4QG7A

S.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
197
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 82
structure length 197
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qg7A00
3UWKA 4PZZA 4DEXA 4IFEA 5E4FA 2XJ4A 2XSZA 1NI3A 4B76A 2JJ8A 4GI7A 3NIBA 1D2NA 3KTAA 3W6NA 2C9CA 1Z0IA 1P7CA 4Q4JB 4DDWA 3IIMA 4US2R 1IY1A 2WWHA 3WYFA 4E07A 3UMFA 1W44A 3TGPA 3C8UA 1QHHA 2W6IA 1HYQA 4Z1MA 3TBKA 4TYNA 1EWRA 2RMKA 2GWHA 2PT5A 1Q20A 2W2TA 1XTIA 3QEJA 2O0KA 4FWIB 4L9WA 4PO8A 3HU3A 2QI9C 1P2VA 1KJYA 1A5TA 4V03A 1NG1A 1Z07A 5JLJA 1NJGA 1E4YA 2EFGA 4M53A 4TTRA 3VR5A 3M6AA 4QBIA 4D4KA 1TX4B 1YZLA 3X1XA 1XXHA 3TRFA 1YRAA 1MOZA 2Z5FA 3CWZA 2ZE5A 2IYWA 3TW8B 2JLYA 1W7AA 1KNXA 5C1BA 1VG0B 4IXMA 1LY1A 3KFXA 4ABYA 5E95A 1YZNA 3K70D 1SXJC 3ZVMA 4NKRA 2RGBA 4LGMA 821PA 4CDGA 4MGIR 5TVKA 2QBYB 2BIFA 1HT2E 4LSGA 3VR1A 2QPOA 2R44A 4XJXA 2B7CA 3THYB 4V0LA 1E9BA 3AUXA 5F98A 1E2MA 1E0KA 4MRPA 2GZAA 3ZVLA 5FPYA 5H8WA 1BMFD 4DB2A 4EPXA 3L43A 1T91A 3SFVA 4AKHA 3GD7A 3CPEA 3U44A 4JZKA 4QBGB 2FFAA 1XD2A 2UZIR 3UXMA 3FTQA 4J0QA 2ZPTX 4AG5A 5KNCA 4KYUA 3V4RA 1PUIA 1GAJA 5JI3E 2OLJA 4EQ6B 1E9DA 1KMHA 3W34A 3TW4A 1BKDR 3AF1A 3RS3A 3BFKA 2FOLA 4CEHA 4GNKA 5J4VA 4NYMR 4UNPA 3QSYA 2HF9A 3KB1A 1AN0A 1EFHA 1CJVC 1FZQA 4RCYA 1Q22A 2QU8A 1ZP6A 2WJYA 1VCMA 5EE5B 1E9RA 2JCSA 2WWIA 5JHHB 2ZRPA 1DTSA 2DY1A 4EAQA 1JEEA 2IYVA 2GVDC 2VBCA 3K1JA 1A4RA 1DAIA 1KO8A 1AS0A 1JQLB 1SVOA 2REXB 1HE8B 1M1YE 1IN6A 1G8GA 1IJFA 1UFQA 3LV8A 4DXAA 4HAUA 4LJ4A 2VHTA 3K9HA 3CNNA 1CLUA 3B1VA 4K8OA 4QBHA 3P27A 1JNYA 4TTPA 4Z8YA 1F2UB 3Q7QA 3JZAA 4DDTA 1Z6YA 4Q01A 4Z54A 4TYQA 2BV3A 4JJKA 5JCZA 1G8FA 2C77A 3V4FA 1YZUA 2FX3A 5TMPA 3R9XA 4BEJA 5TY0A 3C14C 3BS4A 1JBKA 1ZD9A 4EPVA 3LDAA 5GJVC 1FMJA 3IHLA 3GPLA 2DFKB 4IEIA 5SZKB 4AC9A 3W9YA 4DCSA 4AG6A 1OYWA 4LZZA 5M04A 2A78A 1G5TA 2AFIE 4B3GA 3QPWA 2OM2A 2NZJA 4WW0A 3LXXA 1NF3A 2QAGA 3RRNA 3C16C 2O52A 3RABA 5D3QA 3AKCA 3RNLA 1DAGA 2JDID 5CB8A 3CKLA 3VTKA 4DLRA 4Y0AA 4ZIRA 5EP2A 2AX4A 1ZNWA 3QY0A 2WJVA 2PJRA 1XF9A 2C78A 2F9LA 4TQAA 5AJWA 1KZ7B 1G3UA 3DL0A 5BYJA 2VRWA 1UAAA 4C0KA 1GG2A 1UEJA 4BECA 4HZUA 1S9DA 3UG7A 1CEEA 4LJ6A 2W6JD 1IXZA 2ZRJA 3BWDD 5HTKA 2Q3HA 5AUOB 1NL3A 3OEED 4NYMQ 2C9YA 2BM0A 3FB4A 3SFZA 2GK7A 2IC5A 3SE0A 1Q1BA 3EC2A 4ZKDA 2NO6A 1OFTA 1MABB 2ODWA 3H86A 3RS4A 1HT1E 4ZDWA 2CXXA 3QBTA 4AKIA 4PPNA 3Q8XB 1Q1EA 3REFA 2RHMA 3KKQA 2J59A 3GEEA 3TSWA 3ZD7A 1ZNYA 3C41J 2Z6VA 3UANA 4TLDA 3EPHA 1NLYA 2CE7A 4D4MA 4KFUA 2ZYWX 1BS1A 4MA4A 1W36D 4FD2A 2FSGA 1OXTA 2J3EA 2IF2A 3PR1A 1IN4A 4X8MA 2QQ0A 4QOSA 4X8LA 2F1HA 1KKMA 3OEHA 1R5NA 1VMAA 1R10A 4HYYA 2EFHB 2R6GA 1S0UA 3D31A 3QE0A 5FUYA 5JZVA 1N6RA 4ZI3A 1M8PA 1U8AA 2RKOA 1RRPA 4MKHA 3LQRA 1OH5A 2I3BA 3IDQA 2AR7A 4MH0R 3SYKA 3VR3A 1CS4C 4O2LA 2A5YB 2IT1A 3OHMA 4XVQA 3AVYA 2ZRNA 1UPTA 3PCRB 3LBNA 5FOXA 2DFTA 5BW8A 3ZVNA 2FZLA 1E9FA 1ZUIA 5EP3A 2ZSFA 5FPHA 3TLXA 3EA0A 2D7DA 5DISB 2HJGA 3EZ7A 5HZKA 1FP7A 5HKKA 2JJ1A 4TYWA 1GKUB 1UBFA 1OIXA 3CR8A 5EZ6B 4D26A 2V4ZA 1C4OA 3OIWA 3X1DA 5JS7A 4HLCA 3CW2A 2VQSA 3MFYA 4EFMA 1W0JD 1WCV1 4KSBA 4DIEA 5A4JA 4QJ3A 5IHPA 3GLFA 4V0OA 3CRMA 4QGFA 1FX0B 1JB1A 1KO7A 2FN4A 5FBVB 4I99A 4L16A 3DO6A 3KJEA 4H1VA 2G88A 1P5ZB 3C5CA 4A4DA 3B85A 1E9AA 5BXQC 4D4LA 1CULC 2NO7A 5DHAA 2IYSA 4MUBA 2CJWB 1LFDB 3D3QA 1CP2A 2VP4A 3FMFA 5FBQB 3PJRA 3IPYA 4EFNA 1YR6A 4FWTA 5E7JA 4JLMA 4A1FA 1G6HA 1MO3A 1ZYUA 2C98A 1GWNA 4CGZA 4AIIA 1W2HA 4A2PA 1E2DA 4NCHA 4F7WA 4BEBA 4LHZA 2ODEA 1KK0A 3MWJA 3MJHA 1KSJA 1W5SA 2B21A 2PZFA 2WAXA 4DLZA 3U3OA 2MSDB 3CRRA 4IJMA 3K53A 2IXFA 2J5XA 2HXSA 3SYNA 2FGKA 4M1WA 1CR2A 1ZNZA 3PVSA 2UZ3A 2RGAA 3DMDA 1G7RA 4P4SB 1LB1B 2QGZA 3GLGA 1E0SA 4PHGA 1T3HA 3ADDA 1M6NA 2AL7A 2REOA 3MCAA 1F2TB 5EXPA 4HUQA 4JLKA 1L7VC 3SU8A 4XVRA 3VU9A 4DT1A 2FSIA 2DPXA 1T3SA 1W0KD 3BFVA 4PC6A 4C3ZA 1QHXA 2P0EA 1BH2A 4IOKA 2CLSA 4EFLA 4NMMA 2J0UA 2LKDA 1U2RA 2OHFA 3LFUA 3BE4A 1HURA 3GLHB 5FOVA 4DB4A 3TUJC 3A4MA 4JL8A 3EC1A 2FV8A 4U5XA 1U0JA 3K9NA 1EWQA 2RGCA 4EJSB 3A36A 3DVLA 4TL8A 3BD9A 3MSXA 4KFRA 4GP6A 2EU8A 3B13B 3QXHA 5JI2E 3CR7A 2J7PD 5L8VA 4B71A 3H2YA 3MWLA 3THOA 1J7KA 4YDSA 1G7CA 2ZE6A 1A1VA 4D82A 2QMOA 3ZQ6A 2ZANA 4BGDA 5DN6D 3W3ZB 2BBOA 4EKDA 2ZRKA 3NTUA 2OCBA 3PUZA 5CB6A 4B6FA 2HYIC 1S8FA 1OXXK 4PAMA 1GP2A 2QT0A 3QVVA 3F8TA 1R8SA 1ZM4A 1TQ2A 4E5UA 2GBLC 1R6BX 3RC3A 1XTSA 2ZIAA 5P21A 1JAHA 2GCPA 2ZRBA 3FVQA 5DSZA 3JZMA 5B58C 4ZI2A 4TLEA 1NVVR 2ZJ8A 3PEVA 1XCPA 5KSZA 3KFVA 4Q1CA 4OQFA 4LJYA 4IW3B 1J2JA 1LS1A 4DLXA 4FINA 3ZD6A 1H8EA 3AVXA 1MO5A 5C18A 4A2WA 4KCGA 4QKQA 1OFIA 2GXQA 3UWOA 4HLUA 3K0CA 1P2TA 4JS0A 4F4JA 3AP3A 2IWHA 4OQXA 3B5JA 4LJ9A 4ZV4A 3I5YA 4YLGA 3PFIA 3MUFA 4IVRA 4OI2A 2GEUA 3B8HA 2D7CA 2QEQA 3KQHA 4I1OA 1CJMA 4KV9A 1OB5A 2BMJA 3CM0A 2GESA 2XZOA 4B3CA 5BYKA 2MMGA 3EWAA 1IM2A 4LYJA 4F4IA 5H70A 1ZUHA 4GZLA 1AZSC 3L2OB 2D62A 3U5ZB 2IW3A 3I8SA 4L8GA 1NKSA 1QHGA 3CNOA 1CRPA 1G41A 3U6KA 2QAJA 3FKQA 5B30A 5BN3A 4TLCA 1KI2A 4XTRA 5FL7D 1D6JA 2P3SA 1W2GA 4G3XA 2VF8A 3DZDA 1SHZA 3AKYA 1IAQA 521PA 1NY5A 2WOJA 3WBJA 2JATA 5E7IA 3ZZ0A 2QENA 2FFBA 3N2EA 5DGXA 1ZINA 3GJ4A 5UKDA 5EZ5A 3AQ4A 4DC9A 2GRJA 2H57A 2W0MA 3W5JA 1N5LA 2LKCA 3TNFA 2AD1A 5CYOA 5EP1A 3WBKA 1E9CA 4D81A 2XGJA 2A5JA 2YWHA 1YZGA 5CIQA 2ZU0C 3B1XA 4TMTA 5C4MA 1TMKA 2GZDA 2VPPA 3A1SA 1KOFA 4PPQA 1VTKA 4CF7A 4KU4A 1NN3A 1EFUA 2IXGA 3U7FB 2SHKA 2WICA 2OESA 1NVVQ 2YOHA 1L8QA 3UATA 4YMTA 5FPKA 1T0JB 2R8RA 5GJWC 4Z51A 3A1UA 2JLZA 4B43A 2A5GA 4A8JC 2HDNB 3BH0A 2IS6A 4G1UC 2CCKA 5GJCA 4D0NA 4BFYA 5C4GB 2DFLA 4DUGD 3T61A 1B23P 1R0YA 2WMOB 2WSSD 5FPTA 3FYHA 1K6MA 4B2LA 1KI4A 5JJLA 4Z8XA 1NY6A 2O5VA 5EE3A 1T5IA 1VHLA 4RFVA 2YWGA 3UK6A 3FWYA 1XPRA 3NH9A 1TPZA 4G0NA 2O8BA 1ZBDA 1G20E 3K9LA 4G5SA 1JPJA 421PA 1FW6A 1O87A 2IYQA 5DIFA 2XXAB 3EW9A 2V6IA 2OCAA 5AWFC 3PUXA 4M9QA 1MH1A 4ESVA 4AKGA 4NCIA 3QJYA 5EJEA 3ZLJA 1Z22A 5J5CA 3AGQA 4A6PA 2GJAA 2FZ4A 2FSHA 2IEYA 1FTSA 1JPNA 1EFCA 1XTQA 3I61A 1WE2A 4AWXA 2VHQA 5HPYB 1VG8A 3CF6R 2VO1A 1WA5A 2CCGA 1R0XA 2O0HA 3BERA 5HR5A 2R6CA 3FFAA 1SXJB 1E79D 1AKEA 5JRJA 1PZNA 1FNNA 3OF5A 4CVNA 4GPTA 4PHFA 2W83A 2FFQA 3B6EA 3RRZA 2ZSAA 4B3DA 3IO3A 1AM4D 1G291 4CT4B 1GOTA 2V54A 3THXA 2ZR7A 1ZC4A 1N6PA 4U00A 4C4PA 2IWRA 2XB2A 1ZMXA 4QBFA 5DLQC 1DAKA 2EWWA 1RYHA 2J41A 1VIYA 3I4LA 4NHOA 1KDOA 2B7BA 3AP1A 4D2IA 4AYTA 4BLTA 1QRAA 1CKEA 4I1UA 4JKIA 3ZIAA 4C0JA 3DOEA 1CJUC 2BJVA 3I92A 3QXXA 1GNRA 3ASYA 4Q9HA 2GDJA 3GLIA 3EIQA 2PL3A 4PPGA 3HYRA 4V0MA 4DLSA 4TL6A 3AM1A 2F6RA 1MR3F 1S3SA 1QG4A 4S2EA 4AURA 4DSTA 3AGPA 2F43B 3KJGA 4JLPA 1PVOA 4M0LA 2PH1A 4ZDJA 4XWKA 1TL7C 2PEZA 2V7QA 2GBLA 2B8WA 2WJGA 1FUUA 4JSYA 1TADA 1T5LA 2PLFA 2VL7A 4X8HA 4NTZA 3AKEA 4NCKA 1OF1A 4NE2A 2DWPA 1VCNA 4US1R 4WXRA 1OB2A 1VYUA 3WMFA 1W36B 4RFSB 1N6HA 1G1MA 2IBMA 3TAUA 1H8HD 5CM9C 2JJ2A 4M1YA 1NG9A 3X2SA 1YR9A 5FR2A 5L3SB 2XZLA 4O0MA 2GHIA 3EIHA 4LRWA 2V55B 3LLMA 2XTMA 4XD7A 1PLLA 2QAGC 4R2HA 3UKDA 4OQNA 1I4LD 4NH0A 4RCZA 1WBDA 2ZJOA 4FMDB 4WVFA 2A3RA 4LWZA 1A82A 3VHXA 2CDNA 1ANKA 5BN5A 3LO5A 2OBNA 5IF9A 2WIBA 3IILA 4LYAA 4AY2A 4JLVA 5F3WB 3P32A 4YONB 2FG5A 2VSXA 2B92A 2O8FB 3OAAA 4R71A 3U4QB 4LYHA 5EP4A 1GNQA 4PSKA 2CLCX 3IHWA 1W48A 1XP8A 3KXLA 4JLDA 4GRAA 3VR2A 3BK7A 4KI0A 1KAGA 4DBLC 2IX3A 5FBWB 4CEJB 1RW4A 1IONA 1KO1A 2QP9X 4Q18A 4CEIA 1N6KA 2ZAOA 2JLWA 2N42A 2XZPA 2VP0A 3GJ8A 4IKEA 4M2LA 5DO9A 3FKSD 2P5TB 2VHCA 1CTQA 4ZCMA 4BFZA 2FU5C 3T1VA 3KQUA 5CM8B 1D9ZA 2FSFA 4HATA 2A9KA 5CDFA 4PQFA 1DOAA 1R0ZA 2OFXA 3VX3A 2OBMA 2C95A 2HYDA 2AHOA 2B6HA 2IYRA 5AJXA 2IF0A 2FPKA 5FI1B 2F1JA 4B3XA 4Q9IA 2O8DB 2ZR9A 1NSFA 5EE1A 4JKYA 5TARA 2X2EA 5FI0B 4JVLA 3AEZA 4LHYA 1G8PA 2IHYA 3CUEF 3T5DA 3KX2A 1RE0A 4ARZB 1COWA 4KFSA 4NYJR 4BLQA 1IBRA 1F48A 4D0LB 1IJEA 1G21E 2YZ2A 4XWOA 5JSZA 3ZJYA 1FTNA 4NYIQ 4W7SA 4OHZA 4JBXA 1G3MA 4A8JA 3SR0A 3UMSA 3CX7A 4F93B 3F0TA 4BE7B 1F60A 5DH9A 2WTUA 5JJIA 4RZ2A 3KXKA 3M1IA 2CHGA 2GA8A 4TMWA 3RLFA 3SNHA 1K5DA 3VNUA 5SZHB 4C0LA 1LF5A 4YC7A 721PA 2QM7A 3RRYA 5JEDA 4N0EA 2OE2A 1KDRA 4QHTA 1XJQA 2VYFA 4QJ5A 2QL6A 4IOJA 2GK6A 2YJTD 4DLWA 5G41A 2CNWA 1AQUA 1M34E 4B47A 1KI6B 2QRNA 3THWB 2GZHA 1NN5A 4XSHA 3MD0A 2VH5R 4X8OA 1TEXA 4A0FA 4A0HA 3PUWA 1NLZA 1YE8A 5FPSA 2O8EB 2F3TA 2ZS7A 2JEOA 1Z63A 2HJVA 4OQMA 4OK5A 5G40A 3SYLA 3QF4B 1GZSA 4MRSA 3DMNA 4B32A 1HEIA 5KDLA 5F9HA 1VDZA 2N1BA 1Z6GA 3CF0A 3NVAA 1DE0A 2X19A 3Q72A 4PQYA 3LX8A 4MRVA 3WP1B 4BLRA 4GSYA 4BRUA 2YINC 3BORA 1RVDA 2K5UA 2C96A 3RWOA 4RD3A 4KXFB 1TQ6A 1E4VA 2OEPA 2AD5A 3LD9A 2IS1A 5B64A 3NHBA 3W8NA 2XNDA 2AN9A 2I1VB 2CMKA 4EPRA 4CYMA 4TZ6A 4HB4A 1ZCBA 4NCJA 1IY2A 3K0FB 1MO4A 4PXAA 1OHHA 1TQDA 1KO4A 3K8YA 3WNCA 5JHGB 4B3FX 1ZD8A 1D2EA 2DYKA 4XVUA 2I1QA 2ZQ5A 1X6VA 3BIFA 1MKYA 2BMDA 5L3QB 1KMQA 3K0AB 4IOLA 1ZJ6A 5AJVB 5KYKA 2O8CB 2PMDA 3X1WA 3WRYC 2NZ8A 3CB4A 2C8VA 3G82C 4NYJQ 4S35A 4URWR 3BB4A 2XNSA 4PC3A 1SVLA 1P72A 1XCGB 3QQ5A 4TL9A 3KJIA 3WNBA 2AWNA 4HB0A 3I8XA 2QMEA 5CLQA 4ITRC 3NC1C 4EDHA 4Q7LA 1JXMA 2NO9A 1RPZA 1NN1A 1Z2AA 4JYBA 4HUTA 3CZPA 3QKUA 3ZS9A 5J4KA 2DWQA 5LBIA 3EZ6A 5GVRA 2GCOB 1SVMA 2V3CC 3TR0A 3LBHA 1G4AE 2EWVA 1DARA 1RJ9A 1SXJD 2XTNA 1DS6A 4GFDA 4RVCA 3IGFA 3QPVA 1XJCA 4EPTA 3QXSA 4D6PA 4V02A 3PENA 1XTRA 2BMEA 1P2UA 5FFMA 4FW9A 3RYTC 4E09A 1G3IA 5FUVA 1X3SA 3TVDA 3B82A 1SXJE 4XWAA 1IN5A 3CLVA 3HDTA 1NIPA 1OKKD 1DO2A 5FTJA 2GF9A 2CK3D 1Z47A 2FMXA 2ZI3A 5EE9A 3RRMA 4KODA 4Q21A 3P26A 4FCVA 4B48A 2ORIA 4ZPXA 4IOMA 1KSHA 1VIAA 4C0HA 4FCTA 1KI1A 2GETA 2ZE7A 1PJRA 3T35A 1BMFA 4LPSA 4RD1A 1ZVQA 2IA5A 3AV0B 4P3YA 1XX6A 2RHDA 4LY6A 4AYXA 3GLFE 2V1XA 1ZU4A 4M4SA 1VG1A 5F2EA 3E70C 3NBZC 1BO6A 4LHWA 1DBSA 4YXWD 3ZZTA 1XPOA 1FMLA 2C04A 4C9BA 4O2RA 2OXCA 2H1LA 3LY5A 4ASUD 1AK2A 3FDIA 4HLUC 4OL0A 3K0CC 4JVSB 1NNEA 3PEYA 4MRRA 4JJZA 1NVXQ 3HPQA 4UKDA 4GP7A 2FFHA 2VA8A 4KVGA 3QEOA 4UNNA 1GNPA 4RY2A 5LD2B 3CPJB 3R8FA 1K5GA 4UXIA 2GJ9A 3HWSA 3MWYW 1E2GA 4HAXA 5K8LA 1II8B 1ZM3A 3ND8A 4JLOA 2L0XA 4UJ5A 5HZHA 3QI2A 4OHXA 1QF9A 3DDCA 3LW8A 3WMGA 5JBQA 1TU4A 1CRQA 3NDPA 3SQWA 2YC4C 2RGNA 1FQKA 2G6BA 1Q3TA 2WVJA 1FUKA 3BBPA 2QORA 1DAHA 2X2FA 2YVUA 4R98A 2O0JA 3NG1A 3T12A 1DVRA 2YOFA 2R6AA 2XXAA 2VSFA 4LBWA 4E03A 4LBYA 4WA7A 3BB3A 5CIWA 1JALA 4LJ8A 3TVTA 4B33A 3QKRA 4Q1EA 1OT3A 3X1ZA 1NLFA 3LA6A 2QN6A 1AGPA 5F9FA 2JLRA 2WKQA 2HUPA 4Q1FA 3A1VA 4NDZA 1GSIA 2BM1A 3B1WA 4W5JA 1EFRD 1FNMA 4TT3D 2ECKA 1OIVA 5FR1A 3S1AA 3D8BA 1N6LA 4Y0VA 5KSPA 4TTQA 1WDTA 1DAFA 1LS6A 2QM8A 1SKYB 1WRBA 1OW3B 4EUNA 3B9PA 4B34A 1G17A 2VEDA 3R9IA 2IYUA 1EXMA 2HXYA 4HAZA 1U0LA 3MRSA 3NBYC 3VHLB 2R65A 1G64A 2FEMA 2JDIA 3DM9B 2ZYVX 3PITA 3GEIA 2QPAA 1UF9A 4HSEA 4LJAA 1TEVA 1OFUX 1FFHA 2W0SA 1EESA 1ZM2A 3LWNA 1IXSB 1YJ5A 5EXTA 1P6XA 3ECCA 4IDQA 1ZNXA 3SJCA 3ZYCA 1G19A 1IHUA 2QTFA 3KKMA 3O8DA 2KSQA 3D6TB 2W6JA 3WNDA 4UXJA 1ZCAA 3LQQA 2ZRLA 3OEEA 2P6UA 2NPFA 3NDBB 3HP1A 1E9EA 4PR0A 2G9NA 1R4AA 2BOVA 2WJIA 4URYR 2OG2A 1QHHB 4RD6A 1XWIA 2JA1A 3DHWC 3MAAC 2OLKA 3EXAA 3PEWA 3P4XA 2WWWA 1J8MF 1S1MA 3PG5A 1N0WA 4M22A 4QNMA 3KQKA 4TSFD 1GIAA 2XOKD 5CK4A 5AJYA 1UKEA 4PO9A 4Q1AA 3U7EB 5DHFA 4EPWA 3QG1A 2XB4A 5JFGA 1FL9A 2HT6A 2IUTA 3SN6A 3C4JA 1ESNA 1AS2A 3QBVA 4LC0A 2PZGA 1EX7A 4MRNA 4Q4LA 3EPJA 2CVFA 1X1SA 1NMZA 2JLUA 4LHVA 4Q7JB 4NPHA 3EASA 1V5WA 3Q3JB 4D25A 2PBRA 2XTZA 3E1SA 4LHXA 3B60A 3EX7C 1NMYA 1R2QA 1UJ2A 1E32A 1E69A 2VP9A 4C7OA 2EVWX 2FPMA 4E22A 1X1RA 4DDUA 4NONA 2RCNA 3JVVA 1JR3D 3FE2A 4UNQA 1WQ1R 1IOZA 2WPDD 2O8FA 4IEEA 1M7HA 2GVZC 3W8RA 3IEVA 3IBGA 3T1OA 2FWRA 4GOKA 2OT3B 1W46A 1HY3A 1Z06A 3A6PC 4PAOA 1UBGA 1OLOA 4K46A 4M9ZA 3AVTA 4C2TA 3U44B 3R7WA 1JR3E 1KK3A 1XRJA 4Q4AA 4TYPA 3QPUA 4LCBA 4KBGA 3PEUA 5SZJA 2VF7A 1E2HA 4WIAA 1CR1A 3IUYA 3PUVA 1N25A 3BGWA 3OESA 5ELXA 1GL6A 4RSGA 3OE7D 2CL0X 4B73A 3VR4A 1GM5A 4KLNA 2G1JA 3KUCA 1KMHB 3KKNA 5LB2A 3CO5A 4FI3C 2BMFA 4TT3A 3LLUA 4M8NE 2QE7D 1W0JA 4CEHB 1DELA 5A5GA 1U99A 3AF3A 4MGKR 4F92B 1P2SA 5C46F 1N5IA 4Q4JA 2OFOA 1QDEA 3WXMA 2OUKA 3T34A 1KY3A 3G0HA 2ZJ5A 3QXJA 2HF8A 2VIIA 4AYWA 2PX0A 4I1SA 2ZRHA 1F6BA 1J8YF 1MO6A 2R9VA 4QFMA 3DZ8A 1P9NA 1XEWX 3I73A 4ARZA 2Y8EA 4FMDF 1DAEA 1CXZA 1P73A 2ZI6A 3C7KA 1F5NA 3DPUA 3KB2A 4QRHA 2J1LA 1M74A 4IDPA 1N6OA 4B75A 1HA3A 2BDTA 3GJ6A 1JJ7A 1S96A 5DI3B 2QTHA 1QHIA 2PMKA 4I1VA 2OZEA 1YRBA 4LJ5A 2J0VA 4HAWA 1P4SA 4JIMA 4QC2A 4AKEA 2IYZA 2ZITA 3BH7A 1XDBA 2NGRA 2HLDD 3RVBA 2QBYA 1BYIA 3F3YA 3QKTA 3U3RA 2VLIA 4URUR 3W6OA 4WBSA 2QNRA 2ZU6A 3THYA 1U9IA 2VTKA 3U7GA 4IRUB 4MYTA 4B3BA 2VHJA 1W0KA 1ZC3A 3NKVA 4KJZA 5FTMA 4C2UA 1D2MA 3N2IA 2GNOA 4JLAA 2JIZD 2WIAA 3AF0A 2QAGB 3PXGA 2V8OA 3OIUA 4DRZA 2ZRFA 4OI0A 1R5BA 1GRRA 1E1QD 1U98A 4QXAA 4M1SA 5JCPA 5DI9A 2C2HA 1MRNA 3EZ2A 2KJQA 3FMOB 1KI9A 4C0BA 2ZJAA 5K8UA 4URZR 4EQ6A 1YVDA 2YWFA 4KVAA 2UKDA 1G5PA 1C1YA 4HZUB 4YDHB 2KBFA 4ZKEA 5FTKA 3TK1A 4DCUA 3TUZC 1WBBA 3CH5A 3DKVA 5J4HA 2J7PA 1U94A 4PFSA 4BLPA 2CHVA 2ZJZA 1YKSA 3TSOA 1Q44A 3PUYA 3ZH9B 2J0QA 2A30A 2P65A 3QKSB 5AJZA 3RANA 4A36A 4GOXA 4TMVA 5GJBA 4LBVA 4ZCIA 5J47A 3TSZA 5DN6A 1TF7A 5IK2D 2QROA 4ZO4A 4BFTA 3FHOA 3L8ZA 3TMKA 3I62A 3KZ1E 1NBMD 1BYUA 1E3MA 4LOAA 4WAUA 4PX9A 1KZGB 4HDOB 5HCIA 4QJ4A 4D4JA 2O8CA 2H18A 3ONWA 4OK3A 4UNRA 2JAQA 2OXRA 3F5FA 2WOOA 1F2UA 4DIDA 3DEFA 1NBME 1NMXA 3G5UA 2ZUBA 2ANBA 2YYZA 4IVQA 1KSGA 2HCBA 2DWOA 3E5HA 1DG1G 3LX5A 3SBEA 4XSGA 2ASEA 1KY2A 2GILA 1OH6A 2P2LA 1E2FA 5EXSA 2AWOA 3SEAA 2AKAB 3WYGA 1E6CA 4IHQA 3A37A 1E2JA 2E1RA 1XBTA 1G7SA 4OJQA 4BWYA 4P4TA 4DZZA 3KKOA 2EYQA 4HI0E 5EQTA 4BLOA 2WWFA 2XJ9A 2FH5B 3HU1A 1T0HB 3IQXA 1ZD1A 1XPUA 1BOFA 1TF2A 2ZYTX 4DKXA 2W2VA 2HT1A 2DR3A 4NBSA 1ESMA 2P5SA 5FBRB 4BZPA 1QVRA 1T3LA 5KSYA 5IRCD 1E1RD 2NG1A 5GVSA 2LCFA 1DAMA 5AUNB 2OILA 4Q5IA 1SVSA 3BH6A 2WKPA 1W4AA 1SKYE 3AVQA 2IUUA 3SJAA 2HLDA 1E2QA 2ZJBA 3AF2A 3ZDQA 2RGXA 2BKUA 2P67A 3OFND 1G7TA 2OO7A 4FCWA 5EUMA 2Z4SA 5FL7A 3FPAA 4Q02A 2ZRDA 2XSZD 2VHUA 3V9PA 4ESHA 2ODBA 4B2PA 4F4CA 2OCPA 3P1JA 3GLFB 4W5WA 2ZUDA 4DWJA 4KYIB 1A2BA 1SGWA 2REBA 4Q48A 4D0GA 2ORVA 4GOJA 1X86B 5CDFE 2W6ID 4Z1MD 5JEEA 1R8QA 3I72A 4NCNA 1MABA 3SBDA 2ZI4A 5IT5A 2AXPA 2ONKA 2DFNA 4R2IA 2RH5A 5FOSA 2JLXA 4B35A 3GJ7A 4G5GA 4MGZR 1XEXB 4Q03A 1W4CA 4R9UC 2ZRMA 5TDHA 1KK2A 1JR6A 4NYIR 1GDDA 1R0WA 3BAFA 4OKSA 4II7A 2H5EA 4ILEA 1XFAA 2GEDA 3LNCA 5KUTA 4UQOA 2Z43A 4M1KA 4CT5A 4M1TA 8OHMA 3UG6A 1T9HA 4HDQB 4TQUS 3N70A 1WB9A 1XXHE 4B2IA 1XEFA 3L8YA 4KFTA 2BCGY 2A5DA 5E3HA 3GLGB 1XMJA 4DUGA 3K70C 4V0NA 3IQWA 3ADBA 3ICEA 2WSSA 4Q9JA 4FMCB 1OPXA 1XD9A 4HUQB 2X77A 2QMHA 4DLTA 4DT1B 1AJEA 5JWHA 3RHFA 2Q9AA 4PC1A 4K81B 1LTQA 3GEHA 3I1FA 4PAQA 5FOUA 1MRSA 1NIJA 2AFHE 1R5OA 4ON9A 1G6OA 3EWSA 5HCNA 2J0UB 1JAIA 2D3WA 1U8YA 3NH6A 3R20A 1Q1ZA 2MSEB 1Q0UA 2P6RA 2YC2C 5L3VA 3EA5A 5FTLA 1US8B 2QY9A 4M1MA 1SVWA 1Z6TA 5DNYB 4DLYA 3HU2A 1N5JA 2RGEA 2HV8A 1U0HC 3KUDA 4LK2A 1M7GA 3T5GA 2GJKA 4POAA 4PHHA 1OJLA 4TZ0A 2BBSA 1FX0A 2GEVA 3UIEA 3CONA 3CWQA 2PX3A 4BPBA 1E79A 3GP8A 1W4BA 2ATXA 2NO0A 2ATVA 1H65A 3TQCA 3LBIA 1Q21A 2PCLA 2PLRA 1N0VC 4A9AA 1G8YA 3WMEA 3GMTA 2CJWA 4G5OA 4N1AA 3TE6A 1ZW6A 4OHVA 3B1ZA 2WHXA 3NBFA 3VR6A 2NIPA 2Z83A 1E0JA 4AI6A 3KL4A 3CNLA 3FFBA 1G3RA 1N3BA 4OK6A 3K0EA 2IYLD 2E9SA 1YHNA 4CZ2A 3ZGXA 4F91B 1T6NA 2OCYC 1P61B 3WRXC 4MYHA 3C5HA 2RGNC 3HR8A 1BIFA 2Q6TA 1W4RA 2VP2A 1HE1C 2PJZA 3H4MA 4QG7A 4TLAA 5LB4A 3WHLA 1NN0A 1TU3A 1KTVA 4LV5B 2D2EA 3ZZUA 1QVAA 4P4SA 2UVQA 1I2MA 1X8JA 1FQJA 4L15A 2BC9A 4NP6A 4DLVA 3HYTA 5KNDA 2EFEB 2BEJA 2QQEA 2WM9B 3AF4A 1AGRA 3QIAA 1NP6A 3QF7A 2EW1A 2OSBA 2QTVB 4FMBB 4MYCA 5CK5A 1F2TA 2BBWA 2QP4A 5LDDC 1C9KA 4XIGS 1OE0A 4QL3A 4ACAA 4UXHA 621PA 2ZE8A 1WP9A 1E99A 2ZR0A 3A4NA 3U6BA 2R62A 4FN5A 1HTWA 1T8UA 4O3MA 3T06B 5KO2A 5EXXA 3LAWA 4P32A 3KKPA 2D06A 3B9QA 1H8HA 1QHSA 1QHYA 2V1UA 3GLHA 1Z29A 5CYPA 4CRWB 3CX6A 5H68A 2IYYA 3GJXC 1KYIA 4CW7A 2JGNA 4EJSA 5G3ZA 2J0SA 2ZI5A 4LC1A 1S9HA 1QG2A 2W58A 3AVWA 1AZTA 3U7HB 1HV8A 3Q7PA 4OJKA 1GRNA 4XTCS 2ANCA 2FA9A 3ETLA 5FL3A 4HDCA 2E87A 5DE3A 2QMUA 4Q47A 3LH5A 4RD2A 4OBEA 2WJHA 1KAOA 5DYGA 4NL4H 4JYCA 4PC2A 1RFLA 1U8ZA 4KSCA 3VKWA 2QUZA 3WHKA 1Z8FA 1ZU5A 2PZEA 3FKSA 4GL2A 2WWXA 3NHAA 2GJ8A 3QOFA 3ZS8A 2YWEA 3AVVA 1E9SA 2A7QA 2ZXUA 2EFDB 3FOZA 3GQBA 4A92A 3VKHA 1OXUA 2ZI7A 4L9SA 4YMSA 3GCGA 3H84A 1Q12A 3PV0A 2WWGA 2QT1A 2ZSBA 5TB5A 4DJTA 1GRQA 4Q9KA 3X1YA 4B74A 4ZCLA 1W36C 1DPFA 2GAAA 3UMRA 3H1TA 3OEHD 4TWZA 4N3NA 1E2EA 2DHRA 1QZXA 3A4LA 1RIFA 5BWMA 3TH5A 3L82B 4KLZA 3SI7A 5J4YA 1Z3IX 1NKTA 3QUSA 5IDVA 3PQCA 1E2LA 1RRFA 1SVKA 4DSUA 1IN7A 1AIPA 1Z5ZA 2F55A 5BQ5A 2VSOA 3A8TA 4DVGA 5L3RA 5EE0A 1HQCA 2ZRGA 4ERNA 3W6PA 2ERYA 2QPTA 3AP2A 2O8BB 5DI3A 1VHTA 4JBWA 2WV9A 2TMKA 3B2EA 3Q5DA 1VECA 1GITA 2J9RA 2IEZA 2Q9BA 3B78A 3Q9LA 1Y63A 1QHNA 4JMPA 4Q1BA 5CJ2A 1HQYE 4BFUA 1ZM9A 5HKKD 1FOEB 2JJ1D 3FMPB 4DHEA 3W5IA 1T8TA 2NQ2C 5D3MB 1CR0A 4BZQA 1Y3AA 4BUJA 2ZRAA 3AVUA 1KKLA 3BXZA 3BRWD 1UKZA 3TUIC 3M4YA 1EG7A 3TKLA 3WP0A 2FEOA 4IVPA 2VP6A 3K09A 3NWJA 2ZSDA 2BJWA 4P33A 3VQTA 3P4YA 4KAXA 4TYYA 3SC3A 1IXRC 1Z0AA 4PC7A 5JJKA 3THXB 3HR7A 4GBMA 3TQFA 1FP6A 1E98A 1XMSA 1E2PA 1JJVA 2CVHA 4B6EA 4BFVA 2ZM5A 2OV2A 3A1TA 4R7ZA 1LW7A 3VX4A 2EYUA 1V43A 2KBEA 2ZVPX 4GMDA 3VFDA 3ADKA 1KDPA 4A6XA 4JSTA 4M21A 5TV2A 1EX6A 1GILA 2FGJA 1WMSA 4OQLA 2Q21A 1KI3A 1Z6XA 1Z2CA 2Z4RA 4NU0A 1E2NA 4XOIA 3REGA 2VP5A 3VMFA 3GLIB 3QKSA 3RS2A 1XZPA 3FMIA 4Q4HB 5ANRB 1KHTA 1XU4A 2J46A 4BFWA 2QP3A 4QGGA 2DB3A 4DCVA 3EAQA 3VKGA 1SVIA 3EPKA 4M1OA 2Z0MA 4W9MC 2JLVA 1VYVA 1AKYA 4C30A 5B57C 2AKYA 2AK2A 3TIFA 4DSNA 1IQPA 1TTTA 3A58B 2GF0A 3QVUA 4RKFA 2KWIA 3KJHA 4URVR 3GLGE 5TXGA 4GMXA 1Z0JA 2AXNA 1N6NA 1F3OA 1D5CA 1P3JA 3VAAA 2F7SA 4US0R 1U9IC 4G01B 4MKGA 4BFSA 4RZXA 1ZIOA 5FOWA 3QNUA 5AUPB 2OAP1 5KDDA 3BJIC 3Q5EA 3RAPR 2YKGA 1OSNA 3RS5A 3RC8A 2BHRA 1KI8A 2WBLC 3D7MA 3AUYA 3EIEA 2Q0HA 3IPXA 1XCMA 2FPLA 4TL7A 5KTYA 1ONBA 1VKJA 2MSCB 2GXUA 3N5CA 4A15A 4MKIA 3L0SA 2R2AA 1M7BA 2JLQA 2GXSA 4IXNA 3JVUA 2WWYA 2Q9CA 1SXJA 1Z6AA 1I2DA 2ZROA 4NZYA 4YQFA 3VNVA 1Z28A 2ZUCA 1EK0A 4V0KA 2YV5A 3AVOA 3CIOA 3GFTA 3OIVA 2ORWA 2HEIA 1TF5A 4CEIB 3SOPA 2OAQ1 1LNZA 1OV4A 3EZFA 4DSOA 4B44A 2FE4A 2IYTA 3KQNA 1VG9B 3MGCA 4GZMA 2CL7X 4ZDIA 3SQXA 5K8IA 5FOTA 1OKKA 3L0IB 2G0NA 2CK3A 2H92A 3I32A 1KO5A 3MJRA 2ERXA 4CIDA 2JLSA 2P6NA 5G3YA 1X8LA 3AB3A 2V9PA 3C15C 1XNJA 4RJLA 4C0QC 3E2IA 1CU1A 1Z0DA 1G9XA 3KTAB 2ZEJA 1KNQA 1FPMA 1PUJA 1O3YA 4WZ6A 2F3RA 4PTLA 1UDWA 2F43A 1EGAA 4M9XA 3M0EA 1ZIPA 4ZDKA 5AUQA 2F1RA 1CBUA 1H8ED 5FUXA 1P60A 3NBXX 2G1KA 2YNMA 4TMXA 3L0PA 4YMVA 2ZREA 2KI5A 5G53C 3QG5A 3O47A 4XH9B 3MMPA 2C5LA 2IUSA 4YXWA 5FH9A 1XEXA 1KGDA 1ZRHA 2ZVQX 2V6JA 2X1VA 2CL6X 3A1WA 4ASUA 4HB2A 1AQYA 1GKYA 4GDFA 4QM6A 5CITA 2GJSA 3SJZA 5JSZB 3SHWA 1XXHB 1W5TA 4QGAA 4RFSA 2GXAA 4A8JB 1KK1A 2JASA 5LPNA 5BN4A 3CX8A 5HE9A 2FJUA 3SJBA 1TAGA 5L3SA 3K0SA 2W2XA 3MG9A 4PPFA 4WZBE 2EQBA 1YR8A 1P75A 3MWKA 4Q7MB 1XZQA 2EFCB 4DLUA 3RSOA 2ZAMA 5C2JB 1U90A 3CH4B 4QM7A 1UM8A 2ZI9A 4TMKA 1DG3A 3ASZA 1LVGA 3R9WA 2IK8A 1Q1QA 3FHCB 4PHTA 3CBQA 1JEDA 3U4QA 1OFHA 2GAOA 4L4UA 1KJZA 4ACBA 3ZVRA 4DEYA 3U3MA 2BEKA 3HPRA 1IN8A 4CEJA 4LI0A 1YQTA 3P20A 4TMZA 4WXPA 2WMNB 1XD2B 3SHFA 1US8A 3WYAA 2AK3A 2F9MA 2Q3FA 4JL6A 3IKJA 4MUAA 4QGHA 2GTPA 3V00A 4IDOA 3EARA 5HE8A 1I4TD 1SKQA 1E2IA 1OXSC 4P31A 1PV4A 2C03A 5DYIA 4JLJA 4TLBA 3RDPA 2CLDX 1EFRA 1SHKA 5CJPA 1OYYA 2G3YA 3KDSE 1RYFA 221PA 3R8CA 4HAVA 4IFBA 4LPKA 4OI4A 1AA9A 4G5QA 1MV5A 1PLJA 2RAPA 4JBYA 3TAHA 1UKVY 2N46A 4MYUA 2WZQA 3K9GA 2YHSA 4P0TA 2O8DA 1VYTA 3T1TA 1GKIA 4A0GA 2BVNA 1NRJB 5LD2C 2BBTA 4LX0A 4MDEA 5AK0A 4JT2A 4LV6A 2CCJA 4EPYA 2NPIA 3O8CA 1ZUNB 1RZ3A 1OIWA 5KDOA 3ZQJA 5KNBA 1A2KC 1R7RA 4FMCF 1QBKC 1G4UR 2DCUA 4D80A 1I4DD 4BZXA 3WY9A 4JVMA 4C0SA 1KI7A 3I3SR 2PT7A 5AR1A 3U61B 5JRZA 4P4UA 4EIWA 4MDFA 3EZ9A 4BRWA 6Q21A 5KHOC 4YMUA 2CHQA 3EPLA 2WJJA 4OYHA 2OFWA 4IDHA 4HAYA 1JXOA 1IY0A 1J90A 1WXQA 3EG5A 5A0FA 1XJ0A 3BOSA 2ZETA 2IS2A 3BFXA 4BFXA 4TSFA 1OH8A 2XOKA 3QENA 4YMWA 4OHWA 3UPUA 2QRZA 4HLQB 4Q1DA 2ZRCA 1GUAA 5JMTA 1UBCA 5B2ZA 3O8RA 3OIYA 2QSZA 2ZYUX 1KI6A 3THWA 4HEJA 1RJ9B 4PZLA 3NXSA 4H1UA 2LWIA 2C9OA 3IEUA 4LBZA 3RSLA 3BB1A 4DCTA 2IL1A 2O8EA 3IIKA 3GJ5A 1HH4A 3U3KA 5CLLA 1OH7A 3QF4A 2NO1A 3T1QA 5JS8A 121PA 3K70B 1II0A 2G83A 4URXR 4PZYA 3H0KA 4ZIRB 1AS3A 1DADA 2DBYA 4M9SA 1W49A 1XMVA 1L2TA 1WF3A 4PSAA 2R6DA 1CR4A 1ODFA 2H17A 3W90A 1GL9B 1XTJA 4HB3A 1P9WA 3ZIAD 1J99A 2KB0A 4BLSA 1DEKA 1JR3A 1KSFX 2ZS9A 4PQRA 4I81A 4TN1A 3DOFA 4MKFA 2WPDA 3LW7A 1UBEA 2NMVA 2RB4A 2WKRA 2B8TA 2W00A 4QNRA 3B7GA 2IS4A 1Q57A 4I4LA 1SQ5A 1UKYA 2FF7A 1HUQA 3SZRA 3K0FA 3DM5A 4TQ9A 2PCJA 2V7QD 2HCJB 2X8AA 2QSYA 1ELOA 3GLIE 1GFIA 4LUCA 1D9XA 2ZTSA 4V0ME 3OZXA 4FIDA 5KPJA 3LVQE 4AK9A 2H7VA 4Q66C 5J4LA 5L3QA 2XX3A 2J87A 3U2QA 1MT0A 3OE7A 3K0AA 3RS7A 1L4UA 1Z83A 4RZ3A 1LV7A 1A7JA 1RKBA 1PLKA 2QG6A 3DKPA 4U02A 2ONJA 4UJ3A 1G16A 4KHZA 4RD4A 2QE7A 3SDZA 4A2QA 3CF2A 1G18A 2JJ2D 5KOYA 1GTVA 2ZS8A 2D2FA 5H1YA 4XD7D 5KPDA 1SZPA 2J7KA 4RKEA 2QGNA 3I5XA 4WOPA 4JT4A 2PEYA 3CRQA 4LJ7A 2GCOA 3Q85A 2CBZA 2Q3MA 2KE5A 4EJSC 5EUQB 1RRCA 1E94E 3OAAD 1D8TA 1N5KA 1NVUQ 1TNDA 3AKDA 4U7DA 1N6IA 1VPLA 3GFOA 2GKSA 2OBLA 1UADA 4MQBA 4Q7KA 1N2CE 4QHYA 1Z0KA 3QKRB 3J81k 1YZTA 4PO1A 1NSTA 5JWRA 1E2KA 1S3GA 2A5FA 5D3MA 3LVRE 2YOGA 2QA5A 2BCJQ 2CEAA 2ZJYA 3B1YA 4BQSA 4H9GA 1DO0A 2IHBA 2H8KA 2XITA 3S1AB 2XEXA 1EFTA 1K8RA 4KBFA 2CE2X 1NJFA 1TUIA 4HLDA 3NEYA 3O8BA 3CRVA 1ZAKA 3RS0A 4O25A 4Q00A 3KQLA 4Q9LA 3CZQA 2JIZA 3CPHA 5SZIA 1B0UA 1ETUA 3AH8A 4LV8B 4JVNA 3HJNA 1KJWA 4QHSA 5E7MA 5FBLB 5JECA 1RC8A 2D4HA 4A82A 1G3QA 3GJ3A 4HZIA 1VCOA 1E1QA 1GL7A 2A2ZA 4AD8A 1XD8A 1COWD 1SULA 3L0OA 3NC0C 1TUEA 1YU9A 3FGNA 5K8TA 1JECA 2G77B 2D74A 4LYFA 2FDCA 2RGDA 2C99A 1NVWQ 2ODNA 5KU1A 1RRGA 1UEIA 3T15A 1II9A 4UNSA 3GFPA 3U60B 4Q4HA 4DCNA 2R6FA 2BKEA 1XEWY 1P62B 1YZKA 3AVPA 4L5BA 3ICQB 1II8A 4MITA 5IK2A 1CJKC 3LRPA 2I4IA 3BC1A 4RZUA 3RWMB 1NBMA 2NOAA 3SS8A 3FHTA 1E96A 4N0DA 3PIRA 1KIMA 1GVNB 3KXIA 2ZSEA 2G0TA 2ZRIA 4MGYR 5FUWA 5JWOA 1M2OB 2QZ4A 3QXCA 2BWJA 2CNWD 4PSVA 4OI1A 1G5RA 1XB2A 1CIPA 2J45A 2ZJ2A 3VU9B 1XMIA 3IO5A 1UDXA 2IYXA 1VCIA 3MLEA 4JLBA 4G5RA 1P9RA 1JQJC 4KO8A 3W3AA 5FTNA 2WSMA 3K09C 2WAYA 2IXEA 4FXPA 4PANA 1KDTA 2H16A 1N0UA 1CJTC 4Q19A 4BASA 1U81A 2XAUA 1E0AA 1JI0A 1S2MA 4A0RA 3TJZA 1OXVA 4C7OB 1LF0A 2F1IA 2RGGA 1CF4A 3GJ0A 3GLHE 4LDJA 4RD0A 5GADl 3IIJA 3ADCA 4JL5A 1J70A 1T4GA 4WZAE 4OHYA 1Q3HA 1L4YA 2FNAA 1TQ4A 4W5HA 3TR5A 3NEJA 4DDVA 2XNDD 1Z08A 1W47A 1S4QA 1ZM7A 4IDNA 1XTKA 1X8KA 3IBYA 4GT1A 3R7WB 1OHHD 1YR7A 4Q4AB 1E1RA 3U3JA 1YZQA 2NTYC 2MMCA 1G8HA 3CRW1 4C0AC 1W1WA 3LXRA 1S1CA 4JLNA 3ND9A 4KITB 5J40A 4F38A 2GCNA 1Z0FA 5KSOA 3OFNA
chains in the Genus database with same CATH superfamily
1FVFA 3ZHQA 4N18A 4PZZA 4DEXA 3P0HA 1OAAA 1ECLA 4ZHQF 4L5CA 4DYVA 1AMNA 1BE1A 1JHOA 2HIAA 4M38A 4LECA 1CETA 5FKJA 4DDWA 1P7CA 3ZY5A 4UM9B 4LF5B 3QHAA 2OYRA 3TGPA 3C8UA 4L0CA 5KTMA 4TWBA 4FR2A 1EWRA 2B5VA 2EIXA 1RQXA 1SKUA 3FDXA 2O0KA 4YFYA 4PO8A 2HTEA 2ZWVA 2VTBB 3COZA 4X64B 3ADPA 2E4VA 1KYXA 3UV3A 3QA3E 4V03A 3NM4A 4FOTA 1N7IA 3NQ41 4MIEA 3MUEA 3M6AA 4AULA 2NSDA 3EOBI 3F4BA 3NW9A 5DXFA 2B4TO 4TGLA 1YRAA 2Z5FA 3CWZA 1W7AA 4XLTA 4HMQA 3UMVA 2I2WA 1RCTE 3AHFA 3TPFA 3T1YB 3WKBA 1TA0A 5C1BA 1A9QA 4R05A 4RTQA 3SHWA 3KFXA 4ABYA 1S2GA 2WF8A 3R3UA 2ZB3A 3R7BA 4GKJB 4I55A 3MTGA 4EO9A 3ZVMA 4J0FA 3WK6A 5TF4A 4HN2A 4LXUA 2Y2VA 3N75A 2PSDA 3SX4A 2RGBA 3SAJA 4BQQA 3PWZA 4OXQA 1UR5A 821PA 4RK0A 3S1SA 1P2BA 3EGDB 5TVKA 4EZEA 3ZU6A 4JC4A 3VR1A 2QPOA 1HT0A 3QU9A 2VA9A 3THYB 2Q2OA 3LT4A 3JYNA 3CZRA 4J7CA 3Q1LA 5LIRA 2RHJA 1BMFD 2IOHA 1Y6RA 3AJ8A 2XIQA 3PHBE 2R79A 5D86A 4DC0A 1GGMA 3O2NA 4RSRA 2WD7B 3UJ9A 1UPCA 3NIFB 1TAQA 2Q7OE 4EW6A 3PPXA 3WLRA 5C0OE 1U8CB 1E58A 1Z7BA 1X7XA 2UZIR 2EKDA 4IO0A 3QOWA 2C4NA 4J1SA 3DAPA 1IZ0A 2ZGVA 3CVOA 5KNCA 3V4RA 1FTGA 3A6HA 5FUBA 1C1XB 4M0FA 3I6BA 1A8UA 1GAJA 1O97D 3ISVA 1RLMA 3PB3A 4E4YA 5I51A 5M2QA 1WY5A 3WGIA 2F3QA 3RWBA 3TZKA 1KMHA 3R0IA 3L5OA 4A6DA 2BFFA 3C98A 2V96A 2DH6A 2HJWA 3RS3A 5JMPA 4II3A 2P68A 1L6IA 5EWMB 3UA3A 4D8XA 3PTAA 4GNKA 1NXSA 3QUAA 1MB3A 1YQDA 1D2RA 3BKXA 4AS2A 1YDHA 1CJVC 1FZQA 4RCYA 2QU8A 5EE5B 1POXA 1K8YB 1E9RA 1RMTA 2JCSA 1YL7A 2WWIA 2Z5LA 2ZRPA 3VBEA 3WWYA 1YNSA 4EBBA 5JHHB 2YICA 1C9DB 2IYVA 3OCJA 3OA2A 3K71B 3BWXA 1PWXA 1DAIA 1X42A 1KO8A 4JOCA 4UDYX 4QG3A 5J58A 1SVOA 1CW2B 1M6VB 1W96A 2B3DA 2QJOA 2REXB 3K5HA 4ZC1A 1E2BA 3ZWWA 3UT5A 4DM4A 3PA8A 2J9YB 3PL5A 4GKBA 4MP3A 5BSHA 3RYCA 1UFQA 1FDSA 2HBYA 4MQEA 1KL7A 1TOAA 5DHRA 5K2MA 3D6NB 2CY0A 4K8OA 3CNNA 4QBHA 3B1VA 4ZOLA 1VI5A 4OHBA 3I9FA 5CURA 4GVXA 3ROTA 1Z6YA 5KREA 4Q01A 3N86A 4Z54A 2XRZA 2YS6A 4D97A 5A4AA 3JARB 2XVMA 4FYYA 4QTTB 2RH8A 2BV3A 2Y6UA 4JJKA 2GN0A 4BC1A 4W7HA 1G8FA 2C77A 2O7VA 2XGGA 1YZUA 2FX3A 1DHRA 1OV6A 2H54A 5HX7A 1FP2A 5DRTA 3R9XA 3GT4A 1RBMA 3F5SA 2NVOA 5TY0A 3D8SA 1RWPA 3BS4A 1M34A 1JBKA 3D2BA 3MERA 3BGOS 3GG2A 4EPVA 2BGGA 1J8QA 3FPBA 1DKRA 3GPLA 3FCCA 2GZ2A 5SZKB 4IGFA 3W9YA 3D7LA 5AHOA 1Y9DA 1Y8QB 1SCNE 1O95C 4G81A 4C5CA 3O2JA 2AFIE 1GR1A 1C8VB 1PL7A 1F7VA 5DNAA 4X1IA 4B3GA 3FZYA 1DX6A 1HORA 2DT5A 3CV3A 3ME5A 3QPWA 1LLQA 3OP1A 4LYGA 2PAFA 3OE1A 1Q2XA 4FK8A 4EECA 5KOJB 1NF3A 3QLVC 1X38A 4PG4A 4BO0A 2WWVD 5AW0A 2QIPA 3FYUA 4BX3A 5CB8A 2V58A 3RT1A 3TNLA 2ECFA 2QS9A 5EVCA 4Y0AA 3TQTA 4ZIRA 3CY6A 1KQGA 5IM4A 3QY0A 2WJVA 2JFWA 1QLWA 1XF9A 2C78A 3AHHA 2OENG 1KZ7B 3ESRA 3N07A 4TQAA 4ID9A 5TS2A 1EVQA 1GQFA 3SXUA 5BMOA 3RT9A 3E7PA 3K8QA 4AY4A 4C0KA 1QTNA 3T7KA 2VJKA 3GOQA 4HZUA 1HDXA 1FUEA 1DRVA 4HHEA 3AR8A 1UJBA 3LWDA 4MPTA 4V2IA 1IXZA 2H4FA 3ANSA 4H7HA 3I9V1 3OEED 2ROQA 4Q16A 4BJ5A 1YRHA 3LUGA 5KEIA 3UAVA 2PBZA 1NWHA 1V5GA 4RE5A 5K8JB 4ROSA 2OQIA 3EC2A 3EGWA 4Y1RA 3TSAA 4BB9A 2NO6A 5KYVA 1WOYA 4K9LA 1MABB 3K1ZA 1MQ8B 3QX9A 4DNPA 2GCEA 1E59A 5LYYA 2ZYAA 4F7DA 1AXGA 4NQZA 4DC9A 4DWOA 4AKIA 2BDUA 3Q8XB 1JKFA 1Q1EA 2EBUA 4TRNA 4LF4B 4UTNA 1YZFA 2TMDA 2ZVJA 4RPLA 3IEMA 3GEEA 3ZD7A 1KPGA 2FPUA 2C4MA 3M8KA 6GPBA 1NLYA 4K3UA 4KFUA 2YUIA 3TZLA 4EZBA 2HOQA 4RTKA 2C94A 4INPA 2E82A 2EW2A 3H42B 3NYRA 3HYCA 5FF9A 1I2BA 4LRYA 4CM1A 2EKBA 3C6KA 2PUGA 4WFKA 3PR1A 4G1MB 3QYFA 1G63A 1AOXA 1OX6A 2F1HA 4C76A 1VMAA 3O75A 3QU4A 5AHWA 3G2JA 1VPVA 2JGDB 3OFVA 1PR9A 1R10A 1ZN2A 4X7PA 2FEWB 1EA5A 2ZBDA 3LLVA 3D31A 1S0UA 3C48A 2GS9A 2VYQA 1U04A 1L8XA 1YZ3A 1ULAA 4L5AA 5ALZA 1U8AA 2RKOA 1RRPA 3KBBA 1OBOA 3LQRA 2Q62A 4KO1S 5SV2A 1EFKA 1AQIA 1ZD3A 3OU2A 4MH0R 3SYKA 1RRVA 3DXXA 1NUQA 3D02A 2IT1A 4JJ7A 4PLGA 3ZW7A 1OLSB 4WCFC 5JBIA 2WEKA 5KQSA 2ZT8A 1C9EA 1SUFA 2IIPA 1E5XA 1NVBA 3LBNA 3PCRB 3MT8A 4ICIA 3ZVNA 1D2GA 4LRUA 1ZUIA 3I1YA 3EAGA 1F2DA 2IE8A 2V97A 1IFXA 3EA0A 3RYHA 1AKWA 3WYNA 4C7JA 4DCOA 3PF9A 3SIRA 1RFGE 5AI6A 4CN9A 1FP7A 1PCXA 4TYWA 1CPYA 1HMYA 2EP7A 1Q16A 2XWPA 4Y6OA 5I7OA 1IB0A 5GY7A 1FFWA 5JH7F 2QL7A 2WYIA 3ZHVA 3FUCA 4NEQA 2J6HA 1TECE 1TVKB 3PC2A 4UZSA 4DIEA 3BRWA 5F1KA 3AERB 2J3KA 2VDRB 2HMVA 3DB1A 3KKZA 4R1NA 3UBTA 2GX6A 3G8CA 1N77A 2Q49A 3PPVA 1G8AA 3G8YA 3UAGA 2VHZA 5AHXA 4O4JF 1VE5A 2G88A 4DJJA 2G67A 2OBXA 3ICVA 3LS2A 5BXQC 4UPVA 5DHAA 4YRGA 1L7DA 2IYSA 2AJLI 3D3QA 3U7QB 5FBQB 4AKSA 3R3HA 1IH8A 4NBRA 1YR6A 5EWLB 1XTBA 3G2MA 4REOA 3UMGA 3GT3A 1CRZA 2BONA 2IV2X 3EODA 4CGZA 1GWNA 1BJRE 1W1IA 1SIWA 3R5TA 1Z34A 2QYOA 2QUBA 4A2PA 2M6RA 1E2DA 1QRTA 4F7WA 5EKXA 4BNDA 4BEBA 3HJHA 4ZXFA 3V4ZA 2RGYA 2B1GA 1QIHA 1U8UA 1BJKA 1KSJA 2A1TS 2PZFA 2P11A 3KPUA 4Q37A 4D57A 4DLZA 2Z08A 3K53A 2D0PB 2IXFA 3EPPA 3NATA 4H0FA 4C03A 2NYUA 4B85A 3PVSA 1DLIA 2UZ3A 3E3AA 3MAJA 4GM1A 4P4SB 1G7RA 1V2HE 3A6EA 4ZVRA 4DV4B 3K8ZA 2O8DA 1D3AA 1PFQA 1I7LA 2H0QA 1I0ZA 2QGZA 3H1FA 4MV8A 4NU5A 4OJMX 1RYMA 1V8PA 3DE0X 4TV9B 4GECA 3IOYA 1M6NA 3DL2A 4ENUA 3OPYI 4IS2A 4RPJA 2BKXA 4UUOA 3SSOA 2XMSA 2YDXA 1RJFA 3PJEA 4KX5A 4MKRA 4DT1A 4K9NA 1YA6A 2VWQA 3F2IA 1JQBA 1KH3A 5GTDA 2XV1A 3KZKA 3O83A 4HQOA 1WB5A 3BFVA 4KE6A 1GXSA 2VNAA 3DULA 3H2ZA 3ON5A 1QHXA 6ADHA 2P0EA 4DV0B 3Q0EA 1PL6A 4A73A 4EFLA 4QDOA 4WJLA 5CA1B 2EFYA 3KOOA 3LFUA 4NBNA 1XAIA 1A77A 3ROGA 5ARBA 3DMYA 3GLHB 1T1JA 2JBAB 2GPBA 2PYDA 3TUJC 2ID8A 3ZGVA 4G0QA 4CR6A 4JL8A 3EC1A 1JEJA 5THKA 3W1VA 1ETHA 5TR9A 1U0JA 2CDRA 3K9NA 4TRRA 5LMZA 3NVMB 1SUAA 3NPAA 1LK0A 3TG8A 2J5BA 3DCJA 2ZB4A 3KJFA 4MEJA 4KBYA 3DVLA 1KEZA 2B3TA 1HX7A 4EF4A 3BD9A 3MSXA 1GYPA 2HJ9A 3S81A 2I4LA 2EU8A 1F3LA 3QXHA 4YECA 3D0QA 1HRDA 3QPAA 3MBKA 5TPWB 1Q83A 1QWOA 2L2QA 5LZ8A 3MWLA 4DDHA 1J21A 5TQ2B 1FF9A 2I8LA 2R6ZA 3U1TA 5I7UA 2QYTA 2ZANA 1GA6A 4G8DA 2BBOA 1OI7A 1N33B 3AI2A 3OPQA 4XIJA 1W19A 3EVTA 3PUZA 1XRPA 4B6FA 4Z4IA 1WKCA 1ZH6A 4E5NA 4XWWA 5BMVB 2QT0A 3FM9A 3QRWA 3F8TA 3ZGOA 1JHPA 3ZXUB 1X7WB 3CQ9A 1XVLA 3TBFA 1W8DA 3LP6A 5I8WA 5LQCA 4YBZA 2IBSA 1XCJA 2C3OA 1IM8A 2ZIAA 2FF5A 1L4FA 4RYDA 2ZRBA 3V3KA 3WGNA 3FVQA 5H3LA 3PD0A 4DE5A 3BJZA 1MEJA 1V7PC 1WR8A 3K7EA 3U40A 3BQ9A 4RAQA 4TLEA 3F73A 2HMAA 3K20A 5FNVB 5KSZA 3N2KA 2R8YA 1XVUA 5AOCA 1CT9A 4M1EA 2FCRA 4Q1CA 4HXEB 3NOXA 4OQFA 4WHMA 1VPWA 3NKLA 4RS4A 5JCXA 1LSJA 1SVNA 4EEKA 2H00A 5JIBA 4M54A 3WJ2A 3IP1A 4R1OA 3S2IA 3OQVA 2C7OA 4BIIA 1H8EA 1Z26A 3G0IA 1J2RA 5J1SB 1Y42X 3G8BA 2XOEA 4KCGA 4J1QA 2H1OA 1XA3A 2FPWA 3K0CA 3GJTA 4B31A 4Y6QA 1P2TA 4YV1A 4MR9A 4EHJA 2A88A 2WUGA 2ZB2A 4OQXA 2Z2IA 4LJ9A 5AXDA 3URMA 3ETGA 4U39A 3AL2A 3PFIA 3F49S 1TKRA 4IGIA 4WZBA 4OAPA 2WIKA 3PQ6A 4MMXB 2VT3A 3FPSA 3HCCA 4GDMA 4KV9A 5HSGA 4WGFA 2K2WA 3CM0A 2ZB8A 3ENZA 3BSWA 4Q3AA 1PEDA 4RK5A 3VPSA 3G0BA 1IM2A 1TK2A 4LYJA 3ZHRA 4F4IA 5DK6A 1PGOA 1Q0QA 1QUFA 2CWWA 4GZLA 1AZSC 1DO8A 3WZLA 1V96A 1R0SA 3O9ZA 4QULA 2VSYA 2IW3A 1VE7A 1QHGA 2DWUA 5E0KB 3B1JA 4QYIB 1NX6A 2Z8XA 3FKQA 3OQIB 3W9UA 3L1UA 5FL7D 4G0VA 4ZZ2A 1GG8A 2ZTUA 4XB1A 2XCTB 1JIUA 4CMCA 4O8ZA 2Y0EA 3PDIB 3SMVA 3SC6A 2VF8A 1JYFA 2QRJA 3AKYA 3DZDA 2QMYA 3PNSA 4FEAA 3VYTB 5ITZA 1NY5A 2PX6A 1CWUA 2FQYA 3C3JA 4LOHA 3LFTA 5LLTA 3FOFC 3ZZ0A 3D3WB 5CVVA 5I9BA 5UKDA 4DANA 1D6MA 1TIBA 2G40A 2HLPA 3I83A 4BMZA 2H57A 3OZWA 4JJGA 2LKCA 3WL6A 1TKBA 1ZD2P 3CG0A 4Z53A 4H2DA 1HYHA 3WBKA 3KLPX 2HM7A 2R25B 1Z12A 1C1XA 4G07A 3DDSA 1YZGA 3HGTA 4JLSA 3GT7A 4Q9NA 1SFRA 4RPIA 2VNJA 4E5DA 2OZLA 3PHIA 4XQ9A 1H2FA 2HD4A 3Q2IA 4R7TA 1PZXA 2M9MA 3S1LA 3CXUA 4AUNA 3TXYA 5C4MA 2R7AA 1XN1A 3CB2A 1KTIA 2OLEA 2GSWA 1DBQA 2IXGA 3AHGA 1DWUA 3RAGA 3V7NA 1PZFA 3EEIA 3LSYA 1HNZB 3HXPA 5EHGA 2YOHA 1EWYA 4NARA 1OFVA 1M54A 2R8RA 4GOMD 1PK7A 3L49A 4KE9A 2JLZA 2A5GA 2J33A 4CIAA 2HDNB 1G5QA 1C8LA 3ZE8A 1PQYA 4OPMA 4G1UC 1U2QA 1NBIA 2CCKA 3QBEA 4TX1A 5GJCA 3ZHTA 5A4FS 2DFLA 1ULUA 1B1CA 3ROPA 1O6GA 1C30B 1JVBA 3T61A 1VMIA 2WMOB 1U7WA 1B23P 3EEOA 1K6MA 1JIIA 2ZWAA 1KI4A 3T1QA 4XYBA 4B2LA 2FW8A 4X7BA 5EE3A 1FQWA 2GD2A 4G1EB 1ECCA 4NNPA 4OMUA 5LQJA 3OE5A 1NP7A 3HGMA 4LTNA 4AJIA 3U1BA 1XPRA 4G0NA 1ZGJA 2HQSA 2IPOA 1G20E 4GBED 2PS1A 2DC1A 421PA 4NBKA 1XK7A 4OUDA 2OV3A 1BKYA 1Y9EA 1NV8A 2H4XA 2FKNA 5DIFA 4BBPA 3ESDA 2XXAB 4DMLA 1I1QB 1N9GA 5DTEA 1E5VA 3EF0A 3LTEA 2I33A 2CMGA 3PRYA 4TMYA 3TOSA 1JFTA 3SKYA 1M9NA 1KVRA 2O6HA 4NCIA 2NUPB 3F7OA 3MJSA 4U4AA 3S2SA 5EJEA 1BD3A 1VL1A 3ZLJA 1Z22A 4G0WA 1TJPB 1E3WA 5I5GA 2Z30A 3OQHA 4DLBA 3SWWA 3AQIA 1RI2A 2I7DA 2FSHA 2IEYA 1JPNA 1EFCA 1WE2A 1NVAA 1YJBA 2VHQA 5JS1A 4AZTA 2CCGA 1YC5A 4JGIA 1SBZA 3CBGA 3FFAA 4ONEA 3DR3A 1WPXA 2FEKA 3RK1A 1V6SA 1PZNA 1FNNA 4YRNA 5LQDA 2JD2A 2PGLA 4G0OA 2I22A 1B43A 5DSXA 5JC1A 3HS3A 4JK3A 3W04A 1PBNA 1ISIA 4KQ2A 3OD5A 1G6KA 5CBPA 2P5YA 2IWRA 2Z09A 3DXFA 3MIIA 5CXXA 2EZ9A 2UZ4A 1XT6A 5DLQC 3K2IA 1DAKA 1Z73A 2EWWA 3OEYA 1JHUA 2SECE 2AMFA 4KX3A 4OA8A 2DERA 1RYHA 2J41A 4IKPA 3I4LA 4KK3A 2B7BA 4NSNA 4UM8B 2NXJA 1XG5A 4PCAA 4BLTA 4E5PA 1QRAA 1XL0A 4RMIA 2QVGA 2PZMA 2OK8A 3GJZA 5EGNA 3UN1A 1TYBE 2ZIXA 4UATA 5FULA 1J06A 4M36A 2PL3A 4PPGA 3DTVB 4E12A 2PS0A 2FPGB 2EJWA 1BFDA 1J8VA 1GPBA 2C5SA 2DHQA 3DFMA 3EY9A 4S2EA 4DSTA 1YTLA 2F43B 3AGPA 2XMPA 3UWDA 1JHDA 3A70A 2PH1A 4M0LA 4N54A 3RBVA 4CLOB 5FX2A 2PTHA 2R48A 5KNDD 2GBLA 1JHYA 3W78A 4H7IA 4ZT7A 5E6RB 3VOBA 1BVHA 1XTUA 1FUUA 1JBQA 5KAMA 2A92A 4IM7A 2YZGA 3CKYA 4ISBA 3UMMA 1ZJJA 3PXCX 1Z18A 2SKDA 1RXWA 1LJLA 3ZWQA 3AKEA 2NXWA 4GIBA 4WXRA 4MIKA 3A9VA 3B20A 3HRIA 4O2AB 2ZM6B 5HJ7A 1H9AA 1N6HA 3Q8WA 1C8BA 1IHDA 1Q1GA 4U3JB 1BS9A 1KEEB 3GZNB 4JH0A 4PY2A 2X14A 4M1YA 5BV0A 4IF6A 2WJWA 3H2HA 3O0DA 3TSYA 1YR9A 4O5OA 4R0VA 2Z8ZA 4O0MA 1LPOA 1WXEA 2VDLB 4WT7A 2J6IA 2X5JO 1P29A 2QAGC 3KD3A 3S28A 4D3FA 4YX9A 1I4LD 4WFJA 4IJUA 4RCZA 3BHIA 3FVWA 3W2HA 4D0SA 5IJWA 1IYZA 1N3LA 3S2ZA 1E1CB 1EPUA 3RF6A 1T5OA 1Y5LA 3VZSA 2WIBA 3I34X 3EHEA 3GEMA 3GOHA 1U2DC 1TLTA 3HVJA 3AT1A 2VZEA 1RAGA 2FG5A 4R8LA 1QGZA 2DM6A 2C2YA 5IH7A 2YS7A 1R12A 4K6KA 1JPUA 4BVJA 1GNQA 2BZSA 2CLCX 4DYDA 1F20A 4ID3A 1KBZA 3KXLA 1VQ1A 3KPYA 4IDEA 4NS4A 3VR2A 5AW6A 4DBLC 2Z3ZA 1E4EB 3IA7A 3BFPA 4Q18A 1QGAA 2KPOA 4XVCA 5KJCA 5E2IA 3E05A 3MA0A 5AJUA 2XHEA 3PFGA 1LJ8A 4IKEA 4KQCA 5E6SA 1USUA 4FFPA 4YRKA 3DBLA 3HCWA 4ZGBA 1CTQA 4LWOA 4ZCMA 1J0DA 4HRAA 3T1VA 1NNLA 1KIFA 4Y9DA 2FSFA 2OCKA 1IWPB 3B8EA 4AS1A 1ACLA 2H9YA 3M6IA 1R0ZA 1H5UA 2DUJA 3VX3A 5LMCA 3LT5A 4EFKA 4INZA 3NLLA 1T6XA 2FPKA 4J7UA 3P0JA 1O5IA 1USVA 4LC9A 2BFAA 4A27A 3W5BA 4LTMA 1WD7A 3I4FA 5TF0A 3GY0A 3RTEA 5TARA 2X2EA 2WZCA 2ODQA 2V7XA 4DR4B 2CUKA 3H5TA 4YAWA 1OWMA 4GVPA 1G8PA 4ND2A 1FXWA 1WXIA 3N7TA 3T5DA 4CKZA 1W581 5JVDA 4GXRA 1RE0A 4GRDA 3W2TA 3LHDA 3BN3A 1UAGA 5L95A 3URKA 1YWGO 5DOVA 1A9YA 1I7DA 1B4DA 4NYJR 1VSVA 2QU7A 1YI0A 3DBOB 1F48A 4QYWA 4D0LB 5ISMA 2DP4E 4JB2A 1G21E 5F5NA 4Q82A 4XWOA 5KQRA 4EL5A 3ZJYA 1IL0A 3KSMA 1FTNA 5CNKA 1V5IA 1XAGA 3KOZA 2HWUA 3GMSA 3HEBA 4JBXA 4MHOA 5J4LA 4F93B 3B3AA 2VH2A 4ZHSA 4NBTA 5EVJA 1F60A 2Z2XA 2G09A 1RPTA 5FBKA 1K5DA 1NM5A 4GM4A 4P7BA 1BU5A 4NENB 4YCAA 3QBDA 1LF5A 4WOCA 5FJJA 721PA 3EXIA 4YT8A 1OZHA 2FRDA 5JARA 3PTZA 3T5TA 1KDRA 1X7DA 5C8YB 2VYFA 3ELBA 1Q0SA 3L02A 4KC0A 1VRWA 2PY6A 5D1NA 4AN0A 3KYDB 4IOJA 2GK6A 2YJTD 3LQFA 4DLWA 1ADFA 5G41A 1LVUA 4OQEA 3RS8A 4CE6A 4GQIA 2FSUA 2AN5A 2P9YA 2QRNA 3BIXA 4TXLA 5KC9A 1NN5A 1FYFA 1B00A 1MX3A 3OO1A 1C0PA 3Q11A 1WETA 2H1WA 3PUWA 1NLZA 4YQZA 5FPSA 2O8EB 2F3TA 2ZS7A 1L7PA 2HJVA 2ZT6A 3C6MA 4IVNA 3N2LA 5AVSA 3D8HA 2XOXA 3DMNA 4MRSA 3EGOA 4MR7B 5GV8A 1HEIA 3Q9UA 2G4LA 3FTPA 3CF0A 5KKAA 2QZSA 4C06A 2ILVA 4YRAA 1PR2A 2A1UB 3R3XA 2PH7A 1B76A 2X19A 3Q72A 4RE6A 4Y2QA 2AQHA 2XI4A 4Y7CA 3QBJA 4POOA 2HA4A 4M88A 1OX4B 5SICE 3RNOA 4EWLA 1E7QA 1CY2A 1S3FA 3BORA 4KQGA 4RTMA 4C21A 3IEPA 2O2IA 5DPMA 3RWOA 2C96A 1SOAA 1EGQA 1ZK4A 1PDOA 1XYYA 3T9FA 4JC5A 4EHBA 3Q98A 4G8JA 4QFCA 5BW4A 3H17A 4I4TF 3W8NA 1DB3A 1RYBA 2M1XA 2I2CA 1QIEA 2H5JA 4IF4A 3T9DA 4OKNA 4EPRA 5BRJA 1ZCBA 2C5EA 2ETVA 4P0PB 3IDOA 2CB9A 2J32A 4CJXA 3KT0A 1K97A 3AI1A 3K8YA 4YUZA 1RXIA 2D1SA 5B7NA 2ZSKA 1TMGE 2ZYGA 4FFOA 4FGKA 5D84A 1LI5A 4M8LA 3WGTA 4P7KA 2X3FA 2Z1MA 4MAFA 3BWMA 1V8OA 1X6VA 3BIFA 4X90A 1ZA2A 3EMBA 4TRMA 4C22A 2V0CA 3A1NA 1ZJ6A 5AD1A 1M2JA 4CIBA 5I48A 2A14A 2XUGA 1QP7A 1ODJA 1QG6A 2GO7A 4AAYA 4JYAB 3FPEA 2IXDA 2XE8A 4EITA 2I03A 3G82C 2BEVB 4NYJQ 4OG2A 2W48A 3AHEA 4L85A 4MVJI 5EMKA 3WXBA 2G25A 1FMCA 1P72A 3B5IA 4X1YB 4CM3A 5KTRA 2IHNA 1T1IA 3ENKA 5IMSA 4TV8B 3I04A 1Z6QA 1ECBA 2V7GA 2P78A 5J59A 4HB0A 1YQXA 3B3FA 2QMEA 4NDNE 3ZHYA 4BFTA 3EOAI 3HFGA 4GKVA 3COYA 1MT3A 4Q7LA 1JXMA 2IXBA 5HQTA 1RPZA 4OL9A 4OH7A 3IQGX 4Q1VA 4HUTA 3CZPA 3I53A 3VU1A 2W2PA 3QKUA 4B84A 3HA5A 1GGHA 3I0MA 4MUYA 5IBRA 2OD9A 5LBIA 2XRMA 2QLNA 1E62A 3O73A 1CE8B 3EZ6A 3MJTA 4QQFA 3F6SA 3H99A 4NATA 4K6MA 4PZPA 2XF2A 5GVRA 1MFPA 4FFLA 4B3MB 3LBHA 4RA9A 4DAEA 1RHQA 2PYIA 1P5HA 1SXJD 3OBIA 4L50A 4ND1A 1LLDA 2CV0A 1NQWA 5BOSB 3QXSA 4FNOA 4ZMRA 3BMNB 3D4IA 1PX0A 3EGXB 2O1WA 3VA7A 1P2UA 1ZL0A 5FFMA 4HDKA 3WB9A 1M2GA 1G3IA 3L0YA 4XE5A 5FUVA 2NAPA 3TVDA 3B82A 1IN5A 2QVLA 4XAQA 5EJ2A 3RYFB 2YIVX 3UFXB 4NF2A 4LHSA 4KAFA 2BCEA 3J81A 2CK3D 4M0UA 3HDJA 3E7XA 2ASVA 1A1SA 3C8ZA 3JQAD 3PXUA 4KYVA 1X8XA 1C3EA 3IJ5A 3OJWA 4KODA 3TTYA 2CLHB 4D5EA 5I01A 5JASA 4FCVA 4ZZ3A 4GAEA 1GYRA 5LQSA 4IOMA 3EG9B 4X85A 3INYA 2JI7A 3VVMA 1Z4NA 1KI1A 2GETA 3A9UA 4JODA 2HPZA 4OA5A 3ZX4A 4LGVA 3OCXA 2FWMX 3TTTA 5LWHA 2KLHA 3AV0B 4KDCA 4P3YA 2XQIA 4F86A 2WM3A 1HQKA 3B89A 4LY6A 1JSRA 1LZKA 4X6YA 1MW8X 3JALB 4M4SA 2YNMD 1JQ5A 4WJKB 4YJFB 5F2EA 2HGZA 2ZSHA 1RZVA 2H5IA 4XFDA 1GPWB 3FHLA 4LHWA 4YXWD 1EDZA 1NE7A 5DTRA 2O1SA 4BLWA 1V2GA 1R6XA 4BMOB 4CFZA 2H1LA 4BIMA 2YXBA 5A4KA 4LF9B 1CUJA 3MW8A 3LQ1A 1SG0A 4OL0A 4HLUC 3NHUA 4JVSB 1RWBA 1VBFA 2E6KA 4R31A 4CXMA 3NT2A 4KMSA 4N3GA 1TZJA 3FY4A 3AMVA 2Y1XA 4GP7A 4JI1B 1THTA 1UT8A 3MGGA 4UNNA 4YBRA 3BF8A 4RWEA 5A05A 2ZG6A 1A27A 4IHJA 3G5TA 3TJRA 4HKTA 1BQ3A 5DHFA 2JJQA 4NNJA 4IO1A 2V7BA 3T3PB 1QF9A 3DDCA 2RGUA 3LW8A 5E9WA 3UJHA 3ED1A 5CFOA 2VTEA 3CYFA 3RU2A 1B42A 3R5SA 4X71A 4GLBA 3NDPA 1CRQA 3WRXA 1DKLA 3D6FA 3H5LA 3NTLA 3F6CA 4TRJA 1T9DA 3EGIA 4KXQA 3HDVA 3SIPA 4COOA 1ESDA 1R18A 2CLEB 2GFQA 2G6BA 1Z7WA 1M8KA 3OICA 1TTQB 2P69A 3MYYA 4R98A 1YF3A 3SQOA 3NG1A 4B6JA 2JGJA 5FFNA 2MR5A 3T12A 4DMKA 1DVRA 5CT9A 5DM60 3L40A 4DZRA 4YAKA 2XXAA 3WIBA 2AV6A 4O4LA 3IPLA 2NUTA 1JPVA 1ORDA 3QKRA 4N9WA 1IIRA 2C2OA 4B8WA 4EMBA 3G59A 2PYZA 2YXNA 2AFIA 2RK3A 2C8KA 1AGPA 3I4CA 4XJVA 1T29A 4MJ7A 3VKFA 2IH4A 3Q6MA 2WKQA 2QF7A 2WG0A 1P7ZA 2VRNA 1JXAA 3LDHA 1R5JA 4G86A 4Q1FA 5KI6A 3A1VA 1HFKA 1CNFA 1GSIA 3OM9A 4ESEA 1CUUA 1IQ0A 3TOVA 1IXKA 4RTSA 4QUJA 2HSEA 3R3JA 2YWDA 2HFKA 1N6LA 3L5KA 1JEQB 3MCUA 3UUFA 2XLCA 2ZJ0A 1DAFA 1LUAA 2R87A 1SKYB 1WRBA 2HZ7A 5CHYA 4E1AA 1RZRD 1OFUA 2FQ1A 2ZAIA 1FE8A 2HXYA 2VXYA 2QLJA 3HLTA 4HAZA 5BSUA 4EABA 1U0LA 3MRSA 3ZGZA 2WU0A 2Y4NA 3EBLA 3VHLB 3ZCTA 1G64A 1K88A 2JDIA 3CUWA 3QWAA 2ZYVX 3EF3A 3L06A 4R3WA 1QC5A 4EQ6A 4OM7A 1UF9A 5G0UA 1Y4DE 4CM5A 2BELA 1A69A 1NUAA 2W0SA 5KYUA 1ZM2A 3LDUA 3QTTA 4F5ZA 1YJ5A 3RCBA 3VJRA 1Y1SA 2QUJA 1P39A 1CUDA 1P6XA 3ECCA 4E09A 5JQWA 2BI8A 1G19A 1IHUA 2QTFA 3KKMA 4QOGA 3WGOA 3KSUA 1CY8A 3FNRA 1ZCAA 3VU8A 1CIJA 4MTLA 2P4UA 3HV2A 1I8TA 4UBIA 2G9NA 5U4XA 1L5QA 2WHEA 2WJIA 4LZLA 4URYR 3CW8X 2OORA 4CLOA 3P0IA 2W11A 2OLKA 3E03A 3HR4A 4LMBA 3IAM6 4MRMB 4QQRA 4UREA 3SY8A 3ANXA 3EIUA 4Y2XA 4HWSA 2AZTA 5CW2A 4ZEOA 3C7AA 5CK4A 1W52X 1V6CA 3SZGA 5A71A 2Z9CA 5BSRA 4F72A 2HU7A 5JC8A 5JFGA 2AR9A 2IUTA 2CDCA 1SQFA 3ITNA 5IJAA 2RARA 2HW8A 3H9CA 4O2AA 1AS2A 4AJLA 4B81A 1XZCA 1FFSA 2Z04A 2C9MA 3WFZA 3AX6A 3B2QA 5KCMA 1RS0A 2CVFA 3CT4A 2A58A 1UXOA 3RSCA 1FRQA 4LHVA 4Q7JB 1CZUA 4NPHA 5H4GA 5EYPA 3AF5A 4BZZA 1K5PA 1IUOA 1GCIA 2ZTHA 1VRVA 1I3LA 3ROKA 3WL3A 1FTWA 4HTFB 4RMNA 2QTLA 1XO1A 2JL1A 4IR7A 4LHXA 5TE9A 4ABTA 1E32A 3NEPX 4JJ4A 2VP9A 2P2CA 5HKLA 2EVWX 1TT5A 3FPKA 3G2OA 4L4YA 5AVWA 2BI4A 1S2OA 3HE3A 3Q8MA 2FZKA 5LQUA 4NCAA 2AKEA 3CHYA 3JVVA 5BV2P 3C6QA 1QFMA 1JG2A 1KU6A 1OI4A 2MHCA 2PPVA 1ORTA 2WPDD 2IITA 1V9CA 4IFTA 5EERA 1E7RA 2JI9A 1M7HA 3IBGA 2X1LA 4WK2B 2O07A 3TLEA 2IEAA 3JATA 3M3DA 5IMBA 1HY3A 3PK0A 2H9AA 4MMZB 1PV2A 1TC1A 1BN7A 1E4EA 3AVTA 1GA1A 1IBCA 1ZBQA 4Q9DA 3L0DA 1M83A 2NYAA 3M89A 2P0AA 4TYPA 3SIWA 3FNBA 4N3BA 3QPUA 4LCBA 1M2KA 4CCYB 2NSHA 1J0BA 3TI7A 2VF7A 5C53B 4JD5A 1CR1A 1FS5A 5AW1A 3OECA 4CM8B 5ELXA 5DSTA 1MA3A 1Y6JA 4JELA 4PFKA 3S27A 1H93A 3DJYA 4DSZA 4Z7JA 1FIUA 3HJFA 3KKNA 5LB2A 1C0EA 1PJAA 1JTFA 3VYVA 3OZTA 1UZUA 3LT2A 4M8NE 1A8HA 1W0JA 3TLCA 1RAEA 3WBBA 4QXQA 4E5MA 2L19A 3LL4A 3P2IA 1D6SA 1SBNE 1B73A 3JWHA 2V59A 4IBOA 2OUKA 1ND5A 5AVQA 2EJCA 3VNBA 2XXBA 3DE4X 5EGSA 2ZJ5A 5ALUA 4E6EA 3SPXA 1ZIDA 2NVWA 2PGJA 4P5EA 4AYWA 1P0PA 2ZRHA 1F6BA 3H75A 3TD2A 1J8YF 2VK2A 3OQNA 5LQNA 4QFMA 4LY9A 3F5MA 1XEWX 3QPCA 3U0BA 3VZQA 4KQ6A 4U2BA 2CVZA 4Y9RA 1RQPA 1WIWA 2ZAGA 4DCPA 6PFKA 4GQBA 1XNRB 1D04A 1LKZA 2E4ZA 1M74A 2ECOA 2VWGA 1TO6A 1N6OA 2ZJ7A 4KQIA 1U5CA 4I9UA 4MW9A 2BDTA 1EJBA 3E23A 4HMOA 3TW8A 4C6SA 2OXIA 4DR6B 1P4AA 2QTHA 2PMKA 5TGDA 1QU3A 4Z0HO 1S01A 3RIEA 1XQWA 1XA0A 1BU8A 1Z37A 2D1RA 5FDFA 4E33A 1U63A 1YJQA 4D3SA 5AKLA 5TEVA 5GWXA 1VHJA 3K96A 2D5AA 4MXDA 4MLPA 4S1VA 5ALVA 3QUBA 2NGRA 3EMVA 1VL2A 3H7AA 2QBYA 1E7YA 1RSZA 2P9BA 3F3YA 1LDYA 3GWGA 3QKTA 3ZBPA 3ZIUA 4O63O 3DO8A 3LY9A 4FP9A 2WZDA 1R4MA 2PVSA 3BJRA 3DL4A 3FOAA 5TVGA 5GINE 1GARA 1VIVA 1Q84A 1PX2A 2YJ5A 5AKEA 2ONYA 4DNQA 3SSMA 2VHJA 2ZTVA 3CO0S 3EQZA 1QFSA 3RRBA 3GLGA 2I65A 1BDHA 5K4HA 1IUNA 1PF7E 1FFAA 2JIZD 3I05A 3OOSA 2QAGB 3Q9NA 4JLAA 2ZRFA 3JCZA 4X5OA 2FQQA 2W37A 4MR7A 1R5BA 2BZ0A 4ZI7A 4OI0A 3HMKA 3HZHA 3MS4A 4GPD1 4HBZA 5CX1B 5LZ9A 3LKVA 4MW1A 1P5RA 1D1PA 3FH0A 5DI9A 2VUSA 2FRVA 3T7EA 1JG7A 1JDBC 2KJQA 4LCEA 4C0BA 1NXOA 4P34A 1OX4A 1W1UA 2Q1XA 4OUKX 5LKRA 4URZR 3SNKA 1YVDA 1XU9A 2BTQB 2YWFA 2UKDA 1G5PA 2POCA 2Q4OA 3BWEA 2KBFA 4OVKA 4QD3A 3I04M 4OQZA 3AEUB 3ZXSA 1UDCA 2ISCA 2GSDA