 3WRYC 1I4LD 4B48A 1MOZA 1CR4A 3HPQA 4MITA 221PA 5CJPA 3QPUA 4TZ6A 1YR8A 2WIAA 2VO1A 1W46A 2FH5B 2A78A 3B1WA 3T1VA 1NLZA 4AKIA 2AL7A 1OFUX 3RWOA 3T34A 3GJ7A 2NO6A 3UATA 1W49A 2XOKD 2PJRA 1EK0A 4JS0A 2ZETA 3DVLA 3LRPA 3ZJYA 2XB2A 2W6IA 4JL8A 1E2DA 5BN5A 3ADDA 1GILA 2FSIA 1KJZA 3F5FA 1IY2A 4GSYA 5JEDA 3R9XA 5JS7A 2J87A 2CLCX 4JBWA 4E03A 3THXA 1IHUA 1MH1A 1GSIA 2C5LA 2H18A 3B13B 4UQOA 5FBLB 3EPLA 4XH9B 2ZRLA 1SXJB 3FB4A 4TL8A 4URYR 5D3MA 4A8JC 1ZVQA 3U4QB 4JBXA 2OE2A 2GEUA 1N5JA 2KWIA 2QAGC 1C1YA 1II8B 2VPPA 2B92A 3KQLA 1FQJA 1F2UB 3CONA 3B60A 3CR7A 1T3LA 4NZYA 4WW0A 1QG4A 4G5RA 1WE2A 2P67A 3BB3A 3L43A 3WYGA 3A4LA 3QKUA 2FFBA 1XZPA 3QSYA 5AUNB 2FZLA 4BLQA 2X77A 2ZYVX 2J7PA 3NDPA 1JR3A 2JEOA 3EARA 3L8YA 1UKEA 1BS1A 2HUPA 2ZRGA 3MAAC 4MRSA 3WBJA 4LBZA 5LD2C 2R6AA 4C4PA 3REGA 4KFSA 1B0UA 1KO5A 3VX4A 2QSZA 3DOEA 1SVOA 2F3TA 3NG1A 3EIEA 3I3SR 4M9XA 1OPXA 3VR1A 5KPJA 5J5CA 2OXCA 1T4GA 1NRJB 2ZR7A 2QZ4A 2GJAA 5FI0B 1Q1EA 4CDGA 1F5NA 2AFHE 3FVQA 2VTKA 2AFIE 1DO0A 1Z6GA 3T1OA 4HAXA 3A37A 4V03A 1DADA 3BBPA 1LFDB 1YRAA 1T3SA 2GETA 3A36A 1UAAA 5FL3A 3PUXA 3TW4A 2WJHA 4ASUD 1N6NA 1OB2A 2XTMA 5LD2B 4PC3A 1NIJA 2BEKA 5BN4A 1NBMD 2XJ9A 3PENA 3IBGA 5AK0A 4B71A 2QAJA 4GOJA 4NP6A 4GL2A 5CLQA 3IHLA 4BZQA 1W36B 1JPNA 3L8ZA 4LRWA 2C95A 3CBQA 4JVSB 1U8AA 4C2TA 1YRBA 3U3JA 2ZI4A 3ZVMA 1YR6A 2W0MA 4UNNA 3QXCA 4HLQB 1OIWA 1NVVR 3K0FA 2EW1A 2RGAA 2FDCA 5FOXA 3TH5A 4B76A 1IJEA 4B2IA 1ZM3A 5JI2E 3THOA 4B2PA 1TEVA 4NYMR 2OM2A 2GXSA 3RNLA 3QI2A 4B44A 4IDPA 3MD0A 3U7GA 1NG1A 1W36C 3VU9B 1ZUIA 4WXPA 1XEFA 2D2FA 2OCYC 4Q5IA 3TW8B 5JI3E 1JAHA 4D0GA 1E0JA 4QBFA 2V55B 3RLFA 3KB1A 4JL6A 3LV8A 2VHJA 4BUJA 5JSZB 1XD2A 4U7DA 5L3QB 5EP3A 5TXGA 2ZRHA 3FHTA 4C0JA 1D2MA 3IUYA 3PUZA 3H2YA 1EFCA 3O8BA 4D4KA 5KDOA 4Q66C 4FW9A 1MO5A 1KIMA 2MMCA 5HKKA 3QKRA 4OK5A 3AQ4A 5KU1A 1N0WA 3BGWA 5KYKA 1FX0A 4M9ZA 4N1AA 2Q3FA 3H0KA 3X1YA 1G5PA 3Q85A 3W5JA 1AKEA 2IUUA 2VP9A 1JR6A 1U9IA 2PLRA 3GFTA 2EWWA 1PZNA 4DUGA 2JATA 4NYJR 2CJWA 1RC8A 4DLRA 3PCRB 4HDCA 4IVQA 3QBVA 5DGXA 1ELOA 3THYA 4OI4A 1COWD 1US8A 3IGFA 4MKFA 3K0SA 2FA9A 4JT2A 5JEEA 4A9AA 4HB0A 2BV3A 4WA7A 3MLEA 3Q72A 1N0UA 1S0UA 2YWFA 2AWNA 4HZUA 5HCIA 2GZHA 3W8RA 2D4HA 5CDFE 1F2TB 2YYZA 3TNFA 1KI6B 3DPUA 3X2SA 4PC6A 2ECKA 2D7DA 4KI0A 1NMZA 2GBLA 2ZRMA 2Q9AA 3RYTC 3QJYA 3EX7C 1ZAKA 3SJBA 4V0ME 4B35A 4AY2A 2NOAA 4U5XA 1KJYA 1G7SA 2AD1A 2CNWD 4BPBA 2F6RA 4H1UA 4YC7A 2QY9A 4DLTA 4XTCS 3CO5A 3AVQA 2XX3A 2BCJQ 1LF5A 1N2CE 3RS2A 2ZROA 1PVOA 1G1MA 2GTPA 3S1AB 4IDQA 2NIPA 3GEIA 4QBIA 4L4UA 1BMFA 1W0KA 2ZPTX 2R6DA 5AR1A 1CRPA 3UK6A 5BYJA 4DLVA 4LJ9A 2DFTA 3AGPA 4TLEA 2CK3D 2P65A 3WNDA 2ZREA 3KB2A 2OSBA 1H8EA 3K9LA 3QG1A 1CJKC 4WIAA 4PSKA 5GJBA 4Q03A 1YVDA 5EE1A 4RZXA 2ZTSA 3KXKA 1ZC4A 1E1RA 3AKDA 2QPOA 1RW4A 2OBNA 3L2OB 1G8PA 1R5BA 4W9MC 1ZUNB 4PZYA 1GOTA 2YJTD 3VR2A 4HB2A 4ZPXA 4EPYA 1TL7C 1X1RA 2GRJA 3AB3A 1E79D 1NLYA 4UKDA 1ZD9A 4H1VA 4RCYA 4TMXA 4A2PA 4YDHB 3BXZA 3TUIC 1KI3A 5JZVA 3DEFA 1XTSA 1GITA 1N25A 2F43A 4QXAA 2B6HA 4KVAA 3W5IA 2QBYB 3K0CC 4PC1A 3K09A 4S2EA 2IK8A 2VF8A 3EAQA 5CLLA 4JLVA 1NJGA 1BKDR 1MRNA 3LBNA 3PUVA 4DCVA 2O0KA 4KLNA 1GL9B 3KJIA 4EPRA 1CP2A 1ESMA 2ZRBA 1R5OA 2RGCA 3CM0A 2EFHB 1KI4A 2KJQA 5FTKA 1ZNXA 4QHTA 2DFKB 1NMXA 2IBMA 4B73A 3OZXA 3GFOA 1GRRA 1TTTA 2OBMA 4Z54A 4TYWA 2ORWA 4OHWA 3RANA 2BMEA 3MCAA 2ORVA 3ZIAD 2BMFA 4HI0E 4CVNA 2XZLA 3ECCA 3NIBA 4RD1A 2G9NA 2QEQA 1N6RA 1E32A 4A0HA 4NMMA 5AUPB 1S8FA 5JJLA 5G40A 1E2QA 3I32A 4PPQA 1U0HC 1IY1A 4N0EA 2VP6A 5LPNA 4XVQA 1W2HA 1YZNA 4IHQA 4TWZA 1D2NA 1YE8A 2REOA 2FPMA 3UWOA 4D2IA 5AJVB 1Z3IX 2O8CA 1T0HB 3U7EB 3S1AA 4MH0R 4E22A 3AVOA 2PZEA 2ZI5A 4MGZR 4CF7A 1CRQA 1KK0A 3TR5A 3SN6A 1QF9A 3DOFA 1IM2A 1RYHA 2F9LA 4LX0A 5J4LA 4OI0A 4OHVA 1ANKA 1CR0A 1G4AE 3CB4A 3GD7A 1P2UA 1ZD8A 3LBIA 4L16A 1XMJA 3OE7A 4PAOA 5FBQB 2J59A 4G5GA 3I8XA 1T3HA 4URZR 1SXJA 5D3MB 3SJZA 1Z0FA 1G8YA 5EXPA 1P62B 3WBKA 4UNPA 2FPLA 5F98A 1KI8A 5B30A 3UMRA 1NY6A 3E70C 1KTVA 4WZBE 1ZJ6A 4A6XA 4YXWD 3IBYA 4QBGB 1E9RA 3R8CA 3ASZA 1S3SA 4HLUC 2VQSA 2BKEA 5FR2A 1OT3A 4LYHA 2BVNA 4UXJA 2DR3A 4P33A 3W9YA 3QIAA 2RGDA 1N6OA 3MWYW 1OIVA 4V0OA 4F91B 3VR6A 3U7HB 1Z07A 5SZJA 1IBRA 2IYZA 2GJKA 1EFHA 4LHVA 2F9MA 1TEXA 1RE0A 1GUAA 4RD6A 4DKXA 4MDEA 2XJ4A 3WMFA 4D0NA 3KQNA 3UPUA 3Q7QA 2VF7A 1G6OA 3U6KA 4V02A 3C15C 4DT1A 4FCVA 2JLRA 4AK9A 3U44B 1W4BA 2AXPA 1IY0A 2BJVA 3A4NA 1GWNA 4B75A 3CRVA 3KKMA 1HYQA 2GVDC 4BQSA 2ZSAA 1VHTA 3CPJB 3LO5A 3B9PA 4Q1AA 1ZUHA 1G7RA 3THYB 5KNCA 1P2TA 3IKJA 4K46A 3NBFA 1KI7A 2FEMA 3OHMA 3ZVRA 2GHIA 3SBEA 1ZM9A 2IYYA 4AURA 3PEVA 5CM9C 2WHXA 1Z2AA 2UKDA 4JYBA 3TVDA 3CWZA 2V54A 2IXFA 2ZSBA 4DZZA 2ZAOA 3OF5A 4Q7KA 4EUNA 5DHFA 3QKRB 3RS0A 2WSSA 1CLUA 1YR7A 1NNEA 2C99A 1DPFA 4BZPA 3NDBB 2QMHA 1GFIA 3CH4B 1T5LA 1CJVC 1VMAA 1XEXA 2IYTA 1DE0A 2J7PD 3O47A 4PO8A 3QEOA 2ZIAA 2O8EB 1IN5A 1D9XA 1KI1A 2VYFA 1WXQA 3LXRA 4PC2A 4PPNA 1TUEA 3T5GA 2GEDA 1KGDA 1DVRA 1RRFA 1UADA 4HAWA 3NBZC 1CTQA 3NEYA 4HZIA 2YNMA 2D62A 3BH0A 1VYVA 4Q7LA 4QC2A 2B8WA 3DKPA 2RGEA 1ZMXA 4IDNA 4CEHB 4A2QA 4OJQA 3V4FA 1X1SA 5AJXA 1A1VA 1T91A 1AN0A 4EQ6A 2ODNA 1A4RA 4JLJA 3SR0A 2XGJA 3K0FB 4DSUA 4PAQA 5CB6A 2IW3A 4I99A 3QVVA 4DWJA 1E2GA 1KNXA 3K0AA 3G0HA 3EA0A 2FSGA 4QGAA 2OBLA 3P32A 3FOZA 4AD8A 1E6CA 1LV7A 3WHKA 3GLHE 3GJ6A 4LZZA 2A5JA 3ZD7A 1FMLA 4LHXA 3FKSA 1JI0A 4US2R 1E2PA 4JJZA 1Y63A 5FUYA 5FBVB 1HH4A 1Z0KA 3C16C 3IPXA 1T9HA 2CBZA 2QE7A 2ZE5A 3GJXC 4R71A 2NZJA 4Q7JB 4RD2A 1HE8B 2IUTA 4PX9A 5DISB 1XEWY 4I1UA 2PMDA 4QNRA 3CKLA 5G3ZA 3WXMA 5FBWB 5EE5B 1DBSA 2CL0X 5DSZA 2QRZA 4CEIA 3VNUA 4US1R 4BE7B 3K9GA 3RHFA 3KFVA 1Z2CA 1OIXA 2P2LA 4Q19A 5HE9A 3SEAA 1XWIA 3VNVA 4LJ5A 5A5GA 3EASA 4M1KA 4FIDA 1CJTC 2ZJBA 2FE4A 1E0AA 1GTVA 1G4UR 4Q21A 4HAYA 2O0JA 4M1OA 3KZ1E 4FMCB 2IWRA 1EFRA 3IDQA 2RGGA 2B21A 4LHZA 2VP2A 1GRNA 3SJCA 4AIIA 2B8TA 4GFDA 1W5SA 2IS2A 4P4SA 3GEHA 4R98A 1TF7A 4XWKA 5CB8A 1G3RA 4LK2A 4RJLA 1TQ4A 4AWXA 2HT1A 2GF9A 2GDJA 3QNUA 2UZIR 3KXIA 4WOPA 4B43A 4IXNA 1HA3A 3Q7PA 1NJFA 3UG6A 2Q0HA 2C2HA 3ZYCA 4P31A 3BD9A 3LNCA 4YMWA 4DB4A 3SOPA 1E4VA 4OHYA 1M74A 4Q9LA 3T5DA 2WBLC 2KI5A 4MRRA 4BFYA 5K8UA 1NI3A 1DAMA 5FOTA 5FOUA 3T12A 1G5RA 2BDTA 3W8NA 1Q3TA 3AVYA 4KFUA 3K8YA 1G8FA 2SHKA 5CIWA 2Q3HA 1X8LA 3B1ZA 4FWTA 1QG2A 2PLFA 2HCJB 4OK6A 1S3GA 2QM8A 4M21A 3RVBA 3R20A 4HATA 4KBFA 4Q7MB 4Y0VA 1IONA 4TTPA 4JLMA 4MUBA 4ABYA 1XXHB 3GLIA 4KCGA 4RZ2A 3ZD6A 1AJEA 1R0WA 3BH7A 4GP6A 1GNQA 4JZKA 1VDZA 2G1KA 2FG5A 3QY0A 4MKIA 4Q9JA 5DI3A 3K9HA 3QPWA 1N5LA 2JLYA 1N6KA 2RCNA 2XSZD 3WYAA 3SQXA 4M9SA 3B78A 2WKRA 5EZ6B 2QA5A 3THWA 2WZQA 4C0BA 2QGZA 4EFLA 4YDSA 3I62A 1P73A 2G88A 4AKHA 4M1WA 1ZCBA 4BEJA 1XB2A 4TL9A 3NWJA 4NYIQ 4MKGA 1UBFA 1I4DD 1AIPA 4LBVA 3MMPA 2J7KA 1EX6A 1YZKA 2VHTA 3T06B 1UBEA 4Z8YA 1G6HA 4Z1MA 3RC3A 1G21E 4C2UA 1G8GA 3PUYA 1EXMA 1A2BA 1IOZA 1LF0A 1ZW6A 4Q1CA 3T1TA 3K70C 1CULC 1SHKA 3UIEA 4FCWA 4EPVA 1FZQA 1P2SA 3EWAA 5JS8A 3QQ5A 4B47A 5KNBA 3ZH9B 1Z0IA 2OILA 2QP4A 4L8GA 1KZ7B 2JAQA 1JBKA 2FU5C 1AM4D 1QHYA 5H70A 1N6PA 5G41A 1ZC3A 4URVR 2BMJA 4QJ3A 1XPUA 4C0QC 5G3YA 2AK2A 4NL4H 2QU8A 1XCMA 3MWKA 4DDUA 3A8TA 4ESVA 2MSEB 1KK2A 4NYMQ 2KB0A 1NN3A 5EUQB 1LS6A 2YWEA 1DAKA 2KBEA 3LQQA 1EWRA 3KUCA 3QG5A 3EPJA 4B3BA 1HY3A 1F6BA 1E1RD 1EFUA 4I1SA 3U6BA 5H8WA 5C4MA 3A1WA 3PITA 1OXUA 3LX5A 3RRYA 2H57A 1OYYA 1TF2A 2WWHA 3TAHA 4BLTA 1JAIA 1VIYA 2LKDA 1Z63A 2BOVA 1R10A 3WMGA 1OW3B 1ZU5A 1OXXK 3KKNA 4A0RA 1DAFA 2N46A 3H4MA 3E1SA 3L0OA 5BN3A 3Q8XB 4FN5A 4YMSA 4KU4A 2VIIA 4P4SB 1G17A 4YXWA 3ZQJA 3E5HA 3P27A 4EJSB 2VH5R 3CWQA 1GKIA 2BCGY 3BFXA 1Q3HA 2ATXA 1AQUA 2QM7A 1UKVY 4MRVA 4L15A 5FR1A 2XXAB 5KNDA 3R8FA 3MJHA 5F3WB 1YZTA 2KSQA 4NKRA 1XTJA 1TQ2A 2G1JA 3LVRE 2IT1A 5FUXA 5KSOA 4C0HA 4Q01A 4TLAA 5DN6D 3TQCA 3BWDD 2CNWA 1KDTA 4AYTA 3ZQ6A 4PFSA 1NLFA 1X6VA 2Z0MA 2IXGA 1SVSA 2J45A 3QF4A 4BFTA 4BRUA 5JCPA 1PUJA 4ACAA 4EJSC 5JCZA 2PCJA 3AUYA 3QPVA 2ZRKA 4QNMA 4PZZA 4XD7A 3A58B 3DZ8A 5EE0A 2FSHA 4KSBA 4TTRA 3VFDA 4MRNA 1BOFA 2YV5A 4OI2A 2Q6TA 1IN7A 1R8SA 2ZQ5A 3ZVLA 4KSCA 1KY2A 4KO8A 1R4AA 3IIMA 4M4SA 4O25A 1CF4A 3GLFA 5DYGA 3VKHA 3WYFA 3RC8A 3EZFA 4Q00A 3RRNA 5AJWA 1E4YA 3X1WA 1KI9A 1MRSA 4X8LA 4D82A 4ZDKA 3EWSA 2QN6A 1XX6A 2J9RA 4LYAA 2WWWA 2VHUA 2JLVA 4HEJA 5JRJA 3D7MA 4KXFB
chains in the Genus database with same CATH superfamily
3D2LA 2ARKA 1XAJA 1KE2A 1HEIA 1RZ3A 1Z5NA 3D6UA 3H1GA 3QXSA 4K6FA 4TVKA 1I3KA 1JNYA 1ONBA 3KR9A 4ZYYA 4BLRA 1YZGA 1G64A 2XRFA 4FYWA 3WHLA 1Z4PX 1EQAA 2B7BA 3FIUA 3PB3A 1PJTA 3CNBA 4LOLA 3EISA 4QEKA 2JAWA 2XQKA 1D0SA 4J7CA 4QU9A 3N2KB 4B7ZA 2BFFB 2WU1A 3QM1A 2ONKA 2HT6A 2AOXA 3IRVA 2WYHA 1P3Y1 4Q4JB 4INPA 3E27A 3TSYA 1N2BA 2QSJA 5EWJB 4FXPA 3IR6A 2J1LA 1L7QA 2H7YA 5U1PA 1M1YE 3T7CA 1C81A 3GUHA 2JZCA 2PJUA 4Q6BA 4CL3A 3AR4A 4ER0A 1Y1TA 1AKYA 1Y5NA 2ZATA 3JAWA 2GAIA 4KYIB 4OSOA 4XDYA 5LBIA 1QIHA 3RTBA 3B48A 4JK3A 5MN4A 5J2TA 2W6OA 2H7VA 3IDAA 3NEJA 4XVCA 1PFWA 5HBRA 4V0NA 7MHTA 1HGXA 1N3YA 1JDJA 2WYOA 2H06A 1NV9A 3U9TA 1V9CA 1H6AA 1SCBA 2Q8QA 3SBOA 1IXSB 4DARA 1ZXLA 2E3JA 3LQFA 3BB1A 1BFKA 5J3JA 5IJ9B 2KBFA 4MB2A 5JPIA 2XWJI 1PNRA 2HJVA 3QVLA 1J9ZA 4IIFA 2V5VA 4MQMA 3CX6A 3UKDA 1XRQA 1EUDB 3MCUA 3T9AA 2FG6C 1ZGAA 5EJEA 1MQAA 4P53A 2PANA 5LA6F 3ENVA 4YRGA 4GF5A 5FUWA 2J5BA 4NBWA 1JHMA 4WXMA 3LCMA 4HR7A 1E77A 1A69A 1K2VN 1W0JA 4YMVA 4ODIA 4HUTA 4AJNA 3M4NA 3A3PA 1OBVA 2EOAA 4R5MA 2RHMA 4ND8B 1ZGBA 2CLMB 4OAPA 2I5PO 4ZVSA 4ARZA 1VB5A 1YAJA 3AR8A 2NTEA 1FSFA 3CKMA 1M1NB 2QROA 3MERA 4Q1BA 3B3GA 3WG9A 2A3RA 2QZJA 2RHLA 2VBCA 2VFAA 2XB8A 2ZQZA 3PC7A 3ZDQA 4BCCA 3LA6A 4I9NA 5IVHA 4LSWA 1R8QA 3BD6A 3VC7A 1SCNE 1LRLA 3WI7A 4DR3B 3D5TA 4HOYA 3Q9SA 3WB1A 2V3CC 3G2MA 3GUVA 4ARBA 4Z4EA 2PRYA 3PWTA 5EQJB 2JBWA 3E35A 3HPRA 2DBZA 2HWUA 4UXIA 3MWDA 1ZK0A 1L5YA 3S2SA 3U60B 5ALMA 3C41J 4U7PB 1GCOA 1WMFA 4LTDA 4D92A 2OKGA 3J81k 3T9EA 1OFTA 3PHIA 2G6TA 4S1WA 2NV0A 3FTNA 1XNGA 1X1EA 2G28A 4BNTA 4UREA 3ZHSA 4YONB 3H5TA 3KL4A 2HNBA 1AQIA 1NXXA 1LY1A 1YZ3A 1N5IA 4ZOLA 2IV2X 5AJHA 2QMUA 1SK8A 3DBRA 4Q9AA 4RVOA 3L7KA 4R84A 3I6IA 1L7OA 3TO5A 1VMKA 2ZSFA 4JC4A 4BBAA 3A6PC 2CVOA 4C3ZA 5HP4A 1I6LA 3MGAA 4GYWA 3HJFA 3VR0A 1DG1G 2FNAA 4YIKA 5C1DA 3PEWA 3INYA 5EFZA 3N2LA 4HEA1 5BN4B 3PGMA 4AIRA 5CXUA 2PVCA 3NHZA 3I1JA 1WOMA 4AO6A 3UWDA 5EY5B 1S01A 3CPHA 3QWHA 4IQ4A 5TVGA 3Q5GA 2C8VA 1N8KA 2LIPA 2C8KA 4QQFA 1IUOA 2B7LA 4S1NA 4W5JA 5DHTA 1R27A 2ES4A 4RYDA 3TQRA 4YI3A 2HUNA 3I76A 3R1IA 3QJGA 1TLFA 4E12A 3FOCA 2RGXA 1J90A 2XDQA 1UIMA 1XCJA 3R5XA 4GYJA 5DI3B 5JD6A 1OWPA 3E9RA 4LY6A 4OYHA 4ZCQA 3VR3A 1N34B 1AUPA 1ZGHA 3B1YA 3PA6A 1CS0B 1D6NA 2C1XA 1N3IA 1DX6A 1KQ3A 2B36A 2BUCA 3FVWA 4CLEA 1S4MA 2ICAA 5HK9A 4XQ9A 5ICFA 3LVBA 4TWBA 4OM8A 3HB7A 3RRZA 3CZPA 4HWSA 3ADBA 4NI5A 3VPGA 4UAVA 2NP7A 2DU8A 4DWVA 4G5XA 3BXGA 3R23A 3ITNA 1EP3B 5G4KB 1SBHA 4DV0B 2H9IA 2C96A 4RMGA 5EXDA 4EMBA 1QHGA 4JB2A 4MR7B 5BYAA 1BDIA 5BQ5A 4MGIR 3RUHA 3VYWA 4AJJA 2Z2JA 3CVJA 3I01M 3NHRA 1UFQA 3FB1A 5B3JA 5KTYA 4EY8A 4WJLA 2C8JA 1X9IA 4YLGA 2ZE8A 2P2CA 3B6KA 2OZLA 3AY7A 5IAKA 3ZN2A 5BV2P 4IZOA 1OC2A 3WLKX 2ZUWA 3LW7A 1E64A 2R85A 3I6YA 3DDCA 1JXMA 2PS1A 2I0FA 1QVZA 3COSA 1RKBA 4IOMA 4OB8A 3HVUA 4AYWA 3HKEA 3ZKAA 4IXWA 2HWWA 4OCZA 2DPHA 3AVTA 1WRBA 2Z6VA 3WGVA 3RLIA 1HE1C 3AEUB 4YTEA 2Z2XA 4NE2A 1NKTA 1V8BA 2YMPA 3EC2A 3K05A 4GMXA 3SU8A 5JNLA 3RAJA 1SBYA 2PX2A 2Q9BA 2BMDA 3HGMA 4X1KB 2BM0A 1JE1A 2NU8B 2BDEA 3GLHB 1ZHFA 2ZK7A 4O8CA 4R2MA 3U7RA 4GKJB 3NTXA 3QXJA 4EHJA 3OQVA 1V71A 3ER8A 2PKRA 1QH8B 2NTYC 4AP9A 1CSEE 1EUZA 1V39A 4ITUA 3VXKA 1QFSA 4MWCA 1KO7A 4A8JB 2PKWA 3CX4A 3C4QA 3B2QA 3M6IA 3UKJA 3V1LA 4DSOA 4H3SA 2QAGB 1CF9A 2ORIA 3N7UA 5H82A 4YRNA 4BYMA 2E0IA 2C97A 4EWLA 3CLSC 4OGGA 2F1IA 3OESA 4GRAA 4FBMA 3O3MB 3QXXA 4LV5B 3Q88A 3ZG6A 5DEIA 4AUEA 1EDZA 3KELA 1MPXA 2QE7D 3GFFA 4RJIA 4US0R 4YCJA 3TOCA 1RYDA 3KTAB 2OTCA 4HTFA 4NDZA 1X7HA 3PTZA 3JARA 2HPVA 3PNVA 2NW6A 2Q49A 2ODEA 3GJ8A 3R9XB 5TARA 2YY7A 1V95A 1CPYA 2ZXEA 2I87A 1XQ1A 4MUNA 1XZCA 1CVRA 1KAQA 3QE2A 4F3NA 1T6ZA 1NAHA 1VLJA 3AJRA 3EOBI 4YK7A 3D3EA 2C0QA 5D7BA 4KDEA 1M2OB 4X1OA 5ADVA 2HR1A 3U37A 4KX3A 1JIXA 4E32A 5JH7B 4QWWA 1Q0TA 2ZI9A 4NPHA 4CMEA 1E5DA 1OYOA 1WW3A 1BYUA 1LNZA 1W94A 3DR5A 1R66A 3LUFA 3CEPB 1EM6A 3H9JA 4IFBA 4W99A 1C30B 3UXMA 3D1VA 3L05A 3Q7SA 4HNSA 4RDXA 2XCRB 1KXJA 4J0IA 2YS6A 3JZAA 5DPMA 7REQB 2ECQA 1BCSB 3BL5A 2MSKA 1B43A 2VNIA 3EFOA 3ZIUA 1XXHE 4EDHA 5K0FA 2NUAA 4RL6A 1NBWB 2JNWA 4EH1A 4WDQA 3ZHQA 1QYWA 1ZN9A 2HA6A 2J0UA 4BZXA 1UH5A 3EBPA 3UH1A 5HVNA 1H4VB 2AXNA 1IXKA 2EFCB 4Q02A 2DETA 1DOZA 5FRDA 2PR2A 1U1EA 1SBZA 2LNDA 1T2UA 4GBGA 4RPCA 2HI0A 2ZSEA 2ZAMA 3PPWA 4DY4A 3T3EA 4FQ7A 2GESA 3EE6A 2NGRA 2HK7A 3I9NA 1TM4E 5CH5A 1XYYA 3NIGB 2R4TA 4RTRA 1PWXA 4FB4A 3EGCA 3HCFA 4BP3A 4PZDA 1KYTA 2W2QA 4KRFA 1NXQA 3I04A 4S3MA 2EL7A 4TT3A 2R6JA 1B93A 4PR3A 3PHHA 2LTAA 4WVFA 3F5QA 2XKKA 3DV0B 5T4EA 4FYXA 4P7JA 3WQSB 5IABA 4OSEA 1DFIA 3ZDFA 1R16A 4CRWB 1FDRA 2JJ1D 2ON6A 3F0TA 1SZJG 3FPJA 2B35A 5IJ0B 2IOHA 1FP6A 3SC6A 1NR5A 1QV9A 3KSUA 4O8ZA 5DBIA 2WQ6A 4P1ZA 4GPTA 1KDRA 4RCZA 4BMSA 2J5KA 1Y89A 2FRVA 1QFJA 2WUWE 3BEDA 4FEEA 4KITB 1G38A 3IPAA 4RNDB 3NS7A 3TXXA 3MJCA 3ST7A 2D54A 4PU0A 4ZVVA 3ESAA 4ZDJA 4IDEA 4NONA 2COUA 2FVYA 2HK9A 3IH5A 1C7JA 3OE4A 3ICCA 1JHRA 2VKTA 2ZIVB 4Q3AA 4H08A 5BRAA 5LKAA 1Z22A 4HGPA 4Z7OB 1V8OA 4GBED 3KPVA 4XI9A 4F84A 2ZYHA 4TKVA 2XBUA 4HNUA 1CQIB 3RUAA 3U62A 1VQ1A 4DV5B 4I1PA 1ND5A 2WSIA 3M5PA 2IYXA 4UMEA 2XAUA 1V16B 1XTBA 3IT2A 4ZOCA 2PKXA 3SX2A 4BRZA 3E81A 5JG7A 4YMTA 4XIGS 3ADOA 4S1OA 4CKZA 3SVLA 5EIEA 2RB5A 5FI1B 1O97D 3MJTA 4DJJA 3GT4A 1RXIA 4QREA 2G9RA 1U8CB 1NF8A 3L8MA 2LW7A 1R9MA 2YQ4A 3N8NA 4PCVA 3VHQA 1FDUA 5HZHA 4M53A 1PR6A 3CUKA 3H6HA 3QKTA 4C3OB 4Y2XA 3O7MA 1H94A 3DLBA 2GSWA 3L82B 3T7DA 1M5UA 2QG6A 3JATB 3KBOA 4C6TA 3SNHA 1VHWA 1IVNA 3P19A 3N39C 4IFTA 4A0FA 1VJ5A 2HA2A 2BF7A 4IHKA 4U02A 4OFXA 2EIHA 2XMBA 3OT4A 1L7AA 4MIEA 3IUBA 3DWFA 4K86A 4ZT5A 1ZWLA 3RYFB 2LGJA 1R1DA 1SA0A 1FYVA 1FVFA 2QD4A 3ISVA 6Q21A 1OBCA 2WA2A 1VKZA 3GJSA 3HYRA 5ILQA 4CEJA 5GY7A 5KOYA 3DE0X 1W4ZA 3ONDA 3GZNA 4ZIRB 5HUJA 3B7PA 3UTDA 1X80B 5JRZA 3PHBE 1UFOA 1I24A 1GEGA 2I34A 3L79A 4HDNA 4JI8B 4DR6B 4CT0A 3DHWC 5HZKA 1U2ZA 2R68A 3GRRA 5KTPA 2LD4A 4LBWA 4MUFA 4AF7A 4TYPA 2W2VA 2E1PA 4POAA 5KNBD 1F0NA 3CNOA 1A76A 2E4WA 2QLFA 1IL0A 3WGNA 5KTTA 2ZSJA 4OMCA 2JIDA 3M3HA 3P1JA 3GMSA 1NFFA 1CZUA 1NW4A 1KNQA 4BJ3A 1KP3A 2E87A 2QX7A 3NHMA 1A5TA 1YB1A 3ZIAA 4Q4HB 5IG2A 4KFCA 1A8IA 1K8XB 3ORSA 4J43A 3KKQA 3O8OA 3Q3IA 2EKPA 4BO3A 2OD2A 3O8RA 1YQUA 4MEAA 2BZ1A 3DLCA 4Z49A 1P80A 1LVGA 3BHIA 1OI3A 3NAGA 3TTUA 4BNYA 1GTG1 2AG5A 4HD8A 1WPQA 2TS1A 5IM5A 1VA4A 2AJDA 3L40A 2OBYA 5FNVF 4F60A 3ROXA 3EY4A 2GEVA 3WP0A 1XKXA 3WLFA 3K5HA 1EVIA 1UDAA 3QXHA 4OQXA 1IVSA 5E1MA 13PKA 4NYJQ 5BSMA 1J21A 3FTDA 3IC5A 4KUGA 4RKEA 5AVZA 4JLPA 1YTUA 1I0LA 3PGA1 2A9RA 4G2TA 4GP7A 4BB5A 2RARA 1ML4A 3M1YA 2PBRA 5THXA 1A4IA 1NN5A 1P6QA 4IS2A 2C3MA 3R6DA 1JUDA 1AGPA 2GO7A 2XT0A 1L7DA 2WICA 3ZU4A 4JT4A 1SKUA 1DBIA 5JNSA 1RJEA 2JCYA 2W7TA 5SYMA 5JSQA 3ANSA 5JZBA 1NQ5A 3PLRA 1RI3A 3QLVA 1TU3A 3T3NA 3CUTA 4BAZA 4ROSA 4A4DA 1CJMA 4W5WA 3PZBA 4AG6A 1IY9A 1V37A 2HQOA 5BR8B 4Q3DA 4KR0A 3SS7X 2YZ7A 1ATZA 5EJ8A 2V3VA 1BVYF 2C3YA 1TVEA 2AOUA 1K0UA 5BWLA 2IOQA 2YWBA 1CNEA 2WG0A 3FSRA 4RA6A 3MS4A 2XLBA 4JODA 5IULC 2B1JA 9LDBA 1KZ4A 1WD5A 2OBXA 3A1SA 3GCGA 1GV0A 1DBRA 4K8OA 3NKLA 1T8WA 4P4GA 4WFKA 4LQLA 3ZV7A 3AESA 4BMYA 4BJ6A 5EIBC 4ECEA 4MKZA 2BPOA 3V2HA 4BO2A 1KORA 1ZNYA 3AV0B 5F9MA 5T6BA 5DYWA 4D4MA 2FPOA 2M6SA 2P0EA 2PZLA 5CR9A 1VBFA 1JTEA 2GCPA 5AKZA 5CAEA 2E6UX 2DTEA 3BERA 3TQIA 2W6JA 2P4HX 1QQ6A 3CSUA 4X6XA 2GKGA 3LL4A 1ODLA 5EZYB 5CBKA 2JGRA 3OQMA 3NRCA 4PYMA 3PGJA 5BPHA 2QNBA 4ISCA 4D7AA 3C87A 1NBEA 4E4TA 2DFNA 1I3LA 5IWCA 2O7NA 4ISBA 3KNZA 4CMHA 3RSLA 1GGNA 1M3SA 1YMVA 2OUIA 2V0GA 4ZEVA 2CCGA 1U90A 3FMPB 5GOTA 4MQBA 2C5FA 1C4WA 4URFA 1C7EA 1W19A 1Y1KE 3BILA 3TAUA 3PPXA 2B4QA 4Z3DA 3EJ6A 4DSAA 3NCHA 5LR6A 3L3BA 2BR4A 2ERXA 3NASA 2DJ5A 1CIVA 1F4LA 3K9BA 3W9SA 3JD1A 2GOYA 1GRCA 1US8B 3QVTA 1G41A 3I28A 3O8CA 3FYUA 1GYQA 4R3NA 1FQOA 1P5HA 5DHSA 1RI4A 4BTEA 3B2NA 1GAJA 5LMCA 4DDMA 5AM4A 1AK9A 4P98A 1ZM7A 1UJNA 1ZQ1A 2Z3ZA 3KHKA 3N70A 3ZNOA 3OLXA 2AVNA 1XNRB 1OSNA 2C07A 4YAKA 5CLFA 3DBLA 1Z4JA 5ALKA 2W6ZA 2JLQA 2EHDA 4B3HA 4NZNA 4HDRA 4N9WA 1IPHA 4YAUA 2HEIA 5GJVC 3D7RA 1FTSA 1C1HA 1NVUQ 3CN7A 1DCKA 1Z88A 3ZU3A 3KQKA 2EP7A 3LDUA 3K20A 3R0VA 3T8YA 3TEMA 5D8DA 4C22A 2O0MA 4MAFA 3VZBA 1SB8A 1EGHA 4PYLA 4R2KA 3I53A 2RK3A 2JKZA 3V00A 3NOVA 1XZJA 1M0WA 1VP9A 2EG9A 3KQTA 3LQ4A 5L40A 1YA6A 1B8OA 1C9MA 1W1IA 1C8KA 4P7GA 1N5OX 1F0KA 1G5QA 1O2DA 1R0YA 1E61A 1QORA 2JA1A 3BSFA 3IERA 2DMRA 3IOBA 4JAVC 4KXVA 2R86A 4K1XA 4NU5A 1WZNA 1NFQA 2V7TA 4IV5A 2A1UB 2FK7A 2ZEJA 3IP1A 2DF8A 3HCAA 3R3YA 1U31A 5LB4A 1QE5A 1RACA 4MKRA 5GVSA 4ZKEA 1M2VB 3CR3C 3R3ZA 1H8HA 5EHQA 2QX8A 4RZIA 1J00A 1G63A 3MRVA 1NUHA 3BWVA 4HUQB 5C32A 1RJFA 2VRCA 1E96A 2REXB 1U2GC 2HSWA 2JHGA 1EUYA 3BM5A 3BXPA 5COAA 3CVVA 4NZPA 1W4LA 4KBYA 4EQ6B 2CXXA 2GK7A 2OV8A 4MVYA 2VHWA 4IHJB 5AKKA 3GJ0A 1RBMA 2ZE6A 1TNDA 3P2IA 5L4SA 2WPDA 5DMXA 3UHPA 2BHLA 3IAS6 1BZYA 1E3IA 5F9FA 1A8UA 3IQGX 4F38A 4UJ5A 1M8PA 1PHRA 3KKPA 2KHZA 1Z26A 1ZL0A 3RABA 2FFAA 4HVLA 4E09A 3JQDA 4GX5A 4N0MA 3CTMA 1DFGA 2R8XA 2ZPUA 3EHDA 3VR6H 1N2CB 3NGLA 5K4HA 1G0NA 1GNSA 2IYSA 4HDSB 1YS9A 2ZRJA 4GWKA 4HRVA 3QU4A 4PYQA 4YP7A 4HYYA 3LUDA 3ME5A 2E48A 4UZSA 4HZGA 4S1PA 3LUBA 1TPZA 2WUEA 4UATA 1ID1A 2HMTA 3GGGA 3V8QA 2YY6A 1A7KA 2PX3A 4IMIB 2AYXA 1D1PA 2JEZA 3G0BA 2OCBA 3T52A 2J08A 3TX2A 4BLOA 4DUPA 1X86B 3KTDA 1E18A 3FR8A 4HHEA 4X20A 2AEMA 3P9KA 4IFEA 1T15A 5BSEA 4FDTA 1L5ZA 1DL5A 1VSUA 2ODWA 2V7WA 5JAOA 3UGJA 2K7FA 4ZO6A 1K6MA 2X8BA 2YICA 3AUXA 3U4HA 1RPJA 2R1UA 3UCFA 1E8DA 1K88A 4DY6A 1CNMA 1VKJA 3AEKA 2CLKB 3OQBA 3MT8A 4HNAA 4V2UA 4CCYA 5HX7A 3H5WA 5JLJA 3BYZA 4RTNA 4WZAE 2JHPA 1E9DA 1VJCA 2IUSA 3OZEA 4ZHSA 4FYKA 1W0JD 4FR2A 4LFBB 1M6YA 3HL4A 1JR3D 4WT7A 1MA0A 2IEAA 4JJ4A 3ZV4A 5ALRA 1T8RA 1T3TA 5LIPA 3L0ZA 3F6PA 1FX1A 3ZEIA 4TTQA 4DQLA 2AI1A 3OIYA 2PX4A 3T3MB 2ZIZA 4P4UA 3IE2A 2N3ZA 3LT0A 4GYKA 3REFA 4FOSA 1KOGA 2DX7A 1AA9A 5ALUA 5GONA 2G5TA 3GXOA 1S8AA 4PSAA 1J8QA 1TAGA 2B7CA 2VHCA 1VJ0A 3EDMA 4D4IA 4YRQA 2FQWA 3TKAA 4QFCA 1WXIA 9ATCA 1TIKA 3ECAA 2E4AA 2YWXA 1X7XB 3GZ4A 1TVCA 2VDLB 1Q7RA 2RKOA 1T5BA 1LI4A 1MEEA 2CKDA 2YZ2A 2QVZX 1UM8A 3PXDA 4TZ0A 3HH8A 1G7TA 4X24A 1W0CA 3L9WA 2HPHA 2G9QA 1OLXA 1GZ5A 1MG5A 4OSPA 4XB1A 1JGTA 1OF1A 4H0NA 5GM2A 4BNZA 4CLRA 1O1YA 3B89A 3AY6A 2EBFX 1UBCA 2EGHA 2FWRA 5IS2A 4F3TA 2H9YA 3PT9A 1XZQA 1K92A 2XV1A 1JJ7A 1NR7A 3N5CA 5ADUS 4ND2A 5IVPA 1FMFA 4I4LA 3AEQA 3ITEA 4NQZA 4TVSA 3GJZA 3RYIB 1VIAA 1XNHA 4ZAFA 1YJAA 2X76A 4A5SA 5BSKA 5HW0A 2Y6VA 3IHWA 3DULA 3VHLB 4CM4B 1EDBA 1D7OA 2RHJA 4DM4A 4YMHA 1PJQA 1PKXA 4PWZA 3LBFA 1KAHA 2AFRA 3ELUA 4WUVA 5FFFA 5FTMA 1R9NA 1WDLA 4KHZA 3A7DA 4LX8A 5LP6B 1UPBA 2YZKA 5JAIA 1YU9A 4R6XA 1CR1A 2WIKA 2IA5A 2OWDA 2XNDA 3WFJA 1GXSB 1YBAA 4LJ8A 3DHNA 4AXBA 2PSHA 3ZXIA 1M5RA 4C7JA 1WV0A 1VG1A 2A57A 1HV8A 2L18A 2I2CA 2Q3MA 4TMWA 1DWUA 2VH2A 2O8BA 2R65A 4WLOA 2R8ZA 4KQFA 4ZDWA 3F9CA 4W8OA 1R6BX 1O57A 2NTJA 3IVRA 4MWBA 3TIFA 1J2RA 2VTBA 1Q3KA 5KOJB 1LJ8A 1OFIA 3F3YA 1EE1A 4D4LA 5JMWA 3ZHVA 5DN9A 3AUFA 3MQ2A 4FYIA 1FA9A 2J85A 4ZOEA 1I9GA 3Q3CA 3JZFA 1ZM2A 2CMGA 4HDAA 5DGHA 2OY0A 3D3KA 1RWKA 2DH6A 2XZDA 4NS1A 4WASA 5E9JA 1WZEA 2G36A 5AJZA 4BYGA 1QRAA 1OZFA 3Q3HA 5DIFA 3RJ9A 1E20A 5EMNA 3PGVA 1BXRB 3KDSE 1GVNB 2ZITA 2I62A 5DGCA 4F92B 4RIGA 2CMKA 4KAXA 2V4MA 3ZE7A 4E5KA 1LZKA 1NAIA 4P5DA 5JVDF 3NCTA 3HB4X 4M54A 4B3CA 2Q46A 1SVUA 1XLVA 4MI3A 3PWKA 1P9OA 4R16A 5HDQA 4QYSA 5B1IA 3NC1C 5IDVA 5DNWA 3HJHA 1DARA 1CFZA 2O7QA 3H8WA 4NENA 5HM8A 5C0OE 5KQGA 1ISGA 3N2EA 3TINA 2BCEA 3R77A 5IP5A 2QS9A 2W6JD 3D8SA 4FGKA 4JI7B 3CJQA 3KTFA 2KM1A 3LF2A 4NMWA 4PHTA 5JDIA 2AFHA 4NEQA 5DTMA 1Z6ZA 4FE3A 4N41A 3ADKA 4KR9A 1JKJA 5THKA 2QL9A 3I9OA 4Y2RA 3AGQA 3KT8A 2QX9A 3FSEA 5K6AA 1O0CA 2WHQA 3PYXA 3I5MA 3GRYA 4BQFA 5K8LA 2XUKA 4NXNB 4HDQB 3WKDA 4QFBA 3DLHA 1U65A 2Y68A 3I30X 3E82A 2WWYA 2YMMA 4ICIA 1X9HA 3VYTB 4Y2YA 1W47A 5JDCC 1RAGA 4FE7A 2NPIA 4RW0A 4TV8B 2Q28A 1HORA 1ABEA 1CUXA 3SSOA 3ZK9A 5JMOA 4GXRA 3JR3A 4O4HB 4LSGA 4RQBA 1R7RA 3DL2A 1QIFA 3PI7A 1NZFA 3CNLA 2HLDD 1BG6A 1JTVA 1OX4A 5LB2A 4ZI3A 1Z29A 1AQYA 3GQBA 2FETA 5FWNA 1T9BA 1IZ7A 1YRLA 3JVUA 4TX1A 4G1BA 3CBGA 4LUCA 2ZR0A 4EG7A 3F4KA 1QH1B 2VRBA 2A67A 3QRWA 3C1UA 3EXAA 1ZH2A 4JVMA 4XCXA 4DS3A 5AW2A 3WGYA 1XJ0A 3WWYA 1J0EA 1GU7A 1Y8RB 3B6MA 4R2XA 3N0VA 3GDGA 5IK2D 1VP3A 4IJMA 2FCRA 2R4QA 5AKYA 3UEOA 2X2OA 4NS4A 1MZPA 4CFZA 1LS1A 1FVXA 3F97A 3OX1A 4BO4A 1Y6GA 2JFNA 2ZJ4A 1UEIA 1PL6A 1ZNWA 5DO9A 5A3JA 5KQLA 1K7FB 3AFOA 1YCFA 1PP4A 3JQRA 3NBYC 1D09A 2GNOA 3F8WA 1XMOB 1M8GA 5D01A 4C0WA 1VRCA 3PYLA 3VPXA 4KNVA 3DXYA 1F12A 1ARZA 1N8NA 4EB0A 2X40A 3H99A 3C7KA 3KXLA 5BSTA 2P9GA 2KX7A 3OD1A 4FFPA 4FTWA 4OU5A 3RRXA 3FUUA 4D02A 4R8LA 4DR7B 4B8YA 5JXWA 1VLMA 1FFAA 2NG1A 4OFBA 1IQUA 1M2KA 4G5OA 1Z75A 4QYIA 1M1UA 3T61A 4Q3LA 1SCJA 3GZTB 2KE5A 3INTA 3K30A 1L4EA 4UDYX 2XTJA 5LC1A 4PN7A 5A3RA 3LPNA 1GL7A 3KS9A 4KSYA 4KUEA 4W1QA 1L5HB 4ZOQI 3IJRA 4GGPA 4PSUA 4WVLA 1NVFA 3GLIE 3QVMA 1OLUB 4LCEA 2H5JA 4MV0A 1MD9A 1W4AA 3IQWA 3F8TA 3TVTA 2WINI 4MK4A 4ZARA 1GA4A 3WHIA 3G8BA 2ERYA 1NKVA 1AK2A 1LI7A 1XXHA 3G1WA 4R1UA 1R0RE 4AW9A 4Y9SA 2A9QA 4WKOA 4CIAA 2DOKA 2XW6A 3QEJA 1KYIA 1KJJA 3OJXA 1DCFA 4MQ5A 2C20A 2X2EA 1E9FA 4H9GA 3BIFA 3GVPA 5LQCA 1FNDA 1O77A 4CIBA 4P32A 4V0LA 2HX1A 2WMYA 4L4RA 2PEZA 3IFSA 5HPYB 4OXQA 4F9EA 3ZW9A 1FQKA 1E2KA 1TFRA 4QG7A 2YC2C 4ENRA 1S8OA 1DTWB 2X3FA 4C03A 2Z6QA 1N78A 4F4IA 3UOWA 2I99A 4ITVA 1XHLA 2PG3A 2QTVA 2YUTA 3HJCA 4GICA 4UBLA 4M6WB 3M9XA 1QU3A 3T4UA 2H4WA 2ZJ5A 1H2YA 2WPDD 4P35A 3DDUA 3GF4A 1XZNA 1DIBA 5F3RA 3ZDZB 3KE8A 3DH0A 1LI5A 2ISQA 3FHCB 4Y2HA 4ALJA 4LFCB 1YJXA 1E1QA 4MEJA 4RPGA 1YL6A 2WSLA 3DFUA 1K0FA 1NGSA 4FKZA 5DHPA 3R7SA 3ORYA 3NO4A 5LUAA 1I5OA 1Y1QA 3SFVA 3VGPA 4CDMA 1N7IA 2FWAA 1H8HD 3D4OA 4ETMA 2H31A 4EL0A 3UJPA 5FLYA 3LP8A 2H3HA 2DT5A 5B6IA 1E2HA 1VYTA 2RGNC 3H1AA 5E2IA 1Z74A 3KZOA 3GVHA 3RC2A 4D4HA 4QICA 3VUEA 2IOFK 1C1DA 4RH0A 4EPXA 2DPXA 4XFJA 5T7BA 3AVWA 2O1WA 3TIVA 2C7PA 4F9TA 1XG5A 1XNJA 5KYWA 1MVOA 3ONVA 3SYRA 3VMMA 3MSCA 1JQEA 1RTTA 1SR8A 1V3VA 3NP7A 3PEUA 4JVOA 3SC2B 3WSVA 5HWSA 3ZWQA 1KY4A 3RVDA 3WY9A 2HA3A 5JAPA 1RHQA 3GJ5A 2ZYSA 5BSRA 2JAHA 4LSZA 1KIAA 3W6NA 2GKSA 1VJ1A 5FLEX 4KRGA 4DLUA 1B8UA 3MFYA 1JKFA 1DC5A 1UJCA 4O29A 4AC9A 4RZHA 2GYWA 1K9VF 2VP5A 1EXDA 3LW8A 2WNHA 3H2IA 2I2WA 3PQ7A 3K6SB 3GLFE 5FWDA 1H2WA 4D45A 2WVAA 3V8MA 4H59A 4WH0A 4LQDA 4JP1A 3SC3A 1HLFA 5AIAA 3WJ7A 1UBLS 3AZOA 3MSXA 4XWGA 2W8BB 3E9ZA 3KRTA 1FDOA 3WK6A 1GGFA 1WX1A 4UHJA 1S2OA 2IZ0A 5C53B 2QV0A 2AK3A 1ONOA 2NN3C 2H8GA 3FCYA 4BLPA 1HURA 1UMDA 4L57A 1K5DA 4MARA 4N8DA 2GN8A 2FUNB 1KDVA 5B64A 1VPWA 1PV1A 4OHOA 1VKNA 3CG0A 3VSDA 3WYNA 1XLTA 1X7WA 1ULAA 2BGNA 2G25A 2HTEA 1E9AA 3UUWA 3V46A 2BFDB 3LX8A 2QZZA 2RH8A 4TYMA 4BEWA 1E2FA 2J3DA 4ZO4A 1N36B 3KXPA 1JHPA 5TF4A 5IM4A 4LF9B 4KMOA 1CNFA 1PWEA 2CW5A 4Y98A 4XUDA 1OFHA 5F33A 3WLHA 1YRWA 1OH8A 2OHFA 4JLAA 1KQFA 2XXAA 4LDAA 3TSWA 2A59A 2VJNA 4X63A 5B1HA 1H2FA 2F67A 4W5HA 4AMGA 3ZCSA 5C2JB 4D1YA 1EXNA 4Q3EA 3VGJA 4D6PA 5L3SA 3ZS9A 2YQ5A 3IHKA 4NE7A 3VYRB 4JNKA 4FINA 2XMZA 4WD3A 3KQPA 3UMBA 2JLXA 2JIRA 2IH5A 3RTAA 2ZBQA 1TJNA 4KHPB 7MDHA 3VDMA 1KJWA 2X9NA 3AJAA 4DA8A 1O6ZA 1Q1GA 2EP5A 3BE8A 3PVSA 4PAGA 1I51A 1L0BA 3WRWA 3G5LA 4TRRA 5A7GA 4X00A 2FRDA 1RZVA 3L5KA 5E4JA 4AN4A 3DW1X 3TK1A 3FDIA 5SZHB 1D1QA 1H2EA 1MEJA 4MOWA 5BT9A 4HFRA 4CV1A 2SBTA 1QVAA 1VRVA 3JPYA 1LWNA 3C7CB 3NR2A 3OTIA 3WLTA 2Z2ZA 1TT7A 4G36A 3VR6D 2JGFA 3B82A 3HKDB 3NPMA 1NQOA 1CIJA 2YZNA 2BEJA 3CX8A 3ZDXB 5CB4F 4IWNA 3V8PA 4YRKA 5IZCA 1RYMA 3A6FA 3Q5DA 1K7XB 1CEYA 2VDWB 4DLNA 1J7KA 2PJZA 3WP1B 4I5IA 3GIDA 3FPGA 3O1JC 1QLHA 1KYYA 1WSWA 4LFAB 4AJ4A 1RNLA 2WM2A 4PZ0A 4RSRA 4NTZA 1VDMA 3VYUB 5E6SA 1DKNA 1T5SA 5JJIA 3OBIA 2BBOA 5KWEA 3LQ2A 1PUXA 2WHYA 1OX6A 4WDRA 1WP9A 1UFVA 2IIPA 4X8HA 1EK1A 1A9QA 1TGVA 3KLMX 2GDZA 2GMWA 2VR1A 3STVA 1ESCA 2QMEA 5LMUB 4B6FA 3H18A 3VR5A 1TJ3A 2XECA 3IEXA 4J9UE 3GR6A 2QVGA 2VF2A 1TECE 2V9CA 3QLVC 4BWYA 2DRIA 5CXQA 3CS3A 1TT5A 1U3FA 1LC0A 1W29A 4GC5A 5DE3A 3V6MA 3S28A 3ZWMA 1J2TA 3TMKA 1ADCA 3OE7D 4D9KA 2IPMA 3RRFA 4YAIA 3ESYA 4R1TA 4FLFA 3SDBA 2VJLA 2ZUCA 2O8FB 2WE8A 3ONWA 4ZT6A 5AW1A 4ZZIA 1EGAA 2IYFA 3EVTA 2A0KA 4NX2A 5EIBD 3LXMA 1VCOA 1RC0A 1FC0A 1GVHA 1VPDA 2A5FA 3BQ9A 4FNMA 3ZGXA 4DMUB 2QLNA 2D7JA 3QBEA 4CM3A 4LCBA 2R8BA 3G2PA 5CDFA 4FMPA 4CM5A 1N6LA 1D2GA 4KO2S 2ZJYA 4G23A 5CX1B 1QIMA 2QRLA 3G0GA 2CJYA 2GYVA 1IHXA 1L7NA 1FE8A 4JVNA 5DULA 1MB9A 3E3AA 5TRTA 3H5AA 3HVJA 4JHLA 2BFMA 3R0ZA 2OFWA 3AI1A 3H5NA 2PGIA 5C34B 4FKMA 5EXSA 4QM7A 1A8HA 4NCHA 1PNOA 1P4JA 2NPFA 2G80A 3D8RA 1NJ2A 1TW3A 3KOZA 4I0WB 2J3HA 2I4OA 4KRXA 3O2NA 2D2IA 3TAXA 3KJEA 1XZAA 1F51E 1OBOA 4DJDC 2HIGA 3P9PA 3VPBA 3KPWA 3RVJA 3ZV6A 2H63A 3RQSA 5KNBH 1GUDA 2O5VA 2P62A 1TLTA 1FOEB 1U6IA 4TMZA 2GEFA 4R68A 2QRUA 4B2LA 2FX5A 4F6RB 1U5BA 1WU7A 3OQNA 4DR4B 4M8LA 1ISRA 1V11A 1YGPA 4PX2A 3JR7A 1RLUA 1WBDA 5KSPA 1E59A 1RFLA 5JSZA 2PUBA 3DVAA 4IIGA 5TLSA 2RK6A 4X9XA 3CLTD 4MIOA 2HA7A 2NT3A 3BWXA 4HEHA 1Q95A 3GUCA 1W30A 3IJEB 4MPPA 5EWLB 4E07A 2WU0A 4LWQA 4RLFA 3IXQA 1UQTA 1N8SA 1A4UA 3TRFA 5J63A 3L18A 2R84A 4BNDA 2CNNA 4Q0MA 4R7GA 3HU1A 4MUGA 5GONF 4Z4CA 1B3RA 5I51A 4AZ3B 2P4QA 1KJ8A 2VYND 4OX9Y 3I23A 1IN6A 1MQ9A 3VM6A 2AQIA 3ZIDA 2C3OA 2GZRA 5JPCA 2BJWA 4DV7B 4YRSA 1W2GA 2I7VA 3M70A 5EWMA 5C4GB 5FH9A 4ARVA 4OHMA 2NUPB 5DX0A 2KQUA 1ZDMA 2VPQA 4BU1A 4KL8S 1QAMA 2IHBA 3JYNA 4RMJA 3LXUX 5F2EA 4Y30A 4C5AA 1OVGA 3OSZA 3NTLA 1MHTA 3O0TA 3O1IC 2FMFA 1L3BA 2HJ9A 3DEZA 1QIJA 2UYQA 3REOA 1QFXA 1QK4A 1C5KA 3QPDA 2QP9X 5FO0A 1L5KA 4E5VA 1UK9A 5C7OO 3L7MA 3JQCA 4EKGA 2XB4A 3H05A 1Q50A 3DL7A 4GNRA 2I67A 1NOKA 1Z5OA 4QFDA 3AF0A 1GZSA 5AIBA 1XTKA 3C45A 1KMHB 2VSYA 1Z28A 1PDOA 3VOTA 2O3SA 4UBIA 1LBSA 1JHVA 1X87A 1K68A 5CFNA 4DFDA 1ECFA 1ZHHA 1D0VA 1MLDA 5KYXB 3HWWA 5AJUA 1VCMA 1CQWA 3GX1A 3OLWA 4OU4A 2B8NA 3KKLA 3L7YA 1JDUA 4UTPA 1A2KC 4GXQA 3QWBA 3RSSA 2ZRAA 3H86A 2P3QA