4QG7A

S.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
197
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 197
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qg7A00
2PCJA 2WBLC 2IS2A 3QXJA 3W6PA 2WM9B 4ASUD 3PV0A 1TF2A 4URZR 1W36B 4BFTA 2RGXA 1A82A 3MJHA 2F3TA 2WSSA 2WSSD 3DVLA 4PPFA 3TQFA 3GLFB 3A1SA 4MUAA 3T12A 1TUIA 2EU8A 4A0FA 3PIRA 1KKMA 4TMVA 2FDCA 1S1MA 2D4HA 1CJMA 4JLDA 3OIWA 2KI5A 3MD0A 4UXJA 4BWYA 1KKLA 3ZIAD 4HB2A 3ZIAA 3LO5A 3PENA 4J0QA 3AVVA 4EFLA 3KJHA 1SVOA 4UNNA 5KO2A 5G41A 2WWYA 3BB3A 2E9SA 2D3WA 2NG1A 421PA 4DLTA 4LBWA 5IK2A 2O8DB 4AG6A 3CO5A 1AKEA 1LFDB 2HV8A 4FWTA 1GNPA 3IIMA 1OXSC 3K0FA 1JR3A 4FMDB 2O5VA 4YQFA 3BS4A 3OF5A 4ZCMA 3J81k 2V3CC 2ZIAA 4WZAE 2RCNA 821PA 3IBYA 5K8LA 5JZVA 1OYYA 1Y3AA 5HE9A 4HLUA 4MRNA 4IDNA 1U81A 3K9NA 2CJWB 4PPQA 3BE4A 1P6XA 4Q7JB 3AVUA 1F6BA 1CLUA 3FOZA 1DOAA 4MDEA 4WXPA 3LNCA 3Q7QA 2FEOA 1IOZA 4JSTA 1FUUA 2VA8A 2OFWA 5A4JA 4ZDJA 3T5DA 3P26A 2B6HA 2GJAA 1YHNA 3AKCA 4TSFA 4LJ7A 3B2EA 2IXFA 1G21E 4C0HA 1SVKA 3B7GA 2A5FA 1R0XA 2GESA 4BFWA 3R8FA 1U2RA 5L3QA 3VFDA 3TRFA 4PFSA 5LD2B 4F93B 5F9FA 4EFNA 2QZ4A 1C1YA 1MT0A 4DBLC 1KI8A 1ZNWA 4OQMA 3CH4B 4RZXA 4KV9A 5D3MA 1F48A 1I2DA 3ECCA 4JL8A 4TQUS 4A6XA 3FKSD 1R0YA 3K53A 2WJHA 1XRJA 1TL7C 4IDPA 4DLZA 5AUNB 3KUDA 2BIFA 4AG5A 3PG5A 2EQBA 1AQYA 3LXXA 2ZRGA 1N0VC 4GNKA 2D62A 4YLGA 5BN3A 2G0TA 1HE8B 1DTSA 1OFIA 1ODFA 3LX8A 4NTZA 3PCRB 1G20E 4HLDA 1L4UA 4BUJA 5JEEA 1M7BA 3HYTA 2ZRHA 3SC3A 3BFVA 5LPNA 4KLZA 2Q9AA 1OH8A 2WWFA 5TB5A 1G3RA 1XFAA 5CM8B 2DWPA 2FJUA 4B3GA 2H57A 2G9NA 2HYIC 2ZETA 3LBNA 3WP0A 3CF6R 3UMSA 4B48A 1XMSA 3SJZA 4ZV4A 4QJ5A 2VHUA 2CLDX 3EX7C 2FU5C 3PEUA 4MRVA 5BQ5A 3FTQA 2REBA 3K70B 1GNRA 2FA9A 5AR1A 4PHHA 1G41A 2GF9A 4AC9A 3C15C 3CM0A 4HEJA 2IC5A 3P4XA 2PZEA 2GAAA 4GI7A 4PX9A 4CEIA 3KKMA 1KZGB 2CL6X 4EDHA 4YDSA 3H1TA 4ZDWA 5FUXA 1S9DA 5B58C 2MSCB 1DAEA 4NBSA 5HPYB 4DB2A 1DO0A 1ZJ6A 4US1R 3SZRA 4KU4A 3OEHD 1TU4A 1HY3A 2EYQA 2PMDA 4C2TA 1NMYA 2ZRIA 4DSUA 3I32A 5KHOC 4B75A 2Z83A 3IQWA 1TADA 1KI7A 4QHTA 2OBNA 4EPVA 4G5GA 2IW3A 3DKPA 4PZLA 4Q19A 2J59A 2A5YB 4TZ0A 2RGNA 3HJNA 2ZR9A 1HV8A 3EZFA 3LLUA 2D06A 3P32A 3WHKA 4EJSA 5JHHB 4WIAA 2VP5A 1SVWA 4PO1A 3CX7A 4QM6A 4KVAA 4DLUA 1KSFX 4QGFA 3BJIC 4QGAA 2ZYUX 3LWNA 4CT5A 3F8TA 3OE7A 1NG1A 1SHKA 3B1VA 4C0BA 1Z5ZA 1N6LA 1OHHA 4XJXA 1EFRA 2CMKA 1HEIA 3SQXA 1D6JA 2FH5B 4BASA 5JWRA 4AD8A 1G7RA 1S96A 1GTVA 1XWIA 3K09A 3NEJA 4JLPA 2J41A 3SU8A 3BERA 1UM8A 2QP4A 3IUYA 4TQAA 4D4LA 1IXZA 1N6KA 2W2VA 3CX8A 3BWDD 1FP6A 1EG7A 1YZLA 4B2LA 4RVCA 3LAWA 1QHIA 1FMJA 2R6GA 4OBEA 1Q22A 2LKCA 1US8B 2O8FB 3QF7A 3LH5A 1FFHA 1VMAA 4Q4AB 4YMSA 2FV8A 4HB0A 1J8MF 2OBMA 3MSXA 4WZBE 1NKSA 3OEED 2IYSA 3X2SA 1QF9A 1P75A 5FI1B 2V54A 2H1LA 1O3YA 4EPXA 1FW6A 3GEIA 2CK3D 4IDQA 3GEEA 4IOKA 3W3AA 5JI3E 5F98A 1A2BA 1PUJA 4PSVA 1Z0KA 2VF7A 4LC1A 2CCJA 3WNCA 1G18A 1YRBA 3I1FA 2G1JA 3G5UA 4ON9A 3TAUA 2Q6TA 3U7GA 1L8QA 4A2QA 2QQEA 2GXUA 2XNSA 5DLQC 2JLXA 2IHYA 2WPDD 3VQTA 2H8KA 3PVSA 2I1QA 2ZSFA 1RW4A 2WOJA 3DZDA 3RDPA 4K8OA 2QRZA 1IXRC 1GG2A 4XVUA 2NTYC 1OE0A 3TKLA 5CLQA 3K0CC 2FG5A 2YVUA 4A82A 2DFNA 2KB0A 2WIAA 2NPFA 1J90A 2WWGA 5GADl 1CBUA 2BMDA 1KI1A 1W2GA 3HR7A 4ZKDA 1ZC4A 3FE2A 5EZ6B 5KPDA 1E2MA 4GPTA 3REFA 3B9QA 2OCYC 4PC3A 4TL8A 3KJEA 1K5DA 2B8TA 2ZE7A 4PSAA 2GTPA 1AKYA 1SVSA 1FOEB 2QMOA 3DMNA 3THWA 4JYBA 5LBIA 1W46A 4LDJA 3ZVMA 4Q47A 2O52A 4A9AA 2ZR7A 4P31A 3VNVA 3BH0A 4M8NE 3ZZUA 4IJMA 2BOVA 4P4SA 3WYAA 2A5DA 5KDDA 1OW3B 4N3NA 1PVOA 4QXAA 1TX4B 4PHGA 5EE5B 2XNDA 2XNDD 3NXSA 2NO7A 2IYQA 1JNYA 3KFXA 1FL9A 1Z0FA 5EUQB 1WE2A 2AK2A 1VG9B 2KJQA 1NY6A 2PMKA 4F4CA 1Q20A 4OHYA 1RVDA 4B74A 5J4KA 5JBQA 1SXJE 3QXHA 4RFSA 1OSNA 3RYTC 2R6CA 3H2YA 4BLTA 4B2PA 3VR3A 4E07A 2Y8EA 4OK6A 3IBGA 1G17A 2NZJA 3AP3A 5BN5A 2XEXA 4Q4HA 3S1AA 3PEWA 1KDRA 1B23P 4JVLA 3UPUA 2A78A 1XEXA 2MMCA 3T1OA 4FXPA 1DG3A 1E2PA 3RS5A 3C14C 1FMLA 1JALA 3AVPA 1FP7A 4JLAA 2J7PA 2J7PD 4M4SA 3MGCA 4A6PA 3GPLA 3GLIE 2IK8A 1PLJA 3K0FB 1VKJA 2V55B 1I4TD 4XSGA 1G1MA 2YWFA 3M0EA 1ZUIA 5BYJA 4M9QA 3CNNA 3TJZA 1U94A 4GOKA 1S8FA 5HZKA 3DDCA 1G7SA 4Q02A 3ADKA 1KY3A 1VIYA 2J9RA 2VTKA 3D7MA 4OKSA 2B21A 5DI9A 4EKDA 4B44A 3GLGA 1CR2A 4U00A 1N5JA 3MLEA 1T5IA 3KKQA 2IWHA 3T61A 1CJUC 2WKRA 2D74A 1Q1QA 1X3SA 1Z06A 3OFND 3UATA 2P6RA 3EZ9A 3HP1A 2FPMA 4CEJA 2B7BA 3D31A 2EFDB 4JYCA 2FFHA 4DJTA 3KQLA 1Z28A 1E0JA 3SJCA 4V0LA 2HJGA 2ZUDA 5L3QB 4DSOA 3AH8A 1XMIA 1WBBA 1KJYA 1YVDA 4HDQB 4PO8A 3NBFA 3TUZC 3E5HA 3H84A 4MA4A 4IFEA 2B8WA 4QJ3A 1E2HA 2WAXA 5D3MB 3DEFA 5EE0A 2BBWA 3EG5A 1TUEA 4XVRA 1MH1A 1NBME 1OIVA 4BLRA 3BH7A 4Q03A 1AS0A 1NLZA 2G77B 3QG1A 5CB6A 2WJYA 3GMTA 3DM5A 2H18A 3IILA 4TMTA 4YDHB 3AKEA 5KUTA 5JCZA 2KBEA 1NBMD 2DFTA 3KUCA 4KFRA 4TLCA 1HURA 1I4DD 4M9SA 4TMKA 4A1FA 3SNHA 1WCV1 2WKQA 3HU2A 4YXWD 4C2UA 1DAKA 1N3BA 4Q9KA 1GIAA 3AV0B 1IY1A 1E9CA 1J7KA 4URUR 5CK5A 4MITA 2OSBA 1E1RA 1E1RD 5B57C 5DE3A 5L3SA 2HCBA 4PSKA 4E5UA 3C8UA 2ZVQX 3X1DA 3AVYA 2BMJA 2CE7A 4X8HA 3SYKA 2QA5A 2V6JA 4M1TA 2ZR0A 5CLLA 4BZQA 4CEIB 2G6BA 4OQNA 3I8XA 4DLWA 3X1WA 4DC9A 3GJ4A 1HQCA 4EPRA 4RZ3A 5FUVA 1Z22A 2FGKA 3QXXA 5JI2E 4HAXA 1W4AA 4Q7MB 2YWHA 5JJLA 4LWZA 4BFXA 1E1QD 3GLIA 3R9XA 3RC3A 1Z6YA 3SR0A 2FSIA 1Z2CA 5FOVA 5C2JB 2C2HA 3Q72A 4FN5A 4AWXA 4B47A 2AX4A 3T34A 3CPHA 4GMDA 3QVUA 4W5HA 1JXMA 4CDGA 3Q85A 1N6NA 1TEXA 3OZXA 3X1ZA 2O8BA 1L4YA 1U0JA 1S3GA 2J46A 2ZJYA 1T8TA 3CZPA 2W2TA 1SZPA 4JLJA 4TTRA 3R20A 1GKYA 1EFUA 1ZNYA 4QHSA 2FNAA 3HYRA 4PC1A 3DMDA 4IRUB 4EJSB 4DCVA 1NVVQ 1ZCBA 4NCKA 2HXYA 5CIWA 3CPEA 5DGXA 1GP2A 2QSYA 3O8DA 4Q21A 1HA3A 5KNDA 1G3QA 1AK2A 3FGNA 4UJ5A 4HLUC 1XP8A 4C0LA 1N5KA 2Q9BA 4PAOA 1VHLA 5J4YA 4ACBA 5C46F 3QNUA 5FTNA 4OI0A 2Z0MA 3ASZA 2YOGA 1X8KA 1G8GA 1R5BA 1U90A 5FOSA 2WTUA 2GZDA 2ZI4A 2BMEA 4CGZA 2O8EA 2GCPA 2QM8A 4PR0A 2GETA 4QM7A 4LPSA 3SE0A 5DI3A 2VYFA 5EXXA 3VR4A 1XBTA 3W3ZB 5HZHA 1YKSA 3QXCA 1E9FA 2RKOA 2WJGA 3JZAA 4M1KA 5JSZA 1OKKA 1OKKD 1G7CA 1RKBA 4UXHA 2QPTA 1UBGA 1VCMA 2JLQA 2LKDA 1T3HA 3U4QA 3KXKA 3WMEA 5L8VA 3Q3JB 3H86A 3QUSA 1EESA 1OLOA 2ZE5A 2BDTA 4B3BA 3O8RA 1FNMA 4OQLA 3RVBA 4L4UA 3JZMA 2YOFA 1YE8A 2QPOA 2ZRAA 2FFQA 1DAFA 1T3LA 2O0JA 2GEDA 1WB9A 1M8PA 3EARA 3OAAA 3HPRA 4YONB 1TQ4A 5BN4A 4MQBA 1ZUHA 1UBCA 4C0SA 3QPWA 2C03A 5H70A 2FF7A 4MGYR 5ANRB 4TLEA 4Z8YA 1IN5A 1AS2A 4KO8A 3BIFA 4URXR 1AS3A 3FHOA 1MO5A 4RJLA 5C4GB 2W0MA 1XEFA 4RKEA 1H8ED 4EFMA 4Q5IA 2QAJA 3TNFA 4B76A 3I3SR 1ZM2A 3TUJC 3CH5A 4PC7A 1AJEA 3O47A 2Q0HA 3QIAA 3T06B 1GRNA 5J4HA 5FBRB 4LJAA 2MMGA 3DM9B 1TQDA 1UKYA 2HT6A 3CB4A 3M6AA 2QBYA 2AXNA 5KSPA 5HKKD 5HKKA 3TW4A 4B3XA 3U3RA 4C7OA 2OFXA 5SZKB 1YZNA 3A8TA 4OQFA 3FYHA 3AQ4A 2PLRA 1JB1A 1Q21A 2XTZA 2PT7A 2Z4RA 3THWB 2P0EA 2JIZA 2JIZD 2DFLA 3I5YA 1M7HA 1KHTA 1LS6A 5FTJA 1G6OA 1W7AA 2C5LA 1DPFA 4FWIB 4DIEA 3D3QA 4P4SB 1FTSA 1JBKA 1T4GA 2GCOA 3I92A 1E2KA 1JR6A 3GJXC 3K0SA 1OXTA 2C78A 2CHQA 3VHLB 4G0NA 1XU4A 2W6IA 2W6ID 4DB4A 2XX3A 3WRYC 2IXGA 1BYIA 2RGNC 2ZRPA 5AWFC 4D25A 4BFZA 3LQRA 2BKUA 1E2QA 4HB4A 2CNWD 1Z6GA 4RFSB 4TYPA 2EFEB 1DAGA 2WAYA 3B5JA 1E2FA 4IFBA 2QMHA 3I4LA 1R8QA 3LVQE 3W8NA 4G5SA 3F0TA 2C8VA 1TAGA 4Q4HB 3S1AB 3ZVRA 3LRPA 1UKVY 1YZTA 1XEXB 1XTQA 4PTLA 2AXPA 2XITA 3EPJA 1A1VA 1UDXA 4ASUA 4LSGA 1R4AA 1KIMA 1P2UA 4OJKA 4MRRA 2GK7A 1W49A 3SYLA 4QNMA 4IDOA 4R9UC 3K09C 3QPUA 4HAZA 2ZS8A 5FL7A 5FL7D 3TSZA 3WYFA 2HUPA 4V02A 5J4LA 2EYUA 1Z8FA 2GZHA 3JVUA 1XTIA 3VKGA 1FUKA 1DADA 3QPVA 1UADA 3WRXC 1Z0IA 2FN4A 1D2NA 2ZI6A 3GLGB 3QKTA 2FEMA 3O8BA 2ODNA 3C7KA 3WYGA 1G5TA 2HLDD 4AIIA 3CRW1 3NHBA 2MSDB 4MGKR 3KXIA 2CCGA 1P9RA 1FQJA 2I4IA 3CBQA 3DL0A 4JBWA 4ERNA 2PJRA 5HE8A 1TMKA 4N0EA 4RCZA 2YWEA 3RSOA 3HPQA 4ESVA 3E70C 2ERXA 4G3XA 4CEJB 3V4FA 4Q4JA 5KSYA 4UNQA 2F43A 3U3OA 4Q1DA 2JATA 3KFVA 5EP1A 4MKIA 1AZTA 2C95A 4U5XA 1GZSA 2JJ1D 5JJKA 1Z6AA 4Q66C 1CJKC 1FNNA 2BBTA 2FWRA 5FBQB 3QBTA 4GBMA 4HLQB 3HWSA 2VHCA 1K6MA 2UVQA 2A30A 2YZ2A 4P0TA 3THXA 2IF0A 3SQWA 1JECA 3AP1A 1UAAA 2GAOA 3KQUA 3V00A 1W5TA 1RRFA 3K8YA 4A8JC 4OQXA 5SZIA 3L8YA 3THYA 4CIDA 2EFHB 3KQNA 5EXSA 3BK7A 3AB3A 3IKJA 4U7DA 4LPKA 5JEDA 2ONKA 2QE7A 2QE7D 3U7EB 1Z63A 5TDHA 3QF4A 3TAHA 1EGAA 1M7GA 3AF2A 2VO1A 1E96A 1AIPA 2PCLA 1KJZA 2Z5FA 5FOUA 1XCGB 4KXFB 2IX3A 3KJGA 3SFZA 5IT5A 5A5GA 4LJ8A 1QDEA 2FZLA 2ZI3A 1RE0A 1Y63A 1U9IA 3FVQA 2D2FA 3OHMA 4BQSA 4LBZA 4D2IA 4M9ZA 2AD1A 4RD4A 2RGBA 3PITA 4FINA 2ZYVX 4M1MA 4NYIR 5L3SB 4IW3B 5FPYA 2PEZA 1PLKA 4OI4A 2P6NA 1KO7A 3P27A 1H65A 3SHWA 1Z6XA 5TV2A 3UG6A 3TW8B 5KNBA 3GJ8A 1P2TA 3FKSA 2WJJA 1LY1A 3NBYC 4FCVA 3R9WA 1JJ7A 4QC2A 5BW8A 3MRSA 4GOJA 3ZDQA 1HE1C 2J1LA 2OO7A 1LW7A 1E2EA 1NN3A 5CJPA 2AHOA 3TH5A 2QENA 4NZYA 4GP6A 2R6DA 3UIEA 3ZD7A 1CF4A 2V4ZA 1CR1A 1NY5A 1E2NA 2F1JA 4N1AA 1CR0A 4XSHA 1P7CA 1WA5A 1UDWA 4YC7A 1GM5A 1GSIA 4CW7A 1XF9A 1RJ9A 3GFTA 1RRGA 2E87A 4ITRC 3AVQA 4LV8B 1OT3A 4BLQA 2V9PA 1TTTA 3NHAA 5CM9C 1OJLA 1WDTA 3L0PA 2ZXUA 5JFGA 2O8CA 2QMUA 1QHNA 2XTNA 3GQBA 2HT1A 3CLVA 4P4TA 3U7HB 3W9YA 4HYYA 2O8BB 3B78A 2J7KA 3QY0A 2NPIA 1CJVC 3P4YA 4E03A 3DZ8A 4LHVA 4PQRA 1G5RA 4XVQA 2RHDA 1KSHA 1QHYA 1GAJA 1MRNA 1LF5A 2F3RA 2X2FA 4BLSA 1GRRA 1E0AA 1CP2A 1CIPA 5P21A 1IN7A 4ZCLA 3A4NA 2IS4A 1VTKA 3ZYCA 1DAMA 4RD6A 5DN6A 1QG4A 5DN6D 4KBGA 2NIPA 4RFVA 1E79D 3PXGA 2BBSA 2O8EB 3DO6A 1QHHA 2ORIA 1I2MA 3OEHA 3ICEA 2A7QA 5DI3B 3NDBB 1J8YF 1MO6A 2ZUCA 2GBLC 2VF8A 2FSGA 4KCGA 4PHFA 3B9PA 4QHYA 4MGZR 4B34A 5JSZB 5AJYA 5IHPA 4QBGB 3U4QB 3AF4A 3BC1A 5FL3A 5IF9A 1FPMA 3TVDA 2QP9X 1ZIOA 2X1VA 3C16C 1P4SA 3U44A 5CDFE 2ZRDA 1JI0A 1MRSA 3WNBA 2IUUA 2IYUA 2OT3B 4Q9JA 1P62B 2QEQA 1FX0A 4JLNA 3QG5A 4GZMA 4WW0A 4OHXA 5F9HA 4PPGA 1TF7A 3IEUA 1G4AE 3RLFA 1ZCAA 3SYNA 2PBRA 1VCOA 1COWD 4FD2A 4NYMQ 1FZQA 4K81B 4DCNA 4JVMA 4NONA 3UKDA 4DDVA 3NDPA 1OH6A 4LJ9A 2NO6A 4GP7A 2XTMA 3K1JA 4DUGA 4DUGD 3A1VA 3CR7A 3AVTA 2GVZC 4Z1MD 4CRWB 4LJ4A 4M53A 4F4JA 3LA6A 2OLJA 1EK0A 4LHZA 1HTWA 1DAIA 2ZSAA 3OIVA 3LBHA 4QL3A 2ZU0C 2ZUBA 4TMXA 1WBDA 3OEEA 3KZ1E 4JVSB 4KFUA 3ZVLA 5CIQA 2XB4A 4XH9B 3RS2A 5B30A 5AJXA 2Q3MA 3F3YA 3A4MA 1TQ6A 4XWAA 4DLXA 4A15A 2CK3A 2QBYB 5DISB 1G3IA 2QMEA 4FW9A 1S9HA 4H9GA 121PA 4UNPA 3CWQA 5L3RA 2K5UA 4LBYA 4X8MA 1MR3F 3VX3A 4OK5A 4C7OB 3BB1A 4TTQA 1E69A 2IYRA 5E7IA 1G8PA 1BO6A 5CYOA 2DWQA 2OUKA 1B0UA 4QGGA 5H8WA 3DPUA 2F55A 2OXCA 2GXAA 4UNSA 2WPDA 4BFYA 3CONA 5SZJA 4A8JA 3W34A 3IPYA 1PUIA 2ZANA 3KQKA 2VHTA 4W9MC 4CEHA 4D82A 2GCOB 2VLIA 4GSYA 3H0KA 1EWRA 1HQYE 2RGCA 2WMNB 4TWZA 4TLDA 2AFIE 4QBIA 2UKDA 2IYLD 2ZRCA 4NL4H 5CYPA 1N6RA 3CF0A 4ZPXA 3EIHA 3RANA 3RS7A 3WBKA 4B43A 2XXAA 2ATXA 1PV4A 3LD9A 4B33A 3X1YA 3LVRE 4Q1BA 3HDTA 1J70A 3SN6A 3UG7A 2BVNA 2F6RA 4E09A 5KDLA 5FPTA 4F4IA 5G3YA 3AM1A 2YNMA 1KJWA 1R0ZA 1W2HA 4ESHA 3B85A 3NH6A 2RH5A 1DE0A 5DH9A 1KNQA 3TLXA 1NKTA 1OB5A 1KNXA 3AUXA 1JJVA 1C4OA 4JVNA 4QG7A 2GXSA 2NMVA 2NO9A 4MYUA 4OYHA 3CWZA 3W5JA 5BYKA 1RFLA 5JJIA 3AKDA 2W2XA 1KOFA 4TQ9A 5FR2A 1KK0A 1VYVA 3GFOA 4LC0A 4O2LA 1AGPA 3KB1A 1SULA 1IAQA 4U02A 2G83A 1YR8A 3DOEA 3L2OB 2WHXA 4DSTA 2ECKA 2YYZA 3BRWD 3CRRA 4Q01A 5DSZA 5J47A 1A4RA 2YHSA 1M34E 4KYIB 2BJWA 2A9KA 4B3CA 3AGPA 5DIFA 3FKQA 3ZZ0A 2AKYA 1OIXA 4NYMR 1NLFA 3G82C 3RNLA 1KI9A 2JJ2D 1XD2A 3GFPA 3TSOA 1M2OB 2GA8A 4AURA 3WP1B 1E4VA 3K9LA 4LGMA 1Q1EA 4IHQA 4R2IA 1NMXA 1SXJD 1VG0B 5D3QA 3K0AA 3OESA 1D8TA 4Q4JB 1ELOA 1PZNA 3ZLJA 2F43B 5ELXA 4IDHA 1Q57A 4NCIA 4Q9LA 1OXUA 2WV9A 3SEAA 1Z0DA 5KNCA 3EPHA 1ESNA 1NN1A 3U7FB 1UKEA 3A37A 4D6PA 3R9IA 2VH5R 4Q18A 3UK6A 1LV7A 3FHTA 3HR8A 3L43A 3RS4A 3THXB 1UPTA 1FTNA 5EXPA 2G1KA 3H4MA 4EIWA 3GLFE 1D9XA 1W48A 3P20A 2R8RA 4NMMA 3SJAA 3THYB 1M1YE 4AYXA 2OCBA 4POAA 5FBWB 4TTPA 5DYGA 221PA 2J0UA 1W36D 1W0JD 4TL9A 1ZM7A 2B92A 5JLJA 5E7JA 3OFNA 3N2EA 4DLVA 1XCMA 2FSFA 2CCKA 4KAXA 4EUNA 2GBLA 3FMIA 3QF4B 1OYWA 2ZAOA 3WY9A 1Z3IX 1W0KD 4Z8XA 1T0HB 3SJBA 1SVLA 3KB2A 3NBZC 3SOPA 4KI0A 2CL0X 2CE2X 2XOKD 2OE2A 4MKFA 1R5NA 2B7CA 2P67A 3ZQ6A 2JLZA 3FMPB 2PH1A 2IA5A 5EP3A 1A7JA 3RS0A 2P6UA 3QJYA 3SDZA 3RC8A 3MWYW 1R0WA 5HCNA 3RHFA 1XTKA 3QKRA 4WXRA 4Q9IA 2BHRA 1BKDR 4G5OA 4AKHA 2ODBA 4KLNA 4W5JA 3FB4A 3LY5A 5HR5A 3FPAA 1KMQA 4KFSA 1UBFA 2D2EA 3RWOA 1NIPA 1XZPA 1RRCA 3EC1A 4HLCA 5JRZA 2JLUA 4DZZA 2W0SA 1OFTA 2QUZA 1GL7A 4D26A 4MYHA 2GWHA 2PX0A 1X8JA 2RHMA 4BZPA 1XPUA 1NBMA 5AUQA 1K5GA 2GJKA 3AF3A 4LX0A 2F9LA 2N1BA 1QVAA 3TVTA 1W44A 5H68A 1Z07A 4YXWA 3T15A 4QBFA 3CR8A 3M1IA 4IOJA 1NSFA 4DCUA 2WWIA 3E1SA 1KI2A 2V7QD 1NL3A 2VRWA 1RJ9B 1OH7A 2PX3A 2BWJA 4NE2A 4TLBA 3IEVA 2REOA 2DFKB 2DYKA 1DS6A 3FDIA 3L8ZA 4KFTA 5CK4A 4NHOA 4LRWA 4K46A 1ETUA 3VR6A 4D0GA 2GNOA 4L9WA 2O8CB 2RGAA 2ZREA 3IPXA 4BGDA 2ZROA 4DSNA 2ODWA 1KI6A 4URYR 2V8OA 2ZQ5A 2IT1A 1GVNB 1XXHA 2WIBA 2O0KA 3C5HA 2A2ZA 4CT4B 1XZQA 1R8SA 1GWNA 3WMFA 2LWIA 2H92A 2WWWA 5KU1A 2D7DA 1NVUQ 3IGFA 3RRZA 1P73A 2QN6A 1II0A 1N6IA 3NVAA 3NWJA 3T1TA 4B2IA 2OG2A 2QAGC 1DBSA 2F1RA 4PAQA 2ZM5A 3ZS9A 3TE6A 4DDTA 2IYWA 5KOYA 1ZIPA 4TMWA 5LB2A 5AUPB 2AN9A 1U8ZA 4N0DA 2BEJA 5EP2A 1E1QA 4HZUA 1F5NA 2HYDA 2Q3FA 4HSEA 1BYUA 2AWOA 4PANA 1E32A 2ZSBA 1NG9A 1Q1ZA 2ZVPX 1QHHB 1LF0A 4PQYA 1G7TA 4JKIA 5LB4A 3B1WA 4LYAA 3T35A 1G4UR 1IJFA 2REXB 1N0UA 3B6EA 1GUAA 2I1VB 2GF0A 2NO1A 2DPXA 5KTYA 2JLYA 2EVWX 3RAPR 4KSBA 4GRAA 1NF3A 2P2LA 3ND8A 2KWIA 2IYYA 1HT2E 1VECA 2VQSA 2FMXA 4M1OA 5AK0A 3I5XA 2ZSDA 2ZE6A 1EX6A 2BKEA 3UMRA 1H8HD 5E3HA 3QENA 5EQTA 2QTVB 3EWSA 3U44B 4FIDA 3ONWA 721PA 1NN5A 1IHUA 4DRZA 1E2LA 1Q0UA 5L3VA 2NGRA 3TSWA 4ABYA 1S0UA 4RZ2A 1E2IA 1FX0B 4IOLA 4MRSA 2E1RA 4A2PA 5CB8A 3K70D 2C77A 3OIUA 4AKIA 4HAUA 1II9A 2AWNA 3U61B 2ANBA 1M74A 4GMXA 1G3UA 4GZLA 2OAP1 4Y0VA 1Q3HA 1R6BX 5AJZA 2QY9A 1XMVA 1T3SA 2RGGA 4D4MA 1S3SA 3IHLA 3FHCB 4BRUA 2BCGY 2V6IA 4HAWA 1G8FA 4JBYA 3KKPA 3U3MA 1YZUA 1U9IC 3L0IB 5C1BA 3LQQA 4OJQA 1IM2A 1E0KA 2VHQA 5GVRA 4I1OA 1XD9A 1ZINA 1MABA 1D2MA 2IUSA 1IQPA 2GCNA 1ZC3A 3DKVA 1JEEA 4I1VA 4Q48A 2QSZA 1A2KC 3QKUA 2WJIA 2BBOA 3KL4A 5FH9A 4HUQA 2GILA 3QXSA 1HH4A 2L0XA 1XNJA 1T9HA 2QORA 2GJSA 2R44A 3GLHA 1Z0AA 1T8UA 1CJTC 3RABA 2PT5A 4Q7LA 1JXOA 1T0JB 3K9HA 2HF8A 2N46A 1G5PA 2C9OA 3VX4A 1GITA 2XAUA 4JL6A 2A5JA 4HDCA 2R65A 2QPAA 4RZUA 3B82A 4A8JB 1H8EA 3Q7PA 3ZH9B 3IHWA 2FOLA 5G40A 1E99A 4BLPA 3V4RA 4EQ6A 1QBKC 3ND9A 3ZQJA 4CEHB 4P3YA 5J5CA 3A58B 4I99A 1ZD8A 3B1XA 4M2LA 2BCJQ 1GNQA 3W6NA 3VU9A 2FX3A 1YZKA 2C9CA 4QJ4A 2IEZA 2J0VA 3C4JA 1OH5A 4YMWA 2XXAB 4V0ME 2KSQA 4GFDA 3VKWA 4DEYA 1KK2A 1NIJA 2YOHA 3VR2A 3BB4A 3LDAA 5E95A 2J0SA 2GK6A 4AYTA 2ZAMA 3VKHA 3QQ5A 4JLKA 1SQ5A 4JLOA 4TYNA 3I61A 4KSCA 4BEJA 3ZVNA 5A0FA 4MYTA 1NVWQ 2QTFA 2DWOA 2ZRKA 2ZS9A 3BBPA 8OHMA 4QGHA 2QT0A 4OHZA 3LX5A 4L8GA 3REGA 1YRAA 2GJ8A 1GRQA 3EA5A 1RC8A 3TBKA 3AKYA 1KY2A 4NYIQ 1N6HA 4C0KA 2V1UA 1ZRHA 4GL2A 1SHZA 4OL0A 5EE1A 2WMOB 1TEVA 4LBVA 1AQUA 1ZM4A 1VIAA 3EA0A 3PEVA 4I1UA 1V5WA 2IF2A 4NCHA 4S35A 6Q21A 4V03A 1N5IA 2QQ0A 2BV3A 1CXZA 2CNWA 3FWYA 3PUXA 4M22A 4M21A 3RRNA 1QRAA 4R71A 3T1VA 2ZJ8A 3NC1C 1XD2B 4WAUA 4TN1A 3X1XA 2RB4A 3F5FA 1CRPA 1NRJB 3IIJA 1Z2AA 1ZAKA 4PQFA 2R62A 3GD7A 1X6VA 2KBFA 3K0AB 1L7VC 3LW7A 3PUWA 4DLSA 1EFHA 3ADBA 4B73A 3LXRA 4LHWA 1U8AA 2VP0A 1G19A 1E4YA 2VL7A 4HZIA 2DR3A 3KTAA 1S1CA 4ZI3A 4II7A 1Z08A 3PFIA 2JCSA 2QAGA 2VBCA 1ZYUA 1BS1A 3Q8XB 3WBJA 3V9PA 1DO2A 1KO1A 1SVIA 1BIFA 4QRHA 4M9XA 4H1VA 5FPKA 2HLDA 4R98A 1P3JA 2J0UB 4W7SA 3B60A 4PXAA 4A36A 2WOOA 5C4MA 1VYTA 2IS6A 4HATA 1W1WA 3MUFA 4S2EA 2JAQA 2ZJ2A 1OXXK 4B32A 4BPBA 4ARZA 4QOSA 1GDDA 1ZUNB 3PQCA 2QTHA 3OIYA 1RYHA 4LHYA 1AGRA 4Q9HA 2JJ1A 5AJVB 2G88A 1Q44A 1Z0JA 3AUYA 3U3JA 3ADCA 2NZ8A 4G5RA 2ZJOA 4BLOA 5M04A 4Q7KA 2X8AA 3SI7A 4QBHA 1JR3E 3ZJYA 1HYQA 1E2GA 3QKSA 4MKGA 2KE5A 3QKRB 5CJ2A 5BWMA 3RRYA 3GJ5A 4AI6A 5IK2D 1D9ZA 4RD1A 3EZ6A 3I72A 4M1YA 1F2TA 1YR6A 2WSMA 4JLBA 2J3EA 1JR3D 3EAQA 2AD5A 4V0KA 2IUTA 1EFCA 4LY6A 4LJ5A 2P5SA 4MUBA 2OBLA 5E4FA 1NVXQ 1UFQA 1NNEA 4FMDF 1SKQA 1GKIA 1SKYB 2DY1A 4B6EA 1E9EA 1A5TA 2QROA 3C5CA 1GL9B 3FMOB 1Q12A 4E22A 2R2AA 5JS7A 4M1SA 2HJVA 4CZ2A 3AF1A 2VSFA 5J40A 1UKZA 1XX6A 3TK1A 3BORA 2P3SA 1XMJA 1AA9A 2CBZA 5EJEA 2OLKA 1ZU4A 1KGDA 4ZDKA 1DARA 5DHAA 4Z54A 1XEWY 4XWOA 1KI6B 2G0NA 4TSFD 3ADDA 3AGQA 1XXHB 1U0LA 2P65A 4LV6A 4C4PA 1VCNA 4DWJA 1KO5A 5FFMA 1QHXA 2QGZA 4WOPA 1AM4D 2AL7A 1G8HA 2C9YA 2ZYTX 4D4JA 5FBLB 1YU9A 2ZTSA 2OV2A 4C30A 4DVGA 2AFHE 2IWRA 4RSGA 1CEEA 1X1RA 3BFKA 3MJRA 4B35A 1OXVA 5FPHA 4O25A 3A1TA 3GJ0A 1Z29A 4AY2A 2AR7A 4TYQA 2RGDA 2J0QA 3QI2A 1FQKA 1HT1E 1OFHA 2ORVA 4NYJQ 5UKDA 2XZLA 5H1YA 4HZUB 5HTKA 1Q3TA 4M0LA 2C96A 3NH9A 1UJ2A 4TLAA 4NP6A 5EUMA 1OIWA 4D80A 5J4VA 1E6CA 3VR5A 3PR1A 4ZO4A 3FFBA 2ZJBA 1P72A 1XCPA 1E3MA 1SXJC 5EZ5A 4HAVA 1E9BA 3KDSE 2GHIA 2JDIA 2JDID 4JJZA 4UQOA 5FOWA 4A0RA 2DB3A 2WWXA 2ZE8A 3KJIA 1MO3A 3BFXA 3P1JA 1N6OA 2OHFA 5FOXA 1T6NA 3EXAA 3TIFA 1G291 1D5CA 4FI3C 1VG1A 4H1UA 3GJ6A 4WBSA 4BRWA 3IQXA 4TZ6A 1NI3A 1YJ5A 3B1ZA 3CZQA 2YC4C 3L0SA 4PO9A 1N0WA 2NOAA 3EC2A 3PUZA 4YMTA 2QL6A 2ZRFA 2FZ4A 1GFIA 1IY0A 1NN0A 3QOFA 2GEVA 4DCSA 3AVWA 2XJ4A 1E79A 2XZPA 5LDDC 3K9GA 4QKQA 3W5IA 1W36C 3AVXA 4HAYA 4WA7A 4NU0A 3CNOA 621PA 1XDBA 4DT1A 1DELA 2FSHA 4RY2A 1UEIA 3AF0A 1KZ7B 1K8RA 2CEAA 2HDNB 3L82B 2A5GA 2ZJAA 1I4LD 3LW8A 5EE9A 1ZNXA 2FPLA 1ZNZA 2JASA 1WF3A 2QRNA 2XJ9A 2Q21A 5HCIA 4JS0A 3UANA 3SHFA 4C0JA 4D0NA 4EAQA 2QT1A 1J2JA 3THOA 1MABB 1KK3A 2H16A 5G3ZA 2ZRNA 1M6NA 3UWKA 2DHRA 2HF9A 2VP4A 1XJ0A 2W58A 4ZKEA 2XZOA 3UMFA 3N5CA 4HUQB 3BXZA 4DHEA 1P61B 4AYWA 2VSXA 1EWQA 4R2HA 5CDFA 1TPZA 1COWA 3I8SA 4FMCB 5JECA 4OK3A 1ZD9A 4JJKA 3RSLA 1KMHA 3ZGXA 5JCPA 2ZS7A 3CKLA 1X86B 3GLHB 2H5EA 1KSJA 1G16A 3LLMA 2BEKA 3WHLA 1ZU5A 1E2DA 4FMCF 3ZS8A 1E9RA 2JLSA 4C9BA 1DVRA 3HU1A 4LOAA 4Z1MA 4IKEA 4FCTA 4PHTA 3OE7D 4TT3A 3IO5A 4TT3D 4OI2A 5B2ZA 3ZD6A 4AKGA 3MAAC 1BMFA 1BMFD 1OHHD 5BXQC 1EFRD 5JRJA 2QI9C 4KYUA 4NPHA 1HUQA 2CLCX 4EQ6B 4JZKA 2OFOA 1YQTA 3BGWA 1II8A 1NJGA 1GILA 4IVQA 3W6OA 1L2TA 2CL7X 2OESA 3VU9B 2EWWA 4X8LA 4L16A 2EW1A 3R7WA 2ZJZA 3VAAA 2IYXA 4JT2A 4DDWA 3U6KA 4I1SA 3NC0C 2V1XA 3BOSA 3C41J 3NTUA 4NYJR 3TR5A 2VSOA 3MWKA 1KDOA 3AEZA 2ATVA 4G5QA 5LD2C 2RMKA 2ZYWX 2ZJ5A 4TYWA 4LCBA 1IN6A 4NKRA 5B64A 1CRQA 3GCGA 1NJFA 3EPKA 1RYFA 2TMKA 3U3KA 1WQ1R 4XOIA 5C18A 4I4LA 2BC9A 3O8CA 4LI0A 3GEHA 1ESMA 2BMFA 5JS8A 2EFGA 2UZ3A 1JPNA 2JLWA 2QU8A 2OXRA 3MWLA 2D7CA 2JA1A 3GJ3A 4O2RA 5TXGA 1KTVA 2WZQA 4TL6A 4UNRA 3VHXA 3QBVA 1O87A 3EPLA 2VP2A 4UKDA 4XD7A 1BOFA 2IHBA 1W4RA 3EZ7A 4IEEA 4XD7D 3WMGA 1LNZA 4EPYA 3AP2A 3CIOA 1ZM3A 4NH0A 2MSEB 1MV5A 1U98A 1U99A 3KX2A 4LK2A 4A92A 4YMVA 4PAMA 4ZIRA 5EXTA 1F60A 1X1SA 2QM7A 2YJTD 4M1WA 1YR7A 3K70C 1JQLB 1JPJA 3HU3A 1MO4A 3D8BA 1ZP6A 1F2UA 1XB2A 5GJWC 4DKXA 2OILA 2VP9A 4MKHA 2HCJB 5KSZA 2X19A 3KKNA 4BEBA 2YINC 1G8YA 5K8UA 5FOTA 2IXEA 3WNDA 2GJ9A 2A3RA 1PLLA 4KBFA 5F2EA 3CRVA 1N2CE 2X2EA 3KTAB 3NKVA 2VIIA 3B8HA 1GL6A 2GEUA 1Q1BA 2QAGB 1IY2A 1G3MA 1KO8A 2H17A 5DO9A 2BM0A 2YC2C 2ZSEA 5GVSA 3G0HA 1QHSA 2ZI5A 2DBYA 3EW9A 2PLFA 3MCAA 3SBEA 1TQ2A 1CTQA 3CX6A 1LB1B 4RKFA 1X8LA 2JJ2A 3NIBA 2JEOA 2FFAA 3K0EA 5FR1A 2ZITA 5FUWA 3TGPA 1U8YA 3GJ7A 4L5BA 3ICQB 1J99A 5FTLA 4RD2A 1CU1A 4ZDIA 2GVDC 1SXJA 1KDPA 3A4LA 2YV5A 4ARZB 4ILEA 4BFVA 1E0SA 2FGJA 3CF2A 1IN8A 1RPZA 4FCWA 2VPPA 4YMUA 2W00A 4Q1CA 4A0GA 4A4DA 3U60B 1P5ZB 2WWHA 4MGIR 4TL7A 4Q4LA 1S4QA 3TR0A 1QZXA 1LVGA 1N25A 2VP6A 3CW2A 3QKSB 5TVKA 3QVVA 2AKAB 1XEWX 2WJVA 4V0NA 4RD3A 1OFUX 1EFTA 3N70A 2J45A 1NP6A 1OB2A 5JWHA 2R9VA 4MYCA 1F2TB 1W0JA 4IXNA 4XIGS 4F92B 1IJEA 4UJ3A 3GLGE 1VPLA 4URVR 3GLFA 2RGEA 5KPJA 1GOTA 3RWMB 3A1WA 4P33A 4HDOB 2Q3HA 2JJ8A 5DYIA 3SS8A 1W0KA 4DDUA 4OHVA 3CNLA 3AVOA 4NCNA 2FPKA 2FE4A 2VHJA 3LFUA 4AKEA 4IXMA 1XD8A 4URWR 1AZSC 4Q1FA 2XOKA 4LJYA 4C3ZA 2CVFA 2OAQ1 1Z6TA 1ZMXA 4KVGA 2PEYA 4O3MA 4EPWA 3EASA 1U0HC 3FFAA 3L0OA 3QE0A 1IBRA 2JGNA 2Z43A 1P9NA 3B1YA 1DAHA 2CHGA 1DEKA 2AK3A 1KO4A 1VHTA 4P4UA 2YKGA 4JLMA 2O8DA 1XTJA 2R6AA 5IDVA 2RAPA 3CPJB 1SGWA 2Z4SA 1XJQA 2ANCA 4O0MA 3U6BA 4DLYA 2LCFA 1WMSA 5EP4A 1E9SA 2ZI7A 4G01B 3TUIC 3Q5DA 3KQHA 1ZD1A 4KITB 1ONBA 5JWOA 1TF5A 1ZM9A 2CDNA 3A1UA 1QVRA 3RS3A 2WKPA 4Z51A 2CVHA 4AK9A 4D0LB 1YZQA 5K8TA 1WP9A 2CJWA 1Z83A 1XTSA 2C99A 3QEJA 1TNDA 2V7QA 1W4BA 1CR4A 2IBMA 4B3FX 1E9AA 2F9MA 3PUYA 1SKYE 4X8OA 4JSYA 4C0QC 2J5XA 1R5OA 1UF9A 1VCIA 3IIKA 3U2QA 2Z6VA 3LBIA 1RRPA 2EFCB 2QNRA 2WVJA 3NEYA 3R8CA 1JAHA 2N42A 4PZZA 2IS1A 4BFUA 3I62A 4QNRA 5AJWA 1NSTA 4BECA 2ZRBA 5JMTA 4DLRA 5KYKA 1N6PA 4NDZA 4V0OA 1KI4A 2CHVA 2SHKA 4JIMA 3CRMA 4GOXA 1XXHE 1E94E 2JLRA 3D6TB 4LV5B 2IL1A 4XWKA 1QHGA 1RIFA 4NCJA 4CYMA 1WXQA 1R7RA 1OPXA 2PL3A 2Q9CA 1E98A 4DIDA 4F91B 3QEOA 2ZRJA 4IEIA 1E9DA 2ZU6A 4DT1B 1P2SA 4LYFA 5EE3A 1P60A 5GJCA 5SZHB 2H7VA 1N5LA 5TARA 2YWGA 3EZ2A 5FUYA 1G9XA 2ZEJA 2FFBA 2C04A 1Z47A 3KKOA 3TMKA 5E7MA 1ZVQA 1QG2A 2HEIA 1D2EA 1YZGA 4IVPA 1KSGA 1H8HA 4LHXA 3NG1A 2VEDA 5G53C 1KI3A 4BFSA 2IEYA 2ZRMA 3BD9A 4OI1A 2JLVA 1VDZA 1XPRA 1KYIA 4MH0R 2W6JA 2W6JD 3K0CA 4Y0AA 1P9WA 1EXMA 1W5SA 1CULC 2ORWA 4P32A 3QSYA 3EIQA 1EX7A 4A2WA 4B3DA 4IVRA 2C98A 1SVMA 4ZI2A 4GDFA 4EPTA 2G3YA 1LTQA 4LYJA 2ERYA 4F7WA 1KMHB 4LUCA 3U5ZB 1YR9A 521PA 1MKYA 2GZAA 5FI0B 5AUOB 3LV8A 3MMPA 1R10A 3RRMA 3T5GA 4KJZA 4BZXA 3GP8A 2CXXA 5TY0A 5FTMA 1ZW6A 5IRCD 2XGJA 4GT1A 3W90A 5KSOA 1UEJA 1OF1A 2ODEA 5FTKA 4JMPA 4JL5A 2GDJA 3A36A 4TMZA 1CS4C 3DHWC 1II8B 4XTRA 3Q5EA 3UWOA 2QGNA 2ZI9A 4B71A 2OCPA 3ZZTA 3MWJA 4HI0E 4PZYA 2J87A 3Q9LA 1NLYA 1KAGA 4IOMA 3R7WB 5TMPA 1VYUA 2X77A 1JAIA 1T91A 1T5LA 1WRBA 3N2IA 4B6FA 4CVNA 2ONJA 1F3OA 4MRPA 1CKEA 2PZGA 4W5WA 2QP3A 1GKUB 1KK1A 2F7SA 4LYHA 2I3BA 2PJZA 5KDOA 1MOZA 1XJCA 4Q1AA 4LZZA 4KODA 1ZBDA 4DCTA 4G1UC 3E2IA 3BH6A 3GLHE 1G64A 4LJ6A 4Q00A 1KDTA 4L9SA 2GXQA 3VMFA 4BE7B 1BH2A 4ZCIA 1KAOA 1IONA 3OAAD 4C0AC 2PZFA 4CF7A 3TQCA 3B13B 3VTKA 1V43A 3I73A 2IYTA 2O0HA 3EIEA 3FMFA 2OEPA 1PJRA 3CUEF 4PC6A 2BJVA 2XSZA 2XSZD 4MDFA 4JLVA 4US2R 3JVVA 1AN0A 4KHZA 4F38A 2HXSA 1W47A 4US0R 1US8A 1P2VA 2ASEA 2O8FA 1UBEA 2GRJA 4V0MA 2F1HA 4Q4AA 1IXSB 4ZIRB 2BM1A 3WXMA 3DOFA 4L15A 3VR1A 4UXIA 4JT4A 4OHWA 2OZEA 3MFYA 1JEDA 4PC2A 1F2UB 4TYYA 1NMZA 3UXMA 3KXLA 4I81A 5GJBA 1RZ3A 5K8IA 5GJVC 1OV4A 1LS1A 3IO3A 3PUVA 3NBXX 3PEYA 3A6PC 1VG8A 2EWVA 5DNYB 4DEXA 2ZPTX 4QFMA 2IYZA 4ACAA 1R2QA 4A0HA 2W83A 4RD0A 2R6FA 4JBXA 3SBDA 2OM2A 1ANKA 4DXAA 1TU3A 4HUTA 1W4CA 3M4YA 1E2JA 1NVVR 2NQ2C 4JKYA 4R7ZA 3W8RA 3BAFA 1DG1G 2IYVA 3EWAA 1SXJB 3CRQA 4D81A 1S2MA 2CLSA 3SFVA 4WVFA 2GKSA 2F1IA 4WZ6A 1XPOA 3PJRA 2ZRLA 4PPNA 4RCYA 4XTCS 4EJSC 3VNUA 5DHFA 5JHGB 5FBVB 2P5TB 4HB3A 1XTRA 2DCUA 2UZIR 3T1QA 5CITA 1JQJC 2NO0A 2QG6A 2XB2A 4D4KA 5FPSA 3MG9A 3GLIB 1G6HA 5F3WB 1C9KA 1IN4A 2WICA 4Q1EA 3IDQA 2OCAA 3ASYA 4FMBB 3ETLA
chains in the Genus database with same CATH superfamily
2VDWB 3ZX4A 3TPFA 2PCJA 4WK0B 2IS2A 1T43A 2BFMA 2X4GA 5LZ7A 2JAHA 3AJEA 5C7IO 3WGTA 1AQNA 5DK4A 3KQOA 3PV0A 4RKYA 1DC5A 4ASUD 1USIA 2FUKA 2MOKA 3R2JA 4BZZA 2DKOA 5CXQA 2RGXA 2XBLA 2W93A 4LGVA 1TUBB 4A1OA 1VQ1A 3CJQA 2DX7A 4MR9A 1YMUA 4AKTA 2OWEA 3HO6A 4A0FA 3ANNA 2NNWB 3M34A 3OIGA 4GYJA 4TKZA 3WGUA 3FKJA 5K03A 4CL2A 1CUDA 2GZ1A 2G82A 2FPPB 3F9IA 3K0KA 1CJMA 4LY0A 3OIWA 3NANA 1Q0PA 4RYDA 4WI1A 3FTFA 2PKXA 4N40A 3O5AA 1EVYA 1KKLA 2LV8A 2XRYA 3FUXA 1RSZA 1W88A 4J0QA 2CB0A 1LBTA 2ZYGA 1OX5A 5G41A 4OLBA 5EIBC 2D2IA 1V4BA 1WCWA 2D3WA 1PEDA 1Z0SA 2VUSA 3G5TA 4FBGA 4FMPA 3LPNA 5IK2A 2QTCA 3E7DA 2O8DB 2FSPA 4DCMA 4K03A 4GP9A 4TVSA 2XD4A 3V33A 1E66A 1PFKA 1GNPA 1EAYA 3VZBA 3G1TA 3OF5A 4E6PA 2V3CC 2WLSA 1JLRA 4AUEA 1UOOA 4ME6A 2CHEA 1JIKA 1VBFA 5ITWA 3IBYA 3ODPA 4N3GA 3L6CA 5JZVA 4L4YA 1DSSG 4IIHA 5HE9A 4HLUA 4MRNA 5K3SA 4ZT6A 5TEVA 1L5HB 3WDLA 3ZE6A 4PPQA 3QITA 2Z58A 3BE4A 4Q7JB 2CVOA 3AVUA 3FOZA 5JALA 4CUKA 3LNCA 1Z5WA 2FEOA 1DKRA 1IOZA 3RVMA 3S2ZA 4JSTA 4IMRA 2QR5A 3KZCA 3BXGA 2E4YA 1I5EA 3FNIA 2C9ZA 2O57A 2XPCA 3SEFA 3BUSA 1KJ8A 3FCCA 3SPXA 3AKCA 3SKVA 2J30A 4YLYA 3D8UA 3KTDA 4TSFA 4LJ7A 1KS2A 1G2PA 3B2EA 5C9ZA 3RUEA 1KEUA 4FDVA 3MUEA 1A7AA 4URHA 4NQRA 3B7GA 2QRPA 3LZDA 1BE0A 2WIFA 3OZSA 2P9BA 3DGFC 4HXEB 3LNTA 1YBMA 3MT7A 5CT5A 3R8FA 2A0KA 1P1FA 2VCYA 1U2RA 4JD5A 5F1PA 4L02A 3TRFA 3VFDA 5L3QA 1OAOA 1EFVA 2P9ZA 3RYFB 1N7JA 2JFXA 4RABA 4C5CA 3OT4A 1EVIA 1KI8A 1ZNWA 4L6IA 1REQB 1BWQA 4KV9A 3H2IA 4IIYA 1FCJA 1RFGE 4N03A 1CUJA 3IAFA 4JL8A 4TQUS 3FKSD 1GD1O 1R0YA 3K53A 4JP1A 4AO6A 4QT4A 3HK2A 4F2DA 1P39A 3DVAB 5AK3A 4AG5A 4EKGA 1FTYA 3F2IA 3LXXA 3PWKA 1IUPA 2ZRGA 2HLNA 1M2KA 1N0VC 4YLGA 3RU7A 1DC4A 3P5SA 1COZA 2G0TA 2KS6A 4YEDA 1HE8B 5CEJA 4AW9A 1DTSA 3BWBA 1OFIA 4WNIA 1ODFA 4PCVA 2ZXFA 1JDBB 3DE1X 3EBPA 3IQDB 4HLDA 4OBWA 2LW7A 4NU5A 2GPBA 4JZYA 5EMMA 4X3OA 2ZIXA 1RWMA 2PA3A 4BUJA 3NNNA 4BFLA 4ED9A 2WD7A 4JDUA 3BFVA 5LPNA 4JEHA 5CM8B 3IVMA 3QW2A 3OM1A 3C45A 2G9NA 3DDOA 2JARA 2CNOA 5CMLA 5D7BA 4J29A 3CF6R 3ABZA 3GW8A 3OE5A 3UMSA 4B48A 4C3UA 3LTNC 2CLDX 2H3HA 3BD6A 4A8HA 2FU5C 2IKSA 4IGEA 4MRVA 5BQ5A 2B9EA 1DDOA 1DBPA 2FA9A 3ZK9A 2XVMA 2A1TR 3H1PA 4PHHA 5AR1A 3TXAA 4AC9A 4IIJF 1EE9A 2FEPA 2IC5A 4HK4A 2PZEA 4CEIA 5KREA 1U0RA 1ZOSA 3UJPA 3JQCA 5LJIA 3DPIA 3GDFA 4DC0A 5JNRA 2O8VA 3JZFA 3HUDA 3MCZA 1BVYF 3H1TA 1GJRA 2C2ZA 4MMZB 3MHTA 4ZAVA 1QAQA 1S9DA 4HDAA 3OJXA 4IJKA 5EQFA 2MSCB 5EZYB 2IV2X 5B58C 1FFBA 2IPNA 3IDOA 3PC4A 3RASA 4KG7A 2ZTMA 1T6XA 3H75A 5BUCA 5E6SA 4U7FA 1WS6A 2LP4Y 4US1R 1PK8A 1SKUA 1BX1A 1ICEA 3ESYA 3EUAA 5EHNA 4KR3A 1O54A 3WFZA 1KOJA 4KU4A 4YRZA 1TU4A 3BD7A 3AO0B 3UJ8A 1ZHFA 3Q9SA 3ZY2A 3I32A 1PHRA 3PDCA 1GGKA 2ZYIA 4ZO8A 3MIIA 4KGXA 4B75A 5KHOC 2EGGA 1ZESA 3E5RA 5DNVA 4KQEA 5A7GA 1TADA 4N0MA 4LOHA 2JBWA 4FFMA 5EHIA 2OBNA 4H7EA 1LDGA 4CMIB 4DMRA 2R8OA 5HCUA 4EPVA 3EF3A 2ARKA 3WI7A 5TIIA 4PZLA 1OGJA 3C0KA 3AESB 3GN2A 3PQDA 2RGNA 3HJNA 3ZCUA 2ZR9A 1HV8A 4FDUA 4EM6A 3EZFA 4EJSA 4CCAA 2J4FA 3NR2A 4WIAA 2WM8A 1P3DA 3JQFA 3I34X 1NFQA 4IFIA 4PO1A 2G7ZA 1ZVVA 4X91A 4KVAA 1VE7A 2QX8A 4QGFA 3V1KA 5B36A 4UTPA 1CY0A 3LWNA 4EFDA 4I6JA 1YT5A 3LCUA 4TLMB 3KPVA 1PR1A 1Z5ZA 1N6LA 3MFQA 1WV1A 3P19A 1EFRA 2I1LA 3WS7A 3ND6A 3R6TA 1QX3A 4G1FA 1W59A 3UJ7A 2HWYA 2EQAA 1V3UA 2OZLB 3MWDB 3TM4A 3SQXA 1D6JA 1XQ9A 1XTVA 3HYCA 3WGKA 1D0IA 4AMVA 3QU7A 4EHAA 5JWRA 2RGRA 1ZWLA 4J2TA 2DERA 2XH8A 3BERA 5SY6A 1T4DA 3WZ2A 1G8SA 4TQAA 4WMLA 2JAWA 1IXZA 1RQGA 1SWWA 1BHQ1 2IPMA 2W2VA 3A05A 3CX8A 1FP6A 1PJ4A 4PGFA 1JEOA 4XR4A 3O8OA 1U0SY 3R74A 3OUZA 1PNVA 3SQLA 4EEZA 1AV6A 1YZLA 4YCAA 1YJCA 3ELYA 4RVCA 3ZWWA 1E61A 1Q22A 3GWZA 4O8CA 3QF7A 4UHBA 3VV2A 1FFHA 4ALKA 4K9RA 3HRHA 4N4AA 4DMHA 4DWWA 4WZBE 1J9EA 1NKSA 2PDAA 2YL2A 4RDXA 3U3XA 4X41A 2H1IA 2Z4TA 2B94A 2HK7A 1AQ6A 3GFBA 3GUUA 5F1KA 1IIRA 5EKUA 5FI1B 3RJ9A 3D6NB 1M2VB 2FMKA 2WVHA 3DZFA 3G68A 3VO8A 3ZE9A 2ZKLA 3KSDO 2C7PA 3WNZA 1HG1A 3W3AA 4XEHA 3W3AD 3ZCVA 4GBJA 5JI3E 4WNYA 3JD0A 5JSHA 3JY6A 5J2UB 4F12A 1VFPA 4DUZB 1FMFA 5I7RA 4ON9A 4XQEA 4J07A 1KP9A 2FHPA 1C4WA 3OC0A 5HIIA 2GZ2A 2P9YA 3GFFA 3LIPA 5A9TA 4JI6B 5LNK1 2WKWA 3HB9A 2GXUA 3PGA1 3VJKA 2IHYA 4GHWA 3NCHA 3H4IA 2ST1A 5T7BA 1LLFA 4ZYUA 1IXRC 2EKDA 4S1PA 1A8IA 3IPAA 2HB6A 3OO0A 4Y2QA 2NTYC 4F9GA 2SCUB 5C8ZA 2OOKA 2MJLA 4WINA 1R9NA 3JQQA 3MS7A 3HSYA 5CLQA 4BQIA 4V39A 1GUDA 1WUJS 2FG5A 4H4CA 3TXYA 1SK8A 4E70A 2C7GA 3WZLA 2WIAA 3DBRA 4CHTA 2SKEA 4NDAA 1ZC4A 2BI7A 3RUHA 3FE2A 3PKZA 4HNRA 2VPTA 4OB6A 5EZ6B 3WL7A 3REFA 2FAXA 4IDBA 4BB9A 4YT8A 1GYPA 5FWNA 1SCDA 2QQ5A 4NMLA 2V59A 3WRWA 2QZZA 2WILA 2AC4A 3CH6A 3P9IA 3FMGA 4RXMA 2GS9A 2K4MA 4PC3A 4PSAA 1BQEA 2FHSA 2NWQA 2XY4A 4JA0A 4QTXA 3X44A 5CDYA 3QJGA 4XAQA 3PL5A 3ETEA 1SCJA 2HQBA 2ZBRA 4I6EA 3K2IA 5LBIA 4P4LA 3THWA 3DZHA 3CVUA 1L5WA 1OLSB 4DJAA 1DX9A 4OMCA 4WPGA 2DZDA 4PVDA 4F6RB 3V3KA 4A9AA 4DM3A 2ZR7A 1NUAA 3BJEA 4UTRA 1CYEA 4M8NE 1J1ZA 2ECFA 2C5BA 1N2CA 2CXPA 5J9FA 3UYLA 2A5DA 5CA0F 2GA9A 1FFXB 5BOSB 4N3NA 3LBAA 2E4UA 3F6YA 5JNVA 5CDTA 1QH1B 2P6PA 5CPFA 4C6TB 3HKDA 1TPYA 1I1QB 1IMJA 3C4VA 4S04A 2HBYA 1K5HA 3ZWXA 5FEMA 1WE2A 2AK2A 2V9ZA 1SUWA 2OCDA 5U9CA 1NZDA 3KHTA 2ZQZA 2PMKA 4I7EA 4XGIA 1PO7A 1ZL0A 2QYSA 3SYMA 2G9VA 5CT8A 4AY4A 4DM4A 4GXNA 5FKJA 2VWHA 1RVDA 2M9MA 3TZLA 3ZXIA 4B74A 4QG3A 3KYDA 2BCEA 1KA9H 2PXCA 2C20A 2VNKA 2V5UA 1B4DA 1OSNA 2D5AA 1FP1D 4E07A 3VR3A 4OK6A 2O2DA 2NZJA 3AP3A 3GBPA 3MELA 2XEXA 2RCYA 3NIWA 3RODA 2QW0X 3ABQB 2BISA 2W2MA 4JVLA 2XD9A 4EJFA 1XEXA 5CX4A 4MCAA 1R74A 3LDUA 4FXPA 5EMHA 1E2PA 3D6VA 3ZWNA 2O7SA 3IE2A 2W90A 2VDQB 1FP7A 2H9IA 4JB0A 4M4SA 1VJ1A 1PEYA 1TK3A 4KQ1A 1PLJA 2BFAA 4R8RA 5KNCD 4GX1A 1CEYA 2C94A 2MTBA 3ZY3A 1FEZA 4MUYA 1OWLA 4ETWA 4HVLA 5KZMB 2HIAA 2FJPA 2Y76A 1M6EX 2RHJA 3C3XA 2I87A 2W6ZA 4G8CA 4CNQA 4XFJA 4M9QA 3DVQX 3TJZA 2Q3BA 4GOKA 3UJHA 3D2CA 1CCWA 2R86A 2D1YA 2JZOA 1G7SA 1RC1A 2HTFA 4Q02A 5CIYA 5DI9A 2YV1A 3DMTC 2Z3WA 1SBCA 3IQFA 4DQXA 4EKDA 5I9NA 5FB3A 2VPZA 1N5JA 2C07A 1B0PA 1X3LA 3KKQA 3MLEA 3ZHOA 3WGVA 2VBIA 1CJUC 2YUIA 4M0KA 4DG8A 3RVNA 2AI1A 2D74A 4MEBA 2HH9A 2PUDA 2E49A 3ZWMA 2MYTA 4P1ZA 3S1SA 2WMDA 1NZFA 2B20A 2FFJA 3FSJX 1VE9A 3VH2A 5F7ZA 2Z5LA 3UC5A 1BD4A 1YZ3A 2C0QA 1VB3A 2ZRQA 3IMFA 4ARVA 4DVJA 4HDSB 4OLJA 4EW3A 5TQVA 4EG8A 4DJTA 1LV8A 3OCJA 4HWSA 1E0JA 1MMFB 4E1AA 4V0LA 4JQCA 2ZUDA 3EGDA 3SEZA 4CLHA 2OL4A 3IPLA 3CQ9A 4PO8A 1YVDA 1SC9A 3NBFA 1XTZA 3E5HA 3TUZC 3OZIA 2C82A 3EVTA 1TZKA 4JJEA 1ZRNA 3JD3A 4HGNA 5IZCC 2ILVA 1NUTA 2G70A 4AP9A 1U31A 4ZVUA 5I9SA 1ULTA 1WVGA 2JFPA 3C4QA 3MQ2A 1NBME 1OIVA 3IR7A 3DCJA 4JDPA 3HUFA 1AS0A 3G0GA 3U26A 4MXDA 4MA0A 1NLZA 5LMCA 3QG1A 4Y30A 5BN3B 1XVUA 3DM5A 2VRNA 3NKLA 4YDHB 4A6DA 4G25A 4JJGA 5CAEB 4EB0A 2KBEA 3IDFA 4CM7A 1YQEA 1HXHA 2AMLA 1SXGA 4TS1A 4A1FA 4YMGA 3A04A 1F06A 2WKQA 2Q3EA 3VM6A 2IH5A 1E3WA 2FW8A 4MQUA 1GA1A 3GZJA 1WXFA 1DQNA 1XZJA 2O2XA 1L5SA 2A4MA 3T5BA 1DCTA 2OSBA 4YP7A 3G2OA 1B8OA 2I8CA 1OX6A 2HCBA 2PGOA 1RXEA 2OQVA 2XCOA 4UEKA 2N3ZA 3DEJA 2B2CA 3EXEB 4MHOA 2CUNA 4BNTA 5E2AA 2J48A 2QNBA 4DV7B 1SCKA 2VT3A 4V24A 3AVYA 2QUBA 4X8HA 2D2VA 3Q2IA 1HLDA 3G2IA 2GLXA 2GYWA 4RA6B 5CLLA 3ORQA 1UMBA 1U9JA 2G6BA 4NV0A 4EG6A 2I78A 1ISMA 4DLWA 4U5QA 1MW9X 2PAAA 2YHIA 4YACA 5IAKA 3GJ4A 3X1WA 4DC9A 1HT3A 4BEWA 4IXWA 5B3LA 2R8PA 3QHAA 3ACBA 5I9TA 9ABPA 2I6XA 5L6MB 5JI2E 2JIMA 1IZ9A 5GGXA 1UIRA 4OP3A 3JYPA 2XRZA 5EIWA 3Q11A 5I48A 1XMOB 1JKFA 5JJLA 3K4PA 4IJ6A 4ALMA 3SR0A 2EJTA 4K26A 3CX3A 3S70A 2WTNA 3FVRA 3V4ZA 3Q72A 5K1ZA 2B69A 2YQZA 3TQOA 1QO7A 4CI0B 1QQTA 4D56A 1MBZA 3QVUA 3GAMA 1JXMA 3ED1A 3O2QB 1SIOA 4F3RA 1U3GA 3OZXA 1Z33A 3U31A 2EIXA 3HI4A 1NT2A 1U0JA 2JCXA 3DKRA 3JAWB 3LDFA 4XKJA 2JIQA 5DJ5A 1SZPA 1O96A 1JXAA 4HX9A 5SICE 4BQRA 1JQAA 3E7PA 2GD0A 3R20A 1EFUA 1ZNYA 1QP0A 2D5CA 2FNAA 3HYRA 3V42A 4DIKA 5IBPA 4N49A 3K6RA 4FILA 4QFBA 5DGXA 1DNPA 4X64B 4MKXA 4AZVA 3C43A 3O8DA 2JGKA 3MCVA 4PLZA 2AOUA 5AW3A 3DZGA 1H4VB 5TQ0B 3H2JA 1N5KA 1NJ8A 4PAOA 3THSA 3F4LA 4CMEC 3PC6A 4GE0A 1Z73A 4DG9A 1QIGA 3H65A 1JBEA 4FZJA 2L17A 2PUBA 2AYXA 5C46F 4UDOA 4OI0A 3ASZA 2YOGA 5FOSA 1G8GA 1NWCA 1U90A 5EL0A 3OLZA 2GZDA 2QMYA 5B4TA 1JSRA 2JAUA 2GCPA 3D81A 3IAHA 4LPSA 4TKMA 5K2OA 3TCXB 3VR4A 2BRUC 2AEFA 1Y9JA 2Y77A 3BWYA 5DPMA 4GNRA 3KVYA 3T5TA 3ZW7A 3F7MA 4IH1A 2PFGA 5IXYA 5GONB 3OQBA 3D1LA 4K6GA 4EOGA 4YJ2A 1U1IA 2H29A 4L08A 2YHUA 4EF4A 3ESZA 4G0OA 5C53B 1BROA 1BFKA 2HK6A 1H2BA 4UXHA 1UBGA 2PXXA 2DFPA 3IUNA 2LKDA 5C51B 3FM9A 1C5KA 4GF5A 1TLTA 3H86A 5KKAA 2EKLA 2JGEA 2BI4A 3V6MA 1Z12A 2VH1A 5AESA 1EJ0A 2VCEA 4FPXA 2R7NA 1FNMA 2OP1A 3H2SA 4CM9D 4CM9A 3KPWA 4OYYA 5JMOA 1EA5A 2QUKA 1KERA 2YOFA 2QPOA 3DUFB 2HMUA 1BMTA 2FFQA 1DAFA 3O75A 1XO1A 4S1VA 4UVHA 5BNZA 3L4EA 4IG9A 1ARZA 1EFAA 2I3ZA 3EARA 3ML1A 3N5KA 4YONB 4BP3A 3GIDA 3RBAA 1N78A 4XXHA 5BN4A 2H00A 4IIXA 4Q4CA 4RVHA 2RI1A 2WUVA 5BSHA 3L04A 3JSAA 3BJRA 4MGYR 4QA9A 5ANRB 4TLEA 4D57A 2LR0A 1IN5A 1AS2A 3IA7A 4G0YA 3WNQA 4ID3A 4KO8A 4LZAA 2PLNA 4GS5A 3CB2A 1RPJA 2VTEA 1O9BA 1XLTC 2W0MA 4HGOA 1GLGA 4X85A 4RKEA 5LU8A 4AN0A 3DMTA 1H8ED 4A23A 1DBQA 4KOAA 2F3UA 1WUTA 1ZM2A 2EX0A 5BQFA 4NOLA 1MVLA 3U4HA 1OZFA 3QIAA 2HU5A 1JVSA 1CQWA 1FMTA 3OHSX 1QTIA 2X76A 4LJAA 4BTVA 1XWWA 3NIDB 1KH1A 2Z3ZA 3CB4A 3C74A 4GICA 2AXNA 2W11A 5HKKA 5HKKD 5A3VA 2GVNA 1OBOA 3D8HA 3BHMA 1N4AA 5LQCA 2CKDA 2GX6A 4C7OA 4MUIA 3UMGA 3GRZA 3A8TA 1MUUA 4UZSA 4YFVA 3E2MA 3ORRA 2JA2A 3K20A 5CH3A 3MS4A 4BQEA 1LJ8A 2OB1A 3ID6C 3RNOA 4HDKB 2VJNA 2JIZA 2JIZD 3PC2A 5TQ2B 1TQHA 3ZGLA 1M7HA 1KHTA 3DEYX 1LS6A 1SRQA 2OVFA 5BURA 3SXPA 2DQKA 3VYTB 3IH5A 1EVKA 4K7JA 5CLGA 3KR0A 3H8SA 3MTJA 4ZARA 5H3HA 3I6BA 3ZEAA 1JR6A 1NXSA 2GDZA 2I80A 2RFLA 4OYRA 4XDHA 3CN7A 1M3SA 4FIZA 4UEQA 2VJOA 2VQ6A 3CPSA 1MO2A 3HZRA 4G0NA 4BO2A 4YCJA 2HEGA 1YTUA 4G0ZA 1CZHA 1ACLA 3UOAB 4K2AA 4R0VA 3CW9A 2Q5JA 4F9FA 5AWFC 3BTVA 3TINA 2BKUA 3OTOB 4AZ3A 2E1PA 2BH9A 1V4VA 2FQWA 4D3XA 3TECE 4IJQA 3IXMA 1N7GA 4B6GA 1P1IA 1XK7A 1WD7A 4IFBA 5L4LA 3G9ZA 1E7QA 1K1EA 1I01A 3I4LA 3LVQE 4G5SA 1Y5IA 3W8NA 6YASA 3P2EA 1U80A 4M36A 5BN5B 4KB5A 3VBEA 2IUYA 1CDZA 4EG7A 4MQFA 1GT6A 2VUHB 1W94A 4MR7A 5TGZA 1XTQA 4FX2A 3EPRA 3EPJA 3EIOA 1GN9A 3HZHA 4IUYA 2VDMB 4ZALA 1NNI1 3UAGA 3RVSA 4BGVA 2GK7A 2J3KA 3D7KA 1DRUA 3BSWA 4QTYA 2IHZA 1PN3A 4WKCA 3ZXUB 4NZMA 1XRNA 3E03A 2BTEA 1ND5A 2EYUA 1G0NA 4YP9A 2GZHA 3R7AA 1XDZA 1XTIA 1EQAA 3PX3A 1FUKA 4MWSA 4YUYA 5KX5A 3K0BA 1NBIA 2FZEA 1XDDA 3UGQA 4UHDA 2G1UA 2H1OA 1D2NA 3GLGB 2A9VA 4OXXA 2XAAA 3O8BA 3IODA 2QLFA 2DFVA 4KXLA 1V26A 1XKXA 2MSDB 4MGKR 3GVHA 3I2IA 3ZHUA 1P9RA 2VDPB 4DZZA 4LS3A 5F2OA 1EUCA 1ZSYA 4IM7A 5HE8A 3P97A 2ICAA 3B48A 3OETA 3SR3A 4YAIA 4U2GA 4RTJA 4E46A 2ERXA 2IOFK 4CEJB 1P77A 1JHZA 3NVDA 3OZVA 3PRHA 2IEBA 4BCDA 4IHJF 4Q4JA 3VHRA 4UNQA 2F43A 2JATA 3PU6A 5DGTA 3ABRB 3PE4A 4ZVPA 3MBOA 2C95A 4DJ5X 5ALXA 2O7RA 4F46A 4AU1A 2EEZA 1Z6AA 3KEGA 1QORA 2NLOA 1G59A 2F2TA 4GBMA 1MC8A 2X8BA 4DJJA 2VHCA 3WK7A 1RM5A 3SQWA 1DXQA 3AP1A 3WY9A 3BFPA 2LIVA 3E5MA 2QXUA 3OCCA 3KQUA 1X7XA 3EZXA 1NF9A 2WWTA 3L8YA 4BRZA 4ND5A 3I4CA 1FY2A 1ZI6A 1TZMA 1I2ZA 2IEGA 3BK7A 1V9LA 2VK8A 4D0NA 4C0JA 1Y98A 3KAQA 1CUHA 3NTLA 5A3SA 5B58T 4CGYA 2BFBB 1TD1A 2BRUA 2Z8XA 1ODIA 4WT7A 4GYYA 2ZAGA 4E5DA 1MP0A 4KV7A 2OY0A 2Z5FA 1XK6A 1CD5A 2RKWA 1D2CA 2ZWMA 1QDEA 4IH4A 1Z74A 1L7AA 1Y63A 2GBGA 3GO4A 4MVJE 3G0DA 1Y3IA 4UM7A 3F6CA 2HBZA 4QYTA 5B1HA 4D2IA 3LT0A 1WW3A 5DK6A 3FNRA 2Y1KA 4RD4A 1IHXA 3D43A 3F90A 5K20A 4M1MA 2QTTA 4NYIR 4Q39A 4DBVO 2IY8A 2GQ0A 2PEZA 2P6NA 3P27A 5KNBA 5HK8A 3SHWA 1Z6XA 4LTDA 5AOBA 5TV2A 3ZV5A 5JNSA 3LL7A 4ZAZA 4B6PA 1LY1A 4Z0NA 3R9WA 1W5FA 3ICCA 4EATA 2XW6A 2WQ7A 5BW8A 3HVKA 3MRSA 4ZAWA 4EBBA 1JWLA 1R0BA 1QP4A 1HE1C 2J1LA 2NUTA 3TLZA 2JEYA 4GD3Q 3ISTA 1QK5A 3LCVB 5CJPA 5EKDA 4OJYA 3GRAA 1OVGA 3BBLA 3M6MD 4KYVA 2AYYA 2R1TB 2Y1DA 3CT4A 2R6DA 4GP6A 2VC2B 4JJAA 1N75A 3ZD7A 1CF4A 4OPMA 5KQRA 3B1FA 4K05A 5EYPB 3FPGA 3GB9A 4N1AA 3H6GA 2BKXA 1P7CA 4IIGA 3EFEA 1ZJYA 1B76A 2I2FA 4EUFA 5K6TA 4P3PA 2XNCA 4R9NA 1E1CB 1LSSA 1XF9A 1XLTA 1RJ9A 2PQ2A 4L0MA 1NTRA 4KX3A 4V1CA 3N0VA 2A5LA 3U39A 4TX1A 3AVQA 3BJMA 3EGXA 3ETCA 2DQZA 2V9PA 1D6MA 1Q7BA 4HXGA 3FHJA 1U2TA 3S40A 4BLQA 1OJLA 1S3FA 3L0PA 1M73E 4JP2A 3BQNB 5JFGA 2GD2A 2QMUA 2R8ZA 2BZ1A 3PHLA 1TKAA 3CLVA 4GVXA 5IF3A 2HMSA 1T8YA 1RXCA 2A7XA 2YASA 2WQ6A 2QN1A 5DB4A 5B1IA 3ZTWA 3RYIA 2NPIA 1PI3A 3PQ3A 3ZHRA 4UPEA 1PGOA 3P4YA 3AUAA 2YV4A 1DBIA 3JALB 2A84A 4HWOA 3PDIB 1MRNA 1LF5A 2X2FA 4UVDA 1HBJA 3ZDDA 1CP2A 4A3SA 3SG0A 3W5VA 3BMNA 3FUTA 5HEKA 5KBYA 1DAMA 3ZJ4A 3DO5A 1OZHA 2OGSA 1NQOA 4RC9A 1EWKA 1QG4A 3L0ZA 4P35A 4ABTA 1R0KA 3NNDA 2CJXA 2CNBA 5KJ1A 4HBGA 2PD4A 1E1DA 3USZA 5ARDA 4BVJA 4G0MA 4L0DA 1QHHA 2WA1A 3LHSA 3PWTA 4ARSA 3DP7A 1OMOA 5D86A 4Q3DA 5JD6A 4INPA 2OZKA 4KTTE 1PWEA 1LBHA 2GBLC 2ASVA 3KUKA 3B9PA 3V4SA 3WHIA 5F5LA 4RH0A 4ZQEA 3AIKA 3P9XA 1I32A 4OX9Y 4B34A 3JQAA 1K8YB 5CURA 4EABA 5JY1A 1N36B 4F2WA 1FXSA 4IDDA 3F47A 3NHLA 1JFFA 1Z2EA 3U4QB 3BC1A 2O50A 3N0TA 4BVFA 3GNSA 5IF9A 4M99A 1YDWA 2QP9X 1LRJA 1UAYA 1D5WA 1QB7A 3R1IA 1P4SA 2L42A 2ZRDA 5HRCA 4WOJA 4ND1A 1CEQA 2QVZX 3HGMA 3Q5GA 1Z5VA 2O6LA 3L7LA 3OUUA 3EWNA 2IYUA 2OT3B 3M6WA 3VKFA 4DSZA 4J4HA 2QEQA 4GZMA 4J0GA 3TAXA 4AN4A 1TF7A 1WPRA 4P9NA 5JCOC 3PNLA 2AZ4A 4AO8A 3RC9A 4NYMQ 4PRLA 3I9MA 4O4HF 4DCNA 1K66A 3DV0A 3IAEA 2I6FA 3P0JA 2YICA 1YCGA 4LJ9A 3E7FA 2OA0A 4CLXA 2XTMA 3K1JA 4EYSA 1DJPA 3QWAA 3D5TA 1ZH0A 1GEEA 2AVNA 3AVTA 1R3UA 1U28C 1YZYA 2C31A 4QQRA 5YASA 3STTA 4A8TA 3INTA 4IDGA 4LJ4A 4RDHA 4TOIA 1ZH2A 4F4JA 2OLJA 4C4ZA 1WZUA 3KOZA 4LHZA 3ROMA 1QIJA 4PX3A 5H0IA 2XQKA 4QL3A 1HFEL 1WIWA 1DZIA 2B30A 2CN1A 3G7NA 1E1YA 3QTTA 1OUMA 3GJSA 3H9UA 1JAYA 1TC1A 4HWTA 2H85A 3EIUA 3Q7EA 1TM7E 2JF0A 4W99A 3H9CA 2Q3MA 3HYNA 4DLXA 2QBYB 4GUDA 2Q2OA 1JU4A 4JI2B 2BHSA 3ZU4A 3IL2A 4Z3OA 1MNAA 4LBYA 2VZ8A 4OA8A 4WZBA 1F8XA 1T6YA 5I9BA 3G9TA 3VX3A 1FW8A 2IYRA 3Q4GA 2R25B 3G49A 2J9YB 1D2AA 1G8PA 1GGNA 2Q0SA 3GHYA 4OJNA 3X1MA 2NU8A 5GM1A 3L7DA 2OUKA 4Z9AA 3EH1A 5H8WA 4R3UC 2GXAA 2OXCA 1KZ6A 2A1UB 4EGAA 1M2NA 1I3CA 3CONA 2E4ZA 2CMFA 2RHHA 5ALEA 3IPYA 2H1CA 1LFAA 4LXTA 1YC2A 3HA5A 4QQFA 5F5NA 3KQKA 1ZNQO 3BCSA 4D82A 1XRLA 3H0KA 1EWRA 2RGCA 4J49A 4TLDA 4UMVA 4ZQHA 2QMQA 1U4OA 3C48A 3DD1A 3KLOA 2BGGA 5HX7A 3DAGA 1QTNA 2J07A 2VAPA 4LVOA 2XWPA 3CF0A 2GN0A 4RJJA 2JH8A 3RS7A 3WBKA 4B43A 5HJEA 3ANXA 5E2IA 2QRVA 1AMUA 2IOFA 3PXXA 5M7EA 1HMPA 4B33A 3KETA 1YIDA 4EG0A 2GLUA 1E63A 1UBJS 3LVRE 3HM2A 4Q1BA 3HDTA 4MV1A 4Y1GA 3RFXA 3U40A 3W9BA 5DCUA 4P58A 2BVNA 4YV7A 2F6RA 2IYPA 1L6IA 2X4IA 5KDLA 5B3KA 2XQGA 3PYMA 4WFKA 5CFOA 3LUFA 4WY5A 1QC5B 5G3YA 4J16A 5FWYB 1R0ZA 4ZJUA 5CA0B 3VDRA 2RH5A 4AJJA 4HH0A 5AI9A 4RHCA 4P80A 4RIFA 1K9SA 1KXZA 1QH0A 3AR2A 5LQJA 1HR0B 1KNXA 4F3NA 3MTDA 1JJVA 1C4OA 3OFSA 4HS4A 4JVNA 3V97A 1P5FA 5B1SA 5JO0A 1Y6GA 2JJQA 1H2ZA 1WY5A 2UUAB 4MYUA 2VJKA 5A5EA 2X6TA 1CETA 4GKAA 1RFLA 1KBZA 3AKDA 1KOFA 3BVPA 4TQ9A 4EVRA 3GFOA 1I80A 2QG4A 4HPWA 3RVRA 1H9CA 4RTPA 4KQWA 1BDJA 2OG1A 1L9KA 1RLIA 2WU8A 3OKCA 2WHXA 4R5MA 1JMKC 1MEEA 2IX9A 2ECKA 3BRWD 3FJOA 2GN8A 2BGNA 3N87A 4LXUA 4UBOA 2YHSA 4FZVA 3V2HA 5LDHA 2FLWA 4I50A 3SOZA 4OHMA 4B3CA 2G8LA 1DC8A 2J9ZB 3AGPA 1DEOA 3A6FA 4YJ3F 2IEAA 5M3BA 4DV0B 2PM8A 3FKQA 3MCUA 2H06A 3PXBA 3QFFA 2WAOA 3QSGA 4NYMR 3SSOA 4MI1A 1H4QA 3G82C 1P7PA 3G89A 2JJ2D 4ZRMA 1JAXA 2V3WA 3HRIA 3OJEA 3STHA 5A9RA 1C14A 2BFEA 3DDZX 1SUIA 4IHQA 3HBAA 4RPKA 5BSTA 3U0BA 3VO2A 1X7WA 2WSYB 4G67A 3K0AA 1UMDA 3OESA 4R41A 4WASA 5IDXA 1U3WA 2PLWA 5ELXA 4KWHA 4Q9LA 2WV9A 4B4UA 4UUMA 4M1EA 3GUCA 1NN1A 1XN4A 2ZCVA 1UKEA 5CLIA 1LSOA 1MW8X 3I2YX 1ADGA 3A37A 2ACKA 1GQ2A 3JPYA 4Q18A 3UK6A 3K1AB 1OWOA 1LI5A 4GI3A 5IW8A 3L43A 2YN2A 5LMNB 5JPDA 5T64A 4CI9A 4DV1B 1TRKA 1W48A 1GZ7A 1N1MA 2FEAA 2QUIA 1EFKA 1H3NA 1X7ZA 2Z09A 4X20B 4EJ0A 1ORWA 3WFIA 3IOBA 1SUCA 3TIGA 4TL9A 2I66A 3CYFA 5DF1A 3Q10A 5JZOA 1ID8A 1VRVA 1MB4A 3CRZA 3N2EA 1S02A 1H6BA 1XA4A 3E58A 2ZUUA 1OBCA 5BSWA 1FYEA 2CCKA 4K1LA 2YIVX 4EUNA 2GBLA 1SIWA 3QF4B 1NUHA 3WA7A 3ZD8A 2AYZA 1QNFA 4DLKA 1M67A 5AQEA 2VT2A 4AG3A 5K0ZA 1SVLA 2BUBA 1EAMA 3NASA 2SBTA 3IV7A 3OZCA 1J0EA 5THXA 1IC6A 3KYBA 3LC1O 4L0QA 2P67A 4BNNA 1U0BB 2CBXA 1CY2A 3ZQ6A 4Z7QB 1AURA 2R97A 3GRPA 3RSGA 2F67A 3M1YA 4X0EA 4A8PA 4E11A 3OM0A 4ND8B 5HCNA 5AHXA 3F8WA 5CNJA 2II6A 1E3DA 3JV7A 3OX4A 5I7EA 4W5JA 2VNSA 5HR5A 1X2BA 2QJFA 2ZYDA 3LY5A 1X13A 1RAEA 4KFSA 3BTUA 3RWOA 1K2WA 1XZPA 3U4AA 1JI3A 1GNTA 4U9IS 5HTOA 4RVFA 4HLCA 1CQJB 5LZ2A 1CZUA 3TNYA 4Q1VA 3PC8C 1QOQB 3WDKA 2I7DA 2X41A 1NRIA 1HTBA 1OFTA 2GPSA 2OORA 2Y4OA 1Q1AA 5E9JA 5JCOA 4EL0A 3QBDA 4GM4A 2HTEA 1HL3A 1X8JA 2HO4A 3W6ZA 1NBMA 3MC1A 3E9DA 1QVAA 1T8WA 4QOIA 3W4KA 2ID8A 4LWQA 5ALTA 5FYDA 4D9BA 3N2NA 3ILSA 4J9VA 4YXWA 2BONA 2C2BA 1VOTA 2FN9A 2GI4A 4QBFA 3W1EA 2WWIA 3E1SA 2V7QD 1NL3A 3LOPA 3ORFA 4PFKA 4TLBA 1P0FA 2REOA 2DFKB 3FDIA 1UP7A 5AW2A 1Z45A 3VR6A 3VR6D 1XHLA 10MHA 2RGAA 2RONA 1P2FA 1XRPA 2BELA 3D0OA 3DA8A 4MV3A 4NV1A 4QVKA 1F4VA 2ZROA 3RRBA 1Y42X 3M9XA 3RBVA 4U4AA 2V8OA 5E3IA 2GTHA 1GVNB 1XXHA 1AHIA 1USVA 3C5HA 2XGGA 1FFAA 4D74A 1XQ6A 1QLHA 1U5BA 2H92A 4NPAA 2I2BA 1TAHA 3T8YA 5KU1A 2YXPX 3IGFA 4FS3A 4TYWA 5JXJA 2B1QA 2OBYA 2WUEA 3KL2A 2JHCA 2AFRA 3NWJA 4OATA 4F5EA 2OG2A 4HL6A 3T1TA 2XCLA 2CUKA 3BWCA 4JK3A 3A0RB 4U6QA 5IASA 1QO0A 2ZM5A 1TTPB 3HDVA 5FXMA 4N0DA 4Q0MA 4BMDA 4WLNA 3ZTYA 1TGVA 1O97C 2XMQA 3BSFA 3CY6A 3EEQA 4FCCA 4HZUA 2Z6UA 2HYDA 2Q3FA 1EH5A 2JBAB 1BYUA 4MQ6A 5EQJB 5TT1A 3USCS 1SCQA 4AB1A 3Q6NA 3KOMA 3S8MA 3NOVA 3UV6A 3D4LA 3LA8A 3JATA 1WB6A 3REOA 4LYAA 3IKTA 1BEUB 2WJ3A 1G4UR 4HHEA 4MP8A 2NXWA 1N0UA 5DMXA 2VTBA 2ZB4A 2OAGA 2QW1A 2CVZA 4BKRA 4L5AA 2PUEA 1VL1A 2GF0A 3PI6A 1PR6A 4J0JA 1AUOA 4MX8A 3RAPR 2FMUA 2HY7A 4JODA 3T0GA 2H31A 4J0EA 3UWSA 3V7UA 3L77A 3ND8A 1VECA 3CSUA 3UJBA 5TMEA 4DILA 4XEUA 5DSXA 2Q5CA 1DCFA 3GRUA 4JEMA 3SX0A 5CA1B 1SCAA 1TGYA 2GARA 1ZIYA 421PA 2B98A 3ONWA