4QG7A

S.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
197
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 82
structure length 197
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qg7A00
4ZDIA 3EW9A 2QZ4A 2EW1A 1DE0A 4RD0A 3AVQA 3TR5A 2WWGA 3OEEA 3C15C 4IFBA 1TQ2A 4IDHA 4O2LA 4PHTA 1I4DD 1MO5A 221PA 2YJTD 4HB3A 1E2HA 1S1CA 3PUVA 4P33A 1OH6A 4A6PA 3QVVA 3V9PA 2FSFA 2H18A 4Q18A 5DISB 3UMFA 3GLFA 4ZO4A 2WMNB 1OB2A 5DYIA 4CT4B 2GXAA 3GJ8A 4Q7JB 1Q1BA 4LYAA 2G1KA 5TV2A 2C2HA 2OILA 2W2VA 3EC1A 3PCRB 3RWMB 4JL8A 2HEIA 1AQUA 5DH9A 1XF9A 1GFIA 2CDNA 1A5TA 5EP2A 2VL7A 4Z1MA 5K8LA 1GNQA 5IK2D 4F7WA 3QXSA 2VRWA 5TMPA 2FWRA 5DYGA 2R6AA 3OFNA 4P32A 2VBCA 3EPJA 3ND8A 2D06A 3SHWA 3BE4A 4Z8YA 4HLUA 4V02A 1X6VA 3GEEA 1SKYE 2C9CA 2QP3A 3VKHA 1E4VA 3AEZA 3F5FA 1G7RA 2XITA 3AF3A 3K0FB 2JDIA 1MV5A 1QBKC 1ZM3A 2A3RA 3ZQ6A 4PC3A 2QGZA 3GLFB 1XCGB 3M1IA 4Q9KA 2G77B 1E6CA 4V0OA 2QNRA 3UANA 3GJ4A 4QNRA 2LWIA 1KO5A 2E87A 1RIFA 4ZDJA 1KI1A 1ZM4A 4Q03A 2YKGA 1OIVA 1JJ7A 4JSYA 2A78A 3GMTA 2NO0A 3BFVA 3DOEA 4Q1EA 4DLYA 2OBNA 4CEIB 4AKHA 2WPDA 1EWQA 4UNNA 2OESA 1ZIPA 3B1XA 2XNDD 1ZVQA 4LBVA 1S0UA 4B47A 2RGBA 3PEVA 4HLUC 4KI0A 1DAKA 3D3QA 1DTSA 2O0JA 4NL4H 1T3LA 2C77A 5J4YA 4BFVA 2QY9A 1IAQA 5L3VA 2GJAA 4MYTA 5DN6D 1NJFA 1RYFA 1Z06A 2QBYA 3SR0A 2R44A 3D31A 4EJSC 2HJVA 3VU9A 3AKDA 2WICA 1TQ6A 2BBOA 1NF3A 3SJAA 1XJ0A 4IVRA 2JLQA 3KJHA 2QT0A 4TMWA 2A5JA 4B44A 2ZRKA 1E9SA 3FKSD 3AF1A 3OEED 3FPAA 4V0NA 3V4RA 5K8UA 4A2WA 4GMDA 1G41A 4ILEA 1MABB 1E9BA 1G3RA 3ZD7A 2QQ0A 3BERA 1JR3D 2KI5A 3A8TA 3SQXA 3V4FA 2W6JD 3NHBA 1BMFA 4MRVA 3LA6A 1DO2A 1RPZA 4FCTA 4P4TA 1GM5A 1B0UA 3CH5A 3I72A 4KSBA 1KSHA 1E1QD 1Y3AA 1XZQA 5J4LA 3THWB 3ZVNA 2DY1A 1PZNA 1SVOA 2IYZA 3EZ7A 1VG1A 4US0R 5L3SB 5M04A 3RVBA 2ZUCA 1WMSA 3L82B 1YR9A 5CK5A 3A37A 3SBEA 3VHXA 4B32A 1YRAA 2ZE5A 4Z1MD 3DDCA 1K5DA 4I4LA 4G5RA 4JKIA 4MUAA 1E79A 4U5XA 2H5EA 3W9YA 1L4YA 4OQLA 1NIPA 3LWNA 2PZEA 3EC2A 1ZUHA 2BEJA 2ZETA 4P4UA 1YU9A 1IHUA 2FV8A 3I61A 1JPJA 4C0SA 2VH5R 4MKFA 1ESMA 2X1VA 4ON9A 4TMXA 2QSZA 4BRUA 1CJTC 5GADl 5B30A 1OXUA 2PLRA 2IK8A 2G1JA 1HY3A 4LYHA 3MFYA 4WIAA 4R2HA 2CVFA 1KI3A 2PL3A 2JJ1A 4R71A 4AK9A 1JXMA 2JAQA 4V03A 1IBRA 2VHCA 1W2HA 3NH6A 1CKEA 6Q21A 1LS1A 1E9DA 3KKPA 2JEOA 5HTKA 4ZI3A 3DKPA 3OEHA 3NVAA 2BC9A 3GJ3A 1E69A 4Q66C 1LNZA 3TE6A 1ZNZA 1ZNXA 4S35A 1Q0UA 5FPKA 5F9HA 3LQQA 3A1SA 4U7DA 1Y63A 1NP6A 2QORA 1WP9A 1XD2A 5JJIA 2ZRPA 1KJWA 4LJ5A 4BGDA 5JS8A 2YOGA 2FMXA 4JLKA 3IPYA 4BZXA 2FFBA 4DSTA 1QG4A 4RVCA 2ZRHA 4H1VA 5HZHA 2R62A 1G9XA 4O2RA 4RFSB 3CR8A 1ZIOA 3KX2A 3PUWA 2CEAA 2PX0A 3P32A 2I4IA 3FFAA 3GLIA 2BCJQ 4NYMR 1KSGA 1OXVA 1GRNA 2IUSA 2ZR9A 4NYIQ 4P31A 2ZROA 2O8CB 5LDDC 4QL3A 4CEHA 1JALA 3ZVLA 4K46A 1Z5ZA 1N6OA 4MYHA 2KBFA 2HF9A 1KDTA 3FTQA 4Q4AB 5JJKA 3IIMA 2QROA 2Q9CA 4X8MA 1W5TA 1RJ9A 2GNOA 3BAFA 3CF2A 4WZAE 1RE0A 3U4QB 4PO9A 1UFQA 2Q9BA 3CX6A 1J8YF 3CZQA 1KK0A 2YC4C 2IYUA 4QGFA 1ZM9A 4M9XA 2WMOB 1E2LA 4PZLA 2PZFA 1A4RA 1Q1ZA 3W6OA 1KO8A 1JJVA 1N3BA 2QGNA 1S2MA 2QAJA 3P1JA 4TQUS 3RANA 4GMXA 1UDWA 1DG1G 2HYDA 1DAGA 2P5SA 4KODA 3BWDD 3FB4A 2Q3HA 4OK5A 4C2TA 4UNRA 2JJ2A 1KI6A 2CL7X 5LPNA 4LK2A 1ZRHA 4GOJA 3GLGA 4FWIB 2G6BA 1XRJA 5EXXA 2PMKA 4S2EA 4XD7D 3FMFA 4HUTA 3FKQA 1CJVC 4Q9LA 4EFNA 1GIAA 1JEEA 4JVMA 1XTKA 1II8B 4AKIA 4PHHA 5JZVA 1ELOA 5HE9A 1IN7A 1QRAA 4HUQB 5FUWA 3TQCA 1TEVA 4K81B 4JLJA 1L4UA 4CYMA 3KQLA 3UG7A 2WHXA 1VDZA 4JKYA 4L9SA 1YJ5A 1JB1A 3GFPA 4LOAA 4V0ME 2H1LA 4D80A 3T15A 2IYLD 2Z0MA 3PEWA 3AVOA 2FFHA 4QJ5A 2BMJA 4NH0A 2QMHA 4QBGB 1PLLA 1AM4D 3NBYC 2ZAMA 1UAAA 1OFHA 4URZR 2GAAA 3LW7A 2V1UA 4QM6A 4GI7A 1OYWA 5EXTA 2FSGA 1T5LA 1NVXQ 2D3WA 2OV2A 1UM8A 2ZE7A 1ZNWA 1HURA 3CW2A 4YQFA 1SVIA 2OBMA 1QHYA 2RGNC 3U5ZB 2JJ1D 4B75A 1VPLA 2OE2A 1CTQA 1KYIA 3MUFA 1G3MA 5JHGB 2XTMA 1IN4A 4KV9A 1OFUX 1G17A 2IL1A 3CBQA 1ONBA 1DO0A 4G5GA 2ZRNA 4A36A 2EVWX 5KSZA 1U0JA 4LRWA 4QHSA 2ZVQX 1E9FA 4NYJR 5CM9C 2RH5A 1J90A 3LW8A 4M9QA 1NBMD 4G5QA 2FPLA 1E2NA 2BMDA 3CLVA 2V54A 2DWPA 4YMWA 1X8LA 4XWOA 4OI0A 1KHTA 2C95A 2P5TB 5FI0B 4Q4HA 2AR7A 1W36C 1QHHA 2XZLA 4A82A 1KI8A 1F3OA 3ZZ0A 1D9XA 2EWVA 3B78A 3UWKA 2ZRMA 2ZI7A 1U0LA 2DFLA 4NCIA 5TXGA 3BIFA 4KO8A 4B6FA 3DL0A 1Z2CA 2DFNA 4U02A 1G8YA 1I2DA 3KXIA 4EPRA 2NO9A 2Z6VA 3Q5EA 1Q1EA 1CP2A 4L16A 1E9RA 3EXAA 1EX7A 2DWQA 4NKRA 4QM7A 4BFXA 3EIEA 1UDXA 4PHFA 1X1RA 5KDLA 4DT1B 3T5GA 3NXSA 3QQ5A 4U00A 4HLDA 4WBSA 1PLJA 4OQNA 4YC7A 1U90A 5KNDA 1KMHB 4ESVA 1XPUA 1NLFA 3CPJB 3HPQA 3ZVRA 2ZRLA 1F2UA 3OAAA 5FPYA 2ZRIA 2RHMA 3W6NA 2GKSA 1MT0A 1RVDA 3AP2A 3G5UA 2FZLA 4ARZA 3AP1A 1Z29A 1KKMA 2ERYA 3WP0A 1NMZA 1P2UA 1IJEA 2CJWA 3C14C 4F93B 4V0LA 1W44A 3D8BA 1SHKA 4PAQA 1QHNA 1NIJA 2QUZA 3LXRA 4A0RA 2ONJA 1G6OA 3TUZC 1OXTA 5KDDA 2AKAB 2IC5A 2AWOA 5BWMA 3PUYA 2VP9A 3VNVA 5E7IA 4FMDF 1CR2A 1NLYA 1NVVR 4B33A 2C98A 3AF2A 3SJBA 4FW9A 5LD2C 5GVSA 2WM9B 1GWNA 3PXGA 4LWZA 4C0AC 2H57A 2R6GA 4HSEA 2Z4RA 1N6KA 4LHXA 1NMYA 1DELA 1VYUA 2FSHA 2GWHA 2AFIE 1M7GA 1Z63A 5DN6A 3EPHA 5FOUA 1ZC4A 4DKXA 1P2SA 3BD9A 3EZFA 3LDAA 5HKKA 3IPXA 3VR5A 1DAIA 1S9HA 2B21A 1NKSA 4EPTA 1BMFD 3BC1A 3AVTA 3VU9B 4NMMA 121PA 3HR7A 3LXXA 4NYIR 4DIDA 2IX3A 1GVNB 5D3QA 4M9SA 4A8JC 2CHVA 3TRFA 3DPUA 2O5VA 1F2TB 1T4GA 1MOZA 5L3RA 1KJYA 3F3YA 4E07A 5JWOA 1G8PA 4RD3A 2J0SA 4NHOA 4TMTA 3R9WA 3MGCA 5BN5A 1L7VC 1T6NA 3TGPA 1MR3F 3BS4A 1H8EA 1R8SA 1OH8A 4CVNA 1DBSA 5FTLA 1MRNA 1KDOA 2CK3D 3GEIA 3ADCA 3QEOA 5AJXA 3L8ZA 2W6ID 4YMUA 1SXJE 4GOXA 4KFRA 1MO6A 3DVLA 3QKSA 1IXRC 1VYVA 2YZ2A 4OHYA 1W4AA 1XB2A 3DM5A 4MGIR 5IDVA 3MJRA 3HR8A 4D6PA 1S3SA 4D26A 4JVNA 3SZRA 1YR8A 3EPLA 5D3MA 2V3CC 5E4FA 3I8XA 1KMQA 4Q01A 1FMLA 1GITA 2IEYA 3CRMA 4PC2A 5FTNA 4DDVA 1UADA 2GJ8A 2CCJA 2RGCA 3M6AA 5CYPA 5J40A 4YDHB 1E2EA 4XSHA 1EFRA 1AKYA 3AB3A 4OHXA 2ZM5A 5B2ZA 2ZR7A 2GCOB 3TAHA 2ODBA 4ASUD 4TWZA 1OB5A 3GPLA 1R0XA 5AWFC 4C3ZA 3ONWA 2ZVPX 5LB2A 3U3MA 2ORVA 4QKQA 3X1DA 4DJTA 2RGGA 4LUCA 2ZJYA 5EP4A 3RS4A 5JEEA 5B64A 3B7GA 3THYA 3BFXA 3TKLA 3U3JA 2F55A 1J70A 2NQ2C 4RY2A 2FGJA 1Z8FA 4MUBA 1E2KA 2H17A 2QN6A 2CLCX 2JIZD 2ZU6A 3KL4A 4MQBA 1RRFA 1T0JB 4QBHA 3WXMA 4EJSA 3HJNA 1AJEA 1IY0A 2C5LA 1OPXA 3VR4A 4PAOA 2CHQA 1OXXK 4XOIA 2GZDA 2W6IA 3PITA 4UQOA 1NN0A 1G64A 3EWAA 2RB4A 4B76A 3U7GA 4CDGA 3TVTA 5JWRA 3P26A 1XEWX 1P4SA 4GRAA 1CULC 4Z51A 4FN5A 4TSFA 4IXMA 4BLTA 4W5WA 3T1TA 4TYWA 3PEUA 1EWRA 2B7BA 4KCGA 2GF9A 1OKKA 2WSSD 3DKVA 4O0MA 5KSYA 3I62A 4TSFD 1GRQA 3REFA 3U2QA 2QE7A 1YZKA 4LYFA 3DHWC 3EIHA 3GLIB 5JCZA 4MYCA 2GEDA 1YR7A 4CEHB 4YLGA 4FI3C 4IVPA 4A2QA 4EJSB 4DLVA 2HXSA 4FMDB 3FDIA 2JLZA 1EFRD 2A5FA 4JBXA 4BZQA 2XTZA 3TMKA 4Q4AA 3WMFA 1TQDA 4RD4A 5J4KA 1EFHA 2DR3A 2GA8A 4HLCA 4BFZA 1G5RA 4MKHA 4TQ9A 2ZSDA 1KSJA 5AJVB 3U44A 1DADA 3RLFA 3SJZA 2WZQA 4Q1FA 3KB2A 2P67A 1JQJC 2EFDB 1V5WA 3K8YA 5FPTA 2OAQ1 1LS6A 1G3QA 2AK3A 2F9LA 4GP7A 1R0WA 2B7CA 4PPNA 1L2TA 1GL6A 3K0AA 2OFXA 1KGDA 4G3XA 1Z83A 1UBFA 3QENA 4IDPA 1FTSA 3I92A 4OHVA 4TMKA 1II0A 1GZSA 1EFCA 2QQEA 2ZRGA 4A6XA 4Z54A 5B57C 1KAOA 4DCSA 2XTNA 4B43A 5EZ5A 4C0HA 3EA0A 1KI6B 2ZJZA 2MSCB 5DHFA 5FR1A 1PVOA 3WYFA 4F91B 4D4LA 2PCLA 1BO6A 2QMOA 2XX3A 4NP6A 4KVAA 4UXJA 3CO5A 2QM7A 1XXHE 4M21A 4LSGA 5K8IA 3R9XA 1AS2A 5A4JA 3KKQA 3Q9LA 2F3TA 5H1YA 4DUGD 3ICEA 1XMVA 2AX4A 3PUXA 3BJIC 4LI0A 1M34E 4MA4A 4C4PA 3SQWA 4MGZR 2CCKA 4KBFA 3GLFE 1CRPA 3U7EB 2H16A 1VMAA 2BDTA 1N25A 3RS3A 1IN8A 4URXR 2GDJA 1WCV1 3I8SA 3A4LA 4LDJA 1NBME 2PEZA 3OIWA 1T0HB 2CBZA 5JLJA 1W36D 1QG2A 3RC8A 4C0QC 1W4RA 3T34A 4F4JA 1HT1E 5KDOA 1IM2A 3B1WA 3MG9A 3RRNA 4ZDWA 2G3YA 2KB0A 3Q85A 3PENA 1SULA 4RD1A 2IHYA 1NI3A 1XEFA 3KXKA 3AF0A 3NEYA 3NBFA 5BN4A 4D25A 1D9ZA 4JT2A 5FI1B 1BIFA 1D6JA 1UEJA 4JVLA 2ZU0C 5EJEA 2JA1A 1DAEA 5FL3A 4IFEA 1VYTA 4IOKA 1H8HD 2F1HA 2AL7A 2WWFA 1N6HA 1KJZA 3WYAA 3KB1A 3SEAA 2GTPA 3QKRA 2F7SA 5A5GA 1ESNA 2VP0A 1XPOA 1F48A 3ZIAD 1FW6A 3IEVA 4A15A 1JR3E 4C0BA 2EYUA 2JASA 3KKNA 4A0FA 2FDCA 1OT3A 2J7PD 2V6JA 1VECA 2VYFA 4E09A 2IUTA 5KHOC 1LTQA 2ZRBA 5L3QA 4FCVA 1Q20A 2BJWA 1Q57A 3FHOA 3KTAA 4DHEA 1CU1A 1D5CA 4WXRA 5CDFA 4AWXA 4M22A 1X3SA 2REOA 1P5ZB 3LX5A 4Q4HB 3U61B 1QHHB 4DCNA 1G3UA 3AP3A 4G0NA 4OKSA 4KU4A 1NSFA 4P0TA 3LFUA 4C7OB 3KQNA 2ZSBA 4TZ6A 4TL9A 3SOPA 1ZM2A 2UZIR 4HAUA 3NKVA 5JI3E 4HAYA 3QOFA 3U3KA 2QM8A 3MMPA 1ZUIA 4K8OA 1GRRA 4RZUA 1JXOA 3LVRE 5JI2E 4EFLA 1KO1A 1E2JA 2BKEA 4PPGA 1M8PA 3T1OA 3THXB 3KUCA 1YE8A 4KLZA 4WZ6A 2QTFA 1P75A 2C04A 5IK2A 3W3ZB 4N0DA 3FWYA 1SVLA 1ZJ6A 2Y8EA 4UJ3A 1S4QA 4OBEA 2J1LA 4HZUB 4IOJA 3CM0A 3RRMA 1SVKA 3L2OB 4F4CA 1SXJB 3R20A 4XH9B 3SE0A 1MO3A 2ZRDA 2NG1A 5FFMA 1T8TA 2F6RA 4BZPA 4LBZA 1Z22A 2CJWB 5LD2B 2HLDA 4URYR 4TLEA 1NVUQ 5EE0A 3C16C 3AH8A 1P73A 4DXAA 4DB2A 3B6EA 1ZD8A 3SS8A 5EE9A 2CLDX 1G7TA 1W0KD 3QE0A 3RAPR 1E99A 2DWOA 4XSGA 1TL7C 1ZCAA 2ZSAA 4TQAA 2BMEA 2V9PA 5DNYB 1G291 1XBTA 1KO4A 2BOVA 3BB3A 3MCAA 1FNMA 4HAVA 4KBGA 2J0UB 4GOKA 3IHLA 2FH5B 1SXJA 3QSYA 4ZCIA 2FJUA 4BEJA 1SKQA 5IRCD 1TUEA 2BWJA 3LNCA 3CZPA 2YWHA 1VHTA 4AYTA 3SYLA 1IOZA 1Z0FA 1XWIA 1FPMA 5JBQA 5FOVA 4TL6A 3X1XA 3U7FB 1II9A 2ZR0A 2ZITA 1IY1A 3LH5A 4M1KA 2F43A 4JT4A 3RS5A 3VFDA 3M4YA 4IRUB 2GBLA 5HZKA 2UZ3A 4LHYA 4B3XA 1IQPA 4HDCA 2ZUBA 3R7WB 2BVNA 2WAYA 3ZZTA 4LJ4A 4AC9A 2P6RA 2PT5A 2EU8A 3IO3A 2AWNA 4XVRA 4QRHA 1SZPA 4JJKA 1PV4A 4DC9A 2A5GA 2UVQA 1R0YA 3CRQA 3RRYA 2PZGA 1XJQA 1TQ4A 1X8KA 1SKYB 1XZPA 2QU8A 4DSUA 3FMIA 4TLCA 5CIQA 4XWKA 4D81A 4W9MC 3QPWA 1XP8A 4M9ZA 4Q9IA 1OLOA 2NO7A 1M7BA 1HQCA 2IYWA 1NVVQ 2DB3A 3P27A 5JSZB 2DFKB 4YDSA 2QP4A 3GJ7A 2HDNB 3SYNA 3AM1A 4MDFA 2B92A 1JAHA 2GCOA 1TPZA 2NTYC 4PTLA 3B13B 1G1MA 1K6MA 1NG1A 1R2QA 3TSOA 5DSZA 2O8DA 1YRBA 3W8NA 2KE5A 3QXCA 2OSBA 1CXZA 3FVQA 3CKLA 4FMCF 2HJGA 3UMSA 4R98A 4DLZA 2VHTA 4NDZA 4Q9HA 2HLDD 2DCUA 1W0JA 3CB4A 2RGXA 4OL0A 1SVSA 1US8B 2J87A 1KNQA 3DMNA 1OHHD 5JMTA 3NDPA 3PFIA 5JRJA 1SQ5A 2GCPA 1CRQA 5KOYA 2JLYA 4FCWA 4D2IA 1Z6AA 3N70A 1E1QA 2XAUA 4M1YA 4M1SA 2RGEA 5JCPA 3B85A 4L4UA 2IYRA 3VQTA 2AK2A 3JZMA 1TX4B 2WVJA 1R5NA 1VTKA 4RFVA 4OHZA 621PA 1LF0A 2O8DB 1ODFA 5J4HA 4A4DA 4HAXA 2C99A 3GLHA 4TMVA 2J59A 4B3CA 1XXHB 4B3GA 3ADDA 1E2FA 1H8ED 4R2IA 3QBVA 5CM8B 4ABYA 1EESA 2ECKA 2IT1A 3ZS9A 1PUIA 2P3SA 3CX7A 1N6PA 3T61A 2GILA 2VTKA 1VCNA 1G8GA 3IQXA 3L8YA 3CNLA 4M4SA 3QG1A 3UG6A 1EFTA 2EFHB 3IDQA 4BEBA 1G3IA 3A1TA 1W4BA 3CR7A 1LV7A 3O8DA 1C4OA 1E2PA 3DMDA 1SXJD 1ZBDA 4TTPA 2QI9C 4J0QA 1YR6A 1FQJA 5JECA 1UKEA 4P3YA 2QAGA 3PEYA 2KBEA 1XTJA 2J7PA 2FPMA 2ZYVX 3O8CA 5FBWB 4Q9JA 2QT1A 3V00A 1EFUA 1AK2A 3JZAA 2ZI9A 2W0SA 4KFTA 4GZMA 3ZIAA 4RJLA 5FOTA 1KAGA 5CITA 1MKYA 3WNDA 1FP6A 4HAWA 3SC3A 2D2EA 3WNBA 4W5JA 3T06B 3A1VA 5IF9A 1KY2A 2G0TA 3K09C 1CJMA 1E1RD 2X19A 2VA8A 2HT6A 1TF5A 2AKYA 3ETLA 2P6UA 5FPSA 2KWIA 1U81A 3QXXA 2O8FA 1LW7A 1JNYA 5FBVB 2NO1A 1CIPA 4UJ5A 3O8RA 1Q1QA 4XJXA 1CF4A 1WBDA 1O87A 4KVGA 2N1BA 2GBLC 4CEIA 2GVZC 3C8UA 4B2PA 5C4MA 1QHXA 3LY5A 2Q0HA 3JVVA 3IKJA 4DWJA 4Q4JB 2WWIA 1G20E 1WA5A 4URWR 4NPHA 3C41J 4LBWA 3QF4A 2V6IA 4DLXA 1G16A 4TTRA 2GRJA 3PIRA 4MRPA 5SZKB 2RAPA 4BFSA 4LC0A 1AS0A 2ERXA 2OLKA 4NYJQ 3GQBA 2AXNA 5SZHB 4GDFA 1JR3A 3KJIA 1LB1B 4BFTA 5GVRA 4BFUA 1ZMXA 1U8AA 4Q1BA 1E1RA 4D4MA 2GXQA 1RC8A 1KKLA 2DYKA 2EQBA 2WSMA 1BYUA 3FKSA 4FMBB 1Z0AA 1YZTA 4BFYA 2C9YA 3GCGA 3ND9A 1U2RA 4DBLC 4LJYA 3ASYA 1QF9A 5JFGA 2XJ4A 1MABA 1ZP6A 2IXFA 5L8VA 1XCMA 1EK0A 3RDPA 4G5OA 4IDQA 2WBLC 2WPDD 3Q7QA 3QF4B 2YOHA 4Q02A 1TMKA 1XTRA 2V55B 4C2UA 3IQWA 2WIBA 4Q5IA 5EE3A 1QVRA 4BECA 2HCBA 4TT3D 1A1VA 1N5IA 3TBKA 1Z0KA 1QHGA 1A2KC 3I32A 4UNPA 5KSPA 1XD9A 3QKRB 1FMJA 2OLJA 2J7KA 4RFSA 5EZ6B 1KIMA 4WW0A 1CJKC 3EZ6A 1COWD 4RKEA 1GP2A 4TL8A 3TJZA 4H9GA 2C9OA 2PMDA 4JL5A 1CBUA 3EZ9A 3CF0A 2E1RA 2CLSA 2PT7A 3MAAC 3MWKA 1IONA 3SFZA 2WTUA 2Z5FA 4XVUA 3PVSA 3QBTA 4NU0A 4DVGA 3SDZA 2IS1A 1EX6A 4MKIA 4V0KA 2FPKA 4TZ0A 2JLUA 2XB4A 2ANCA 2IUUA 2IYSA 2PCJA 2QMEA 3ZVMA 4TTQA 2ORIA 2WSSA 4PPFA 3KQHA 4FWTA 2C03A 2I1VB 2VSFA 1AIPA 4AI6A 1EGAA 1ZC3A 4NZYA 1NN3A 4RZ2A 3QY0A 5ANRB 821PA 3WRXC 1VCMA 1N0UA 1X8JA 4DEXA 5BW8A 3IBYA 4OI4A 3IILA 3B8HA 2WWHA 4PC6A 421PA 4DB4A 2IWHA 4GL2A 2REXB 2WWWA 1W4CA 1WE2A 4M1WA 1MH1A 1OJLA 4JLOA 5CJ2A 3RS2A 4LV5B 3AVUA 4NE2A 4MRSA 5IHPA 1P2TA 2F3RA 3P20A 3DM9B 4DZZA 2CNWA 5SZJA 4BPBA 2FZ4A 4D82A 4URUR 3LAWA 4AY2A 4TYQA 2Z4SA 3LBNA 4KXFB 1P6XA 3AKEA 1Z6GA 2P2LA 3MSXA 3R9IA 4PZZA 4AYXA 5CLQA 2BM0A 4HB4A 1W46A 3OE7A 2C78A 4ZIRA 4M8NE 3IBGA 721PA 1M1YE 4HZIA 4LZZA 5CB8A 4YMTA 1P2VA 4KFSA 3UXMA 3K9GA 2CVHA 1AA9A 3QXHA 4DCTA 3BH7A 3AUXA 3U3OA 2X2FA 4GPTA 2VF8A 3TUIC 4BE7B 1FP7A 4N3NA 3VKGA 3T5DA 3CWQA 2RKOA 1GKIA 1XNJA 5EP1A 1G6HA 2X2EA 1GNRA 3EA5A 3VKWA 2DBYA 5EXPA 2N46A 2ZRJA 4CW7A 3Q3JB 3SJCA 2E9SA 4I99A 4ASUA 1U9IC 2QE7D 2G83A 1N6LA 3SFVA 5B58C 1VHLA 2F1RA 3K1JA 3DEFA 3AGQA 4AG5A 1Z07A 1SHZA 2ZYWX 2Q3MA 4D4JA 3ZYCA 1M2OB 1OIWA 4QG7A 5FOWA 3GLIE 5F9FA 4MYUA 2CE7A 1N5LA 3LRPA 5KPDA 4G1UC 1G18A 4QGAA 3K0CC 4M1TA 4C0JA 1P62B 1P9NA 4PX9A 2Q21A 1XMIA 1KTVA 2A5YB 2HYIC 2A7QA 4QJ3A 4GSYA 1T8UA 3H84A 1QDEA 3NBZC 2F1JA 3TLXA 1VIYA 2WJHA 4Q7MB 1E96A 5KTYA 5CYOA 2G88A 4DSOA 4IXNA 5JEDA 4PO8A 4NCJA 1XJCA 1YZGA 1DPFA 4N0EA 3ADBA 2ODEA 1NN1A 2IYVA 3C5CA 1R4AA 1ZCBA 3EWSA 4EQ6A 2AN9A 1FOEB 3EAQA 2VQSA 4N1AA 2VHJA 3WBJA 1AS3A 3KZ1E 3RHFA 2BBTA 2ZS7A 5JSZA 1WXQA 4IHQA 4B2IA 4ZV4A 3B1ZA 1HV8A 4YONB 1V43A 2H92A 3SHFA 3PQCA 4V0MA 3VTKA 1D2EA 4KLNA 3BBPA 1OFIA 2O8BA 4F38A 1FZQA 1W1WA 5AUQA 1E4YA 4DLSA 4DT1A 1FX0A 3ZH9B 3ZQJA 3WP1B 4HDQB 1E9AA 3B60A 2ZE8A 4XIGS 5HCNA 4UXIA 4LJ7A 3VHLB 4BQSA 3QF7A 3D7MA 3GFOA 2B6HA 2WKQA 4B35A 1SXJC 1XX6A 4HDOB 2V7QA 4ARZB 4C0KA 1US8A 1RKBA 2BKUA 4I1VA 3SNHA 2IYXA 4HB2A 1KZGB 2GHIA 4QHTA 2IYTA 1HUQA 4CGZA 5IT5A 2HF8A 4UKDA 3LLMA 3EZ2A 3EPKA 2TMKA 5GJWC 4D4KA 4RD2A 1UKZA 3IHWA 2BEKA 3RS7A 1UEIA 2V4ZA 3BOSA 3RNLA 1GSIA 3ZDQA 2PJZA 2O8BB 3EASA 2JDID 2OCAA 3KUDA 5CJPA 3A4MA 4ZI2A 1WRBA 2JLRA 1OXSC 4PANA 4PSKA 2CE2X 1TAGA 2JCSA 1Q21A 3AVWA 2H7VA 1UKVY 2GXUA 4X8OA 3K0FA 3OIYA 4NONA 1SGWA 3LX8A 4M1OA 2D74A 5KU1A 2VP2A 4Q00A 3HU3A 1UPTA 1PLKA 4TT3A 3W90A 3THWA 2AFHE 5KUTA 3QXJA 1W5SA 4NCNA 3W5IA 5L3SA 1NBMA 4Q21A 1YZQA 2PX3A 4LPSA 1G19A 4BWYA 2HCJB 3NIBA 1JPNA 4LBYA 3TH5A 1E98A 2ZPTX 3LBHA 5DIFA 4US2R 4M1MA 3T1VA 1HE1C 1XU4A 4B3DA 3GFTA 1TNDA 1GKYA 3MWLA 3K70C 2HV8A 2NZJA 5ELXA 1OV4A 1ZUNB 3H1TA 4LJAA 5DI9A 1R7RA 1N6RA 3RS0A 5F2EA 2OBLA 1J8MF 4RZXA 4MGYR 1W49A 3WHKA 2QBYB 4A1FA 4C9BA 3NDBB 5KPJA 2AD5A 3N5CA 4KAXA 1W2GA 4OJKA 1VG9B 1XD8A 5D3MB 4PZYA 5DGXA 2XJ9A 3QPUA 1R8QA 3W34A 3SI7A 4WOPA 1NLZA 2ZS9A 4DLWA 5FBRB 1QHIA 1YKSA 4CIDA 3CRW1 5F3WB 4JYBA 4ACBA 1YZNA 4II7A 3NHAA 1U99A 1OH5A 3OFND 1R0ZA 2H8KA 2ZANA 3DZ8A 1E0SA 1P9WA 2JJ8A 2BJVA 3CUEF 1P9RA 1G5PA 1GG2A 1N5JA 4G5SA 1GUAA 1WF3A 2ZI5A 2B8TA 3N2IA 3SU8A 4XWAA 1AZSC 1FFHA 3QKTA 3AVVA 3UKDA 5AJYA 2QG6A 5DO9A 2YYZA 4JBYA 4CEJB 4ZPXA 1PJRA 5AUOB 1W0JD 2J5XA 2O8EA 3TVDA 1MO4A 3TR0A 2P6NA 4JYCA 1U8ZA 2ZXUA 4OJQA 4LV8B 2OFWA 4PFSA 5EXSA 5FBLB 2D7CA 3TK1A 1U0HC 2W2XA 5G53C 2ZJ5A 4L15A 2Z43A 4JS0A 5A0FA 4KJZA 3I5XA 2BMFA 2D4HA 2UKDA 1Z08A 4YXWA 2JJ2D 3VNUA 4LV6A 5GJCA 4TYPA 2ODNA 2GK7A 3EG5A 2VP5A 4I81A 4DDTA 3LQRA 1GOTA 2RMKA 4DLTA 5H8WA 3ZLJA 1Z6YA 4JLVA 3LBIA 3B9QA 5AJWA 3K9LA 4LPKA 1UF9A 2R6DA 2ZE6A 2QA5A 3K9HA 1G8FA 3K09A 4EPXA 4EUNA 2GETA 2O8EB 2QPTA 1OKKD 4MKGA 1HE8B 2ZJ2A 3X1WA 5G3ZA 3CH4B 1XEXA 5EUQB 3H86A 2CMKA 2IF2A 2OXRA 3WBKA 1DG3A 3CIOA 1NL3A 1B23P 3FYHA 1XD2B 5FUVA 4QC2A 3AF4A 5CLLA 5P21A 4BLPA 3KFXA 3GLGB 3KQKA 2HUPA 2MMCA 1RW4A 5BXQC 3RRZA 3IO5A 4DSNA 2NIPA 2GF0A 2RGDA 4JLNA 1KK3A 4QXAA 2ZTSA 4R9UC 5EQTA 5FTMA 2HXYA 1K8RA 2OUKA 5G40A 3THYB 1Z0DA 2YINC 3U6KA 2ZRCA 1M74A 4HUQA 1VG0B 2OG2A 1DAHA 2R65A 3WNCA 5G3YA 3K0AB 1J7KA 3REGA 2VP4A 2JGNA 4C30A 3IGFA 2O8CA 5CB6A 1YQTA 4L5BA 1C1YA 4O3MA 5BYKA 3OZXA 1NKTA 1KK2A 4DLUA 1BKDR 8OHMA 4EIWA 2CXXA 3C7KA 3PUZA 4JLAA 4NTZA 5EUMA 2VEDA 4TLAA 4A2PA 4GP6A 5TY0A 1GKUB 1RJ9B 1XCPA 2LKDA 3EARA 4KFUA 5G41A 1E9EA 1YZLA 3BH0A 5J5CA 3B1YA 3E5HA 2WJIA 2BCGY 4IJMA 1CEEA 4JLDA 3K0SA 1G8HA 5LBIA 4BLQA 1N6IA 1DS6A 2ZI3A 4BLOA 3E1SA 4NBSA 5KNCA 2GEVA 4PC7A 1E2QA 1JEDA 3IIJA 3X1ZA 4QBIA 2ZUDA 3F8TA 5E95A 4QOSA 4TYYA 2YWEA 4LX0A 1E79D 1EG7A 1XFAA 1HEIA 4PC1A 4UNQA 4C0LA 1Q3TA 3CNOA 4IOMA 2ASEA 1DOAA 1E0JA 2XOKA 1M7HA 5SZIA 2QENA 2PLFA 4CZ2A 1COWA 1OW3B 1ETUA 1Q12A 4HLQB 4PHGA 2ZYTX 4YMSA 5FL7D 1H65A 3I5YA 2ZJAA 3KFVA 3QEJA 4NCHA 4RZ3A 1HH4A 3U44B 2EFCB 5H70A 3GLGE 1KZ7B 4Q19A 4AIIA 5C46F 1II8A 4FINA 2W83A 1NY6A 3UK6A 2REBA 2XSZA 2VF7A 3LVQE 2JLXA 3KJGA 4A8JB 2ZS8A 1SVMA 2EWWA 3DO6A 3RWOA 1T9HA 4BLSA 1XEWY 3MLEA 2ZSFA 4HI0E 1BH2A 2O0HA 3NWJA 4TMZA 3QPVA 2NOAA 3GJ6A 5JHHB 3OF5A 2FU5C 2RCNA 4ZKDA 1LF5A 3DOFA 2V7QD 2C96A 2WV9A 3AVXA 1D8TA 3TQFA 1AGRA 1E0AA 3OEHD 2OZEA 1JI0A 1RFLA 2PEYA 2ZI6A 4R7ZA 4DDUA 1G7SA 1W47A 2NZ8A 2ZSEA 4HEJA 2PH1A 4M2LA 4TLBA 5HPYB 4GFDA 3KTAB 2FF7A 2B8WA 3BORA 4IKEA 2ZIAA 1KK1A 2CHGA 4M53A 3KXLA 5FOXA 1F2UB 1G7CA 2OM2A 1VCIA 2CL0X 2WOOA 3MD0A 2RGNA 2Z83A 3S1AB 3CX8A 2DPXA 1KDPA 1C9KA 1O3YA 5AK0A 2XEXA 4OK3A 1P72A 3L0SA 2IS6A 2A9KA 2IYQA 4LJ8A 2IEZA 4ZKEA 2QL6A 2ZRFA 1DAFA 1KDRA 5E3HA 4DEYA 2Q9AA 1R5BA 4XTRA 1XDBA 2I1QA 2VHUA 5HE8A 1ZM7A 3IUYA 3TSWA 2G0NA 1MRSA 1FX0B 2ZAOA 2MMGA 3WMGA 2FGKA 2P65A 2NMVA 5TB5A 3OAAD 4LC1A 3VR1A 5FL7A 4HYYA 1QZXA 4KYUA 2ATXA 2R2AA 3FHTA 1TUIA 4IOLA 2GJKA 2VIIA 2JATA 5KNBA 3AVYA 5UKDA 1UBGA 1NNEA 3S1AA 1NVWQ 1W48A 1WBBA 1E3MA 3C5HA 1UBEA 1GTVA 4Q7KA 5BYJA 1T3SA 2IXGA 4EDHA 5HKKD 1XTSA 2GXSA 1E94E 1AKEA 4PSAA 3T12A 4DUGA 3OIVA 1JR6A 5DI3A 1G21E 2OO7A 4B71A 2BM1A 3IIKA 1GL7A 2NPIA 1A2BA 1OHHA 1S9DA 4Q47A 3TW8B 3BK7A 1D2MA 3BH6A 4JLMA 2IA5A 2IF0A 4POAA 2GK6A 3QG5A 3BXZA 3NEJA 2AXPA 2KSQA 5EE1A 4A9AA 5AJZA 1FL9A 3GJ5A 1W36B 1OYYA 1Z0IA 4W5HA 2AHOA 4DRZA 1KMHA 2W58A 4DIEA 1ZNYA 5F98A 3CRRA 1KNXA 4QBFA 4IVQA 3TSZA 4MGKR 3MRSA 1HYQA 4L8GA 4MRNA 1HA3A 3GD7A 3TNFA 3R8FA 1CJUC 3QKSB 4GZLA 4C7OA 1TEXA 3QI2A 3Q5DA 4QNMA 1S1MA 1GAJA 2FSIA 3P4YA 2O52A 3LD9A 4Q48A 2J0VA 3QUSA 4Q1DA 4RD6A 3W5JA 2QP9X 2QMUA 2WWYA 2WOJA 2RHDA 3QJYA 4JMPA 2FX3A 1DEKA 1BS1A 2WJVA 3Q7PA 2ZQ5A 4UNSA 5FUYA 1TU3A 3K70D 4G01B 1G4AE 1N6NA 1XTIA 4DLRA 2L0XA 4LHWA 4E22A 521PA 4FD2A 1I4LD 1OSNA 1P60A 4ACAA 3HU1A 4Q1AA 1WDTA 3FOZA 3C4JA 2A30A 1UBCA 1FUKA 1E9CA 1OFTA 3RSLA 3W6PA 4AKEA 4JVSB 4DCVA 2CL6X 4I1OA 5KO2A 3CPHA 4B74A 2VSXA 2XZPA 3ZJYA 2XSZD 1IXSB 5DE3A 1G5TA 2YHSA 4JIMA 1LY1A 2X77A 2F9MA 5HCIA 1QVAA 3HP1A 4PQRA 3LV8A 4OQFA 2GZAA 2QRZA 1J99A 1F2TA 1Q44A 3I4LA 2MSEB 3QVUA 5FR2A 3VR6A 4A0GA 4B48A 1NN5A 5K8TA 3ZGXA 3T1QA 4GBMA 5E7MA 5HR5A 1YHNA 1IXZA 2W00A 3W3AA 2NGRA 1JQLB 1ZW6A 1GILA 2ZJ8A 4P4SA 3RC3A 5BN3A 1EXMA 4JZKA 4ZCLA 4EPWA 3SBDA 4X8LA 2FOLA 3UWOA 2QEQA 2J0QA 1YZUA 2YNMA 1F5NA 1KOFA 1W7AA 3LLUA 3SN6A 2BBSA 5J4VA 4OI2A 2FEOA 3IEUA 1CR4A 4JJZA 3GJ0A 1TF7A 4JSTA 2GEUA 3OE7D 3AQ4A 3O47A 2OFOA 1DVRA 3BGWA 4WA7A 1E2MA 2X8AA 3UPUA 1Z47A 4TYNA 5GJVC 1T5IA 1JAIA 1ZYUA 4LY6A 4IDNA 1N0VC 1ZU5A 4TL7A 2F43B 3TIFA 2WAXA 2W2TA 3OHMA 4MDEA 4I1SA 4CEJA 2D62A 4IW3B 3R7WA 1U94A 1R10A 4H1UA 3Q72A 4ERNA 1T91A 2VPPA 3KQUA 1IJFA 5TARA 3B2EA 4AG6A 4RCYA 2IHBA 2KJQA 1WQ1R 3NC0C 2WJYA 1LVGA 3CPEA 2QRNA 4EFMA 3K9NA 2FEMA 2VSOA 1CS4C 1RZ3A 3K0EA 5J47A 1VKJA 4AKGA 3A1WA 1RRCA 2RGAA 3B82A 3GLHB 3KKOA 1NY5A 4A92A 3G82C 2YVUA 1XXHA 3MWJA 3L43A 2PJRA 2VHQA 3H4MA 5BQ5A 1ANKA 1A82A 3J81k 1N2CE 1M6NA 3RABA 4LHZA 1AQYA 2BIFA 2OCBA 3TAUA 2QAGC 4XD7A 3BB1A 2WIAA 4MH0R 3RSOA 1KI4A 4PXAA 1VIAA 3Q8XB 2AD1A 2FE4A 3L0IB 1KO7A 1RRGA 2GZHA 1XMSA 4I1UA 3H2YA 2EFEB 4PAMA 4AURA 1XEXB 4KITB 2J41A 2WKRA 1AZTA 3A58B 3BB4A 2JLSA 1X86B 2ZRAA 4IEIA 3VX3A 2EYQA 2QAGB 5FUXA 3A36A 3HPRA 4PSVA 3RYTC 1Z0JA 4YXWD 2GJSA 1GL9B 3X1YA 3OIUA 4F92B 5FPHA 4OQXA 2BBWA 1XMJA 3AKYA 1TF2A 2GAOA 2LKCA 5LB4A 2HT1A 1Z6XA 4LGMA 2NPFA 2R9VA 3PV0A 4PQFA 1RYHA 2IYYA 4HAZA 4M0LA 1W0KA 5DLQC 4EPYA 3R8CA 2DFTA 2EFGA 1PUJA 1IN6A 2YOFA 4BUJA 1FNNA 4Q7LA 4WZBE 1ZU4A 4YMVA 5C2JB 4PQYA 2YV5A 2OCYC 1H8HA 4PO1A 4O25A 2O8FB 3NG1A 2GESA 4BLRA 3FHCB 1IY2A 4WVFA 1ZAKA 5EP3A 1XTQA 1JECA 3AUYA 4NYMQ 4BFWA 1DAMA 1ZINA 3K70B 1KI2A 2J45A 4Z8XA 3F0TA 3KDSE 1RRPA 1VG8A 3QKUA 1S8FA 2VLIA 3K0CA 4B2LA 4Q4JA 1P61B 3GLHE 3PJRA 2FFAA 2LCFA 4NCKA 1P3JA 2OT3B 1WB9A 2ZJBA 3CRVA 3VAAA 4QGHA 3CNNA 4CT5A 4URVR 4ZCMA 1E2GA 2D7DA 3WRYC 3G0HA 3B1VA 1KI7A 1JBKA 3UIEA 1D2NA 1NSTA 2WJGA 2D2FA 4B73A 3MJHA 1HT2E 4D0GA 4A0HA 1UJ2A 1E2DA 1T3HA 2CK3A 3QNUA 4FMCB 2IS2A 2O0KA 4ITRC 2QPAA 3ZD6A 5TDHA 2IW3A 5E7JA 3EX7C 1TADA 1NRJB 3GP8A 4RSGA 4LYJA 5L3QB 1CR0A 5FOSA 4CRWB 5AUNB 1SVWA 2QPOA 1KSFX 3E2IA 1R6BX 3DZDA 4QFMA 4QHYA 1N0WA 1Q3HA 2OCPA 2V8OA 5FTJA 3A6PC 3OESA 3BRWD 5FBQB 4A8JA 2ATVA 1LFDB 3FE2A 2FA9A 1F60A 2J3EA 3BFKA 2OHFA 2ORWA 4BASA 3LO5A 1Z3IX 2IWRA 1J2JA 2WWXA 1R5OA 1YVDA 3N2EA 5FH9A 2VP6A 1FTNA 5DHAA 1HQYE 1X1SA 2K5UA 5C18A 3CWZA 4RKFA 1FQKA 2YWFA 3ECCA 2A5DA 3HWSA 3U60B 3FMPB 2XNDA 3CF6R 3A4NA 4EPVA 1I2MA 2BHRA 1CLUA 1BYIA 5JWHA 1U9IA 1FUUA 4FIDA 1QHSA 5CK4A 1N5KA 2QTVB 1F6BA 3KKMA 3NC1C 3CONA 3ZS8A 2V1XA 3U3RA 5H68A 1OH7A 4F4IA 2PBRA 2W0MA 3I73A 3L0PA 1ZD9A 2FG5A 4Q4LA 2BV3A 4AD8A 4XVQA 3M0EA 4JLPA 3QIAA 5JRZA 2QTHA 1TU4A 2OXCA 4UXHA 4QGGA 3O8BA 3A1UA 3EIQA 2C8VA 5C1BA 1NG9A 5FTKA 2NO6A 4WAUA 4B3FX 2FN4A 2GJ9A 4JLBA 2XNSA 4Y0VA 3NTUA 4JBWA 3MWYW 2FFQA 5JJLA 3L0OA 2OAP1 2GCNA 4W7SA 5CDFE 3VMFA 3VX4A 2I3BA 4QJ4A 4US1R 1KY3A 2J9RA 2R6CA 1IN5A 1ZD1A 1S96A 3U4QA 4B34A 4KHZA 4AYWA 1GDDA 5DI3B 1U8YA 3AVPA 1TTTA 2VO1A 1G4UR 2IS4A 2R6FA 5GJBA 3WHLA 4JL6A 2ONKA 4ZIRB 2YC2C 3UMRA 3HU2A 3NBXX 3WYGA 2ZREA 5C4GB 3THXA 1UKYA 1AGPA 4L9WA 3ICQB 3KJEA 4OK6A 1E32A 4TLDA 1S3GA 1OF1A 3E70C 3UATA 1DARA 2J46A 1Z28A 3GJXC 3NH9A 4Y0AA 4OI1A 1L8QA 4HZUA 2IXEA 3GEHA 3SYKA 4PPQA 3HYTA 2DHRA 2ZYUX 2ZEJA 4OQMA 4E5UA 3B9PA 3FFBA 4MITA 4B3BA 3VR3A 2Q3FA 3TUJC 4XTCS 3AGPA 1GNPA 3I1FA 3PG5A 5KYKA 2IBMA 4LJ9A 2N42A 3HYRA 3U6BA 2MSDB 1Z2AA 3ASZA 4Q1CA 4D0NA 1Z6TA 3B5JA 4OYHA 3AV0B 3ZZUA 2A2ZA 2CCGA 1NJGA 2ZI4A 2XXAB 2Q6TA 1U98A 3THOA 2SHKA 4BRWA 4DCUA 4D0LB 2WKPA 4LCBA 4MRRA 1A7JA 2XOKD 1XPRA 1BOFA 2XZOA 4X8HA 2J0UA 4RCZA 2ANBA 3X2SA 1E0KA 3FMOB 4IEEA 3HDTA 4KSCA 4DDWA 2XGJA 2ODWA 2JIZA 2G9NA 3TW4A 2OEPA 5CIWA 3T35A 4IDOA 1KI9A 4FXPA 1I4TD 1OE0A 3JVUA 1E2IA 2JLWA 5EE5B 4B6EA 2JLVA 1Q22A 1HTWA 3I3SR 3WMEA 4E03A 3D6TB 4GNKA 2QSYA 1AN0A 1K5GA 2F1IA 4ESHA 5AUPB 4EQ6B 4HATA 2ZJOA 3AKCA 3K53A 3P4XA 5AR1A 3W8RA 4EKDA 2XB2A 5JS7A 2FNAA 2YWGA 3ADKA 2GVDC 4EAQA 2XXAA 3VR2A 4OHWA 4GT1A 4P4SB 1OIXA 4KYIB 1P7CA 4LJ6A 3H0KA 2R8RA 4LHVA 4TN1A 2P0EA 3U7HB 1VCOA 2WJJA 4HB0A 2CNWD 2W6JA 3FGNA 5TVKA 3WY9A 1NMXA 4ZDKA 4CF7A 3PR1A 4PR0A 4WXPA 1CR1A 5KSOA
chains in the Genus database with same CATH superfamily
3A2KA 3L7YA 3UN1A 4YPOA 1E5LA 3M1AA 2EW1A 4FX2A 3TFOA 1FQWA 3JYHA 3VMMA 4RD0A 2H29A 4GLLA 3K31A 4IDHA 2H1FA 2ZYDA 3LCVB 4KAJA 1I4DD 4KVFA 221PA 2FPRA 2W2LD 1SKAA 2W2OA 2QVGA 3K2BA 4ECAA 3NHUA 2H18A 3UMFA 2CF6A 4PYQA 3ZH2A 4EW2A 1CEYA 4CT4B 3F4BA 2JD1A 1ADBA 2RIRA 4LE0A 1FNBA 4AO7A 4LYAA 1I2CA 1CJCA 5TV2A 4DA4A 2M2IA 2Q1WA 2W2VA 3GT0A 4BVJA 1ZRNA 4I4TB 4X9XA 3VVBA 1BS2A 3ZHSA 3L8FA 2VAPA 2ZYHA 3FCAA 4G8CA 4FJ1A 5ALUA 1L5OA 1Q0SA 4RQAA 5GV8A 1Q74A 4OGGA 4BE9A 3U56A 5K8LA 1GNQA 2Q6KA 1V5EA 2JI7A 3DVAA 2VRWA 3QXSA 4M7OA 4F7WA 4OMUA 2R6AA 1LX7A 3COJA 3N8KA 4Q3LA 3R6DA 3HYNA 4M6WB 2D06A 9GPBA 2Z6QA 1ZO8A 4B7CA 4J90A 2Y1XA 1SOAA 2L19A 2ORYA 2PJDA 1X6VA 2QMZA 3GEEA 5LQJA 3AEZA 3VZCA 3ND5A 2PUDA 3F5FA 4ZHQB 2XITA 4WLOA 3JQ9C 4MHOA 1LNQA 1LK7A 1QBKC 1GG8A 1WZIA 1M66A 2IDMA 4EBFA 4OATA 5GONF 4PC3A 2I55A 3OFKA 1F12A 4RUKA 3EXEA 4ZTBA 4BO9A 4Q9KA 1ZH4A 2PSFA 5DMXA 2QNRA 4Y9SA 4KQIA 1AF4A 1YQWA 4C1NA 4QNRA 1EXVA 1JF8A 1EDOA 1RIFA 1NUTA 3EXHC 4N8EA 5L6LB 2WNSA 1H2BA 1UZLA 3GF4A 1V4VA 4BC0A 1Z5NA 5JJBA 4X66B 4F2PA 3AUKA 2PL9A 2V7PA 5TMEA 3SQDA 3WIVA 5KQPA 1D6SA 1ORDA 4CKCB 3DOEA 5L4LA 4Q1EA 5K5EA 5C52B 4FWBA 2WPDA 2DVMA 3E4CA 3ESRA 4CM7A 5IF3A 1TLFA 4QUDA 1ZIPA 2RC5A 3GNTA 3B1XA 2XNDD 5FL3A 3RJMA 3SM3A 3QEMB 3VA7A 4B47A 2RGBA 1NM5C 4DV7B 1YDGA 1KY5A 2OHGA 1U04A 3HKCB 3O9ZA 3ZCUA 3NHPA 3DMRA 4RACA 1SUIA 1IZ0A 1T3LA 5ALVA 3LUPA 2XQFA 3COPA 3C8ZA 2O0MA 4F2GA 4ZEVA 1RYFA 5DN6D 5KX5A 2QBYA 1T2FA 2Z6AA 4O8ZA 2R44A 1Q16A 4RWEA 1JDJA 1JS1X 5BSMA 2ZB4A 1IPHA 4NY1A 3D3NA 4EJSC 5A06A 5TLSA 4V2UA 1DCFA 3N86A 1Y1QA 2CVZA 2GX6A 2M1ZA 4LK3A 2ZLBA 2BBOA 1PR4A 3SJAA 3KHKA 4C2BA 1DDGA 1CQJB 3Q1LA 2A5JA 1WSBA 2K6GA 3FKSD 4RLHA 3FPAA 3HV0A 5FWXB 5DSXA 3H1GA 1ISFA 1PZGA 5K8UA 1OLSA 2ZYAA 2C9ZA 4GMDA 1NXPA 3QTTA 4IDGA 4TXHA 4KR6A 1E1MA 3NC4A 4Q3NA 4D79A 1LLCA 1NVTA 4S12A 2CT8A 3BERA 4NK5A 1Z2OX 5FX2A 2Z2YA 3TLJA 1YD7A 3NHBA 3QGMA 4FLFA 4RIHA 3LA6A 2A3NA 1DO2A 2IQ5A 4FCTA 4AO8A 4IWNA 2JHCA 5IBRA 1YDEA 2DAPA 5ECWA 1V9CA 1AVTA 1KSHA 2F8LA 3K35A 1E1QD 1XZQA 3NTQA 3PUIA 4DNXA 4W9NA 1PO7A 4F4FA 3GJQA 5B6IA 3TYXA 3AY7A 1V5FA 2VCHA 4LSWA 4NIMA 1OX5A 2CLOB 3LC2O 1AY0A 1E1CB 1KZ9A 4ESEA 1SQGA 1C7IA 2ARKA 3RVBA 1TKBA 4YMLA 3B52X 3L82B 5CVDA 4B32A 4TKVB 1LJLA 1DQNA 1R0RE 1PR5A 2PPLA 3BSFA 4CLEA 1E79A 1DJNA 1F2DA 2YCBA 3U7IA 4MHTA 3AKZA 3IBFA 2O5RA 2E55A 2QM3A 2YJ4A 3CTMA 3EC2A 1QJ4A 2BEJA 2ZTHA 1JLLA 4G9BA 2Q5EA 2RBEA 3CEAA 2FV8A 3I61A 1Y7IA 1JPJA 3BRWA 1U1IA 5HQTA 4XGNA 1TQ8A 2G6TA 3M70A 3QUBA 3V8PA 1UZMA 2P2SA 4I6GA 2PLRA 1GAWA 2ZM6B 3KBBA 1YR2A 2G1JA 2C3OA 2PJUA 2DPGA 3ZKWB 2NU7A 3MFYA 4JUIA 5I8PA 5LZ4A 3BULA 4WIAA 4G0PA 1WHSB 3MQFA 2PL3A 3PUKA 3W6UA 3OMWA 4R71A 5B1EA 1JXMA 2O3RA 3GJSA 3JQEA 4V03A 4YIHA 4QAQA 3NH6A 4TRJA 1T2DA 5FWYB 2PBZA 1PNRA 3P0IA 1E9DA 3UTDA 1HNXB 1RM3A 2C1EA 4L5JA 4ZI3A 4IGAA 1U3CA 4BBZA 4RX1A 3K1TA 2J9FB 3TTSA 2BFEA 4YN3A 1T1RA 3TE6A 5B36A 5AHKA 1K7CA 1ZN8A 2E2WA 2XWQA 5K3OA 2VUHB 3DTVB 3C45A 3K8QA 5EZYA 1EVQA 4DOMA 2QORA 2RHTA 1CUBA 2PSHA 1XD2A 2PKYX 4MVJI 5KB3A 1FJXA 3KOZA 2YOGA 3CE6A 2F00A 2WZBA 2ZDHA 2VCYA 3R2JA 4U5QA 4WOJA 3UFBA 3RROA 1YC5A 2GPJA 2HA6A 3IPYA 3TM5A 2C4TA 2VUIB 4BZXA 3NHFA 3ZGYA 1QK4A 2OK7A 1H2XA 3EFEA 1ZIOA 2PS3A 2CEAA 4BNJA 1IEQA 4WKOA 5JRDS 4LKOA 2D7JA 2P30A 4DBLE 1A8SA 2BCJQ 3FTDA 3BA6A 2H0RA 1KSGA 3GLIA 4GUAA 3G1WA 1OXVA 1NXVA 4P31A 1A4XA 4MP3A 3KELA 2ZDQA 4BQOA 1BRMA 1RXYA 2ZBFA 3QYJA 3ZVLA 3DUFB 4LJKA 3SLGA 3IIIA 3SYTA 3A6EA 1Y42X 5A9RA 5A3QA 1I6WA 4LQCA 1N4DA 4MP6A 2JAWA 4J94A 2QROA 4IIJB 4X8MA 5EL0A 3CEMA 1XTZA 2F59A 3U4QB 4PO9A 4CIXA 5ITVA 1PYDA 2VNKA 3PWZA 5AMXA 3ZDFA 2C5HA 1CFZA 1M1NB 1T9BA 5DBFA 1KK0A 2YC4C 3ITDA 4QGFA 1U7HA 3OZCA 1ZM9A 5CNIA 5A9TA 3VX4A 2AUTA 5AM3A 3HGTA 4Y1EA 1AQNA 2PZFA 1A4RA 1Q1ZA 3FCCA 4CTMA 2CDRA 1CR6A 3FZGA 4CL3A 1VHWA 1G66A 4RESA 1RC1A 1THZA 2HYDA 3W6ZA 1A27A 1DAGA 5HDQA 4O4LF 4YDRA 2W42A 3FRHA 3M5CA 4KGDA 4N03A 2GWRA 5ENDA 4OYRA 2HTEA 2WAAA 4OUDA 2VK1A 3VSBA 1COZA 2FR0A 3RUPA 5IVPA 5LPNA 1ZRHA 4AUEA 2SCUB 1XOIA 5H02A 4MVXA 3VC2A 2IDJA 4BBAA 1XRJA 3JW8A 3H0CA 4XD7D 2P69A 5EXXA 2JH3A 4TTSA 3T7SA 4EB6B 5HA5A 1E3SA 5JADA 5LQNA 1ZXBA 4MUIA 4LDAA 1Z36A 3K9WA 1B26A 1LRJA 1USVA 3DBLB 5H3LA 2H0AA 2XUAA 1V6AA 4PHHA 1CC1S 5JS6A 4R7TA 1IN7A 2GVNA 2QVXX 4BEVA 4YV1A 2BSXA 2QW0X 1K7YA 1RQXA 3ASVA 1L4UA 4JLJA 4O3FA 4WJKB 5I9BA 3TQCA 1BVRA 3UJNA 1CY2A 2WHXA 1JTFA 4JKYA 4L9SA 4V0ME 3K2QA 1FW8A 1CUYA 5ALDA 3RK4A 2H1LA 2AMVA 3OZTA 1C8VB 4DCPA 2VTEA 4XX1A 4KX5A 3NYQA 2XNJA 2Z0MA 3FPLA 4DQ0A 3FCUB 5DBGA 1MFPA 2FFHA 2BMJA 5AVXA 3DD5A 1U0OC 4NH0A 1G1AA 3VZRA 5IX8A 4IDEA 2QOEA 4R05A 3NBYC 3FTEA 3WIBA 1HZJA 3EWNA 2V1UA 1B93A 3Q88A 1KU0A 1QQTA 2Z2ZA 1ENZA 1T5LA 2FSGA 3BSSA 4RCVA 3HXMA 2ZUSA 3U4MA 1XFDA 2CB0A 4MVYA 5BN4B 1RWMA 1GTRA 3K8OE 2VATA 1CY0A 1AUXA 4HH0A 5ALNA 4YQFA 1SVIA 1PWEA 4MW6A 3CURA 1MN6A 1JLMA 1EVIA 2OV1A 2RGNC 2WU3A 3A9SA 4MV1A 5F7JA 2WFLA 4B75A 1VPLA 3N75A 1CTQA 4ZYLA 4HQ0A 1AUQA 4JLSA 5E2IA 5JYBA 5JH7F 4KV9A 1I5OA 1G17A 2W22A 3BPSA 4NZNA 1ONBA 2OHJA 7GPBA 3CLRC 4PXSA 4DJJA 1HK7A 3KSUA 1FYVA 3WBFA 3MINB 5ED4A 2ZRNA 1YIAA 1H5NA 2QR2A 3C3YA 5AHWA 3MTAA 4MW2A 1JB9A 4L02A 2P62A 1Z45A 2R6R1 1AUVA 3SX4A 2OSVA 2FFJA 4JD5A 2RH5A 1J90A 2AF3C 3LW8A 2ZRQA 3HY6A 2V58A 3MHPA 4M9QA 1FSZA 1FA9A 3WTCA 1QHFA 3CLVA 3O8OA 3CJQA 3AJRA 1G20A 2DWPA 3N8DA 4H7PA 4HYTA 4XDHA 1X8LA 5JQWA 4UHJA 3BMCB 2C95A 4UAGA 3E5MA 3WNVA 3U80A 1U4NA 2ASVA 3FNQA 3OD5A 3K6KA 4X7MA 3UWKA 5B5SA 2AG1A 3WIDA 3WO0A 1XRRA 1EEXB 1U0LA 2GCGA 2Y99A 3SP1A 3BCUA 1ZOIA 3BIFA 2E4UA 3OIDA 1QP4A 1B3BA 2DFNA 1T9CA 2C3UA 4UDXX 1G8YA 3RJ5A 3D6UA 1Q1EA 3PX7A 4QT4A 5SYMA 3EXAA 1T35A 4NKRA 4FDAA 4K3VA 4N3CA 4YALA 5T67A 3SJ7A 3KZXA 3WA7A 1O0BA 2ZTVA 4QXQA 5IDQA 4PHFA 2FE1A 3D59A 4ONEA 5DJ5A 4DT1B 5KKCA 1GQOA 1DKMA 1J4AA 2J3QA 4WBSA 1E61A 4D43A 3H75A 1U90A 4ESVA 4PYOA 1I3MA 1XPUA 3CPJB 4RZHA 1CQXA 2OBFA 2ZRLA 1F2UA 5FPYA 2ZRIA 2V7BA 5CU7A 1NXOA 2JC3A 1MT0A 3KYDA 4X71A 2H2FA 5EIOA 3W6NA 1T26A 2FZLA 4ANFA 4AVYA 1PTJA 1Z29A 1SN7A 2ERYA 3AP1A 2O54A 1UJNA 1NMZA 5COAA 3OKCA 4ZVUA 1KP2A 3U4AA 4CMEA 1OZGA 4B9AA 3A1CA 1SUSA 4O4JA 1W44A 1L8XA 1BH6A 1FP4B 1QSGA 2C2KA 1ONSA 2W2KA 3LT0A 1SHKA 4P5EA 1QHNA 3TRIA 1F06A 3VR0A 1GKKA 2QUZA 4L27A 1FDIA 3ZE9A 5DTJA 1G6OA 3U4DA 2RHBA 5BWMA 3PX2A 3CU5A 3O74A 4ALKA 3VNVA 1GLGA 2Y76A 1CR2A 1K66A 3PFGA 5HSGA 2FF5A 3CRNA 4N18A 3RR2A 3AF2A 3Q3GE 4QYSA 2WM9B 4R8SA 4P4GA 1H9BA 4LWZA 4YVFA 1NBAA 1BCRA 4HSEA 3WAJA 3UC9A 1Y4SA 3ET4A 5F64A 3EODA 3MBIA 4UM7A 3BMNA 2HIGA 5DN6A 1KJIA 5FOUA 1G98A 2C4VA 1JH8A 1VJ0A 4OOFA 4NBRA 3IPXA 1DAIA 1S9HA 1LWNA 1FJGB 4L0MA 1BMFD 3KBOA 4HDMB 4R6WA 2MYUA 4HXGA 121PA 1Z56C 1QO0A 3LXXA 4NYIR 4YASA 3UJHA 1GVNB 4C14A 4DIDA 4EJ2A 3E9DA 3TRFA 4BJ1A 1G21A 2WQ7A 3B53X 4J2TA 5L3RA 1JQBA 4ND7A 1E2BA 4W8GA 1NZFA 4TMTA 1Q83A 1SBYA 1VRCA 2DQSA 3MGCA 3JQDA 4JC8A 3S99A 5BV1A 3R0VA 1C8LA 1J25A 1WCYA 1CUAA 4RKYA 2E4ZA 2OQ2A 2P6PA 3GA0A 4MPPA 4Y2HA 1OH8A 3AETA 1DBSA 3CMMA 2CK3D 5DNVA 5EXDA 3TIXB 2R84A 3UPDA 2PUJA 3U9LA 5K0SA 2XKKA 3DWFA 2F8SA 4BAZA 4OHYA 1V9SA 1W4AA 2IELA 1XB2A 1Y3FE 5ES3A 4YYZA 2IPOA 4M49A 3MJRA 5IDVA 3GBSA 4D6PA 2VTBA 4R7GA 3N0WA 5GONB 1DP4A 1JVNA 2OG1A 1HYHA 1NW6A 4H3VA 1YR8A 3EVBA 3USCS 5HJ5A 1RC0A 3EPLA 2BZSA 1UJ6A 5E4FA 3GLUA 1XWFA 3RJTA 4Q01A 3SXJA 3TINA 1X13A 2CF5A 3CRMA 3FMVA 4PC2A 4DDVA 1RP1A 3O4IA 3VISA 1KR2A 1DTWA 2RGCA 4XSVA 5HF8A 3TTXA 1XRPA 5J40A 1S01A 1JIUA 3U9TA 4JYMA 1UMBB 3OLXA 1AKYA 3AB3A 3JRNA 4OHXA 1MAWA 3GZNB 2ZW9A 3TAHA 1JPVA 3QE9Y 4DIUA 3S2SA 4NV3A 2ACVA 4TWZA 4ASUD 4OKNA 3GPLA 1Z26A 2HWWA 4U7PB 1C4KA 2NXEA 4PTZA 4CM9A 2I67A 5F5XA 5ITWA 4A3SA 3BIJA 1JE0A 1M2VA 3C70A 3QYPA 3BBLA 2HUNA 3MJTA 1M2GA 5IFKA 4L1KA 1NNUA 4YO8A 3TKLA 2I8AA 2C0QA 3PVCA 5MN6A 3AB7A 3KSAC 4YUXA 3QFTA 4TS3A 5KWEA 1QP0A 2V4MA 4AZ3A 1CNMA 3KLPX 4V38A 3MLBA 3HCWA 4NABA 1TAHA 2H17A 1TW2A 2OD9A 5FLEX 1WETA 3DDZX 4CDNA 2QUIA 1IBSA 2GPTA 1R0CA 4MR9B 2YN0A 4GOLD 2HLNA 2XDQA 3KL4A 1RRFA 1EYZA 1SBIA 3AL2A 4V2IA 1OZAA 4EI2A 3UJDA 4BGVA 4PAOA 2YFYA 3KQOA 3LHDA 1LW6E 4PG5A 2W6IA 3HXPA 2HQRA 3IQFA 4UQOA 1WMAA 3TECE 1T24A 1G64A 2PBFA 3MJ4A 4B76A 2UUBB 2NP6A 4Z9YA 2K2QB 1JDNA 3AHGA 3COYA 3IKLA 4GRAA 1P4SA 2OHXA 4KKXB 4CV1A 1IZ7A 5AKLA 4W5WA 3STTA 3PEUA 1EWRA 2B7BA 4QGBA 2DKOA 1J9GA 3PI7A 5GMOA 1KYWA 1Y0BA 3DKVA 3LDUA 1V3VA 1ECJA 1XDDA 3OQBA 1Z13A 3ZD9A 4DR7B 3IVMA 2QE7A 1DKQA 3P9ZA 3DHWC 3U2QA 1YTUA 2LP4Y 4WNIA 4BB0A 1ZGJA 2BW0A 2GEDA 2GSWA 2BT4A 2HIAA 2RBKA 3A4IA 3MCVA 4BVFA 1FFAA 2C4UA 2P7HA 5BSHA 4FI3C 1AH2A 3AEKB 1Z75A 3FOCA 3VDXA 3ZI4A 4GLJA 4DLVA 2HXSA 2WK1A 1IQ0A 1XA4A 2JLZA 1FDUA 3K6JA 4JBXA 4LXTA 5KYNA 2B9EA 2RARA 3WMFA 5KQLA 1PHRA 2W2NA 3JQAD 3NAQA 5EIFA 3GAAA 3RARA 4RD4A 3UAZA 1YB7A 1EFHA 2GM9A 2GA8A 1E8MA 1E5TA 1VKHA 1G5RA 1KOJA 4WD3A 1BXZA 1VGVA 1KSJA 5EIBC 3RLFA 4C21A 16PKA 4MIEA 1SCBA 4P3PA 3KB2A 1JQJC 3WOHA 3K8YA 4HFRA 5AOBA 2ECQA 3AIKA 3ZHOA 3NHRA 2B7CA 5ETJA 4K6OA 1L2TA 1GYRA 1PP4A 1B8NA 1XROA 2OFXA 1KGDA 1Q6ZA 3IURA 4G3XA 1XRMA 2X0JA 4OHVA 3G2KA 1C3OA 2UVDA 3D7SA 4IDPA 4A6XA 1GZSA 4PSCA 4BX0A 1EFVA 2NXNA 3U3ZA 2FETA 4B43A 5ICEA 4IXWA 3FZNA 3D3KA 4RDCA 5ESRA 1M0EA 4F71A 3H5TA 1IWPB 4KDFA 4FOLA 4R8VA 3C3CA 5E4TA 2QMOA 5HNKA 1J0DA 2QKYA 1EXNA 2OAEA 2NUPA 4FFNA 3TIGA 4QODA 2OB2A 1QIEA 4IPTA 4KV7A 3R9XA 1F2VA 4NU8X 2EFYA 2C3YA 4R2LA 3Q9LA 4F1KA 1NT4A 2XODA 4G36A 4HDKB 1XMVA 3BK1A 3ICEA 3L41A 4UDYX 3TLAA 4MGZR 2BUAA 3PHHA 2CCKA 2JFQA 4KBFA 3R7SA 1QPZA 3IT0A 4KQKA 3U7EB 5LXTA 1VMAA 2BDTA 3TKYA 1N25A 3RS3A 2OKGA 1M0TA 3T5PA 2PXXA 3W2IA 3W8EA 3ZG6A 4EUFA 2WDPA 2XUPA 5JLJA 4DPMA 1XAHA 3W7BA 1W36D 1QCCA 3CSUA 3MIIA 3E9MA 4JUAA 4R31A 3B1WA 5JDIC 3ZX4A 4BO7A 4CCYA 3FG9A 3ONEA 1JZTA 3RVKA 3CJRA 4CG2A 5K4HA 4J0CA 1EJ0A 1RABA 1UC8A 2X9GA 2IHYA 4LJSA 4RTQA 1NI3A 2HJRA 1N2ZA 3KXKA 3NEYA 3NBFA 1NC3A 2GERA 4W8HA 1MB9A 2ID9A 4YLYA 3S8EA 1VPWA 3F9IA 1KH2A 2JG3A 5EJEA 2JA1A 1DAEA 1Q7BA 2IE8A 2PV0A 2XKAA 2YHIB 2PANA 4MS4B 4IFEA 3OHPA 4NBNA 2OECA 2E49A 3OZRA 2ACEA 2D54A 4E70A 2OM6A 3MS2A 5JDIA 5KX5F 2GTPA 1SA0B 4LGYA 1MNAA 5A5GA 1T8SA 3W5VA 1FW6A 4C89A 3CIFA 1D2AA 3KIPA 1MJGM 3GJZA 1NDQA 3SQMA 4BDTA 2J7PD 3INRA 4RS4A 1VECA 4B0PA 3H7IA 1WUIS 2FUKA 1Y4ZA 3HYLA 1NZJA 3BJZA 1LTQA 2ZRBA 5KHOC 5LKRA 4PX5A 4XIFA 1AKNA 3MD9A 2O50A 5DLPA 2DXIA 2Z9BA 4WXRA 5CDFA 4DRXA 4JOCA 1X3SA 2REOA 4AQYB 4WDRA 4I5IA 1QHHB 2UVPB 4JC4A 3I1JA 1GPWB 4G0NA 1NSFA 1POXA 3DKIA 4P0TA 3T9BA 3ZOKA 4MW0A 4AO6A 2ZSBA 3EOAI 1NM5A 2AG6A 2Q7XA 3ZXYA 5JD4A 4D3SA 4X20A 4D9FA 2WU1A 3PX3A 3V4LA 1EZ1A 4HAUA 3AHEA 3QHPA 3G49A 4HAYA 1O96A 1ZVKA 2P1ZA 3OG9A 5BQXA 4PZ9A 3M8KA 1Z62A 5LYJA 1ZUIA 4OAPA 3IAS6 2IUYA 3NUZA 1T43A 3PFCA 2C3PA 4ZVMA 1YR3A 1M8PA 3T99A 4M99A 4KLZA 2C04A 2H48A 1X14A 3B6ZA 3QLTA 1ZI9A 4MRAA 1P4HA 5FJJA 3E18A 2J1LA 1TFUA 3S5JA 4IOJA 4ZQGA 3QY9A 3CEJA 2FMUA 2J6BA 4F4CA 5K3FA 3IODA 3N2GA 3VC1A 1SXJB 4XH9B 4D9BA 3OWOA 5DHRA 1H66A 2NG1A 5FFMA 3P9XA 3UB3A 2F6RA 2IVFA 4CQMA 1ILEA 2WG0A 3U26A 5BR1A 3ILHA 2HLDA 4RM3A 4Q16A 2OHOA 1UBSB 2WU8A 4MGEA 4TLEA 3UCXA 4IBOA 4TTIA 3NBQA 4EUHA 2ZVDA 1L5SA 2B5VA 3TLBA 1QG6A 2QJOA 3P2EA 4CM1A 1TW3A 3ZI0A 3ZNNA 3LPMA 3AEUA 4XM2A 3RFVA 3QELA 3BGSA 5EE9A 5C1DA 1J0EA 1YSCA 2CLDX 3QE0A 5T4BA 3VKVA 2GGSA 2WQ6A 3PXXA 3I64A 1TL7C 1FK8A 3NASA 2AEFA 3A32A 4W9RA 5BRJA 4A03A 5KSWB 1AHHA 1UPCA 5K8JB 1E3WB 2QN8A 1FNMA 5A0VA 3GRAA 4XQCA 4FB4A 2J0UB 4J4BA 3FYUC 4GOKA 1P4JA 3OZAA 2L18A 4ZCIA 1TLLA 4QQ8A 4KR7A 4LFBB 1NPTO 1SKQA 5LWQA 5IRCD 1NYTA 1W85B 4LOJA 1GXSA 2X0RA 3RYHA 3BT7A 5I7HA 4FPXA 2YWHA 1Y9JA 3U7RA 3HBFA 4N5LA 1U2GC 5LKAA 1LDBA 5IJ9B 2QD1A 4QUHA 5F1KA 4E32A 1TD9A 4NBVA 4D99A 5JBQA 3X1XA 5L6MB 3KEQA 4KH1A 1U8EA 2PK3A 5FB3A 3VFDA 3RU3A 4M1KA 4B8WA 2F43A 1E89A 2FMHA 3A04A 3JAKB 4JT4A 2H00A 1JTVA 3LPNA 4L6IA 2UZ3A 4GBJA 4L0QA 4GW3A 4KXWA 4LHYA 1WSDA 1UJBA 2ZUBA 3DP9A 4OXNA 3R7WB 2BVNA 2WAYA 4C0WA 2VDPB 1J0CA 1PR3A 4LJ4A 5AVJA 3T4XA 4AC9A 2PLNA 5K0ZA 1IBLB 1HGXA 2Z04A 4FNMA 4YI5A 4XVRA 2JBWA 3ZLBA 4EB3A 4OQDA 3BWVA 4MINA 3QI7A 2RIPA 3WB0A 2A5GA 3CRQA 2P8SA 4GHWA 1C1DA 1JFVA 2PZGA 5FO0A 1TAQA 1T3GA 1XJQA 4XWYA 1MX3A 4UARA 4X41A 1NAHA 2Q4RA 3Q15C 3R0ZA 3AI1A 3FMIA 1PJBA 1DRKA 5ALKA 1Z5VA 5CIQA 3ZBTA 4D81A 1Z73A 4PRLA 4UMDA 2NADA 3GCXA 3L40A 1ZHFA 2GSDA 2P2CA 3DZBA 3LZDA 1YOBA 3KOYA 2R8XA 2PS0A 1XQ9A 5LVAA 1KJJA 5IMBA 4BQNA 5D2CA 2NO7A 3VAZA 4OQZA 4UPVA 4M0CA 4O1MA 3NTXA 2VK4A 4EW1A 3ICPA 3ZUGA 2DB3A 3P27A 4L51A 5DNEA 4YJKA 1TA9A 2OV8A 2TECE 1R15A 4LVUA 1A8HA 3AM1A 2HDNB 4OX9B 4X3PA 1B76A 2DULA 2GCOA 1PZHA 1TPZA 4E11A 4OCZA 2B2NA 2BFCA 4KDCA 4RGYA 4UFOA 1SPBS 1EFDN 1NG1A 1PBNA 2FW1A 2FSVA 2ZP1A 2O8DA 1JHDA 2R7LA 5DOVA 4FLEA 4L95C 4KR0A 4EKEA 2AZMA 3G0CA 1D8AA 4R81A 1HDCA 5F3RA 4ND8B 3D8UA 2HJGA 3UMSA 1Z33A 5I7FA 1ZS9A 2QN9A 3EZNA 1ID1A 3FAZA 2RJNA 4JB0A 3S2EA 4DLZA 3PK0A 2VHTA 3DAHA 2BMAA 1A96A 2XKBA 1UXOA 1W0JA 3CB4A 5LWHA 1IVNA 1SVSA 3KALA 4J0GA 1WXIA 3TWOA 5JMTA 4JUDX 3PHBE 3FOBA 4MQEA 1BTOA 1DFHA 1NSYA 1NI4B 1TKAA 3DVSX 4QDTA 4U3JA 4WOCA 4D2IA 1Z6AA 4M1YA 1WOMA 3ESYA 3NQ41 2XPCA 3B85A 4L4UA 5D51S 5TSDA 4ZZ1A 1ILWA 3MTJA 2BGKA 1TX4B 3H5OA 4HKTA 4ZVPA 4UU1A 1E7WA 2NSYA 3ZEIA 1JG4A 2C99A 3ZBQA 1ITZA 4WN3A 1QQ6A 2J59A 2VDJA 2E4WA 3BJEA 4Y30A 1XXHB 3P96A 2ZBEA 2CV2A 2F48A 3IUEA 3D5QA 1EGHA 4MR8B 1FFXA 3BX1A 1H8ED 3LF1A 4P7FA 4O2BF 3UWSA 3VH3A 1L4MA 1EESA 1VJCA 2X8WA 3CX7A 3BQ9A 3DAYA 2CFRA 4Y2QA 1VI2A 3BWMA 5C1OA 2OC9A 2YZMA 4CM6A 2QZSA 5TX7A 1JHQA 4PBSA 3WL8A 4NCXA 4DNFA 1EFTA 2YJNA 4TM8A 4IV0A 1BA2A 1G3IA 1I1NA 2OP1A 4MK4A 4WLFA 3DMHA 2J5QA 3DFUA 4XIYA 1Y6QA 1W4BA 3D8SA 4EMSA 4BTLA 3HO1A 3M49A 4HK4A 1C4OA 3DMDA 4MVJF 4LF9B 3AHFA 1RACA 4TTPA 8ABPA 1R74A 3RYCA 3QE3A 4N54A 2AC2A 5E8RA 2PHZA 4J0QA 1A4UA 1BFKA 3VSDA 3SSAA 1MFZA 3LSTA 3JWPA 1Q7EA 5H80A 4P3YA 4EUSA 4CV3A 1XTJA 3G68A 4MLPA 4D74A 4MROA 2ACKA 2ZYVX 4P5DA 4RF4A 5C32A 4B4OA 1L1FA 4L4RA 1KORA 1AK2A 2I7CA 5BWCA 3ZZNA 4CCSA 4CIAA 3CT6A 1CY4A 3QNWA 4J4HA 3L4KA 4ZC8A 4HVAA 1U0GA 1EUQA 1IBMB 3EGIA 3MOGA 3WNDA 2YJGA 4I55B 2GZRA 2D2EA 3FJYA 1JEOA 3A1VA 4K9LA 1E1DA 4YJGA 1BG6A 5FAXA 3AUJB 1CJMA 1PS0A 1Y5RA 2VA8A 3X1JA 1EI9A 3S29A 2VZLA 2WP0A 3K96A 3ETLA 4Q9AA 5F7ZA 5FYDA 1OYOA 1RBYA 2PUCA 4W99A 4EG5A 2KWIA 1U81A 3N7AA 1CIJA 3V3TA 3SKXA 1T6XA 4BL5A 1JHYA 4RPJA 5FBVB 2B3DA 2NO1A 4IIXA 4O2BB 4EGSA 4QJIA 3O8RA 4XJXA 1ZX1A 4HFNA 1Q0PA 4ZJZA 2BFOA 4KVGA 3TOZA 2N1BA 4DC1A 2C5FA 5A5EA 4CEIA 4HV4A 2GBPA 1FDRA 3C8UA 3NONA 3BHMA 4ARVA 3LY5A 5HEKA 1PE0A 3IKJA 4DWJA 3C1TA 1SB9A 2W93A 1A7UA 4JI1B 1G20E 1WA5A 3G88A 1SEVA 3GBPA 3W05A 4L6AA 1WSAA 4RIIA 4P81A 3N74A 1GQSA 5C1PA 3DOUA 4ETIA 3BD7A 1NX6A 5AVUA 2RAPA 3L92A 4BFSA 3AJDA 2L69A 4ETMA 2AE2A 3JY6A 1JX6A 5CVVA 1HRDA 1M9NA 3HG7A 3PGA1 4DGSA 5BQPA 4IILA 3HV2A 4BFTA 5GVRA 2VLBA 4G56A 2JVKA 5F73A 3NOXA 4X54A 4M8SA 1JDVA 1SWWA 1YZHA 2I6TA 3FYCA 1RC8A 5G1NA 1B42A 4Q3DA 4QARA 1XQYA 3FKSA 1MIOB 1J2YA 3ROXA 3GCGA 5I9IA 3NGMA 4DABA 2Q6OA 4LJYA 4AFNA 1QF9A 4UE2A 1EK0A 2EZ9A 2QV0A 4IDQA 2WBLC 3NXKA 1RRMA 1R4NB 3QF4B 4NG5A 4WHMA 4F0JA 1YCHA 4MB6A 1Z4KA 2XGMA 5EE3A 3R1IA 1C29B 3WV5A 4GH5A 1IYZA 4X6LA 4EY5A 2J9GA 2WD8A 4FKBA 2KS6A 3BIOA 3S5UA 1RXWA 5A3VA 1U3DA 1XD9A 3QKRB 7REQA 4RFSA 5EZ6B 2HSZA 4Z3KA 2YCLA 4WW0A 2WNIA 2QUHA 4KPUA 4TVSA 1W96A 3IUJA 3SIPA 5TJ9A 2WJAA 3HEAA 4EGJA 3D6VA 3JQ7A 5AOVA 2FPWA 3H11B 5ELXA 3G2QA 1EA5A 2ZK7A 5JNSA 4OEHA 4L72A 3VHXB 4ND5A 5IYZA 4C6RA 1N75A 2ZB7A 2VSQA 5FLXA 1NU6A 5LA6F 2YZNA 3GEPA 4P38A 3SJUA 4CLDA 5ADHA 4Z9XA 3M3PA 4CBVA 3EIFA 2PT7A 3MAAC 3MWKA 2WTUA 4KIUA 1FB5A 1LPNA 1SO8A 3PVSA 1WWKA 4XCVA 5ALTA 5TVGA 1O97C 3DV2A 4HTFA 3SDZA 2P27A 3U3XA 4X6UA 1EX6A 3D6FA 4V0KA 4TZ0A 4GMFA 1Z5OA 2PCJA 4QLAA 2Z1NA 2Q46A 4YGYA 5TQVA 2O2EA 1JHAA 2ONZA 4FWTA 1SUAA 1RLJA 5KWVA 2OBBA 2F3UA 4FEYA 4OOEA 2UZ0A 3LOPA 1WKVA 3A05A 1ZC3A 4BB5A 4B31A 1NN3A 3C48A 4RZ2A 3S3TA 3G0IA 4BV2A 1N0UA 4HTAA 2XT6A 4WLUA 1ZZGA 1S4MA 1TZCA 1CRWG 4ZAWA 4ZK6A 5KJ1A 2V0GA 4TUYF 4WN9B 4TWAA 2LPMA 3F78A 421PA 4A8PA 3OEYA 2UV8A 2REXB 5HOEA 3EGDB 4DR1B 4HDNB 5EWMA 1ID8A 4HL6A 2VNIA 4MRSA 4A7PA 3NWBA 3BTVA 3WB2A 3TD2A 5KNDH 1WAMA 3RSCA 3FPCA 5BNWA 4B83A 2NSLA 4DZZA 3IKTA 5SZJA 4YPFA 5AJHA 4BPBA 3K72B 5G0UA 3EDQA 4MVJM 1GT91 1UC5B 2Y1DA 3LAWA 3QHAA 1D1QA 1Y3CE 1STOA 1OD6A 4KXFB 1Z6GA 4BU1A 2F3PA 2I71A 5CLQA 1GRVA 2GA9A 1W46A 1XCBA 3KFLA 1EU1A 3ECAA 3KZOA 1H6AA 1HL7A 2YW9A 3OZUA 5BSWA 1MP0A 3I0ZA 1M1YE 5CT8A 3AIIA 3GZJA 1DOHA 3PKJA 4KFSA 4JHXA 4R83A 4ZO6A 2CVHA 4QD3A 4Z4GA 1YOVA 3O2JA 3QXHA 3BH7A 2Y0PA 4DCTA 4OQPA 2JFUA 3AUUA 4JP3A 1JYFA 1OI7A 2BN4A 1AOXA 4KGVA 3GPBA 5JH7A 3T5DA 4DR4B 4Q34A 4NARA 1GKIA 1ZWKA 1XNJA 4LWQA 4ML3A 1VXRA 1B1AA 5JSUA 3VKWA 5EXPA 4DNQA 2JNWA 2PV7A 4JEHA 2E9SA 2WUWE 4AL4A 3F5MA 1U1GA 1U9IC 2QE7D 2P9BA 4MCHA 1A9OA 1U2DC 2VCEA 3SFVA 2D6FA 4HGOA 1PEAA 4WZAA 5DLDA 5CFLA 4PSDA 1ISGA 2CLMB 5TPZD 1RYYA 4M0MA 5BT8A 4BVEA 1B4DA 1YVEI 3MRVA 4G07A 4NOMA 3VR6H 2VAMA 2PD6A 2FPIB 2G5PA 3GFQA 4NC9A 2RDMA 3OWHA 1EHCA 1OIWA 3Q2KA 3ETEA 2GDZA 4HWPA 4JJ6A 2O1EA 3OC0A 1O5TA 2XAAA 4JQCA 4LOHA 1M2WA 3LRPA 1OROA 2QNIA 3ABQB 3PPWA 5J43A 5KPDA 1MLDA 3D64A 3K9BA 4FOPA 4C0JA 1XDUA 2JF0A 2QX9A 4H31A 2Q21A 3G2IA 3SR4A 3H2BA 2LD4A 4MMXB 4UZSA 4IDAA 2Y2UA 3VC3A 3REQB 2QWXA 1T8UA 4JXKA 5MDHA 2W6NA 1KPIA 4DMCA 1U9JA 2WJHA 4R2MA 5HRAA 3AI3A 5LFAA 4QG3A 2GFIA 3CBGA 5KYGA 1NF9A 5K8VA 5HJ7A 2F17A 4X92A 2BHLA 1NONA 1KZ6A 1VFPA 1OWMA 2VWQA 3F1LA 3L9XA 1XJWA 4PAWA 1R4AA 1ZCBA 3ZK8A 3VYRB 3T7KA 4EQ6A 2JKVA 3C3BA 2D1SA 2WSLA 4N1AA 2VHJA 2X9NA 3RHFA 2VPXA 4WACA 2ECPA 3GCZA 3OZSA 3WRYA 4PLTA 2I4MA 2VDQB 4QDUA 4O4IB 3PQCA 4PGMA 3VTKA 3F6PA 4L8VA 5NLLA 1Y7PA 3CLUC 3ZH9B 4EG0A 1E9AA 1GG5A 2OWDA 2PGJA 3E82A 3FF4A 4BX9A 4YAGA 5LP6F 4ZODA 1MJGA 4JB2A 3DB2A 1BS9A 2PAFA 3FPHA 5HCNA 4R1SA 4BQSA 2XT0A 2C9MA 1H6CA 4LCEA 1PEKE 1C81A 2GKGA 3B6KA 1U8XX 3D7MA 2B6HA 3GFOA 4KP7A 5JO0A 4QYIB 2WV7A 3G6KA 4LAFA