4QG7A

S.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
197
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 197
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qg7A00
5CYOA 4CEIB 1CP2A 2R9VA 4I1SA 2HF8A 4RZ2A 1OV4A 1ANKA 2VP2A 4LDJA 1SXJD 3OFNA 1R4AA 1XCPA 1DAGA 5KDOA 3GJ4A 4DLTA 3V4RA 3NHBA 1TF2A 4ZKDA 2G88A 2GZHA 4FCWA 2IS6A 1E9FA 3X1WA 4NL4H 2R6DA 3W3AA 5FOTA 3SYKA 1KJYA 3K0FB 3H2YA 3BFXA 4GPTA 5CJ2A 4DSTA 2GEVA 4M4SA 1OF1A 2W6ID 2GWHA 3SJCA 3V4FA 1E2JA 2RGBA 1WF3A 2RGGA 3AP3A 4ZCMA 1YVDA 3EZ6A 2DFNA 4EFLA 2RGDA 5M04A 3F8TA 3KUDA 1RIFA 3CIOA 1ZM3A 4HB2A 4WXPA 1VYVA 2LCFA 2CDNA 1TQDA 4CEHA 1G3RA 2G83A 1KO7A 1T0HB 1LS6A 3NHAA 2VIIA 4EJSB 4CGZA 1KO5A 1SULA 5JFGA 3FOZA 3PVSA 4FCTA 1X1SA 4IVQA 3DHWC 2XEXA 2EFDB 4OK6A 1II0A 1SXJB 4XSHA 1AZTA 4BLTA 3RS4A 3HU1A 3AKDA 2ZJAA 4BFZA 2ZUDA 4CRWB 4FWTA 4B33A 1HT2E 2WIAA 2JASA 4MDEA 2YOHA 3QG1A 3GLHE 1JQLB 1KYIA 1P2TA 4ASUA 5C2JB 1T3LA 3GLHA 1CIPA 2GRJA 3K09C 2VHQA 3QKSA 4PANA 2ZYUX 4BUJA 3WMGA 5KSPA 2MMGA 3C5CA 1JI0A 4FW9A 4Q4LA 4BLQA 1VCNA 1IY1A 3K70D 2OFWA 3ZLJA 4NE2A 4BEBA 4TZ6A 1FMLA 4V0LA 4BLSA 3R9IA 3R7WB 3LO5A 4Q00A 1S8FA 2BEKA 4EPYA 1JR3E 2O8FA 2ZPTX 4AC9A 2REXB 3OE7A 1LW7A 3SR0A 4LPKA 3IHLA 4OQLA 1S96A 4X8MA 1JR3A 5JSZB 1T91A 3TR0A 3BH0A 3SYLA 3LDAA 1GKIA 3KUCA 4PZYA 4L5BA 4GZMA 4C9BA 2GETA 3SJBA 3MUFA 2EW1A 4DLSA 4ZDIA 4B76A 1R7RA 2ECKA 3U61B 1XPUA 1Z0FA 4QHYA 4RD3A 2NMVA 1Z6YA 2B7BA 5G53C 1CXZA 1FFHA 2OCPA 2NG1A 1GVNB 2HUPA 4WZ6A 5KOYA 2F1RA 3UMSA 3SEAA 1R2QA 4LSGA 4BFSA 5JEDA 3L8YA 3NDPA 4PC2A 4EAQA 3A36A 1XJ0A 5KNBA 3RS3A 5F98A 5CDFE 3EPJA 3X1ZA 4A8JB 1FNNA 4UNNA 3K70B 3KTAB 2KE5A 4V03A 1E2MA 2ZAMA 4A6PA 3QI2A 5CDFA 2J5XA 3AVTA 4BRUA 1TQ2A 2JDID 3BC1A 4AYTA 2VPPA 2J7PA 2ZYVX 4ZO4A 5FH9A 1YZGA 3I4LA 1U90A 2ZYWX 5JI2E 2BMDA 3PEUA 5BYKA 2AHOA 2ZQ5A 4FMCB 5CJPA 2P5TB 3UK6A 1K5GA 2ZSBA 4QNMA 4ZDKA 1P6XA 3GCGA 2IYZA 3SQXA 1ZAKA 2P67A 2QSYA 3I3SR 2GEDA 1F5NA 3T1OA 1XMSA 3TRFA 1OSNA 4AKHA 1SKYE 3P4YA 4QM7A 3LW7A 3UWKA 1FUKA 1OKKD 1M6NA 4FMBB 4L4UA 3GP8A 1YJ5A 2FZLA 2GA8A 4EPVA 1MOZA 1YZTA 2FFAA 4RZ3A 4QGHA 1N6OA 4XVQA 5B58C 2OBLA 1IM2A 4A0FA 4ZV4A 1NRJB 3O8DA 5J4YA 4HAUA 1RRPA 2NO6A 3VKWA 4CVNA 3K53A 4HATA 1G5PA 2OFXA 2W0SA 2ZRGA 4B3BA 3ZVMA 1E6CA 1S2MA 3RS0A 5CB6A 3CLVA 4D82A 2QAGA 2F6RA 3V9PA 3PUYA 2QPOA 3QXXA 1KY3A 4TSFD 1BIFA 1KK3A 4LHXA 4D81A 1KMHB 1JAHA 3VFDA 5EE3A 3GJ5A 2PMKA 2ZR9A 1KO1A 3B2EA 3PENA 2CE2X 1TX4B 1MABB 1XEWX 2AD1A 2R8RA 2R2AA 4XTRA 4I1UA 1E99A 4RCZA 4DT1B 3MSXA 5KPDA 5A0FA 3U2QA 2Q0HA 5FR2A 3DKPA 1IN6A 5D3QA 4M21A 2QY9A 5SZHB 3AGQA 1UBGA 2QL6A 3UWOA 3I5XA 1KGDA 1WBDA 4I4LA 4BFUA 1G4AE 2J46A 2ZITA 1ZIOA 2OESA 1QHYA 3P32A 3WMFA 2QGZA 4DBLC 1O3YA 2ZRAA 5J4KA 5FUVA 1JXMA 3AKEA 3J81k 3KJGA 4PAOA 2IYRA 3O8BA 4PAQA 2EFEB 3RS2A 3ECCA 4PFSA 1Q44A 4R2HA 3SJAA 4TYYA 1J90A 3CX7A 3A1TA 3BBPA 3BE4A 4MGIR 4LJ8A 3NBZC 4XJXA 3LVQE 3QG5A 2QT0A 1KO4A 1IJFA 5AK0A 2BV3A 4O2LA 3RRNA 5LDDC 4ESHA 1GNQA 4BFYA 3CX6A 5JEEA 1R5BA 4B3FX 2J9RA 4QOSA 3TK1A 3AQ4A 4RD6A 4C4PA 2J0UB 4DLYA 1H8HD 4NCHA 4TT3A 3X1YA 3RS5A 2CJWA 3ZS8A 5E3HA 4Z8YA 4E03A 3V00A 1VYUA 1E69A 4HAVA 5EXXA 4QBGB 1P2SA 5J47A 3K0AB 4QNRA 5HZHA 4DLWA 3RDPA 2WJIA 4Q19A 4URZR 3EASA 1M74A 4IDPA 4UNQA 4QL3A 1TTTA 2WKQA 3L82B 4IDNA 2PBRA 1PV4A 1XDBA 2IC5A 3Q8XB 4G5GA 1Q1EA 2B7CA 4YMUA 2WVJA 1ZC4A 1TUIA 1IXZA 2VHCA 3TSWA 2YINC 1CU1A 2AWOA 2PL3A 3IGFA 4AKEA 3MWKA 5JWRA 4DCVA 1OIXA 1UF9A 4KBGA 2FDCA 1NL3A 5DYGA 1TQ6A 4PHHA 1P9RA 5EE5B 4F4CA 1UDWA 4TYQA 2QMEA 1E1QA 4ITRC 4PQFA 1HV8A 2N1BA 1Z8FA 4GOJA 1HE1C 2WMOB 4OHYA 2ZIAA 5JJKA 1JJVA 1E1RD 5DO9A 4YMWA 521PA 5EP4A 2ODEA 4PO9A 1KAOA 1OFIA 3SC3A 3NTUA 1XEFA 3PUWA 2ZUCA 3T34A 1W44A 4CT5A 2ZSAA 2ZM5A 4Q1CA 1LY1A 4LBYA 5F3WB 3TMKA 3ADDA 2WZQA 1GZSA 4MYHA 4DCTA 1E2EA 2AR7A 2C04A 1XTSA 1MO4A 1KJZA 2ZI4A 3OIYA 3KKMA 3OHMA 4LHVA 4DCUA 2ZRBA 3THXA 4ABYA 4JL8A 2PT7A 5D3MB 2RHDA 4D6PA 1XU4A 1OHHD 2A2ZA 3KKNA 4TLDA 4DSNA 1W47A 4A92A 2JLYA 4TTQA 4A4DA 1WP9A 4X8HA 3NEYA 1D2EA 4TMVA 2FGKA 5DN6A 1Q1BA 2ZSFA 1FX0B 1T5IA 5EQTA 1U98A 2FFHA 2MSCB 3LBHA 4NCNA 4PHGA 5H68A 4JBXA 5FPHA 5JLJA 2C96A 3EW9A 4PX9A 2BCGY 2W2TA 5L3QA 3MMPA 2V9PA 4NYMR 1KKMA 1D2NA 3I8SA 3E2IA 1KI6B 3B78A 3ZIAD 4BFTA 4B6EA 5LBIA 3F3YA 2WHXA 3Q72A 4LBZA 1G7SA 1CR2A 1Z63A 1U2RA 3M0EA 3CNLA 5FTMA 4GL2A 3BK7A 3HU2A 2RB4A 4GRAA 4MUBA 1YR9A 4S2EA 3FB4A 1I2MA 4ARZA 4BGDA 3THWB 2XZLA 1CRPA 1CJUC 2XJ4A 3E5HA 5AWFC 1PZNA 2F1IA 3MFYA 4HDCA 1UAAA 2P6UA 3KQKA 3EWAA 2BM0A 4JVSB 4OL0A 1HTWA 2BOVA 2O8DB 1NBME 2QAGC 4FMDF 5H8WA 1P75A 4DDTA 2RH5A 2IYUA 4DKXA 3AVUA 3HWSA 1VG0B 1NBMA 1Q22A 3QF4B 1HA3A 2RMKA 5BWMA 1VCIA 2DFLA 1B0UA 5KHOC 3PUXA 4ZIRB 1XTRA 2J3EA 3REGA 3ICQB 1YZNA 4JL5A 4Q7JB 2IHBA 3RRZA 4IOKA 3T06B 1WBBA 1EFCA 2D7DA 1CR4A 1EFHA 3C7KA 3VKHA 5FL3A 3U7HB 4TL7A 2FEMA 2GHIA 4NYMQ 1DAKA 2ZTSA 4EPRA 4E07A 4KJZA 2GXAA 4IFBA 2QNRA 3FKQA 4IRUB 2IEZA 1E9CA 1BYIA 3IIJA 4GOXA 4YLGA 2ZRIA 4JKYA 4A2PA 4PPFA 2VL7A 5CYPA 1N0VC 4DLVA 2AX4A 4ACAA 3N2IA 4A0GA 4HAWA 2O8EB 1HQCA 2CHGA 2ZR0A 3VX3A 4R71A 1BYUA 4XWAA 3K0SA 2CLDX 2QQEA 2GF9A 4D80A 4HAYA 3BGWA 1WDTA 2QEQA 1XZPA 4JBWA 4LCBA 1QHHA 2BBWA 4A82A 2GXUA 2JIZA 2GNOA 1OJLA 2V4ZA 3NH9A 4EQ6A 5K8IA 4PZLA 1ZIPA 1S1MA 5HCIA 1KMQA 4C0SA 5KU1A 3VR2A 1VDZA 4Q02A 4E09A 5EXSA 1WCV1 2O8CB 1CJMA 1E9DA 1QHSA 5CB8A 2CVFA 4Y0AA 1D6JA 3E1SA 1I2DA 3IUYA 4JLVA 2IA5A 3QPWA 3UKDA 3DZDA 1M34E 1TL7C 3DMDA 3C41J 2WSSA 1ZUHA 2ZRNA 2FEOA 4KCGA 2V7QA 2BBSA 1Z3IX 4LHZA 2W00A 2MSDB 4P31A 5SZIA 2CK3D 1JR6A 1T3HA 3ZGXA 3A4MA 1SVIA 3HU3A 3QEOA 5KSYA 1VYTA 3RLFA 2CCKA 1NMXA 3IQXA 2YHSA 3ND8A 2BM1A 3ETLA 3G5UA 4EIWA 4LV8B 1XNJA 2X2EA 4GMXA 3PR1A 4HLUA 4M9ZA 3GLGE 4O3MA 5DIFA 1R10A 4ZCIA 1BS1A 1N6HA 1X1RA 1YZUA 4Q7LA 4H1UA 3GLGA 2G0NA 5E7IA 4KODA 1VKJA 2ATVA 3IKJA 4RD0A 3CO5A 5DH9A 3VKGA 1L8QA 1D9ZA 4CEJB 1FOEB 2C78A 2EFGA 1K8RA 4JLDA 1J8MF 4B75A 4HAXA 4M1YA 2ORVA 1XCMA 2V54A 4PC7A 2D7CA 5IF9A 1NVUQ 5JJLA 1YZLA 4M0LA 4Q9HA 1DTSA 1GL7A 4M9SA 3RRMA 4XTCS 1OLOA 4XOIA 4B35A 1N5IA 2A7QA 4W5WA 3DMNA 3MWJA 4JVLA 4PO1A 3THYB 2RCNA 3FMPB 1DAFA 1YR7A 2GCPA 1NLZA 4OI1A 3K0CA 1E2HA 5L3SA 3IEUA 1KI4A 4TYPA 3LNCA 1T4GA 3KJHA 1UBEA 4RKEA 3BD9A 2C77A 2VEDA 4WOPA 2QSZA 4D4KA 1RE0A 1CR1A 1N25A 3Q5EA 5FL7D 1U0LA 3REFA 4HSEA 3I8XA 2B92A 1SGWA 1YR8A 4KSBA 1DG3A 1S9HA 3B8HA 2ZJOA 3C14C 4DB2A 2VYFA 1IN4A 1P2VA 1S3GA 3P20A 2PX0A 3GFTA 3SJZA 2SHKA 4MDFA 4RFSA 5J40A 5GJVC 2JATA 1KNXA 4P4SB 1U8YA 2R65A 1SVLA 4J0QA 1E2NA 1F48A 1ZYUA 2FFBA 2CMKA 2H8KA 2JJ1A 3AUXA 1KK1A 2ODWA 1XEXB 2GCOB 2HF9A 3NBFA 4HDQB 4NBSA 3ZH9B 1KAGA 3HYRA 3T15A 5FTNA 5F2EA 3QVVA 4Q4HA 1Q3TA 3GLFE 4NCKA 1F2UB 1IHUA 3QPUA 4TL6A 1GKUB 3GLIE 2A5DA 3GLFA 3BB4A 2Q3MA 4R2IA 3VAAA 2H7VA 3GLIA 2X8AA 4B3CA 2ZRHA 2ZVPX 2J1LA 1ZD9A 2WWXA 4BFWA 2KSQA 1TNDA 4PC3A 3IO5A 1YZQA 2WPDD 3AF3A 2FJUA 2O8BA 1E2DA 2AXNA 2AN9A 2IYSA 1N6LA 4JLBA 4HZUB 5CIQA 4IDOA 5TB5A 2WJVA 3LD9A 1NNEA 2YKGA 1UPTA 3OFND 1KY2A 2XTNA 3FKSA 2C8VA 3LRPA 3T35A 1ZUNB 1PLLA 2FF7A 2X77A 4Q48A 3EZ9A 5HE9A 5A5GA 5JCZA 2KB0A 5IDVA 1VPLA 1G19A 4QHSA 1DPFA 5E4FA 5GADl 3K8YA 2WBLC 1F2TA 3EC1A 1E0AA 3U6BA 1J7KA 4HDOB 1NVXQ 4XWKA 1EFTA 2WWYA 1Z0IA 4AYXA 3KQLA 2OEPA 4A36A 3GJ0A 3TR5A 1S4QA 3I5YA 4BZPA 2EYQA 2V6IA 2G0TA 3DKVA 1G16A 3U3KA 5JWOA 3U7GA 2DWPA 2QI9C 4NCJA 1ZC3A 5BQ5A 1P73A 5C18A 1ZNWA 1TPZA 2ORIA 5TARA 3SI7A 2I4IA 2RGNA 2ZE5A 3AF4A 2YOGA 5E95A 1XZQA 3KKOA 4AD8A 2BJWA 5FPSA 4MRSA 4Z1MA 3I32A 3ZQ6A 1MRSA 3NC0C 4M1SA 4PPGA 1XPOA 4P3YA 2Z4RA 2QTFA 4BZQA 4TYNA 2DB3A 4DSOA 1C4OA 4H9GA 4BPBA 4C7OA 3RABA 4NTZA 1NY5A 1Q0UA 2XJ9A 2GESA 3U3MA 3QBVA 5AUQA 2WJJA 1OXXK 1NY6A 221PA 3UG6A 2VTKA 2FFQA 1OYYA 3AUYA 1AS2A 1RW4A 2DWQA 1Q12A 2JGNA 4XVUA 1KI2A 2FWRA 2MSEB 2XITA 3CR7A 4QJ5A 3M4YA 4ASUD 2R44A 4G5OA 1E9EA 2P65A 4HUQB 3O8CA 2ZROA 1W4AA 1KJWA 1E2GA 3KB2A 5HR5A 3EZ7A 2FSGA 2HCBA 3KX2A 4OQXA 4CEIA 1G7CA 1RZ3A 5TVKA 1II8A 1G8FA 2IT1A 1UEIA 1G291 621PA 4CEHB 3OIVA 3RYTC 1A2BA 2IW3A 1X86B 3OE7D 2F1JA 1XTIA 2JCSA 2IS1A 5GVRA 3AV0B 4TTPA 3QF7A 1E9AA 4URVR 5JBQA 4HLUC 1JQJC 3DVLA 1KO8A 1Z28A 1ZD1A 4IKEA 3GFPA 2CXXA 2JEOA 1G21E 4NP6A 2ZU0C 4Z51A 4RCYA 2XB2A 1E9SA 1SVMA 5C4MA 4JLOA 1Z6GA 1MO6A 3B82A 4IDQA 2JLQA 4FINA 4CT4B 2RGXA 3UPUA 1Z08A 1LF0A 4LJAA 3P26A 4YONB 1BO6A 1EX7A 3OAAA 3BFVA 4MYCA 3LX5A 4BQSA 4AY2A 4LZZA 1LF5A 4N0DA 1BMFA 3CZPA 2E1RA 4HEJA 4MA4A 1VCMA 5C1BA 4B34A 4Q21A 4EJSA 2FE4A 2RGEA 1C1YA 1EGAA 1EG7A 1N6PA 1NLYA 2Z0MA 3QKUA 4MRNA 5J4HA 1XPRA 2XXAB 5TXGA 4O2RA 2PEZA 1SXJE 4M53A 3FVQA 1U9IA 4PQRA 1AQUA 4GP7A 1F6BA 3K0CC 2PCJA 3SS8A 4IXMA 1BKDR 1RVDA 1SXJA 1W36C 3F5FA 2J7PD 4TLEA 2UZ3A 4I81A 2QQ0A 1D8TA 1Z0AA 3OEED 4TYWA 2V1UA 2IL1A 3Q7PA 2VSOA 2NGRA 1ZU4A 3WMEA 1E0JA 3NDBB 3HPQA 4F4JA 3PEWA 1XJCA 1N6IA 3IBYA 4ZI2A 2XOKD 3NXSA 2WSMA 4TMWA 2W6IA 2MMCA 4DHEA 1E4VA 3DDCA 2VO1A 2HT1A 4P33A 1NJFA 2OCBA 5GJBA 3OF5A 1AGRA 3IPXA 3R7WA 4IW3B 2QMHA 1KI3A 3VR3A 4H1VA 5K8LA 4IOLA 2IUTA 1KDTA 4IEEA 4IVRA 3AVVA 5CK5A 1R0ZA 1ZNXA 5DE3A 5JSZA 3NBYC 1ZUIA 1RJ9B 2C98A 1M8PA 3I73A 4OHXA 1NG9A 1W5TA 2I3BA 4WIAA 5E7MA 4FIDA 3KZ1E 2Q21A 4KVAA 1MR3F 4JLAA 2G3YA 5IHPA 3TGPA 4R7ZA 5CLQA 3FHCB 4FD2A 3WHLA 3KQUA 2FV8A 2ZS8A 2OE2A 1SZPA 3ZS9A 1L4YA 2CNWD 1JPNA 4JLNA 1T0JB 4CZ2A 4AK9A 4KFSA 3WNCA 4MGYR 5GJWC 1FZQA 2A5YB 2AFIE 3SFVA 4K8OA 5JECA 2VH5R 4Z54A 3MD0A 3AVWA 2ZJ5A 1GG2A 2P6NA 4EKDA 1M7HA 1OIVA 3AH8A 3EARA 5EXPA 4A8JA 4DIDA 1UKZA 1OE0A 3EG5A 3EIEA 3NH6A 3KTAA 1FNMA 3TW8B 4XD7D 3FMIA 2KI5A 3TJZA 3U3JA 2BJVA 3RWOA 4KLNA 1OYWA 5GVSA 3WRXC 2RGCA 3EPHA 3KXIA 2ZI3A 4PSAA 2QP9X 1DS6A 2ZI5A 4OQNA 4P4UA 2GXQA 4G3XA 1ZM9A 3HJNA 4HYYA 2P0EA 3SDZA 2HLDA 2GF0A 3UG7A 2D2EA 1NMYA 1Z0KA 1D5CA 1YE8A 3SHFA 3U7EB 1MO3A 1GOTA 3VHXA 4GFDA 2IF2A 2YWGA 4ZI3A 4YMVA 1M7BA 5HCNA 1ZBDA 3U4QB 3PJRA 4Q1DA 4B2PA 3KXLA 1ELOA 3LAWA 1P9WA 2JAQA 4OHVA 3LQQA 1DADA 3ZVRA 3Q85A 4P4TA 4JLPA 2X2FA 2RGNC 2ZJYA 1Z5ZA 5CIWA 5CM9C 2FPMA 4IFEA 3QKRB 4XVRA 4BLPA 4LJ6A 4BRWA 3AEZA 1VIAA 2J0VA 1LS1A 2QE7A 3IPYA 1Z0JA 2WMNB 4B32A 1G7RA 5BN3A 1Z2AA 4ON9A 2ZJBA 2UVQA 2HJVA 3SYNA 1OIWA 2LKCA 2WJYA 4JZKA 3EA5A 2JDIA 3ASYA 2HT6A 1QDEA 4BEJA 2W83A 5JJIA 4B47A 1BH2A 2W58A 3SE0A 2OSBA 2QRZA 3B1ZA 4RD2A 1TAGA 3TE6A 3UMFA 1KSFX 1G8GA 4R98A 5FTJA 3GJ3A 5BYJA 4NONA 3T61A 1WB9A 1E98A 1MV5A 2ZJZA 2R62A 2VF7A 1KMHA 2KBFA 4YXWA 3BRWD 3NBXX 3QEJA 2KBEA 4Q1BA 2XAUA 4DUGA 4QGFA 1CJKC 4ZDWA 4A2QA 3BH6A 1GL9B 4WAUA 3TUZC 4JIMA 4UNSA 2ZREA 1Z6TA 4EPTA 2C99A 4GDFA 4OYHA 1IN8A 2XGJA 2DBYA 4FWIB 2GK6A 3MAAC 3C8UA 2G9NA 4IOMA 1E1QD 2ZRCA 1XRJA 3Q3JB 1OFHA 4Q1EA 5JRZA 3QIAA 3G0HA 3AVOA 1W7AA 1GSIA 1W0KA 2UZIR 4QBFA 2GDJA 2WV9A 1N5JA 1G17A 2VLIA 3LA6A 4D4JA 3QSYA 2GZAA 2IYXA 1GKYA 2ZVQX 2QROA 3ZZ0A 5JCPA 3U44B 2ZANA 4LJYA 2QTHA 2JLSA 2CJWB 5EUQB 3QUSA 1ZM4A 4PPQA 3TVDA 4MQBA 3DL0A 3ZVLA 5L8VA 4C0LA 4LJ4A 2CLSA 1P3JA 4JYCA 4G5QA 1I4DD 3U6KA 4EJSC 4ZKEA 4AKIA 2F3TA 2QUZA 2F55A 4F7WA 3RC3A 4BLRA 1X8KA 5KDDA 1R5OA 1U9IC 3IIMA 1XP8A 4B74A 3CNOA 2NO1A 1LB1B 1SXJC 1VG1A 2D4HA 2OILA 2XZPA 3CH5A 1QHGA 1CJVC 1UM8A 4G5RA 2J0UA 2HYDA 3GJ8A 2D3WA 2NIPA 3Q5DA 1W2HA 3FHOA 1S0UA 5G41A 1EFUA 1ZINA 3ZD7A 5KTYA 2A5GA 3K0AA 4Q4JA 4I1VA 4YMSA 4JVNA 1RFLA 5DLQC 4B73A 4WVFA 4JLJA 3UMRA 3VTKA 2ZI9A 4C2UA 2V8OA 3RHFA 3C15C 5IRCD 4BFXA 1FTNA 4DLUA 4LRWA 1QBKC 2ODBA 2QMOA 4NMMA 4I1OA 1NN0A 3K9HA 3ADCA 1YR6A 5FOSA 1OH8A 5JHGB 4NYJR 2JLRA 3SFZA 3B1WA 1GITA 4US1R 1ZNZA 2DWOA 1DO2A 2VRWA 5FPYA 4AWXA 1HT1E 2ZU6A 1A2KC 1HH4A 4WW0A 3AP2A 3T5DA 3I61A 1VMAA 2WICA 1SHZA 1GILA 4TQ9A 2DFTA 3LFUA 2OAP1 4LJ9A 2QPAA 2ZS9A 1TU4A 4DZZA 5HKKA 1E79D 1NBMD 2B8TA 3B6EA 2LKDA 1IN7A 3N2EA 2X1VA 2DY1A 2O0HA 3EXAA 3X2SA 1UKYA 1A4RA 2ATXA 2PZGA 2FSFA 1UFQA 1EWRA 1TF7A 1SKQA 2OLJA 1J8YF 1WXQA 3FFAA 1OFUX 5KDLA 5E7JA 1GM5A 4A8JC 3DM9B 4RFVA 3QXCA 5EP1A 5K8TA 2FG5A 3K70C 1US8B 1E4YA 2IWHA 2JLVA 5BN4A 2O5VA 3WNBA 1LFDB 1DE0A 1LNZA 2WAXA 3RC8A 4JLKA 4NPHA 4POAA 4KI0A 2CCGA 1W49A 2VP6A 5BW8A 3IDQA 1IJEA 1W0JA 3D3QA 3KL4A 4OBEA 3IBGA 3MWYW 1FX0A 2C2HA 1RRCA 5FTLA 1E1RA 4DEYA 5DSZA 3WP0A 2VQSA 2OFOA 2JIZD 2OXRA 4Q9KA 4HLCA 2BMEA 5B2ZA 3SNHA 5HE8A 4IOJA 3A8TA 5G40A 2ZUBA 4TMTA 4A0RA 2YZ2A 1KI6A 4LBWA 2OAQ1 5DISB 1L7VC 2P5SA 4KLZA 3AVXA 1NVVR 3EPLA 4LC0A 2W6JA 4HUTA 2H18A 3PCRB 1NJGA 2RAPA 4US2R 1QG2A 2QAJA 1A82A 4N0EA 3K1JA 4GBMA 3THWA 4XSGA 1U8ZA 2C03A 4C3ZA 2Z43A 2OZEA 2BHRA 2WSSD 1ZM7A 2IHYA 3QPVA 3RRYA 3QKTA 1KZGB 2O8DA 3D7MA 4LI0A 4AYWA 4RZXA 1KNQA 4US0R 1Q1QA 5AJYA 1W5SA 3B5JA 5FR1A 1XX6A 3QF4A 1Y3AA 2XB4A 3A1WA 1U8AA 3OESA 4JT4A 4L8GA 4PC1A 2AD5A 1DAMA 4QC2A 4D26A 5SZKB 2QG6A 1CLUA 1T6NA 1FUUA 4LC1A 2LWIA 1W48A 4JLMA 4ZIRA 1A7JA 3GJXC 1NKSA 3TKLA 2YYZA 5A4JA 1U81A 2JJ2D 4OI2A 3TSOA 2CE7A 5FPTA 2GXSA 3BH7A 3VU9B 1DG1G 3LBNA 1Q57A 3AVPA 4LUCA 3ADBA 5L3VA 4QM6A 1W46A 3AF2A 3TUIC 1JAIA 2AKYA 2CCJA 2ZE7A 1RPZA 3ZYCA 3PQCA 4LOAA 1VCOA 2W0MA 3HDTA 4MH0R 2KJQA 4QGGA 1NVVQ 2FA9A 2C9OA 3GPLA 5EUMA 5DNYB 3WNDA 4MKGA 2H92A 2IBMA 4IEIA 1HEIA 3TBKA 2O8EA 2WM9B 3NIBA 3IEVA 1LV7A 1VTKA 3I72A 3AM1A 1KOFA 1R8SA 2W2XA 3ADKA 3UXMA 5JZVA 1ZCAA 1P4SA 1ESNA 4OHZA 1HURA 1TADA 1W36D 2QA5A 5FI1B 1FL9A 2J59A 3KXKA 2BKEA 4DC9A 2CL7X 2WOJA 3MRSA 2QBYB 3CH4B 3WXMA 4URWR 4NHOA 1K6MA 3F0TA 1V43A 2CL0X 4DSUA 1RYHA 4O25A 4M1TA 2YV5A 4ZCLA 2O8CA 3W6PA 5FI0B 3WRYC 3I92A 3WP1B 3CX8A 4TLCA 2Q9CA 2YWEA 4F93B 3CZQA 4JYBA 4AG5A 1UADA 1OFTA 1DAHA 2NOAA 1G5TA 4OJQA 2V55B 1AZSC 4OI0A 1R0YA 3L0PA 1N3BA 4M8NE 1TMKA 4MRRA 2F43B 3HPRA 2JJ1D 4C0KA 4DCSA 1Z6XA 2PEYA 5J4VA 2OUKA 1AJEA 2ANBA 2FSHA 1GNPA 4TTRA 2XNDA 3MCAA 4DJTA 4HB0A 1CRQA 4PAMA 4OQFA 4Q4AB 2OM2A 1JPJA 3B60A 2IXGA 2QGNA 2VBCA 3IILA 3SBEA 4QKQA 2ERYA 3L43A 3PEVA 2IS2A 5LB4A 1P9NA 1AN0A 4PQYA 5FPKA 2OCAA 2A5JA 3WYAA 4Q7MB 3U60B 4DLXA 4M1OA 1HQYE 1QVAA 4HLDA 4LYHA 1ETUA 4B44A 1W36B 3EWSA 2BIFA 3FMFA 2CVHA 4MYTA 2GAOA 1NIPA 5FUXA 5CM8B 4F4IA 1PVOA 4AURA 4HB3A 4CEJA 5H1YA 3ZDQA 4ILEA 2GVDC 3W8RA 2F1HA 1E94E 2CHQA 2E87A 2AK2A 5LD2C 2ONKA 5FBWB 4QBIA 2J0SA 1UKVY 2BKUA 1VHLA 3ZQJA 4LY6A 1Q3HA 4PTLA 1G3QA 3CF6R 4LK2A 3THYA 1KI1A 1YHNA 4IVPA 4GT1A 2ONJA 1KK0A 3DOEA 3O47A 4K81B 5UKDA 2PJRA 3EIQA 1UBCA 2IYQA 3TUJC 4KFRA 1DARA 3BOSA 3FPAA 4A1FA 3KQNA 1UBFA 3N70A 3WY9A 1GDDA 2Q9BA 4DVGA 4EPXA 1OXTA 5EE9A 8OHMA 2XZOA 4FMDB 2DFKB 1NG1A 1J70A 2QORA 2WWWA 1XD2B 2PLRA 4PHTA 4GNKA 3H0KA 3HR7A 4MGZR 5KNCA 1N5LA 2G6BA 3LWNA 1Z07A 4FXPA 1COWD 4B71A 4RD1A 1DAIA 3P1JA 4HI0E 1GIAA 1Z2CA 2I1VB 5TV2A 1OXUA 4Q01A 4P4SA 1SVWA 1ZM2A 1ZD8A 4Z1MD 1S9DA 2ZRKA 1XMIA 2VHUA 1XXHB 2QMUA 2VSFA 821PA 2HV8A 2GKSA 1XEXA 2GCOA 1H8ED 2IYWA 4CW7A 5TMPA 2QU8A 4MRPA 3ZZTA 4X8LA 4RZUA 3PUVA 3CUEF 4LV5B 4V0ME 1F2UA 4U02A 1SVOA 3LBIA 1MKYA 1IN5A 1GL6A 2GZDA 2HXYA 4S35A 421PA 4D25A 4GOKA 4V0MA 1KI9A 2ZYTX 1FTSA 3R20A 4IXNA 2ODNA 4MKHA 4UJ3A 2EYUA 4ZPXA 2YNMA 4JT2A 1MT0A 3FMOB 4RY2A 2VHJA 3TW4A 2V1XA 1T3SA 2EU8A 3CR8A 5FTKA 2IYTA 1Q21A 1BOFA 3QNUA 4W5JA 1T8TA 4L15A 5L3RA 4MRVA 4L16A 1XF9A 5JWHA 2OBMA 1TEXA 1RRFA 5DI3B 1EWQA 4QGAA 4HAZA 3OEHA 2B6HA 3S1AB 3TIFA 5KPJA 4V0KA 4B3XA 2NTYC 2F9LA 2XTMA 3NWJA 4KAXA 4KVGA 4RJLA 1T8UA 4TN1A 4WZBE 3KKQA 1DO0A 2QENA 2ZEJA 4PC6A 1G8YA 1S1CA 1AK2A 3OZXA 4FMCF 4G0NA 4LWZA 5IK2A 2FGJA 1G64A 4RVCA 1N0UA 2BDTA 4GMDA 3LVRE 2FNAA 4YDSA 3P27A 4B48A 1XTQA 1WMSA 3BB3A 2KWIA 5AR1A 1HUQA 3KJEA 1JEEA 4TWZA 1FQJA 2P2LA 3W34A 3W3ZB 2YOFA 2NZJA 1R0XA 3M6AA 4C0QC 3K9NA 2D2FA 1LTQA 1II8B 1KZ7B 3BS4A 1PUIA 2WJGA 2YC2C 3H1TA 4M1WA 5TDHA 3UATA 4A2WA 4BASA 1OB5A 4Q5IA 3BXZA 1KSJA 3I62A 1NSFA 1PUJA 2FX3A 2AKAB 2C9CA 5F9FA 2ZI6A 4PXAA 1EFRA 1UKEA 1CTQA 1JR3D 2H5EA 2BBOA 4NCIA 3AF0A 3A6PC 3E70C 3KFVA 3MLEA 2QM8A 1EXMA 2QT1A 4II7A 3DPUA 4K46A 2XTZA 1ZP6A 5LPNA 5EE0A 5BXQC 3QJYA 4HUQA 4DRZA 1AGPA 3LW8A 3NVAA 3B9PA 3K0FA 2Q3HA 3AKYA 4W5HA 4D0NA 3THOA 4C2TA 1YRBA 1E96A 2YWFA 4XIGS 1C9KA 6Q21A 1E2FA 4R9UC 3ICEA 2IXEA 2HEIA 4V0OA 2XSZA 4HLQB 4XH9B 4JMPA 1AKYA 4GZLA 3C4JA 3RANA 3GLHB 3QKSB 4KSCA 3HYTA 3K9LA 3CF0A 3SHWA 3T5GA 2BEJA 1JBKA 1NKTA 1G20E 3KKPA 1XJQA 2G77B 1G3MA 3OIUA 5EZ5A 3A1VA 1DOAA 5KO2A 1CR0A 2P3SA 4UXHA 1KDRA 3U3OA 3SBDA 2VHTA 2O8FB 3VNVA 1CS4C 2Q6TA 3IQWA 2PCLA 4OQMA 5B64A 1IONA 1CBUA 3GEEA 4QBHA 1LVGA 3B9QA 3SN6A 2OXCA 2QP3A 1VIYA 2VP4A 3VR5A 2VSXA 3HP1A 2YJTD 5AJVB 3BB1A 2GILA 1JNYA 3FYHA 3MJRA 1QHIA 4YC7A 3B7GA 2XXAA 2WIBA 2ZSDA 3AB3A 1G4UR 4QRHA 5FBQB 3ZD6A 1GRNA 2EQBA 2PMDA 4TLBA 2ZETA 3KB1A 3QOFA 1H65A 3A4LA 1E2LA 4PPNA 3GFOA 3CF2A 2HLDD 2RGAA 3EA0A 2HYIC 5EXTA 1CKEA 5SZJA 1A5TA 5FBLB 2DHRA 3FHTA 1OXVA 1PLJA 1G8PA 5EE1A 2NO0A 2WKPA 4JS0A 1UJ2A 2PX3A 4E5UA 3X1XA 2GJ8A 2NPFA 1G9XA 2VP5A 3VQTA 5G3YA 4I99A 1YQTA 2ZE8A 4B43A 3EC2A 1I4TD 5FBRB 1ZJ6A 3QENA 4AKGA 4LHYA 4LV6A 1MO5A 5F9HA 1KI8A 4DB4A 2ZRMA 2GAAA 2QE7D 4V0NA 3L0SA 4PHFA 1G18A 1RJ9A 3W90A 1A1VA 4MGKR 1KSHA 4JVMA 4BWYA 1FW6A 1TQ4A 2GCNA 4U00A 1M7GA 1EESA 3TAHA 3CWZA 2O0KA 2VP0A 2WKRA 1QZXA 1L4UA 1SKYB 1NN1A 3BJIC 1DAEA 4LBVA 3DZ8A 3OEEA 4Y0VA 2OLKA 2OT3B 2CL6X 3GEIA 3IHWA 4Q66C 4YXWD 2ZSEA 4DUGD 4LHWA 1E2QA 4YQFA 1KIMA 2XOKA 5CK4A 2NPIA 2QAGB 3PUZA 1W2GA 4DEXA 1KSGA 3JZMA 1RRGA 1E2PA 2WJHA 3JVUA 3A37A 2H16A 3RNLA 4KV9A 1XMJA 3K9GA 1ZRHA 3W8NA 3VHLB 4F92B 4L9SA 3VR6A 2OHFA 2RKOA 5DHAA 1W0KD 3H84A 1WQ1R 4OJKA 5AJZA 3B1XA 4MKFA 2FZ4A 2IEYA 5JHHB 1XEWY 4LJ5A 3VNUA 2JJ8A 3Q9LA 1NIJA 2H17A 4WBSA 1N0WA 2BMJA 3KQHA 4HZIA 1JJ7A 4TT3D 3W6OA 3U4QA 3ONWA 2FMXA 1OXSC 2R6GA 5G3ZA 4EDHA 3D31A 1E9BA 4DIEA 2Z4SA 3BORA 2CNWA 2NO9A 1II9A 3WBJA 3L2OB 1NI3A 1VG9B 1FQKA 2WWIA 3PIRA 3DO6A 1E32A 2GJSA 5AJWA 1F60A 3QKRA 2ZRDA 3CRRA 4DWJA 4OHWA 1X8JA 5GJCA 4Z8XA 4AIIA 2JLZA 4B2LA 3VMFA 1DVRA 2O52A 3A58B 3EZFA 5HPYB 4KFUA 4TQUS 3NC1C 5FUWA 1GUAA 1OT3A 1MABA 1OW3B 2DYKA 4XD7A 4D4LA 4FN5A 1M2OB 1AKEA 4N1AA 2L0XA 4Q9JA 2Z6VA 3ZZUA 1PJRA 4DT1A 3TVTA 3MJHA 1Z29A 3HR8A 4Q03A 1NVWQ 1OKKA 5KSZA 4CF7A 1G5RA 5DI9A 5J4LA 1JXOA 3MGCA 3PFIA 3U3RA 1N2CE 3P4XA 3U7FB 5CITA 1QVRA 2Q3FA 4U7DA 2QRNA 3L8ZA 3QBTA 2HCJB 3SQWA 1FP7A 2H1LA 4A6XA 4KYIB 2UKDA 4Q47A 2REBA 4JJZA 2DCUA 3DM5A 4BZXA 4EPWA 2B8WA 2IUSA 3FFBA 2JLXA 3LV8A 2EFHB 4TSFA 4C0AC 4M1KA 3W6NA 2IK8A 4D4MA 3SZRA 3AVQA 4GSYA 1KTVA 2BC9A 1NSTA 2V6JA 3W5IA 4UNPA 2QPTA 4TQAA 1UEJA 1OH7A 4KFTA 4D0GA 3FE2A 2BCJQ 3ND9A 1B23P 2WTUA 4L9WA 1OB2A 3QY0A 1XTJA 5HKKD 3QXJA 1KKLA 2FH5B 2IF0A 3U44A 3WBKA 3SU8A 4C0JA 3AKCA 4A15A 2GJAA 3AF1A 3CNNA 3CPEA 5DN6D 4UXIA 2IX3A 3BFKA 4LGMA 4NU0A 4Q1AA 1ZVQA 4Q4JB 4DDVA 2QP4A 2ZRFA 2A9KA 3QXSA 4XWOA 1QRAA 4NKRA 5DGXA 4UNRA 2J45A 2ZJ8A 3TQCA 2G1KA 2ZI7A 4B3GA 1DEKA 1CULC 1XTKA 4JL6A 3H4MA 1IOZA 2HDNB 2WWHA 2A5FA 2J0QA 1Z47A 4QJ4A 1CJTC 4LYAA 3RAPR 2GVZC 1W0JD 1M1YE 2R6FA 3BIFA 3RWMB 3DEFA 4B2IA 1KK2A 1ZU5A 1N6KA 4LYFA 3THXB 2F9MA 2JLWA 1KI7A 5LD2B 2ZJ2A 2AK3A 4EFMA 2ASEA 2CHVA 4PZZA 4URXR 1ESMA 2V3CC 1G41A 4TZ0A 2D06A 4JJKA 1XB2A 1PLKA 5ELXA 1IY2A 3AP1A 3GD7A 3TLXA 1R5NA 2HXSA 1QG4A 3B85A 4KXFB 1ZCBA 3KJIA 1H8HA 2A30A 3QVUA 4MITA 5HZKA 2Y8EA 2W6JD 2PH1A 4AG6A 2NO7A 4M22A 4TMZA 3TAUA 5FBVB 4TMXA 2FSIA 2P6RA 4UXJA 1TEVA 2J41A 3LY5A 4N3NA 5L3QB 3WHKA 1GAJA 3ZVNA 3N5CA 2ZXUA 4FI3C 4KBFA 5BN5A 5FOVA 4W9MC 1SVKA 2FOLA 3CKLA 2FN4A 2OV2A 1VECA 3GMTA 4G01B 2R6AA 1KDPA 1J99A 5D3MA 3KDSE 3A1SA 3U5ZB 1IXSB 1Y63A 2CLCX 1XD8A 1HY3A 4WA7A 2NZ8A 3NEJA 3CM0A 2DR3A 4LJ7A 1G7TA 4NYJQ 1UDXA 4ARZB 3FWYA 2CEAA 1P2UA 3CRQA 2ERXA 5KUTA 1E0KA 4YDHB 2GEUA 2K5UA 1P7CA 5P21A 3RVBA 1ZNYA 5AJXA 4QG7A 4MYUA 1X8LA 4P0TA 1V5WA 3DOFA 1VHTA 5JS7A 4B3DA 3R8FA 4Q9LA 1XWIA 1T5LA 1P5ZB 1US8A 2NQ2C 3H86A 3OIWA 2GBLA 1XBTA 1ZW6A 2IUUA 4UKDA 5LB2A 4Q9IA 3PXGA 2VA8A 3KFXA 4URUR 2BWJA 2FPLA 1SQ5A 4U5XA 1YRAA 2EWVA 3VR4A 1P72A 4PR0A 4UJ5A 3WYGA 4G1UC 4CYMA 5H70A 3UANA 1W4CA 1QHNA 3MWLA 4TMKA 3T12A 1OH5A 1TU3A 1N6RA 2D62A 1AQYA 1K5DA 1AA9A 1OHHA 5B30A 2AFHE 2V7QD 1RC8A 4TL8A 5JS8A 5FOWA 4ZDJA 4ESVA 3A1UA 4IJMA 4DDWA 1E79A 3BWDD 3CPJB 3M1IA 2N46A 1FP6A 4BLOA 3TQFA 1OH6A 4FCVA 5EZ6B 4D2IA 1S3SA 3R9XA 2REOA 1DELA 4M9XA 2WWFA 2A3RA 3B1VA 1CEEA 1R6BX 1X3SA 4GI7A 1R0WA 2ZS7A 1WA5A 3L0IB 3VR1A 1N6NA 1TF5A 1NN5A 2HJGA 2X19A 3K0EA 1KHTA 1U0HC 5KYKA 1HYQA 1QHHB 2ZRPA 4F38A 1E2IA 3GEHA 5FFMA 2BVNA 5IT5A 3GJ6A 4EQ6B 3O8RA 3AGPA 3ZIAA 1W4BA 4G5SA 2C95A 5B57C 1GRQA 2GTPA 2XNDD 3LXXA 1I4LD 1MH1A 4OK3A 3EX7C 2A78A 1N5KA 1D9XA 1GRRA 1GTVA 3JZAA 3X1DA 4QJ3A 3Q7QA 3UIEA 4RSGA 3GJ7A 4DDUA 1IBRA 1FMJA 3EIHA 3PG5A 3RS7A 5AUOB 1U94A 1G3IA 2BBTA 1R8QA 4PSKA 1G3UA 3D6TB 3VU9A 1G6HA 2YWHA 5J5CA 4P32A 3RSOA 4M9QA 4DLZA 2EVWX 1XD9A 3EZ2A 4CDGA 4KU4A 4C30A 5DYIA 1OPXA 4KHZA 2XNSA 4X8OA 1F3OA 1E0SA 1EK0A 1GNRA 1L2TA 2IYLD 2QZ4A 2VP9A 3FTQA 3VX4A 2EWWA 1WE2A 2QTVB 4AI6A 3GQBA 3TH5A 4OK5A 1AS0A 2WAYA 2QN6A 1TUEA 3GLGB 3CPHA 3C16C 4W7SA 2D74A 3A4NA 4E22A 4JSTA 3T1QA 2IYVA 2Q9AA 4OKSA 5HTKA 5C46F 2J87A 3AVYA 1XCGB 2PJZA 1U99A 3ASZA 1Z83A 1E9RA 1ODFA 3FDIA 2ORWA 2QBYA 2IS4A 2PLFA 1GWNA 4EFNA 1CF4A 4LPSA 4ACBA 1IY0A 2GJ9A 1E2KA 2IXFA 4NYIR 4C0BA 5L3SB 2JJ2A 3CONA 1NF3A 2ZRJA 3SOPA 3B1YA 3LX8A 2Z83A 4URYR 5JMTA 1KDOA 3T1TA 5EJEA 2AXPA 2AWNA 2CBZA 2F43A 2EFCB 2GJKA 4WXRA 1T9HA 4BE7B 4ERNA 2ANCA 1IXRC 1O87A 1U0JA 4HB4A 4M1MA 2IWRA 3LH5A 2WOOA 4Q18A 3T1VA 3K09A 3PITA 4Q4AA 1W4RA 3W9YA 1W1WA 4TLAA 1Z22A 2ZR7A 3FKSD 4JBYA 2W2VA 3PV0A 4KO8A 4TL9A 4A9AA 2VF8A 3QXHA 4RFSB 4O0MA 3L0OA 1VG8A 1Q1ZA 2YC4C 4BECA 1FPMA 4OI4A 4B6FA 3QQ5A 4YMTA 3PEYA 2JA1A 4NDZA 2I1QA 1G1MA 3G82C 4Q7KA 2R6CA 4JKIA 2CK3A 2J7KA 4Q1FA 2OG2A 5C4GB 3QE0A 1RYFA 4Q4HB 3CBQA 1X6VA 1NN3A 1GFIA 4C0HA 3GLFB 4RD4A 1P61B 2PT5A 1J2JA 3IIKA 4NYIQ 2AL7A 3GLIB 2F7SA 5K8UA 3RSLA 1G6OA 4CIDA 1ZMXA 3NKVA 3CWQA 4D0LB 5JI3E 2OBNA 5ANRB 3EAQA 1P60A 2Z5FA 5FUYA 3CB4A 1DBSA 5TY0A 2O0JA 1P62B 3I1FA 4PSVA 1AIPA 1G8HA 2GK7A 1QF9A 3LLUA 3OEHD 3IO3A 2O8BB 2PZFA 4QHTA 3TNFA 4KITB 2ZAOA 1IQPA 3CRVA 1D2MA 2BMFA 4V02A 5AUPB 3MG9A 4WZAE 4JSYA 5IK2D 1XD2A 1JB1A 121PA 4NH0A 1H8EA 4LYJA 5FOXA 2GBLC 1YZKA 5KSOA 5CLLA 1JECA 4M2LA 3BAFA 1JALA 4RKFA 2OCYC 4GP6A 5DHFA 1QHXA 2WWGA 3CRW1 3JVVA 2OO7A 1NLFA 1XXHE 2ZRLA 1F2TB 1SHKA 1HE8B 1XFAA 3W5JA 2H57A 5EP2A 1EX6A 2YVUA 1XXHA 3B13B 4EUNA 4KYUA 2FU5C 4UQOA 5FL7A 1YU9A 4A0HA 3LXRA 3C5HA 2XX3A 4IDHA 4HZUA 2TMKA 1Z06A 1NMZA 2DPXA 3LLMA 2FPKA 4BFVA 1ONBA 1MRNA 2E9SA 2B21A 1AM4D 3NG1A 1EFRD 5EP3A 1Z0DA 3CRMA 4DXAA 3CW2A 3D8BA 4PO8A 4DCNA 3LQRA 4DLRA 2JLUA 4QFMA 5KNDA 1NP6A 2ZE6A 721PA 4C7OB 3BERA 1WRBA 4QXAA 3R9WA 1XMVA 3EPKA 1IAQA 2RHMA 4MKIA 2G1JA 3R8CA 4F91B 2C9YA 2XSZD 2PZEA 1COWA 3FGNA 4MUAA 2QM7A 3WYFA 2N42A 3ZJYA 5AUNB 3OAAD 5FOUA 1Z6AA 4NZYA 1E3MA 1BMFD 1RKBA 1GP2A 2IYYA 4LX0A 1AS3A 2C5LA 5DI3A 4IHQA 2WPDA 2F3RA 1SVSA 5JRJA 1JEDA 3S1AA 3TSZA 1YKSA 1Q20A
chains in the Genus database with same CATH superfamily
3WGVA 5J2TB 2R9VA 5FQNA 5ICCA 2HF8A 4RZ2A 4I1PA 2H31A 1NXXA 4M8IA 1ACLA 2VP2A 2BE7A 3Q7TA 4REQA 4IINA 3L4EA 3OFNA 3PS9A 1J2UA 1IEQA 1R4AA 4REMA 5AICA 1XCPA 3HI4A 3O5AA 3SKVA 1DAGA 3P9KA 3GJ4A 4MR8B 3H5LA 1WNTA 2A4KA 3UXYA 4ZEVA 3V4RA 2KLHA 3LP5A 3PE3A 1TF2A 1EA5A 2G88A 4I5FA 3EGXA 1KERA 3VOAA 1HXHA 4RTPA 2R6DA 1NXVA 1QH1A 1KJYA 1UWKA 3NONA 4Y6OA 3K0FB 2XVMA 1UC5B 4LHSA 4KUGA 4QIHA 4Y3UA 4GMHA 1MH9A 3ZI4A 4GPTA 3G5MA 4XLLA 3V4FA 3G9QA 2RGBA 1WF3A 5IUKC 1RI1A 5EFOA 4IZIA 1OMOA 1N8TA 3NOXA 4D79A 4FS3A 3EZ6A 4ZYZA 1Y6ZA 1NW4A 5M04A 3KUDA 3I2HA 4I7EA 3VR3D 1EU1A 1ENOA 1UOOA 1HDZA 2QTGA 2YQ4A 3D2BA 4KYTA 3D0KA 4TOIA 4H3SA 4B6OA 2X40A 2X2OA 4I6GA 2XMPA 4C2AA 4NCAA 1E7MA 4Q34A 2ZDHA 4CGZA 4X90A 4X7PA 4JI0B 1EWKA 1SULA 1ID8A 3EZLA 4FCTA 4ZN6A 1L4LA 1X1SA 1GR1A 1VRVA 4IVQA 4TVKA 3OQBA 3B2NA 1SXJB 4KWCA 4XSHA 2EBUA 1Q14A 4A1OA 1QVWA 1AZWA 1SU8A 3EEQA 4BFZA 2ZUDA 1SA0B 3HCOA 3EPRA 4XASA 1C1DB 2XE8A 3IA2A 3IOEA 1ZY2A 2J9GA 1HZZA 2FRVA 2AX3A 4XX0B 2BTQA 4M0MA 2ZXFA 1P2TA 1YUNA 1LK5A 4PLTA 5C2JB 1CIPA 3QKSA 2ZYUX 4BUJA 3WMGA 1EWVA 3G0OA 1JI0A 4G85A 5MN4A 3TB4A 1VCNA 3K70D 2O59A 4Y9RA 4WK0B 3NI2A 4W5RA 3KPJA 5BWCA 2HF2A 4JP5A 1VBMA 3KAPA 1K86A 1XYVA 2O8FA 1CD5A 3N3AC 1DHRA 5AJUA 1F7UA 3OE7A 1QYDA 5FWNA 1E3WB 3E5NA 4LQCA 2QHXA 4QFCA 4U2GA 5BUZA 4TKLA 2ZIUB 4X8MA 5ECGC 2WV7A 5GINE 4BO7A 3SYLA 1W5EA 4DUYB 4G23A 1J1UA 2ZTLA 3H87A 4GVPA 4WN9B 4KH1A 1A04A 5ITSA 3G8CA 1SPBS 3QVWA 1UZUA 1RABA 2JBWA 2XF2A 3KZXA 5T7BA 2G5TA 4F97A 4RD3A 3A9RA 3DLCA 4GMFA 3AILA 2B7BA 5G53C 1UQRA 3D7RA 2ST1A 3NWOA 2CHEA 1OLXA 4CUZA 5LZ9A 2NG1A 1GVNB 2G28A 2QD1A 1FTQA 5KOYA 2CYBA 3A31A 1PV1A 3VR6D 1FRVA 4BFSA 2WNSA 1PRYA 5LP6A 4BMNA 2MYUA 3MIZA 1JBEA 2EKLA 2YXPX 3NDPA 3OT1A 1HK7A 4RVOA 4U9UA 1AURA 3A36A 3WHPA 2HM7A 4PS0A 5FCDA 1K63A 3LCRA 1PJTA 3PGKA 4J94A 3X1ZA 5CHYA 3WK7A 2V7UA 3WLNA 2JH8A 3KTAB 3RYFA 2JS7A 1E2MA 2ZAMA 1EAYA 2J5QA 4EUEA 2ODPA 2FFJA 4BRUA 2JDID 2R4TA 3BC1A 4O08A 5JMOA 1AA6A 4H31A 4CR8A 3D2AA 3EPPA 4NSNA 3AV3A 2YVAA 3S2EA 1J9EA 1REQA 2H2AA 2ZYVX 1T2CA 2JBHA 2JBAA 1ZSVA 1NXSA 3FNBA 4Q4CA 4AB1A 4MR7A 2ZJ1A 4G1MB 4ZCRA 5FBHA 1MJGM 2AHOA 1MHPA 2QF7A 3EWNA 5SY4A 4FMCB 4TRJA 2X8JA 4GXNA 4TQGA 2DH6A 3UK6A 2ZSBA 4FZRA 4QNMA 4NJMB 2P5UA 1S02A 1P6XA 2E1PA 2CFRA 2V3VA 3NBQA 2FPOA 4MPTA 4Y2QA 1OC4A 1QX4A 2QSYA 3OIGA 2WJ4A 3FBGA 1U8TA 4MSUA 1K9SA 2PWBA 3TL6A 4OHOA 3R3YA 3RGGA 3TSYA 5T5QA 3DCIA 4M46A 4AKHA 2W4IA 1SKYE 1FE8A 2W7TA 3DOJA 4QM7A 2Q7XA 4AQ7A 2I4LA 4F85A 1OKKD 4L4UA 5IVKA 3G9TA 1DIGA 3CGWA 3TLAA 4HMOA 1IL0A 1LNQA 3FVWA 1KEZA 1IVNA 3JWGA 4BFLA 2FFAA 5ESWA 4EPVA 2R87A 3I53A 3I9V1 4I5IA 4JZYA 4XVQA 5B58C 5BN3B 4A0FA 1AO0A 3NIGB 4GGOA 4CE6A 5K0TA 1NRJB 4KXYA 1LDNA 2WD7A 2ZUSA 4M49A 5G1OA 5J4YA 5JZBA 1RRPA 2NO6A 2P4HX 3KXPA 1Z4QA 3DEHA 3AI3A 2W0SA 3H3JA 2M1ZA 4B3BA 1E6CA 3ZVMA 3LOPA 1S2MA 1BEZA 4TV9A 4JP2A 3I2IA 4JENA 3KEGA 5LZ8A 2W2MA 4D9KA 5CB6A 1ZVVA 1QR6A 5CBPB 1X87A 4LF9B 3LA8A 1SCIA 1FFSA 2Y4OA 4NENB 1BIFA 1U02A 4KZPA 4YT2A 4GMKA 3PFWO 3PHJA 2AJDA 1R50A 5JD4A 2PNFA 1ISJA 4ROSA 3SJUA 3ELDA 1BN6A 3HL4A 2AOUB 1U3VA 1KMHB 1QKJA 1U1DA 2JFHA 5FPPA 3RSSA 4DC1A 4KMRA 2IY9A 1H4QA 3GB9A 4JX8A 1TD9A 3A05A 5BQPA 2R86A 3EYAA 1NW9B 1KO1A 1MAAA 2WMYA 1NNLA 2ZJ4A 4MI1A 1ZSYA 4UE6A 1SCAA 2FEKA 3HJUA 1P5RA 3WLOA 4KXNA 4F2DA 5JQGA 4EW2A 1RCTE 3RI3A 4GEKA 5KTNA 4CKYA 4E5MA 1PKEA 2ZJFA 1M2FA 2H1IA 4EHFA 3RUPA 2WINI 3LRTA 5D3QA 2PK3A 2QY9A 3A4IA 2ZUWA 5SZHB 3AGQA 4F3RA 1DBQA 2DJ5A 1OAOA 2Q1TA 1KGDA 1RXYA 1CUHA 2QL6A 1T15A 3TKAA 5EAIA 4BFUA 2J46A 2ZITA 3GROA 3UY4A 3TX2A 1QCCA 3P32A 3WMFA 4AJNA 1C14A 1WM1A 3AKEA 2OBBA 2LP4Y 4FKZA 3J81k 3AXSA 4DN6A 5D5PA 4PAOA 5CFPA 5HXAA 1YRHA 4DUZB 2QRKA 5IN5A 2PGAA 2VKQA 1XZNA 3GFVA 4MJLA 4PAQA 3SS9X 3VISA 4AULA 4HVCA 2P6PA 4R1QA 4PFSA 1HM5A 2EZ9A 1OI4A 1VJCA 3BHIA 3B1FA 1NOIA 4ND4A 3R2JA 5K6TA 2OD7A 1GGHA 1U9ZA 1UP7A 4C7MA 1Y1SA 1M2OA 3VOBA 1RMQA 4LOIA 2ZR8A 4K0KB 3RVOA 3OZEA 2RHBA 3LVQE 3HLKA 5AK4A 1JLKA 4S0ZA 4O2LA 3WFZA 3T52A 2WZCA 1AKVA 1GNQA 3D0RA 2HA5A 1C9DB 1VJ0A 5JEEA 1S2LA 4P3NA 1YOBA 2I03A 4MW0A 1LPAB 1NU6A 4ND5A 5LQJA 1F9EA 2FPGB 3MAGA 3CURA 1P4HA 2J0UB 3KYDB 3E23A 3R4VA 1QQ7A 2OHJA 1HL3A 1CB0A 2CJWA 2WG2A 3RS5A 1L5GB 2FK8A 3ZS8A 3M6MD 3V00A 3ZKWB 5KC9A 1E69A 4HAVA 1LRLA 3HV0A 4B80A 1BAPA 1P2SA 5H02A 5J47A 3KO8A 1TM4E 4RY0A 3DV2A 1U6IA 3M4JA 1VE9A 5E1BA 2OKCA 3WSWA 1V11B 4B46A 2WJIA 4MWGA 4URZR 1YBHA 2VK4A 2WYUA 2FMFA 3K6JA 5T57A 4UNQA 4QL3A 1JHAA 1S2NA 3O38A 2BP7B 2WKQA 4IDNA 4ZRDA 3C3WA 3TZLA 3QA9A 4F4HA 4MV1A 5EJ5A 2B7CA 4O0LA 4RADA 1PJAA 5J5AA 4MB0A 2FW9A 2YINC 1YDMA 4LJSA 4N49A 1XNHA 1IRXA 4UC0A 4WCFB 5C0OE 5JWRA 3L4KA 1R6DA 1UF9A 4B3IA 4LDAA 2F8TA 1ILEA 5KQRA 1Z17A 4FFMA 3N6XA 4URHA 1BJTA 5DYGA 1TQ6A 3WDLA 4BCDA 5BV2P 2MR6A 5EE5B 4F4CA 3QPAA 4YJDA 4M6WA 1VJ1A 1YQWA 2QMEA 4G4JA 4YHHB 4GOJA 5D00A 5LQDA 2ZIAA 4B09A 5JJKA 4TPKA 1JJVA 1QCDA 4NJEA 3H65A 5DO9A 2RH9B 3L7BA 1DAOA 1M8KA 4UVDA 3O4VA 1QQ6A 3TM5A 1KY4A 4PO9A 1XZEA 3NEPX 3SC3A 7GPBA 1PJZA 3Q8MA 4JC8A 3VKVA 3W04A 1XEFA 1BVHA 2ZUCA 3L49A 4Q1VA 1H1LA 1DKMA 1O9GA 5ILGA 3F7MA 3OJEA 2M6KA 4Q1CA 3UJ9A 3RK1A 1YCHA 2IOFK 1RQGA 1VJRA 3PFFA 4AJ4A 4BDTA 1WSDA 4CMAA 1F8YA 1E2EA 2AR7A 4HDRB 4XUDA 3VNAA 3LECA 5A7GA 5LQMA 1JJBA 1ZL2A 5K45A 4B3SB 3R40A 4AX4A 4D9CA 4E70A 1CNFA 1RBMA 4DCUA 3ZU3A 4LVOA 4C29A 4ABYA 4JL8A 3FA2A 1MRZA 4NY1A 5D3MB 2RHDA 3PZRA 5CFOA 1BRTA 2C5BA 3KKNA 4TLDA 8ABPA 4DMHA 4FBGA 5CM2Z 4CTNA 4CQNA 2OV1A 3WLQA 4FGLA 2X1MA 4FFRA 1OTYA 2HIGA 2RKBA 3O8NA 4LZJA 4Q3AA 3L77A 2JFGA 3OU6A 4TTQA 5D3ZA 1XWFA 4X8HA 3NEYA 1D2EA 1PGOA 4FFVA 3X1KA 5BPFA 3QX7A 1GTSA 1QGAA 1JIJA 2AVDA 2ZSFA 3IP3A 4HGOA 4PY2A 3TGLA 5A3RA 4RL4A 1E63A 5H68A 5JPDA 1GZUA 1JG7A 5AVXA 3EUAA 1Z7GA 2BCGY 4PX9A 5I9SA 5L40A 3OBIA 2PBFA 1PN3A 3OKFA 4B8YA 3EVCA 1KKMA 1G55A 5HF6A 1DMSA 3DZCA 3GDHA 2YY5A 3V7YA 4J8PA 4B6EA 1VXOA 1MAUA 3FVVA 3FLMA 1FFCA 3B6MA 1GSHA 3Q72A 4PLZA 1CR2A 1GLNA 1KBOA 2D2IA 3ISTA 3PQDA 3R0JA 1SUSA 3VNRA 1I8TA 1OT5A 1Z63A 1KYYA 3BK7A 4GRAA 1TRKA 1SUBA 2DUJA 4K7JA 4OHPA 4S2EA 3UOGA 5MHTA 1I2MA 2J9YB 4BGDA 1CRPA 2ZB7A 3BGSA 1CJUC 1PT8A 2V7BA 3AR5A 4ARUA 3A2KA 3GZTB 3RROA 2IE8A 4AECA 3S7ZA 2P78A 4HDCA 4UULA 2BHNA 1VJTA 2AA3A 4JQZA 1UAAA 3Q2IA 3UJ8A 3EWAA 2BM0A 3SK0A 4JVSB 1NPYA 4OL0A 2BOVA 3TE7A 3N0XA 2QAGC 1JVSA 2P6OA 4IJUA 2FQXA 2PA3A 3OFKA 5FAXA 1R9GA 1XQWA 5HYVA 4RIFA 1CZRA 4D4IA 4B0OA 3T94A 4LOKA 3M49A 4YCSA 4OHFA 2OVFA 1YFJA 4AL4A 1WZIA 4U9IS 3BWYA 3CRNA 5KHOC 4W5OA 1SR8A 1L5LA 1XTRA 2J3EA 1T13A 5H7XA 3O0TA 4QQRA 3ICQB 3RRZA 4YAJA 1ISRA 4IOKA 3V1TC 4KR7A 1WBBA 2OCIA 3ZXYA 2OV8A 5K3AA 4AG3A 4RDXA 4DWWA 2JLBA 2ZTSA 4DMMA 4KJZA 3MXTA 1YS6A 2QNRA 4HRAA 4IFBA 4IRUB 4WBNB 2GAJA 2IEZA 1O0BA 3DEIA 2HZBA 2MYTA 3DAHA 2VZ8A 3IIJA 5KMGB 3O1HB 5D1HA 2YZMA 4A2PA 3ES9A 3CMMA 2FETA 2V96A 5JTUA 2DHDA 2Z95A 5FLXA 5I7RA 3M4ZA 2AX4A 2I62A 4ACAA 1I6LA 2ZR0A 1R8XA 4ADSG 3LUFA 3IVCA 1O6GA 4XWAA 2DETA 1QRSA 2CNLA 3Q3EA 4MMYB 1QFJA 3HU5A 2F64A 3BCSA 5TT0A 2QEQA 3PYXA 3UQYS 1QIIA 5AW0A 1XZPA 4JBWA 5AI8A 1GG5A 2JIZA 1ULBA 2CKDA 3X43A 5JNWA 2BKVA 2V4ZA 3BWBA 1O94A 4EQ6A 4LJLA 1MG0A 3UQZA 1V9SA 1UDRA 2CSUA 4OGLA 1S1MA 2AG6A 2SBTA 2QD4A 3PDIB 1Y3CE 2P9HA 3DWEX 3IAHA 2VAWA 3PDCA 3UT6A 1VDZA 3VR2A 1WCYA 2GOYA 4UCWA 5EXSA 2YY6A 1CJMA 2C7QA 1E9DA 1T3ZA 4TLLB 5IDYA 3R3JA 1ESEA 3T0GA 1I2DA 1QGDA 1T29A 2HSGA 2RCYA 3PQ8A 4JLVA 4WK2B 3KSZO 3UNXA 4ZGWA 2UZ4A 5CLJA 5F4ZA 3WGMA 4DG5A 5F52A 5K0GA 1TL7C 2GN6A 4N03A 3FD8A 1J23A 5D7BA 3ZBQA 4KKVA 3S68A 1GPAA 2ZBDA 2CF6A 5K0SA 3FUWA 1D0SA 3C5VA 1YU6A 1EGVB 1V5FA 4BE9A 1FFXB 1Q7CA 1L8XA 4JQOA 2ZGVA 1P4RA 4LDPA 5DGDA 3O0DA 4W9NC 2MSDB 1RSZA 1UBOS 4LG1A 3DL4A 1O97D 3A4MA 3FPBA 2AMJA 3HU3A 3CEHA 2OGSA 2VZEA 3D8RA 4R8LA 3RYIB 1O96B 2CCKA 4YH1A 4KV7A 2D3TA 2BM1A 4OP2A 3M3DA 1XNJA 1RMTA 4OA5A 3SQOA 5B1EA 1NDUA 2YMQA 1D5WA 4UTZA 1JIXA 4KN8A 5E2IA 3FOEC 4KQ9A 3UF0A 1DRVA 4W1RA 3GLGA 2FR0A 2G0NA 4B45A 1D04A 5A4FS 1P1FA 3H05A 3DCNA 5J2TF 4JEIA 4RD0A 4DJJA 3B70A 1DUIA 1FOEB 2FXVA 3E58A 4I5EA 4PYLA 1I3KA 1ODLA 1GPBA 1V16B 2D1TA 4YJHB 4HAXA 821PA 1XCMA 4GGPA 4WXYB 4PZUA 5IF9A 4EB6A 1WCIA 1YZLA 2GHTA 3N0TA 3ESCA 2P2ZA 3E53A 4XTCS 4EELA 4ES6A 3ANLA 4KACA 4B35A 4EHLA 2A7QA 2VK8A 5AH0A 3S6JA 1VP9A 3DMNA 1CY4A 3MWJA 4DLLA 1FMFA 4FMPA 5MF6A 4GC9A 1H3FA 3N2ZB 1RXEA 1YR7A 2WYVA 4YAEA 5BR7A 4AKSA 3K0CA 5TQ0A 1K7XB 4MHSA 3OM1A 1QTQA 2C0CA 2CKMA 3VRHA 3LNCA 4GU5A 1QZUA 2CXPA 2Y1OA 4IZOA 2WG1A 4QSHA 5K6AC 3HBMA 3UBMA 3B38A 1CZUA 2PVSA 4OOFA 4WOPA 3M82A 5D5QA 2BCEA 4PZAA 3RVJA 1CR1A 2GN0A 3KOWA 2MINB 2QVCA 3I76A 4E3ZA 4PNHA 5AI4A 4EMSA 3NAGA 3ANNA 3I8XA 1Z73A 2Y9PB 3FSGA 1R0LA 3H1BA 1YR8A 5BSVA 4BKQA 3DMTC 3Q2OA 1X94A 1CEYA 3BMQB 1AX9A 5EIHA 2ADMA 3F71A 1JSLA 4GSLA 1IN4A 1NFQA 1S3GA 1Z36A 2PX0A 3P20A 2O06A 3VZBA 1T9AA 2ZW9A 1U8YA 1M8GA 1SVLA 2BKXA 3KQYA 4EKNB 1ZYUA 4EW3A 2H8KA 2JJ1A 4IIXA 2JHFA 4Q9DA 1GT91 1OBOA 1CZKA 1OLSA 2BM9A 2ODWA 4MROA 2HMYB 5C8YA 4ZJPA 3NBFA 1C1HA 2DP4E 3HYRA 4LYDA 5JG7A 2UYYA 3QP9A 3GLFE 2LGJA 1UEXC 1F2UB 4RPCA 4C6TB 4FS8A 3CF4A 3AHIA 1GKUB 3FBWA 1QFXA 3KPUA 3Q87B 2CNDA 3DL7A 4KW7A 5FYDA 4CMEC 3KQHA 4MTLA 1RBQA 3JYHA 1ZUD1 3DLAA 4NF2A 4B3CA 3A10A 4I1YA 1PD1A 2ZRHA 3WRVA 5IM4F 4ILKA 1HPLA 2PX6A 2VG8A 1VHQA 2WWXA 4DV3B 1IZ9A 2PSFA 3B5IA 1GGMA 2KSQA 3HB1A 3LQYA 3UOAB 3IO5A 5ALYA 4E5PA 3CLHA 2FJUA 3HKEB 3OLCX 1QQAA 2JGIA 2IYSA 3DVSX 5CIQA 1T4CB 5LP6F 4KFCA 3GPCA 4JC4A 2TS1A 1MT3A 2AI1A 3LD9A 5DBOA 1UPTA 4DQXA 1KY2A 3FKSA 4MWEA 1JEQB 4RH1A 2Q3EA 3P2IA 2A9QA 3NXKA 1J2RA 2WLSA 4MVJE 5CH3A 3VH4A 3IT2A 2FF7A 4DLSA 4F5EA 2PKEA 4Q48A 2HNKA 3CVJA 1PR3A 2A9RA 2PXCA 5HE9A 5CCEA 4RY9A 2FVYA 3SR3A 2Q3CA 4Y9UA 4DDHA 3R76A 4EEZA 3RBZA 5E9QA 2Q6KA 1VPLA 1J33A 4QHSA 2JFQA 1JHXA 4CMGA 3WOHA 2WBLC 4EVQA 1F2TA 2HSEA 1K89A 1Z5VA 3EC1A 5DNVA 3U6BA 1T36A 3OP4A 4HWPA 1GXSA 4XWKA 3L8DA 3DOIA 3NBMA 4YMIA 3RO7A 1CUXA 3L6BA 2CXHA 2XUFA 3R3WA 3ANXA 1RAEA 3EGOA 2WQZA 2V6IA 1Z5PA 4X1KA 4ZOQI 3PNKA 2IHUA 4GKAA 1G16A 3U3KA 2DWPA 2LTAA 2IVFA 5ITZB 3R09A 5BQ5A 1ZNWA 2X2PA 2ORIA 1U3FA 3SI7A 3V1UA 2I4IA 2ZE5A 3AR6A 1I2ZA 2YOGA 5E95A 2BJWA 2NV2B 2JANA 1MRSA 2FSVC 5DEIA 5DN9A 3KU4A 1PR4A 1KWKA 5BVGB 1YDHA 5ALSA 5AHXA 4BZQA 4A27A 2DB3A 3T54A 1C4OA 2BFCB 3L6OO 4LX8A 3KBBA 1I3OA 2R85A 3TPFA 3TOZA 3E4DA 4LI3X 2AMFA 4RPIA 3BK2A 3S28A 3U1VA 5C5CA 1G8KA 4PSDA 3N7AA 3PWTA 5FA5A 1JBQA 2INGX 4FSHA 1NY6A 5B1YA 4YRJA 4G0OA 1OYYA 2FFQA 5GWXA 3W5BA 5DM2A 1AS2A 1P2FA 4Y1GA 3STXA 2JGNA 1TLFA 2CW5A 2MSEB 3CR7A 3KOOA 4QJ5A 1E1DA 3JQ9A 3M4YA 5K0LA 2C2GA 2R44A 3ONDA 4TT8A 4ASUD 2W6CX 3T4XA 4G5OA 3TLEA 1E9EA 4HEA6 1GL3A 3FTCA 1P1RA 1W4AA 4Q93A 4KDEA 3ZVKA 1BVUA 2CXSA 3UTCA 5WRFA 3KB2A 2CMHA 4G1VA 5IANA 1KAQA 4KP7A 4OM7A 4DMFA 5HW0A 4WL0A 1DBPA 2NUPB 5F1OA 5INTA 1V3TA 2ACVA 2VJOA 4PVCA 4OH1A 3ZU4A 3TRIA 1G7CA 3I4FA 4F0JA 2O6LA 1II8A 2IT1A 3QFTA 4HUJA 2VHVA 5TVKA 3FMGA 5BNIA 5JH7A 3IE0A 4NLLA 4CEHB 4KR3A 4ZA2A 3VPSA 3WK6A 1ODKA 3E7XA 1XTIA 2JCSA 2XQVA 3TW0A 5JQGF 2HTFA 3NKFA 2NNWB 1C9JA 1ZO8A 4O3FA 4JCCA 2BJHA 1JFLA 1OXKB 2O2GA 4TS9A 5EKTA 1OFUA 3QF7A 4QYMA 5FI5A 1HZJA 3CUUA 3HUDA 4HZGA 4GKKB 3N2LA 1P91A 3AUFA 2VQDA 3DTVB 1FBTA 3DVLA 3JS5A 3NGXA 1C3VA 2CXXA 2QRMA 4L3OA 4M9RA 4NP6A 1R9JA 2PUWA 3WO0A 3ZPXA 4EHJA 4KE7A 1SC4A 1T26A 3NHWA 4BMXA 2XB2A 1E9SA 2QDXA 1SMKA 1G21A 1MO6A 3B82A 4FINA 1DUSA 4HDKB 1Y7LA 1BVRA 4LXHA 4GYWA 1LF0A 2XRFA 3TLCA 3I01M 1BO6A 4AKTA 1EX7A 3OAAA 3BFVA 4NQZA 3HCDA 4BMYA 4D41A 5HM6A 1DQYA 1U2GC 3CZPA 2ZPUA 1VCMA 3OCVA 3ROKA 3UV7A 1ZHFA 2WM3A 3OZBA 1PYGA 3DF7A 4UDYX 4XD2A 3IUMA 4MVCA 1F0NA 1EG7A 1N6PA 1NLYA 1JDJA 1ZLYA 1WKVA 1PG0A 1WXGA 2YHAA 2Z0MA 3QKUA 4I14A 1PJSA 5TXGA 5EIEA 1U1IA 4M53A 4PQRA 4V0RA 1QUFA 1UK8A 4GP7A 4HTAA 1T4DA 2PCJA 3R6TA 1BKDR 1RVDA 2ZCVA 3F5FA 2DU8A 1Q74A 4GDMA 4DLPA 4JK3A 5EGNA 1OBVA 2R8ZA 3FGZA 3QM1A 3U0BA 5BUSA 3KIPA 2QM3A 2QQ0A 3ZWMA 1U0OC 4E46A 1NPDA 4BJHB 1X80B 4WESA 3A4VA 2V0GA 2V1UA 2IL1A 3Q7PA 2VSOA 1ZU4A 3DJYA 1B1AA 2ZIGA 4I8XA 3KKLA 1AXRA 1E0JA 4KLAA 1IPHA 5IBPA 3ROFA 3HPQA 3K8QA 4JGIA 4F4JA 1KOGA 1DKQA 3PEWA 1N6IA 2H48A 1N8KA 4FD3A 1A4UA 2JA2A 4HGYA 5B4TA 3MXOA 3HYCA 3WWDA 2OYSA 5JCJD 2MMCA 3P45A 1WVGA 2ES4A 2W9XA 1T0IA 2I22A 3DDCA 3TIVA 1XG5A 1NT2A 2EG5A 4WWHA 2FHSA 3T5CA 4AZ0A 5GJBA 5LA6A 3R7WA 3GGJA 3T1NA 2O1EA 1W1UA 4K9MA 3P0EA 2ZRQA 4I50B 4DV7B 3HSSA 3LWBA 3VNSA 4C7XA 1KDTA 4IEEA 4IVRA 3EDYA 1XAHA 4IIYA 5GONB 3V4ZA 5KWVA 5D8DA 1R0ZA 3DMFA 4JV5B 4CL2A 5JSZA 1ZUIA 2IP4A 3ASUA 4X95A 5I9NA 4QYSA 3I73A 3ELYA 3EBOA 3NTOA 4H4EA 1PGJA 4TWIA 1SB8A 4POOA 5JPCA 4R1LA 2GCGA 4FIDA 2HWWA 2Q21A 5BYBA 1Q84A 5IJWA 1N78A 3URMA 1MR3F 1Z75A 2DC1A 2G3YA 4HNHA 4BL5A 4KTTE 2HA0A 4R7ZA 5AVVA 3TGPA 1WS6A 4QA9A 3RH0A 1J4AA 3H17A 3WHLA 3KQUA 3TEMA 1NHGA 3AK4A 2FV8A 2GCIA 2OE2A 4MQUA 4UD2A 4ZRNA 3EMKA 4TWBA 1L9KA 3ZS9A 4JLNA 2E85A 4RWEA 3A0RB 1XNRB 1G60A 1QWSA 4AK9A 4KFSA 4NEHB 2AFIE 2HJRA 2PD4A 2VH5R 4DILA 1D2GA 2G5PA 1GUZA 4HR7A 3FLBA 3AFOA 2P9CA 4EKDA 1GG2A 2P6NA 2H4WA 2FJ0A 3MILA 1XALA 4WN3A 3HDVA 4PZDA 1WG8A 3WL7A 4B5KA 4DIDA 3NH6A 5ICMA 1IK4A 1WHTA 3FCSB 4YCAA 3U3JA 1W581 2DT5A 2G4LA 2KI5A 4XD7D 4F2PA 1X0VA 5GVSA 3WRXC 2HQBA 4PE5B 4QG3A 1ODJA 1H9AA 4PSAA 3INTA 4EFKA 4OQNA 1HFWA 2QUIA 2I3GA 5LQKA 3KVNA 1T1RA 4C88A 1RYDA 4BVEA 1ZN9A 4HYYA 1EIWA 2D2EA 2TMDA 4FHDA 3U7EB 3I9MA 4XJTA 4D56A 3NNNA 5HFJA 1MC5A 2WJAA 2W70A 5KQMA 3AEUA 3O94A 4QPPA 4OGWA 4UAVA 4EGQA 3U4QB 4QTXA 3DB1A 2XMGA 1N2HA 2G09A 2FR1A 2GH1A 2XI4A 3NOOA 1P9WA 1XFDA 3I2YX 3LQQA 4I55A 3DR5A 2GX6A 4RK4A 1Z13A 3JQ8B 1QO7A 3N8KA 4TX1A 4NX2A 2RGNC 3T4PA 4J29A 4JT8A 5CM9C 2P41A 3FSJX 2FPMA 3BXXA 4TN5A 2O19A 3VPBA 4P0PB 1TMGE 1BCRA 4ZVPA 3ESRA 5K3SA 5TS3A 1UIRA 2UVPB 3AEZA 1QKKA 4BRWA 1MNAA 2EEZA 1SIWA 3FPHA 2VJBA 1T34A 3IPYA 4X3CA 1Z0JA 1A8IA 2WMNB 1G7RA 3NHRA 2NVBA 3L1IA 5AI0A 4DR1B 5IAKA 1TYDE 2HA6A 3SXPA 1OIWA 4GLJA 4LSZA 3HBAA 3UFXA 2RAFA 2WJYA 4JZKA 3RK4A 1SBIA 1T8PA 2N0SA 4HKTA 5E0OA 2QJOA 5EZYB 2HRQA 2YYAA 3EGEA 2XHEA 2B2XA 2QRZA 5AM1A 2IZOA 1TAGA 3TE6A 4G65A 4TZKA 1G8GA 2C7PA 3SDSA 1HL7A 3T61A 3GNSA 2O0MA 2R62A 3IV7A 4ZT5A 2VF7A 1Q2UA 1Z4IA 3ZG6A 2BDEA 3BRWD 3NBXX 2Q0SA 4Q1BA 3COVA 4DUGA 5KWJA 3TDNA 4D9NA 2DY0A 4QGFA 1CJKC 3OPMA 4YLEA 5LBUA 4A2QA 4XQ0A 4WAUA 4IXDA 4LCEA 4UNSA 5AXBA 4EPTA 4Z5XA 3C3DA 3TUZC 3QU5A 3O82A 5KCMA 2W22A 3CG4A 3CWCA 2GK6A 3EXIB 4QNNA 2G9NA 2WTUA 1VKHA 1ZGCA 4HQ6A 4IOMA 1CUEA 3SF8B 3MCUA 2ZRCA 1XRJA 2ZXEA 1XDDA 1P2GA 4B6QA 3P8ZA 1XRQA 5JRZA 1U28A 4KGXA 3A11A 1V1MA 2G63A 4GOOD 1R3DA 4QBFA 3F46A 2GDJA 2WV9A 2NADA 3SIRA 1N5JA 2DWCA 2PZ8A 2H9YA 3VO2A 1W6RA 4D4JA 2JJMA 4RTMA 3QSYA 2GEJA 2FWIA 1GKYA 3SC2B 3BMCA 3ZZ0A 3U44B 3BQ9A 3A3KA 1V41E 2JIRA 4FFPA 4KVZA 2Z1NA 2JLSA 1CF2O 4L8YA 1U7HA 3QUSA 3TVDA 1OILA 2DRIA 1W1IA 2GYUA 2W6ZA 3DFFA 3N5KA 4MQBA 5DTQA 3RUHA 5L8VA 3AR3A 2A5LA 4ZARA 3CV3A 1ZN7A 1NR1A 1P3JA 4JYCA 3BE5A 1I4DD 2F2TA 2V7XA 4MKRA 3EYWA 3RVSA 4ZKEA 4EJSC 4PIPA 1M6EX 2GN9A 2F3TA 1FS5A 4WBNF 1JEAA 3IOYA 5LN1A 2CSXA 1NASA 5I9LA 3TG8A 1KU6A 4INJA 3B6IA 1PSWA 4NFHA 5E1OA 2UUOA 1U9IC 1C3EA 2HU2A 3PL1A 4PYMA 1XP8A 5FLEX 3ZLTA 3ITNA 4MVXA 1P3Y1 5K1ZA 4B74A 1NUHA 2NQ8A 3QYFA 2DBRA 3IV6A 2D4HA 2D54A 3HN2A 4U7WA 2H4ZA 2E4ZA 4EKYA 4EYGA 1JKXA 1RWKA 5BXYA 4DA9A 3I2KA 4L4SA 1KVTA 3TRDA 3DL2A 1V35A 3D5TA 4YGXB 2NIPA 1Z3CA 1JWBB 3AHEA 3FLAA 3V1YA 2JFUA 4ZVKA 3A6EA 4MQFA 5SV2A 2HO5A 1U9YA 1J5PA 3K0AA 5E1DA 4Q4JA 3U7IA 1RFLA 1GZ5A 3U5TA 5IZ4A 4WVFA 1GZ7A 2Q28A 3CLSC 1U11A 3GBPA 4XR9A 4DA0A 4OIFA 2YN4A 3NT2A 4RENA 1K27A 1LDEA 1V9LA 3C15C 3RHFA 1ZMBA 1N2IA 3ORFA 4FB5A 5JSUA 4IF4A 3D5EA 4C0WA 1AUOA 4DRYA 1XQVA 1S8NA 4I1OA 5CURA 4YPOA 3FF4A 3K9HA 3ADCA 1YR6A 5FOSA 2IEIA 3EQ8A 4EATA 3LY9A 1T5SA 3WVNA 3NIWA 1OH8A 3BRQA 1YB1A 1X92A 4FR5A 1Y3FE 2OG1A 3TFWA 1GITA 3K9FC 1QAOA 2QRVA 4N6GA 3FOFC 2RONA 2VRWA 2YFYA 4K8RB 4OXIA 5ALRA 2Q5CA 1YGPA 1M2VA 1UK7A 1IXKA 4H27A 4XGKA 3WIVA 3TL2A 4R2MA 3FAKA 3ETGA 5CVJA 2UUBB 1VMAA 3JU3A 4G1FA 4UBNA 2OQVA 1SHZA 4DAOA 4C3OB 3WLMA 3PGA1 1L5HA 1I7DA 4UBJA 2J3QA 3GZJA 3DFMA 1DCFA 1IJBA 1L7XA 5HKKA 3AERA 1E79D 2B8TA 2AZMA 4HEA1 1KYXA 2LKDA 1T1GA 4M55A 4KXVA 5K3DA 3COZA 3DC2A 5BN1A 2E4WA 1NDHA 4EHIA 3EXAA 4AO6A 4F2WA 1A4RA 2PZGA 5D6OA 5AD1A 2FUNB 4CDRA 1Q5PA 2FZCA 1WQ4A 1J8YF 1DKPA 1WXQA 2PVCA 3CUSA 3ELUA 5KDLA 3RLIA 3PJEA 2NX2A 4Q24A 3T3IA 4A8JC 2VJPA 3DM9B 4HQKA 4RFVA 5HA5A 4GW3A 2DF8A 2G71A 1E4YA 2Z6AA 2FQ1A 3H1GA 4O8CA 1P6UA 4GP9A 3ELBA 4NPHA 4PWZA 5CEJA 4JOBA 3GEPA 3OHPA 4POAA 4RU1A 3EGCA 4G4SO 3FZNA 2VTBA 1A5AB 3FNHA 1IJEA 3EQZA 3IDQA 4JR1A 3KL4A 2HK8A 1QBGA 1U3CA 1ONPA 2C2HA 1XELA 4OREX 4KDRA 4UTRA 5A62A 3NUQA 1E1RA 4DEYA 4TWRA 4RJJA 3T9CA 4E5VA 5JZOA 2GPSA 1Q0QA 3PUHA 4WMLA 3SNHA 4BO3A 2IZZA 3LHSA 5HE8A 2PRKA 3A8TA 5G40A 1OLUA 2CLKB 4J4HA 4RKQA 3UGTA 1KI6A 3CTPA 2OVBA 4AMZA 4QELA 3VVCA 3R9XB 3AVXA 2J3DA 3GN1A 1NVVR 3WLHA 2J3HA 3EPLA 4LC0A 1LA2A 4HUTA 4MVJP 3JQ7B 1X77A 1WPGA 4C4ZA 1QG2A 2QAJA 4RETA 5A71A 2G7ZA 1TZ2A 1V4BA 2GYYA 3Q1KA 4N0EA 4CQLA 1LGYA 4UEOA 4GBMA 2X0KA 3P9XA 3STYA 5DCUA 2C03A 4JEHA 2C57A 1KETA 3ZTTA 3WQQA 3PXXA 1PFYA 3MTBA 2WSSD 3IUSA 5JNTA 1MENA 2PO7A 3KWLA 5H4GA 2PL5A 3QPVA 1PHPA 4UOQA 3RRYA 1UMCA 5F2NA 5KYYB 2O8DA 2Q1YA 3S8EA 4DZRA 1DUVG 3HE3A 5IC6A 3T7IA 3VJLA 4AYWA 2CY0A 1LC0A 3FFXA 2XKAA 1UDBA 3PUKA 3QE4A 1W5SA 1V26A 3B5JA 3QF4A 4NBRA 4F5ZA 2Z3VA 1EVZA 4JT4A 5FOQA 1GTG1 1TCUA 3IODA 1R37A 2QG6A 1CLUA 1T6NA 3HGQA 3M34A 4MEBA 1W48A 4GC5A 4OQ4A 4YT8A 1QIDA 1NKSA 1YBAA 2HFKA 4TTVA 5H59A 3TKLA 4B40A 3D59A 4F1JA 1NZJA 3OBBA 5FPTA 3BH7A 2I54A 1Q57A 3LBNA 4C4TA 1E1KA 3MCWA 3WV5A 5K8VA 1TIBA 2IYEA 1WB4A 4JI1B 1DFIA 1NTOA 1CJSA 2BZGA 3A9WA 2CCJA 4M37A 5TPZA 3PQCA 1Y8ZA 2W0MA 3VSDA 3C3BA 1EVLA 1NVVQ 2R1TB 4YWJA 5DNYB 2QVXX 3AEKB 1XZKA 4MKGA 4YPVA 2H92A 2BM8A 2IBMA 4YRBA 3TBKA 2AI3A 1IHYA 6GPBA 1LV7A 4YCMA 1ZN2A 1KOFA 2O14A 1QK5A 1JHRA 1XNQB 4KR9A 1TYZA 4X6YA 5CA0B 3RKUA 3UXMA 3G1TA