4QGFA

S.aureus tmk in complex with the potent inhibitor compound 38, 2-(3-chlorophenoxy)-3-methoxy-4-{(1r)-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]propyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
196
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
molecule tags Transferase/transferase inhibitor
source organism Staphylococcus aureus subsp. aureus
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
total genus 82
structure length 196
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qgfA00
5B30A 3GFTA 1VG0B 2BC9A 4KU4A 2C2HA 4Q1FA 1MKYA 3HJNA 3X1ZA 4ASUA 1YHNA 2ZYWX 3DEFA 1KSGA 4BQSA 1R5OA 2REOA 1HV8A 4ARZB 2GJKA 5JHHB 1E0KA 1TX4B 4F93B 2GVZC 2Q9AA 3KFVA 1ZW6A 1XTJA 3BS4A 4TMVA 2QPOA 4WXPA 1M1YE 3IHLA 3HYRA 1YZTA 4C7OB 4FWIB 1T4GA 3AUYA 4S2EA 4X8HA 3QXXA 1NVUQ 3MAAC 2JJ2A 1SXJA 2QROA 2WAYA 2O5VA 4TLBA 1NVVQ 1R8QA 2OSBA 5KNCA 4GZMA 4JMPA 4JVSB 3KL4A 2VSXA 1LFDB 2H57A 2YWHA 4FMDF 4CT5A 4DDTA 1NVWQ 4TQ9A 4LUCA 4QBGB 3FE2A 2GF9A 4N1AA 4AG6A 2G1JA 2VLIA 2REBA 1EESA 5GADl 4LK2A 1YQTA 2RH5A 1NMXA 3CH5A 1G3IA 3PUYA 2AD5A 4KYUA 1DPFA 3T06B 2XTZA 5FUXA 1M7HA 4PX9A 4M53A 4FMCF 3RWMB 3GFPA 1BO6A 1BMFD 4UNPA 4DB2A 2OE2A 1HE8B 2XAUA 4EJSB 4A4DA 3DL0A 1TEVA 4O2RA 3X2SA 2YC4C 2ZRHA 1E32A 2F3TA 1JEEA 2N1BA 4K81B 3EZ9A 4P4UA 2ZEJA 1Q57A 4M4SA 5FOUA 1JPJA 2FSGA 1UBGA 4AKEA 1W0JA 3L82B 4TYQA 3G0HA 3THXA 4LJAA 3THWA 1ZM7A 1UADA 1Z2CA 3D7MA 4GP7A 4U02A 2NPFA 1XTIA 3BFXA 3GJ3A 2OM2A 2QNRA 3MJRA 3VAAA 1II8B 1MO5A 4G5GA 1NN5A 4A0RA 1UDWA 2OCBA 3WRXC 2B7CA 5JCPA 2YKGA 1GKIA 1PZNA 1RYHA 2EFCB 1G5RA 4B48A 1HA3A 4DCVA 3WNCA 2ZSFA 3KQHA 4I1SA 4FXPA 1C9KA 5IK2A 1R7RA 1GDDA 3C7KA 3MMPA 1P61B 3QXHA 1OXVA 2X2FA 1UKYA 2CLSA 1U0LA 521PA 3A36A 4A2WA 3NTUA 2QL6A 4FD2A 5LD2C 3KXLA 4PHFA 3WHKA 2ZI4A 2VHUA 3VNVA 3VKHA 4HLQB 1ESMA 1NRJB 2ZJ8A 3CPEA 3D3QA 3G5UA 3MUFA 4OBEA 2GXQA 4WIAA 1OJLA 5FR1A 1TQ2A 5G53C 3X1DA 3QF7A 4PC6A 4KITB 3BB3A 1T8UA 2WWHA 1FW6A 1X8LA 4B43A 3AF4A 2WAXA 2RGNC 5KDDA 2O8DA 5EP3A 1YR9A 2IS4A 1MO6A 2W0MA 3KTAB 4CEIA 1XMJA 4I81A 2A9KA 3TVTA 2VP0A 3O47A 5HZHA 4M9ZA 2WOOA 1XWIA 5KOYA 3O8DA 3I4LA 2IF0A 5L3RA 2WTUA 5JS7A 3PUVA 3TLXA 4E09A 2AFHE 2Z0MA 3DZDA 3IO5A 2CE2X 1KO1A 3W5JA 3LW7A 1K5DA 4LHZA 2HJGA 2P0EA 1XXHB 3PUWA 4HLUA 4KJZA 2WIBA 3NBYC 1G3QA 3CNNA 1N6IA 2ZRPA 2OCAA 3A4LA 1EFUA 3IO3A 2A30A 1QRAA 2J9RA 2LKDA 3QPUA 4NYJR 2R8RA 4GMDA 3QBVA 5HE8A 4Q21A 4QNRA 4BZXA 2I1QA 3QPVA 3QUSA 4DSUA 4DDVA 5FUWA 1ZD8A 1JXOA 3U44B 1QF9A 4KBGA 4I99A 4XSGA 3EPHA 1YRBA 1DTSA 2ZPTX 4GOJA 4D25A 3NDBB 2REXB 4D0LB 4DLWA 5EUMA 4KXFB 3WNDA 2C04A 2EYUA 3CF0A 3GP8A 1OYYA 1LB1B 1R0XA 1KDRA 1XX6A 2V7QA 4JKIA 1LV7A 1E94E 3MLEA 1AS2A 4UXHA 1Z47A 1XEFA 4B76A 3EIHA 3P4YA 2RGAA 4P4SB 1IM2A 5FPTA 3UPUA 1OIVA 3QKRA 1KGDA 3LLMA 1H8EA 2X2EA 1W36B 3ZQ6A 3TVDA 4NONA 5P21A 2IYQA 2IYXA 1E2DA 3SN6A 1K6MA 4AURA 5CLLA 4LGMA 3EPJA 1QHXA 2JDIA 4OHZA 5CB6A 2OEPA 4B34A 4E03A 2FE4A 4E5UA 5K8LA 2YOGA 4L5BA 3OEEA 4M1OA 4BEJA 4HZUB 4M8NE 2QG6A 2GJSA 3FDIA 1E9FA 2IYTA 2Q6TA 2DFTA 4C9BA 3R9XA 1Q1EA 4TSFA 2ZRLA 1NP6A 3CBQA 3BH0A 1G7TA 1N0UA 2PEZA 1A2KC 4FIDA 3GLGA 2NG1A 4QXAA 1F48A 4A36A 3CZQA 1KMHA 3K9HA 4MRSA 1G18A 1GG2A 1SULA 4A1FA 5KNBA 4NP6A 1R0YA 2QMEA 4BRUA 1F2TA 3RLFA 2GXUA 2E9SA 1GKYA 1XCMA 3F0TA 1QBKC 1GL9B 3P1JA 5DN6D 2OBNA 3Q5DA 2QMOA 1Z29A 2WBLC 3EZ2A 4PPNA 4RY2A 3T1QA 2JLXA 1OFIA 4QM6A 2ERYA 1Q20A 1YU9A 1DAMA 3QKSB 4Q47A 2PJRA 3GLHB 3BFVA 3B1XA 4NE2A 1IHUA 3WY9A 5GVSA 3JZMA 3FKSD 4MGYR 3PEUA 2OCYC 5SZJA 1MABA 1XZQA 2NIPA 2Z5FA 3AVPA 3THOA 3KTAA 1NMZA 4CEIB 3C16C 1OXUA 2J3EA 3ETLA 4P3YA 1CJMA 2W83A 2G6BA 2JJ1A 3UG6A 2R6AA 5JHGB 5G3ZA 4DLXA 4AD8A 3RC8A 4JJZA 3AVUA 4AK9A 1OB5A 1NF3A 3SU8A 3E5HA 4RSGA 3MCAA 2R6FA 4U7DA 4H9GA 3LV8A 4QNMA 1ZAKA 2B8WA 2D06A 1Q1BA 3PIRA 4HDOB 5TMPA 3GJ5A 4MRPA 2J7KA 3K1JA 2QAGC 4PTLA 4C3ZA 5CB8A 2XTNA 1CJKC 2F55A 3BB4A 1E2FA 2G0NA 2JLYA 2W2TA 3I73A 3RWOA 4IDQA 4JLJA 2J7PA 4Q1BA 4Q4HB 3CF2A 1CR1A 4YLGA 1OF1A 4LJYA 1JPNA 2IYLD 4RZ2A 2QENA 3KXIA 3U6KA 5D3MB 4OKSA 4YXWD 1GITA 1N6LA 2C78A 2BVNA 4OK6A 2GJAA 3CX7A 5CDFE 2FEOA 4PO1A 2HUPA 4M9XA 1FX0A 2VF8A 5BWMA 4B75A 2X77A 3SI7A 2QTHA 3SHFA 4D80A 2H5EA 5B2ZA 5FTMA 1ZCBA 4GNKA 1S96A 1ZM2A 2PCJA 1KKLA 2IUTA 1PV4A 2PZGA 1YZQA 1X3SA 1MOZA 1G4AE 1XEXB 4A8JC 4MYTA 4BZPA 1CS4C 1WQ1R 5M04A 4LPSA 5JCZA 1OSNA 4V0KA 2ZM5A 2A5FA 3IHWA 4PAQA 5DLQC 2C98A 1YE8A 4OQFA 4WXRA 4FINA 4F38A 2WSMA 3ADCA 1C4OA 1XFAA 3KB2A 4ITRC 4LSGA 1T3HA 3C14C 4GOXA 5EXXA 1QHIA 4LHVA 4JBXA 4LHXA 5AJWA 2XZOA 2GVDC 1AA9A 1EFCA 1YZGA 2PT7A 2YOFA 1NLFA 3DO6A 4ZCLA 1T5LA 2P6NA 1ETUA 4YDHB 2ZU6A 4HUQA 4JLMA 4URYR 1G5TA 1VIAA 4JLBA 1D8TA 4XH9B 1IJFA 3ZS9A 1DBSA 3GLFA 3T61A 2Z43A 4ACBA 3U6BA 3OIVA 1ODFA 2QMHA 1E2LA 4MYCA 1GNQA 1TQDA 2KWIA 1ZYUA 3NIBA 3SFZA 1QDEA 1V43A 2VO1A 1ZUIA 3BB1A 2L0XA 2CLDX 3QIAA 1KI4A 4W5JA 3M0EA 4LJ6A 3QG1A 3QKSA 2H17A 3AKYA 3GLFE 4QHSA 3AP1A 4JZKA 5UKDA 3EZ7A 1OYWA 2DFKB 1EWRA 1Z83A 2V3CC 1LS6A 2C5LA 2WWIA 1E79D 3KKNA 4W9MC 1M74A 3PENA 5KDOA 4EAQA 5JWRA 1G21E 1VYVA 3DPUA 2E1RA 4MYHA 3B6EA 1VIYA 2ZE5A 2TMKA 4WBSA 2H92A 4MDEA 1XTSA 5AJYA 1KKMA 3ZVLA 2CK3D 5E3HA 1OFTA 4NHOA 5FI0B 3AVTA 3QEOA 5DNYB 3BJIC 1OHHA 3RC3A 2FNAA 3ZLJA 4CYMA 1KAOA 1T6NA 2VP9A 1NSTA 2VL7A 4OK5A 4GMXA 2YWFA 2P5SA 4A0GA 4EKDA 5IT5A 3LFUA 3LBIA 3K0EA 3SZRA 5GJWC 2ZYUX 1S8FA 4Z1MA 5AJXA 5EXPA 2Q3FA 4CEHB 1TNDA 3U7FB 2Z83A 2WWYA 1RKBA 3AF2A 1VCNA 3FKQA 4GDFA 2NGRA 3EWSA 4BFVA 2ZRIA 2OBLA 2G77B 1P9WA 2A5YB 4JL8A 1ESNA 4X8MA 4KLNA 1ZM3A 3GEEA 5FR2A 1W46A 3RNLA 3PEYA 1G8FA 2OV2A 2ZRGA 2WJHA 5JSZB 3GEHA 3LQRA 1TAGA 3AF0A 3D31A 4D4MA 1AQYA 2PH1A 3NEJA 1VG9B 3T5GA 3WP0A 3QNUA 1NY5A 4LHWA 3NBXX 4B3FX 2CNWD 3UWKA 4Q4AA 4IXNA 2A3RA 4UKDA 3K0FA 2BEKA 2XB4A 1XCGB 3A8TA 3CH4B 1OFUX 4JLPA 2C96A 4HAUA 4U00A 1VPLA 2W2XA 2BMEA 3I32A 3I62A 2QA5A 2WMOB 1MO4A 1P62B 4D6PA 3U61B 2XOKA 4OL0A 2R6DA 2ZVPX 4FCVA 2FGKA 2ORIA 3CB4A 4B3XA 5AJVB 3BOSA 5FTNA 3GLIB 2F9MA 2ZE6A 3AP2A 5JWOA 1XMIA 2Z6VA 2KE5A 3ZZUA 4JLOA 2MMGA 4F91B 3A6PC 4KV9A 1FPMA 4HUQB 3RAPR 3TR0A 3LY5A 1M6NA 4P0TA 2AXPA 2YYZA 2ZJ5A 1E9BA 1IAQA 5CK5A 2LKCA 3QF4B 4XWOA 3OFNA 1OB2A 2JIZA 3SJAA 1W44A 2CVFA 2BBWA 3AH8A 1VCIA 2RGCA 3B78A 1JAHA 4Q03A 1EGAA 4Q01A 1ANKA 2XSZD 3RS4A 3A1SA 1MABB 2QBYB 2CMKA 4ZI2A 2JASA 2HF9A 1CTQA 3IPXA 2DWOA 1X86B 4R2IA 1QVAA 5C4GB 5KPJA 1OE0A 1KO7A 3K9GA 1N0WA 3B85A 5BN4A 3B1ZA 5K8UA 4PR0A 3BBPA 3HU3A 3QXSA 2IK8A 2V7QD 2IYUA 4TQUS 4BGDA 4TL9A 2FEMA 3SDZA 5FL7A 1L4UA 1CF4A 3PVSA 3U3KA 3K09C 4UNQA 4GZLA 3NHBA 3IKJA 4AG5A 4HB2A 2BMFA 1E1QA 3VR2A 4TLAA 1Z5ZA 2GAAA 2AWNA 2BBTA 4MRNA 4JVNA 3NDPA 1ZU4A 1OIXA 3AGPA 1Q0UA 1W7AA 3L8ZA 2FU5C 2DFLA 1S9DA 5J4KA 1N5LA 5DYIA 4KBFA 2IUSA 2XGJA 3WYAA 1IBRA 3V4RA 2W6IA 1OT3A 2WPDD 1E2PA 4IVRA 4LV8B 4Q1EA 4RFSA 2GZHA 4EQ6B 3LD9A 2VRWA 4ZI3A 4PPFA 2ZRFA 3KKQA 4Q19A 2ORWA 2XXAA 1YVDA 2ZUBA 2O8BB 2ZTSA 3PEVA 4RD0A 2O8EA 1COWD 1ZJ6A 1CLUA 1AS3A 3JVUA 4RZXA 3QSYA 2C99A 2KJQA 1XTKA 4P31A 2IEZA 2ZJ2A 3H84A 2FDCA 5JZVA 3AM1A 5HCIA 3B13B 1E98A 1NKTA 4B71A 2DYKA 2QMUA 3NEYA 5DN6A 5FPKA 2D2FA 1JQJC 3QVUA 1XPUA 1M8PA 1E2MA 1TF2A 4GT1A 1VMAA 2BKUA 3THYB 5JEDA 2ODBA 4TYNA 3RRMA 5SZIA 1KIMA 1L7VC 1DEKA 1N6OA 2ZRAA 5TDHA 3DKVA 1DAKA 4Q1AA 1UBFA 5KO2A 3MSXA 3HPQA 4AWXA 4I1OA 2YVUA 2NQ2C 3A4MA 4EPWA 1GSIA 1MV5A 4OI1A 5BN3A 1HH4A 1R5BA 1N6NA 3H2YA 4B3DA 1KK2A 2JIZD 4R7ZA 5TXGA 3U60B 1KZ7B 1YR6A 5B64A 1S1MA 1N6KA 5JECA 5DGXA 1KDOA 4EDHA 3NC0C 2FOLA 1ZNYA 1NJFA 1G5PA 3EARA 1DELA 4BFXA 3L0IB 1H8ED 4RD4A 1OFHA 2VHJA 4LZZA 1GM5A 5GVRA 2IW3A 2HYIC 4TT3D 3C4JA 2VEDA 1XBTA 1DG3A 5D3QA 2CHGA 2GXAA 2AK2A 3CPJB 1DOAA 5A5GA 3AP3A 3OIUA 2QORA 4FW9A 1U9IA 6Q21A 1Z6YA 3A37A 2QE7A 3OHMA 4UNSA 4UQOA 4DDUA 4LJ5A 2ATVA 4PO9A 1JR3A 2CLCX 3AKCA 5L3VA 2DCUA 3DDCA 4PQFA 3KB1A 5A0FA 2YOHA 3TH5A 1IXZA 1BOFA 2D7DA 1OXSC 2F1JA 4Q9JA 3FFBA 4URVR 1A2BA 2GEVA 4KFTA 1W36D 4C4PA 4II7A 3QBTA 3SBEA 5H70A 5HKKA 3T1OA 4JSYA 3MGCA 2IHBA 4IDHA 1JBKA 4Y0AA 4DLRA 1A7JA 3NVAA 2JAQA 3W8NA 4A2QA 3MRSA 4V0MA 2PZEA 3B2EA 5EE0A 4D81A 5FTJA 3IILA 3IBGA 4ABYA 1XDBA 4PC2A 4URUR 1XCPA 4E22A 2WKPA 1AS0A 1HQYE 3NWJA 2QY9A 1W4BA 5EE5B 3EW9A 1ZC4A 2X1VA 1Q3HA 1GP2A 2AD1A 5HE9A 4PANA 2H18A 3L43A 4C0AC 1AQUA 2J1LA 2XJ4A 1SKYB 2A5DA 4JYBA 1S3GA 4L15A 4TYPA 2A5JA 2GBLC 2YV5A 3FOZA 1NLZA 3U3JA 1W5TA 1TUEA 4DCNA 2BMJA 3B9QA 1DAEA 1WBBA 1GILA 4MUAA 2GZDA 1FTNA 2QAJA 4NYMR 4CZ2A 2IS6A 3NKVA 4R98A 4Q7LA 3RABA 4M2LA 1N6HA 1HT1E 2Q9BA 3P32A 5SZKB 1KJZA 5CJ2A 1Z0AA 4D0NA 1Z6AA 2GTPA 3PITA 5EQTA 5TARA 2C8VA 4LJ7A 5EP2A 2VF7A 2NPIA 2XZLA 4OYHA 5CM9C 5EZ6B 3FMOB 1EFRD 4LHYA 3IIMA 1E96A 3OE7D 3KQUA 1OV4A 2C9YA 3AF3A 4J0QA 4S35A 2PLFA 3K70B 2UKDA 5DH9A 3SJBA 1Z8FA 4Z8XA 3JZAA 3TQFA 1KI3A 2JATA 1KI9A 1KY3A 1RW4A 4FMCB 1SXJB 4GSYA 3H86A 3ZVNA 2EWWA 4ZDWA 1JJ7A 4OI0A 2VHTA 1OIWA 1SQ5A 4KYIB 4RCYA 3IEVA 4JLNA 1FNNA 4PPGA 1G41A 2J0QA 2VQSA 3KXKA 2QE7D 2GETA 4O3MA 5J4LA 4NH0A 5LBIA 2GCNA 2QBYA 3VHLB 3FKSA 1Z0JA 2NO7A 4PC3A 2OFOA 1QG4A 3RVBA 4OHWA 2PZFA 4KVAA 3FHTA 1H8HA 4C0SA 3T5DA 2UVQA 2VP2A 3OFND 2ZI9A 1GOTA 3GPLA 1XF9A 4RZ3A 4G01B 3T1TA 5EZ5A 4ESVA 4GPTA 1N25A 1WA5A 2XSZA 3AEZA 2JLSA 1YJ5A 2ZRMA 2ZREA 2BHRA 3K70D 1KJWA 4Q4JB 2IL1A 1UEJA 3WP1B 4QKQA 3IUYA 2CHQA 2WWXA 3E2IA 1U90A 4V03A 3CUEF 4D0GA 1Z07A 3BORA 2Q0HA 2AWOA 2FJUA 2GBLA 4IOJA 1NN3A 2ZVQX 1N5KA 4LJ9A 1VKJA 1P7CA 4Q18A 1QHHB 3MWLA 2ODEA 2OHFA 5FOSA 3BC1A 2OILA 1S0UA 3F3YA 1G8YA 5F98A 4LX0A 2IWRA 2JLWA 2VH5R 5JWHA 3WMFA 2O8BA 3U7HB 3EIQA 2ZRNA 3AGQA 3K0AB 5EXSA 4V0ME 4BPBA 5C2JB 4PC1A 2D7CA 4AYXA 3W8RA 2RMKA 4CIDA 4KFSA 2VSOA 2OBMA 3N2EA 3PQCA 5BYJA 5J47A 2ZR7A 1OH6A 1ZCAA 4PQRA 2FPLA 3K8YA 2QP3A 2G83A 4MH0R 2HF8A 2IYRA 4Q4LA 5FFMA 3I1FA 3RYTC 4B44A 1E1RD 2GJ8A 5HCNA 4NCKA 4B73A 5JJLA 1YKSA 4KCGA 3B9PA 3UMFA 3FB4A 3RS7A 1OHHD 4RKFA 5D3MA 1ZIPA 3E70C 2QGNA 5CIWA 1FMLA 3TJZA 5IRCD 1F2UA 5G41A 1COWA 4R9UC 3B60A 2F6RA 4HAXA 1GTVA 5J40A 5FTLA 1T5IA 4IOMA 5AK0A 5KNDA 4C0KA 1C1YA 2BV3A 2NO9A 4A9AA 4FMDB 4RD6A 1G6OA 1AIPA 4AI6A 1KMHB 3ASZA 5DI3A 1ZC3A 2FSIA 3I5YA 2QSYA 1AKEA 1UFQA 3K0SA 3SR0A 8OHMA 1PVOA 4A6XA 2XX3A 5F9HA 1XXHA 1NBME 4Q1DA 2QQ0A 1GRRA 2DR3A 3KJHA 2DWQA 4HI0E 4JIMA 4GI7A 1UPTA 4OHYA 2HCBA 1J7KA 3U7GA 3ADBA 1II9A 1QZXA 1SKYE 3TGPA 2ZANA 2V1UA 2FSFA 3K9LA 4OI2A 1W4AA 4TMWA 1TU3A 1NBMA 4N0EA 1ZUNB 2ONJA 4ASUD 4POAA 2HLDA 2Q3HA 3K0FB 3GLFB 4NCHA 1NL3A 1P2VA 3QE0A 4CEJB 221PA 2GHIA 2PBRA 4IOLA 5TY0A 3CPHA 2DB3A 2WPDA 3KJEA 3WBKA 4DSOA 3C8UA 4HAYA 5FBWB 1JB1A 1Z3IX 1P75A 1W0KA 4L9SA 3QPWA 4Q7JB 4DSTA 1QHSA 5K8TA 3ZIAD 1T9HA 4DZZA 2GAOA 5FBRB 4KFRA 4BFZA 4Q7MB 1F60A 4TWZA 1CEEA 4NKRA 3P20A 4QHYA 2X19A 3U4QB 3AUXA 3TIFA 2RB4A 2PX3A 4XIGS 2WJJA 1FUUA 4D4JA 3EPLA 1E2HA 1N6RA 3KQLA 1DAHA 1HTWA 3ASYA 3EC1A 4RKEA 4V0OA 4A15A 2P65A 4IDPA 4ZIRA 3KDSE 2OXCA 2JJ8A 1SVOA 4KSCA 4PZZA 1W48A 1EXMA 3DMDA 3UMSA 4CGZA 3PEWA 2B6HA 4B74A 5C1BA 1OH8A 2J41A 4AKIA 4US0R 4NTZA 3T35A 2IS2A 1N0VC 1G17A 3LBNA 4MRVA 5EUQB 3HDTA 1K8RA 5G40A 3LW8A 1ZD1A 1P3JA 2K5UA 3K0AA 2IBMA 2EFGA 4Q9HA 3RRYA 2FZLA 3LBHA 1T3SA 4WVFA 4UXJA 4MRRA 3KQNA 5FTKA 4C2UA 3M4YA 2YNMA 2ZE7A 4KODA 1U8AA 1I4DD 1KSHA 1NIPA 4F4CA 2RGGA 3PG5A 4M9QA 3BK7A 1TF5A 2ZJOA 3AVOA 1QG2A 2EFHB 2ZJBA 2ODWA 4A92A 1DS6A 1W4RA 2ZUDA 3TKLA 3OIWA 3CF6R 4PSAA 2HEIA 4OK3A 3IQXA 5HZKA 3I72A 4JVLA 2R9VA 1IOZA 5JSZA 4JVMA 1IJEA 1KYIA 5JBQA 5L3SB 1FFHA 5AUQA 1JALA 4EFNA 4QBIA 4TT3A 1NVXQ 2BJVA 1LTQA 2A5GA 1DAIA 2V6IA 3LXRA 4OQMA 1OKKA 3SYNA 5IK2D 1ZNXA 3IBYA 3K09A 3B7GA 1NMYA 1U0JA 3GJ0A 2W00A 1BH2A 4LC1A 4NYJQ 4EIWA 1E2JA 4PPQA 1SHZA 4BWYA 4EFLA 1G8HA 3PXGA 3QVVA 3B1YA 3VQTA 2RHMA 1HY3A 1E2NA 1R6BX 2BMDA 5E7MA 1CIPA 3BE4A 2WICA 1VECA 2CCGA 2FH5B 1HURA 2HLDD 5KUTA 2C9CA 1KZGB 4FMBB 1G9XA 4ZV4A 4KAXA 3ZJYA 5J4HA 1I2MA 4UNRA 2J0SA 1Z0FA 4Q9KA 3RS0A 2D62A 5LPNA 4C2TA 2XEXA 4FCTA 3CNOA 4US1R 4ZO4A 3VR4A 2BCJQ 1Y3AA 3CX8A 2GILA 1YZNA 1LNZA 3HPRA 3QQ5A 1ZUHA 3O8CA 1XD2A 5DE3A 3R8FA 2ZU0C 4PZLA 1E4VA 3CO5A 1M7GA 4TLDA 4RCZA 4RD1A 2ZAOA 4D26A 1JECA 1T8TA 2IT1A 4BLOA 3TW8B 4XTRA 1ZP6A 2GCOA 4LPKA 2Q21A 3TW4A 3EZFA 2EYQA 1W0JD 3UIEA 3H1TA 1FX0B 3C41J 4Q00A 2ZI7A 3VR5A 5AR1A 3JVVA 1AM4D 3QY0A 3W9YA 3U3MA 1HQCA 1NNEA 3W90A 1NVVR 1TF7A 1K5GA 1SZPA 3LAWA 5GJCA 5IDVA 3O8RA 1KI1A 5BYKA 3FMIA 3I3SR 2IS1A 1AK2A 2ZI5A 2OFWA 1XEXA 3EC2A 4IVPA 4XSHA 5JLJA 3OIYA 3EA0A 2H7VA 4H1VA 2XZPA 4HAVA 3EA5A 1WRBA 3BERA 1ELOA 1WE2A 1NSFA 2NOAA 1JI0A 2JLRA 1Q3TA 3TSOA 2IYVA 4URXR 1PLJA 3CONA 4DB4A 1U94A 3VKWA 4FCWA 1B0UA 2OCPA 3NH6A 4UNNA 1NIJA 3S1AA 1FL9A 1CULC 2AKAB 5CDFA 3X1XA 5IF9A 5EE9A 2I3BA 1MRNA 2D3WA 4B32A 3SQXA 4BLPA 3U44A 1UBEA 3DM9B 1XPRA 4WZBE 4MGIR 5J4VA 1G3UA 1XD2B 3VHXA 2PT5A 2IXGA 2VTKA 2J0UA 2J46A 1DARA 2JCSA 2EFEB 3CKLA 1F2UB 3CLVA 1G8PA 3GFOA 3UATA 3WBJA 1AN0A 1VCOA 2BM1A 5C46F 1TUIA 1T91A 3IQWA 1R2QA 4B6EA 1II0A 4AKGA 1DADA 5EE3A 5FUVA 1W2HA 2RGDA 2R2AA 4MGZR 2W58A 3VFDA 4Q4JA 4EUNA 2IX3A 3QG5A 4PHGA 4A6PA 1M34E 4Q48A 1E9AA 1L8QA 2J45A 1ONBA 3C15C 4M22A 3M1IA 4B3BA 3ICQB 1GRQA 4C7OA 1KK0A 2QU8A 3VR6A 2ERXA 4L8GA 4LI0A 4M0LA 2FWRA 2PMDA 2BM0A 3KX2A 5HPYB 1G3MA 2F43B 3AVWA 2WOJA 3QKTA 4BLTA 1GNPA 2J5XA 2WJYA 3BXZA 4B2LA 5DHFA 2XITA 1UKEA 4ESHA 2O8CA 2ZROA 2OAQ1 1CP2A 4C0QC 1BKDR 1IN5A 3C5HA 4MKHA 3W34A 4CF7A 4G5SA 1D5CA 2YZ2A 1XJQA 5FL3A 2R62A 1LS1A 3AQ4A 3N70A 3WNBA 2XNDA 3DKPA 4NYIR 1JR3D 1GZSA 2FSHA 2VP5A 2GEDA 5FOVA 2PCLA 4BFSA 4D2IA 1N5IA 2J59A 3QXJA 2BKEA 1DO0A 4DT1B 3QJYA 1U2RA 4DSNA 2FFAA 2FFHA 3MWKA 1JR3E 4EQ6A 2G1KA 3U2QA 3SS8A 3EZ6A 3R8CA 4URZR 3SNHA 2MMCA 2AN9A 2W0SA 2ZJYA 3FMPB 5CITA 4TZ6A 1CJTC 5LB2A 1KNXA 3BGWA 4XD7A 3WRYC 1ZD9A 4LRWA 4LYHA 4OHXA 4OQXA 2CNWA 4PHHA 1FMJA 3EASA 1UF9A 4I4LA 5LDDC 4V02A 3U3OA 4LV6A 1WDTA 5FOWA 2J7PD 1TPZA 4LBZA 821PA 1KI8A 3IDQA 3OF5A 5ELXA 2CCJA 3PFIA 5EP4A 3EWAA 1CR2A 3B5JA 2C77A 2PLRA 4NMMA 1TQ4A 4GBMA 4OHVA 3S1AB 4YMSA 4DUGA 1BS1A 1ZNWA 1E99A 2GDJA 4M1WA 2ODNA 3ZQJA 4LC0A 5DI9A 1Q12A 4OQLA 4O2LA 2Z4RA 1W47A 1LY1A 3TUZC 2O0JA 1ZRHA 3B1VA 4TL8A 2Z4SA 1OLOA 5KTYA 3P26A 2NO1A 4WW0A 1GFIA 4HEJA 1E9EA 3AVQA 4O0MA 3HR8A 1J2JA 3KQKA 4H1UA 4RD2A 3BD9A 2IWHA 1EX6A 4Q5IA 4FN5A 4LBVA 3VR1A 4MITA 5AUPB 3QKUA 2V6JA 3W3ZB 121PA 1OXXK 4P32A 1E0AA 2RAPA 1PLLA 2JJ1D 2X8AA 4A82A 1XU4A 4UJ3A 2AL7A 3OE7A 4HZUA 2WHXA 3QENA 1E2QA 1QHYA 2KSQA 2LCFA 1EG7A 1RE0A 3BWDD 1LF0A 3TSWA 2B92A 4CVNA 4YMVA 1SVKA 4A2PA 1KO8A 3SE0A 3X1WA 4TL7A 1P72A 3ZYCA 3KKOA 2G88A 2YWEA 4GP6A 2JLVA 3U7EB 2QI9C 1U8YA 1NY6A 3VX4A 4DBLC 1DAFA 3HR7A 1Z08A 1E2IA 5G3YA 2F43A 1KDPA 4JBWA 5FBQB 1X6VA 5E7JA 4G3XA 4C0JA 1YZKA 4XVUA 1E1RA 5B58C 1A1VA 2P2LA 1UAAA 1U99A 2FGJA 1DO2A 2GWHA 4JJKA 4L9WA 1R5NA 2IC5A 1U98A 3A4NA 3RANA 5KHOC 3ZVMA 4QRHA 1WBDA 1VG8A 5B57C 4NDZA 3M6AA 2CL0X 4KHZA 4QL3A 1E79A 1Z0IA 4JLKA 1E4YA 4TLCA 2VHCA 2GCOB 1YR7A 4RFSB 1Q44A 2W6ID 1P5ZB 2IYWA 3CRMA 4XTCS 3FMFA 3EX7C 2GNOA 4DDWA 3LX8A 1E2KA 1J8MF 3NBFA 2R6CA 4HAWA 2DFNA 2QZ4A 1IXSB 3IIKA 3UG7A 1FNMA 1R0ZA 1Z22A 1XTRA 2EFDB 4OQNA 3L0PA 4LBWA 2FN4A 4RJLA 5L3QB 1O87A 5TVKA 3R9WA 2A78A 3SOPA 4XOIA 1GUAA 3F8TA 1CRQA 1G4UR 1XMSA 1UJ2A 4MKGA 3Q72A 3EAQA 5KSZA 1LF5A 1RC8A 4DXAA 1KSJA 4RD3A 1Z6TA 1KI7A 2QT0A 4I1VA 4U5XA 3PJRA 4B2IA 4PHTA 3CWZA 2FMXA 1CRPA 2EQBA 2WIAA 3TUIC 4OI4A 4NCNA 2ASEA 1G8GA 1RRGA 2DPXA 2F1IA 4IDNA 4GOKA 3I8SA 2P6RA 2Q3MA 1SGWA 3ONWA 5H1YA 1E2GA 3BH6A 3L8YA 4LDJA 4TLEA 3GLGB 3MJHA 2WWGA 2ZITA 5BN5A 4JL5A 2KB0A 4JLVA 1XRJA 3MFYA 1Q22A 1BMFA 1AZSC 2J0UB 1W0KD 4CEHA 1G7SA 1KSFX 4JS0A 1ZINA 3L0OA 2YWGA 3NH9A 3O8BA 3UMRA 2MSDB 1Z63A 2PX0A 2BIFA 2OESA 3GCGA 1FP6A 4HYYA 1P73A 2OUKA 2XJ9A 4RZUA 4QFMA 3GLHA 2GF0A 4A0FA 5JI2E 3ECCA 1RVDA 3REFA 5JFGA 3BAFA 1VDZA 4QBFA 4JT4A 1GKUB 5A4JA 1VHLA 5L3QA 1X1SA 1JXMA 4FWTA 1Z6XA 2ANCA 4AC9A 3K9NA 2XOKD 4TTRA 5CYPA 4EPRA 2JA1A 3D6TB 3GJ4A 3LVQE 1CR4A 3A1WA 4HUTA 2EWVA 3SFVA 4ON9A 2IYSA 2PMKA 4C0HA 1PUJA 4DLVA 3A1TA 2WWFA 3EIEA 3NC1C 1J99A 2WZQA 1Q21A 3QEJA 4W5WA 3EXAA 3OAAD 4QOSA 4LWZA 2OLKA 3ZVRA 3DMNA 1R0WA 2O8CB 1XNJA 3THYA 2N42A 4BUJA 4IEEA 1UM8A 1AZTA 4NYIQ 2CXXA 3EPKA 1NBMD 1PUIA 2QAGA 4BASA 1UKVY 2UZ3A 4MYUA 2LWIA 4LBYA 4G1UC 1US8A 5HR5A 1P2TA 4DT1A 4IVQA 3AVVA 2FFQA 1JAIA 4F92B 1GIAA 1FOEB 2KBEA 3DHWC 3ZS8A 1KTVA 3SYKA 2JLZA 4HLCA 5KPDA 2GESA 3TNFA 4OJKA 2WJVA 2O8DB 1OKKD 4AKHA 3GLGE 2YHSA 5H8WA 2J0VA 2FPMA 2MSEB 4G0NA 2V9PA 3E1SA 4HDCA 3F5FA 4W5HA 4OJQA 4YMWA 2ZJAA 3P4XA 2ZRKA 3TMKA 3NG1A 1E2EA 4BLRA 1G291 3CX6A 5DISB 1P6XA 2GK6A 3GJ8A 3GQBA 2ANBA 2DBYA 4NPHA 5TB5A 1NG9A 2NMVA 2P5TB 2ZSAA 3UWOA 3VU9B 1IN8A 5CJPA 2ZYVX 3CIOA 4NYMQ 4QGHA 2V4ZA 1E9DA 3LQQA 4F7WA 1VCMA 4FI3C 4IDOA 2WM9B 2FX3A 4QJ3A 5K8IA 3RSOA 5KU1A 1IN6A 2JLQA 2F7SA 2ZUCA 3QI2A 3T34A 2WVJA 1G3RA 1A82A 2WSSD 4R2HA 3IIJA 2RGNA 2IF2A 1NI3A 2C03A 3AF1A 5FPYA 2BCGY 2HCJB 1VYUA 2GJ9A 1P9RA 3ND9A 1NN1A 1PJRA 1KO4A 1J8YF 1CJUC 3B8HA 1J90A 2ATXA 4TN1A 4Q4HA 1SXJE 1CXZA 3VNUA 1O3YA 2FF7A 4YDSA 4HB4A 1DAGA 4MQBA 5KDLA 4BE7B 3CRVA 4URWR 4DEXA 1G20E 3UKDA 2WKRA 3R9IA 4LCBA 2W6JA 4KLZA 3OAAA 2YJTD 5FL7D 1UKZA 2OXRA 4Q02A 1WB9A 4IEIA 2P6UA 4TSFD 5C18A 4LJ8A 5CYOA 2A7QA 4TYWA 2IUUA 5FI1B 2CE7A 4TTPA 3TQCA 1NG1A 2WJIA 1Y63A 5DYGA 1W36C 1E9CA 5JEEA 2HT1A 2PL3A 5JS8A 1XB2A 1Z6GA 4UXIA 1LVGA 3NXSA 3VKGA 2AK3A 4BLSA 2O0KA 3U4QA 3H0KA 4M1TA 3GJXC 4QBHA 2SHKA 2ZR0A 4DLUA 2G9NA 5E7IA 3UANA 1N3BA 1W1WA 2ZAMA 3QF4A 2XB2A 3REGA 3WMGA 4ZIRB 1AKYA 1LW7A 1SXJD 4JT2A 5FPHA 1HYQA 2AR7A 1KK3A 4IHQA 1D9XA 2R44A 2QT1A 2O8FB 4F4JA 4LYAA 3GLHE 2IYYA 1L2TA 1J70A 3EG5A 4PXAA 3X1YA 2ZRCA 3LRPA 1RPZA 3KFXA 4AY2A 1U0HC 4MDFA 3GEIA 3LA6A 4HB3A 4QGAA 3ZD6A 3QOFA 4ZKDA 2BBSA 5F9FA 2WWWA 4HDQB 4X8LA 2RCNA 5IHPA 3TAHA 2GXSA 621PA 3DZ8A 3SEAA 2ZS8A 4TL6A 3BFKA 4BZQA 4YQFA 4R71A 3KJIA 2FZ4A 4JKYA 3FVQA 4A8JA 4HLUC 2PEYA 3TBKA 1XJCA 3ZZTA 3RS3A 4N3NA 1FQKA 2AHOA 4JBYA 3AVYA 4F4IA 5BXQC 1FTSA 3Q3JB 3ICEA 3NBZC 1YRAA 2GZAA 3ND8A 5BW8A 2ZJZA 1AGRA 3QKRB 2JLUA 3MD0A 1EWQA 3FHOA 1TADA 4DHEA 4TMXA 1P2UA 1XJ0A 3GLIA 1KI2A 3D8BA 1G64A 2ZS9A 4KI0A 3K70C 2CBZA 4KVGA 3QXCA 1E3MA 1G7CA 2XNDD 4ILEA 4CDGA 1A5TA 2V54A 5C4MA 2CJWA 5CK4A 2MSCB 2D2EA 2XNSA 5AUOB 2BBOA 1E0SA 3AKEA 4LOAA 5EE1A 1G7RA 1QHGA 4IRUB 2QM8A 2HDNB 3R7WB 2F1RA 1KY2A 3SC3A 1IY2A 2BOVA 3CW2A 3B1WA 3BH7A 2ORVA 1SVIA 5TV2A 4IOKA 1D2MA 1A4RA 1KMQA 2W2VA 3IEUA 3TRFA 1BYIA 4QGFA 4XD7D 2OG2A 2YINC 1OH7A 5GJVC 1WXQA 1KAGA 2NTYC 2NZ8A 5JRJA 4BFTA 2B21A 3R20A 3LNCA 4BRWA 3DOFA 2XTMA 3LH5A 4ZCMA 4Z8YA 5FOXA 2IA5A 1RFLA 3Q7QA 3PUZA 4L16A 1F2TB 2VIIA 2H1LA 3N5CA 1ZM4A 2IEYA 2GKSA 3W6NA 3CRW1 5BQ5A 4WAUA 2AFIE 1SVWA 2AXNA 3FPAA 4DCTA 2VA8A 2HJVA 3RHFA 4BFUA 4DUGD 1MO3A 2C9OA 3CZPA 1CBUA 1XEWY 3V9PA 1F6BA 1UBCA 2KI5A 3OESA 1GNRA 1GL6A 4AYWA 4EFMA 5GJBA 1VTKA 2DY1A 2JGNA 1M2OB 1R8SA 4D82A 4QM7A 1KI6A 3N2IA 4PC7A 1YR8A 3LLUA 1I2DA 2Q9CA 3RS2A 3THXB 1QVRA 1I4LD 1IXRC 1RRPA 4YMTA 4CT4B 1QHNA 1US8B 1YZUA 3UK6A 1TTTA 3K0CA 4AIIA 1R10A 1MRSA 4DCSA 2I1VB 1KNQA 2QP9X 2ZI6A 2EW1A 4I1UA 5LB4A 5KYKA 4PO8A 3R7WA 1U81A 2ZS7A 721PA 2EU8A 1CJVC 5JJKA 1TMKA 2QTVB 2VYFA 2XXAB 1XPOA 3LXXA 4YONB 3PUXA 3RSLA 4TMZA 3SBDA 1E6CA 4MUBA 4PSVA 1KK1A 3CM0A 3GLIE 4WOPA 1DVRA 4IFBA 4IW3B 4CW7A 2ZXUA 1UEIA 3ADDA 1WF3A 2O8EB 1W4CA 4QHTA 4DC9A 4XVQA 4B35A 1W5SA 4RFVA 4G5RA 3GD7A 2E87A 3A58B 3Q8XB 1T0HB 2CK3A 3DOEA 4D4LA 1TL7C 1ZNZA 1XZPA 4NCJA 3VTKA 1HT2E 1U8ZA 4DIDA 5FPSA 4RVCA 2QN6A 5EP1A 4M1MA 3WYGA 1SVMA 1E9SA 2OAP1 4Q66C 4M1YA 4WA7A 4M21A 1OH5A 3VX3A 3TAUA 4CRWB 3AB3A 1RZ3A 1S4QA 1JNYA 2UZIR 3H4MA 4EPXA 4Z1MD 5JJIA 3ADKA 3WHLA 5J4YA 4DLTA 1N5JA 3RRNA 1SXJC 5EJEA 4DCUA 1KOFA 3HU1A 3AVXA 2QM7A 3SJCA 3DM5A 4YMUA 3J81k 5H68A 2QPTA 4HB0A 4B3CA 1D2NA 1SKQA 4N0DA 4LY6A 2NZJA 5HKKD 1OW3B 3CRQA 4QGGA 1RIFA 2QQEA 4BFYA 5AJZA 5DSZA 5E95A 1Z0DA 2QRZA 4DEYA 3KJGA 1KHTA 4L4UA 3V4FA 1KDTA 4Y0VA 1GAJA 3W6OA 2OFXA 2GCPA 5AWFC 1P2SA 1UDXA 3TUJC 2V8OA 2V55B 4G5OA 4CEJA 2R65A 2QTFA 1N6PA 4ZDKA 4XWKA 1Z06A 4AYTA 4HZIA 3UXMA 4W7SA 5ANRB 2VSFA 4MGKR 4UJ5A 2V1XA 3W5IA 3TK1A 2OO7A 3Q7PA 4JLAA 4US2R 2BJWA 1GL7A 3Q9LA 1W2GA 3ZD7A 3NHAA 4Q9IA 3A1VA 2A2ZA 2OZEA 3RDPA 4BECA 3IGFA 1Z2AA 2C95A 1I4TD 1RYFA 4P4SA 1R4AA 2D74A 1CKEA 1TU4A 2FA9A 2J87A 4Q1CA 2R6GA 2D4HA 4WZAE 1XXHE 2P67A 2F1HA 1W49A 2QSZA 4GRAA 5CIQA 5J5CA 3SQWA 4X8OA 3THWB 4ARZA 4ERNA 3RS5A 2YC2C 4BEBA 1L4YA 1S2MA 2ZSDA 1SVSA 1T3LA 2H16A 4IJMA 3B82A 3SHWA 2VP6A 2RGEA 1T0JB 1GVNB 5CLQA 2O8FA 2FG5A 1FQJA 4ZKEA 3OEHA 4HSEA 3T12A 2VPPA 3ZH9B 2RGXA 1SVLA 3K53A 3L2OB 4TMKA 3ZZ0A 3CR8A 1ZIOA 2OLJA 1X1RA 3G82C 1N2CE 1VYTA 5DIFA 2ZYTX 2QP4A 3PCRB 4DLZA 1DG1G 1P4SA 3CNLA 5CM8B 2FV8A 3PV0A 2FPKA 2ZETA 3V00A 3ZIAA 1HEIA 3I92A 3L0SA 1F5NA 2FFBA 3FWYA 5KSOA 2HXYA 3VMFA 4DRZA 1S3SA 2EVWX 1XMVA 4EPTA 1FP7A 3HWSA 3ZGXA 1S1CA 2Y8EA 2N46A 1EX7A 4GFDA 4KSBA 3I61A 1FUKA 1IN7A 3FGNA 5LD2B 5FUYA 3T15A 2BEJA 2P3SA 2HV8A 3SYLA 1B23P 2GRJA 3WXMA 4P4TA 4C0LA 3DVLA 4NU0A 4XJXA 3BRWD 4ZPXA 3P27A 1MT0A 2CEAA 3HYTA 2IHYA 3KUDA 2BWJA 4IFEA 1E1QD 1CU1A 4JL6A 1IY0A 1ZMXA 3LVRE 4E07A 2CL6X 1U9IC 2CHVA 2CVHA 4C0BA 1NLYA 4M1SA 2ZI3A 2W6JD 2QUZA 2HXSA 4LV5B 1E69A 1HE1C 3KKPA 2DHRA 1JJVA 4M9SA 1XTQA 4PAMA 5DO9A 5EXTA 4B3GA 1SHKA 1FZQA 1M7BA 4TTQA 4MKIA 4MA4A 1GRNA 2CJWB 5JI3E 3ZDQA 1JR6A 5DI3B 2QGZA 5JRZA 1Z0KA 3OZXA 1XEWX 1RJ9A 3U3RA 421PA 2GEUA 1II8A 4XWAA 4ACAA 2I4IA 5HTKA 2IXFA 3W3AA 1XP8A 2WJGA 4PAOA 5DHAA 1EFTA 5KSPA 4O25A 4DIEA 4Q4AB 4NCIA 1KO5A 3GMTA 3CRRA 4PFSA 1YZLA 3A1UA 4G5QA 2WKQA 1DE0A 1JEDA 3LWNA 4KO8A 4TYYA 4ZCIA 4B47A 2HT6A 5F2EA 3OEED 4TQAA 2VP4A 4NBSA 2ZIAA 4M1KA 3VU9A 2OT3B 4A8JB 1E0JA 3W6PA 4Z54A 2BDTA 4EPYA 3CWQA 3BIFA 1Q1QA 1AGPA 4IXMA 1D9ZA 4DLSA 2GA8A 2WSSA 5FOTA 3I8XA 1H8HD 4Q7KA 1ZBDA 2ZRBA 4BFWA 2IYZA 3OEHD 1IONA 1H65A 1PLKA 3LX5A 2QRNA 3PR1A 4B2PA 2IXEA 4D4KA 4TMTA 4K46A 3FTQA 1OPXA 2ZRDA 1WCV1 2NO0A 1IQPA 1V5WA 3KKMA 4PSKA 4JLDA 4NL4H 5FBLB 1GWNA 4JYCA 4LYFA 1CR0A 3TSZA 1F3OA 1ZU5A 4PZYA 2RHDA 3MG9A 5F3WB 1RRCA 4MKFA 2B8TA 3HP1A 1RRFA 1P60A 4K8OA 1XD8A 1TEXA 2DWPA 2JJ2D 3KZ1E 1VG1A 1Q1ZA 4XVRA 4ZDIA 1IY1A 1ZM9A 3FHCB 1NKSA 4BLQA 5KSYA 3LO5A 3SJZA 2ZR9A 2WV9A 3MWYW 4QJ4A 4B33A 2PJZA 2G3YA 3FYHA 1P9NA 2QPAA 5SZHB 2VHQA 2RKOA 4DKXA 5FH9A 3MWJA 3CR7A 3VR3A 4ZDJA 2JDID 1Z28A 1G16A 1X8KA 1KJYA 4B6FA 3AV0B 1MR3F 3HU2A 1G6HA 4NZYA 1WP9A 1E9RA 1HUQA 2ZSBA 4P33A 4EJSC 4EPVA 4V0NA 3FFAA 4YC7A 4Z51A 1TQ6A 2AKYA 2HYDA 4DWJA 4HAZA 1D2EA 1OXTA 4PQYA 1KI6B 2CL7X 5L3SA 3IPYA 2CCKA 4Q9LA 2NO6A 3RRZA 1G19A 4KFUA 4GL2A 3GJ6A 2QEQA 3U5ZB 1MH1A 2KBFA 2GK7A 2ZE8A 2ZQ5A 4JSTA 1NJGA 4WZ6A 3Q5EA 4HATA 1AJEA 4YXWA 4QC2A 1ZVQA 1IN4A 1QHHA 1RJ9B 4LJ4A 3WMEA 3GJ7A 5FBVB 3WYFA 1BIFA 3K0CC 4IKEA 4C30A 3I5XA 1S9HA 2JEOA 1XD9A 1G1MA 3TR5A 5E4FA 2G0TA 2B7BA 3T1VA 2CDNA 3LDAA 3C5CA 5AUNB 4QG7A 3Q85A 4V0LA 4DLYA 3KUCA 4HLDA 1X8JA 1BYUA 2F3RA 3AKDA 1EK0A 2ECKA 4LYJA 2H8KA 2WMNB 4DJTA 4DVGA 3TE6A 2QAGB 2AX4A 2ZSEA 2F9LA 4EJSA 1EFHA 1NN0A 1VHTA 2ZRJA 5JMTA 5L8VA 2O52A 2ONKA 4A0HA 1JQLB 1D6JA 2VBCA 4TZ0A 2O0HA 1EFRA 4QJ5A 1WMSA 2RGBA
chains in the Genus database with same CATH superfamily
1QYWA 4KU4A 1MKYA 1KFCB 3O8QA 3CJRA 3QFFA 1YHNA 1E58A 5C3MA 1R5OA 3DV0B 2KLHA 1TX4B 4ZICA 4MINA 1ZWKA 3U4MA 5HZMA 2GVZC 1QUEA 2YVAA 4HDKA 4RESA 3KFVA 5D1HA 1AGYA 1JQKA 4RH0A 3HYRA 4LZOA 5EIBC 1BKYA 2QKYA 3JQ6A 3SQOA 1WV1A 3TZBA 2H7CA 3W9SA 4CLXA 3PC4A 3IOMA 2FRVA 4YT2A 4UMVA 2G07A 4KE9A 4QE3A 3EN0A 5D7BA 2WAYA 4MPDA 1VA4A 2E4WA 3H2HA 2OSBA 3FWHA 1AB5A 4GZMA 4XPZA 1QQ5A 2I2DA 2QD2A 2HF2A 1A76A 1DBIA 1ZGBA 2ADFA 2VSXA 3PFCA 3WLJA 3H5TA 4FMDF 3SPXA 3TPZA 3WYNA 4X91A 3E3AA 3L0YA 4QBGB 3FE2A 3CEJA 3QLEA 1M10A 1K8QA 1RWMA 2GF9A 2ORYA 2VLIA 3VR3D 2A9QA 4AG6A 4IIGA 3IXQA 2REBA 4FFNA 4IXWA 4WZAA 2J0EA 3HO6A 2XT9A 3T4XA 1YQTA 5AKXA 5F77A 2AD5A 3DXXA 1S2LA 1B1AA 2AGVA 4N7RA 3Q9NA 1GPJA 4PX9A 4M53A 3AR8A 3A10A 4NATA 1T8SA 1S2DA 1ZS9A 1LWOA 5F2OA 5J5AA 3W78A 5DIZA 3IVRA 4CLOB 3N0XA 1ND6A 4ME6A 1HE8B 2CDRA 1EVQA 4EJSB 3WGIA 5IAKA 1QIIA 3OFVA 1TEVA 2AZ4A 1L5NA 2GN1A 4O2RA 4LS3A 4WY5A 4GKAA 2TMGA 4OP2A 1NR7A 4AWBA 4YCDA 1LDBA 1P1CA 4LZNA 3CB2A 3EWNA 1XN1A 2O23A 4MUXA 3L49A 4K81B 3UB4A 2EIHA 2V45A 4M4SA 3G2KA 5FOUA 1DIRA 4BVHA 1CJBA 1W0JA 4FMPA 3VPCA 4YUVA 3THXA 3HEBA 1L7RA 5AH0A 5MGNA 2NPFA 4RM2A 3UY4A 4ILKA 3MJRA 1IEVA 3VAAA 1DV1A 4LYEA 4E2ZA 2WNHA 3FWKA 3H6HA 2H4WA 3HXOA 3URMA 4UBNA 4NEQA 3TB6A 3PF8A 1C30A 2C2GA 4IKOA 4XB6B 2FG6C 5JH7B 1P9LA 4F3TA 2IOQA 1HSOA 1ID1A 1AXRA 2PWZA 1GDDA 4OSOA 4QYSA 1UPAA 1WX1A 3MMPA 3E7DA 1PYDA 3HJGA 1VJCA 3BHNA 2X2FA 1UKYA 521PA 3A36A 1Y1PA 2ZJFA 3P9IA 2QL6A 5CYFA 1F8GA 4ZO9A 4Z7QB 2FETA 4DV0B 2NLOA 3WHKA 2VK4A 2IPNA 4IIYA 4QO8A 2P9QA 3STTA 2QTNA 1GGVA 1KQFA 2ZJ8A 3CPEA 4L6CA 4LCJA 3G5UA 4OBEA 4K6CA 2GXQA 3JQ8B 1GPDG 4Y2PA 3UGQA 3X1DA 2PPVA 4BKMA 2WT9A 3VZDA 4UM7A 2F59A 4X97A 5KI6A 2A67A 2AYYA 1YT5A 2VJAA 2WAXA 1YRQA 3AF4A 3JQAD 5TC4A 3WK7A 5KSWB 3HB0A 1Q91A 3IEIA 1A69A 1CQZA 2W98A 2IZ0A 2PNFA 3BCHA 3NRJA 4AT1A 4HFMA 2C5HA 2QHXA 4CEIA 1FJXA 1XMJA 4WT7A 2A9KA 4YJ2B 2VP0A 4DC1A 3IAFA 5HZHA 3S55A 1IWPB 4M9ZA 4NHEA 4KREA 1XWIA 4YI5A 1H0KA 3O8DA 1BMQA 3K2QA 3GXOA 3PUVA 2P4EA 1CUVA 1U2SA 4MVXA 4XAQA 2FSVC 2GBPA 5EERA 5K2MA 3U56A 3N6VA 2CE2X 1B76A 2PD3A 2EJTA 5AXCA 3QJGA 3L7LA 4ZI5A 4MVJE 5BO5A 1G3QA 3ABOB 1U3UA 2OCAA 5H83A 5FTJA 5B58T 2VTVA 5AVYA 4PGAA 2LKDA 4NYJR 2R8RA 3OZIA 4QNRA 4I3FA 4RZHA 1GYPA 4IWXA 3I9V1 1FFGA 2AQ8A 3U44B 1L5YA 5I4BA 4XSGA 1TK2A 3MB5A 3EPHA 2NZ2A 2AF3C 1IK6A 3S2ZA 3PS9A 4B3JA 2XBMA 3OC0A 3FPHA 1PWZA 4EB6B 2REXB 5K6AC 1USKA 3NDBB 3D6NB 2FVYA 4FONA 4ZVNA 2K87A 2AFIA 2D1YA 2OGUA 2GN2A 2JJYA 2ROQA 2WPNA 2C04A 2EYUA 3CF0A 3KE9A 5EUMA 4ZVMA 4DYDA 4OGLA 4FYKA 5A4AA 4X65B 4BNUA 1LB1B 1O4VA 1KDRA 1A5ZA 2XPCA 4FYMA 3U13A 1EUQA 3R9WA 4ENPA 4UXHA 1F5SA 2PQ0A 2QLLA 3EIHA 3P4YA 1JDZA 3A27A 5TT0A 4ZO8A 1OIVA 1KGDA 1IZ7A 2QU7A 1H8EA 1W581 2JVIA 3VI4B 1UJBA 4M8IA 5CH3A 4CE6A 1AMUA 2AOUA 5EC8A 3RFXA 1W36B 3AFIA 4LNHA 4TZKA 2ET6A 3TVDA 1SCIA 1T36B 1P1KA 2BGWA 1ICIA 2IYQA 3SN6A 3H42B 1S2OA 4ER3A 4EKNB 4LGMA 4U7TB 2DWUA 4OHZA 3NBMA 1SK8A 2YY7A 3L7AA 2PFSA 1LRKA 5CFNA 2B82A 3TRHA 5THQA 4HTAA 4ML3A 1N0HA 4ZT2A 2PKXA 3IUBA 2GJSA 1EBBA 4LVCA 2IYTA 2Q6TA 4RY9A 1QFJA 2DH5A 2ZRLA 1X9IA 1I4WA 4ER0A 1NP6A 2ZUSA 3QPBA 3R5XA 3QUQA 4ZAYA 1VCHA 2RK6A 1GQ2A 3OP1A 1FSSA 2XHZA 1G7TA 2PEZA 5CIYA 4MI9A 4BX3A 3E9ZA 4FIDA 2PMFA 3FZQA 1Y98A 3LF2A 2NG1A 4CCYB 3GLGA 4KQKA 2NUTA 1FS6A 1JEJA 3RKUA 4D9KA 1KMHA 1O95C 1COZA 3D2AA 2GFHA 3EFHA 3V2UA 2EZTA 1FNBA 3SKVA 3TTVA 2ZSJA 2F2TA 4NP6A 1R0YA 1KIAA 1AE1A 3NAZA 4N5HX 2WT4A 2NWQA 4L78A 2JFUA 2WU3A 3H9EO 5A9SB 1HX7A 4TPKA 2ZT6A 2NYRA 3M9LA 4E15A 1UBRS 3D8HA 1ZJYA 2WBLC 3KQYA 1MIOB 2OZPA 4PPNA 1P7WA 1FRVA 1OFIA 2QF7A 3QHAA 5I9MA 3SX4A 1M2NA 1SG9A 1ZK4A 2W2NA 2ES4A 2PT6A 4ZVVA 4MUHA 4DDMA 3B1XA 4GOOD 1IPFA 1IHUA 4OH7A 3JZMA 4DV4B 3AESA 2OCYC 4XPIB 5BQOA 5SZJA 5CB4A 1R8YA 3QTLA 1AQLA 4H16A 5LLSA 4CEIB 1WCXA 4REQA 5FQOA 2J3EA 3K96A 3RH0A 3WRYA 1WZEA 5COQA 3RSCA 1JDBB 4GUAA 4KQ6A 3TIGA 2OKCA 1H1DA 5TJHA 4DIMA 2R7LA 1L1QA 4AZ0A 4DNFA 2WJWA 3H8SA 3JSXA 5CFLA 2JJ1A 2WHPA 3FVVA 1EZ4A 5ADVA 2IIVA 2RK3A 4CKZA 4OQZA 5JFTA 2PO7A 2P2NA 3IQIX 1FDTA 1AURA 4RA9A 4AK9A 1OB5A 2VHYA 4MYDA 1P2FA 4N3BA 3KK0A 2Z58A 4LSMA 2YFYA 3PYXA 1I6KA 2QMYA 4N9WA 4D8WA 4Q34A 4H9GA 4HRXA 4BZWA 3C6XA 2HL6A 3QVKA 1ZAKA 1HE3A 1NE7A 1U4NA 3QU7A 1C2TA 3UJ7A 4C21A 4HDOB 3K1JA 3UQZA 4TS4A 1GDHA 4DG8A 5IN5A 4C3ZA 2EKZA 1FDIA 5CB8A 1CJKC 3M70A 3S2FA 2F55A 1SELA 2JS7A 1E2FA 2G0NA 4WA8A 2W2TA 3ER6A 3LYHA 5CA0A 3TTWA 4U8GA 4Q1BA 4MI1A 3CF2A 1FDUA 1CR1A 3NDRA 1OF1A 1MIOA 3H9BA 4YLGA 3U80A 4XQCA 5AVZA 4KQHA 2QENA 3PYMA 3WGTA 4OKSA 2H4XA 1GITA 3FUCA 1N6LA 2C78A 3TPFA 1D7AA 2BVNA 1T1SA 4U2GA 2QUKA 2WSBA 3CX7A 4F5EA 1L7OA 1U3WA 2FEOA 2MTBA 3KQVA 3KCQA 4YPFA 1O6ZA 2QRQA 2X77A 4QXQA 4C3VA 3SHFA 3OJ0A 2VCYA 3BDAA 1LSUA 2H5EA 3ESYA 3QTBA 4EG4A 1A8HA 1TT7A 1TD9A 1RPNA 1ZM2A 4GNKA 2AUTA 2A57A 2FG7C 2JA2A 3R6GA 2FE1A 4CU5A 3TWOA 3NLLA 1YZQA 1CZHA 3GEBA 4FQ5A 1FYXA 1PFGA 2FW6A 4B3IA 5BVHB 4JITA 1CS4C 4FJ0A 2QVGA 4L3VA 3BA6A 1QFXA 2ZM5A 5ESWA 4PAQA 5DLQC 1CZOA 3KVNA 1E3SA 1PS0A 2VNJA 4MS3B 3JD4A 5DTMA 6NULA 2QIOA 3RK0A 1R5JA 4BL5A 3FI0A 3GFVA 5CA1A 2PIDA 1AHPA 2QD5A 4ITRC 4W6ZA 5HOEA 5AXAA 3C14C 3GF4A 4GOXA 2H2IA 4YIKA 5EXXA 4EHLA 1QHIA 2CL5A 4U7JA 2FEKA 4CF6A 3SIRA 3KAQA 4J2OA 4ARIA 3I37X 3RBAA 1YZGA 2DBRA 4RDCA 4FDAA 1T5LA 1TZMA 3DAFA 4F71A 4DUZB 2H4HA 1X92A 2R8OA 3MT7A 4L4RA 3B5IA 4URYR 2OBFA 3PK0A 4F2PA 2NV6A 4DSZA 1ITZA 4QOJA 3EGCA 4GMKA 3IOBA 3ZS9A 3B12A 3T61A 5KOIA 3T7CA 3U6BA 2Q99A 3OIVA 4E1AA 1QSGA 1E2LA 1GNQA 2EOAA 2KWIA 2UVPB 5AKZA 3NIBA 4GZ5A 1L4MA 4KAJA 2VO1A 2JVJA 1QFZA 2L0XA 3G49A 3T5BA 4EUHA 2NACA 3QIAA 4N9QA 4AJNA 4QDXA 3RRFA 2H17A 3PGJA 3KUKA 3KU4A 4K05A 4IDBA 4FR5A 1UXJA 2GD0A 2DFKB 3COPA 1D1SA 3KUXA 4I46A 4L5JA 3ABQB 5JW6A 2H0AA 1E79D 1QS0A 4XZ3A 3W4IA 2PX8A 5BN1A 3U26A 1XKQA 3PENA 5KDOA 4KQJA 4NS4A 4K9SA 1VYVA 3DPUA 1Q0SA 5D2CA 3B6EA 1GQSA 1HDGO 1VIYA 1MZPA 1XTSA 1EUZA 5CA1B 3HO1A 3UFBA 5E3HA 5FI0B 5C3UA 5DNYB 2WD7A 4N76A 3BJIC 3PNKA 2D1TA 3RC3A 4HL6A 4ENTA 1LCIA 2X5NA 4L0MA 4O2AA 1PQUA 4U7HA 4YMIA 1ZOOA 1MJGA 2TRSB 3A6LA 3SVZA 1YOVA 3U9TA 1SXPA 5IT5A 2AQHA 2CF5A 3EGOA 4X61A 2X58A 2MINB 2XGMA 3OA0A 3LBIA 4WZBA 4OB8A 5AQ1A 4IHAA 2ZYUX 4P9NA 5GJWC 3PKIA 2C7QA 1C7FA 5HFJA 2Y67A 1JE1A 2CBGA 3ENKA 5DEOA 4Z1MA 4L6AA 1EK5A 1ZGAA 2QLTA 1SU8A 5F21A 3VR6H 3AR4A 2VOEA 3D4PA 4MCJA 3U7FB 5JPDA 4ZIRA 1RKBA 4HEA6 4O4HF 4LMAA 2J5QA 4XD2A 3WLRA 3IP7A 3HLYA 2HU7A 3SLRA 1T1RA 2Y9MB 2G77B 1P9WA 2A5YB 2FFJA 4JL8A 2PYDA 2Y3IA 4JROA 4KLNA 1PGQA 3MIIA 3R1IA 1W46A 3MT9A 5FR2A 3PEYA 2FQXA 2ZRGA 1ES9A 1PT9A 2WJHA 2GK4A 1TAGA 3SEFA 4BMXA 3O4IA 1AQYA 4HDRB 4MK4A 4EHAA 2YNMD 2PH1A 5EYPA 2FDXA 3F8SA 1OX6A 1JSZA 4LHWA 5LWHA 3V7WA 3WLPA 2F8SA 4W5NA 1LNSA 2ZCUA 2AYZA 5F51A 1SXIA 2O4CA 1JEYB 1NYRA 3T3GA 4W5TA 2VPQA 3KALA 3RCBA 2XB4A 2AVNA 3M6VA 5IEJA 5HILA 3UBMA 2HUNA 1JEQA 4DMFA 2X7XA 3FW1A 3CH4B 1OFUX 2BKVA 3AL2A 4MAFA 4KL8S 3DJFA 4PY2A 3FHLA 1VPLA 2CV0A 2CLLB 3DVSX 2IYEA 3I32A 4QTTB 5CHEA 2WMOB 3I62A 1EGHA 1YSCA 1Q0QA 2Z9CA 3O1IC 4H7JA 4IIDA 4RHYA 5J2TA 4GD3Q 4D6PA 1ZZGA 1IZYA 1L5OA 2F64A 1BJKA 3L1VA 5KOJA 2PX4A 4BNYA 1HT0A 1W1IA 4DQKA 2H2FA 2P69A 2R6DA 5AICA 5K8VA 1NW9B 2ZVPX 2HOQA 3KO8A 4B3XA 4BP1A 1T25A 4ER5A 1JHQA 3W04A 3FYSA 3PL1A 2F9MA 2QSUA 3V8PA 4Y2QA 1FDSA 2Z6VA 2XF8A 4KZPA 3NNSA 4JLOA 1IPEA 4AUMA 1MDFA 4B6GA 1B26A 4EG8A 1ST2A 1HI9A 3WOHA 1X14A 3ERCA 5E0OA 3LY5A 4ARCA 1M6NA 2AXPA 1E9BA 1UIMA 2PK3A 4YUYA 2O7RA 5KHAA 4R1MA 5IU6A 1WUJS 1LDEA 4PCAA 1F38A 1WHSA 1YBHA 2F67A 2BKXA 5G0SA 3VNAA 5KNDH 1F7UA 1E7YA 2BBWA 1GTL1 3JQBA 2HX1A 4ZO6A 3UUWA 1VCIA 4D3ZA 2RGCA 1A72A 3B78A 3TGLA 4H7DA 4Q9NA 1GLVA 1HGXA 1ANKA 1N2BA 3OP4A 5TEWA 3TOXA 3ZE0B 3A1SA 5IXJA 5J3JA 2QBYB 4OLAA 1H4VB 1KFJB 1MUUA 4LOIA 3JS5A 2JASA 3EQZA 5D51S 3VKFA 2CD7A 4DY6A 4ZI2A 5JYDA 3H9GA 3JYOA 4FK8A 5K03A 2VWGA 3LUJA 4R2IA 4CM7A 4ENVA 3T8YA 5KPJA 2ZATA 3NTLA 4HFRA 3K9GA 4BVJA 1D4OA 7GPBA 1KJQA 4LZLA 3UGTA 2YL2A 3B1ZA 4O4HA 4AJJA 3MRTA 5CVVA 5BN4A 5K8UA 3I0MA 2ACVA 3QXSA 2WUWE 2IK8A 3PE6A 3F6SA 4DC0A 5LOVF 4JUIA 2CDAA 4UBIA 2X9NA 4UUQA 1SC9A 5DNDA 3DNPA 4WEQA 5ALXA 2REQA 3G2OA 3OOSA 3U3KA 4YRGA 4NJEA 3K09C 3E4DA 3T1HB 3B6ZA 3MELA 5ERYA 3GT0A 3NHBA 3IKJA 4QAJA 5LDGA 4E2FA 2H4ZA 3ZJVA 3QSGA 3VR2A 1VPTA 1BFKA 5CLHA 1FUYB 2D7JA 3FYTA 3NDPA 1ZU4A 1MQ9A 3AGPA 1Q0UA 1X1EA 3W5UA 1Z4QA 5C7YA 5J4KA 1N5LA 4KOEC 5DYIA 2QVCA 2XGJA 2IUSA 3GFRA 2Y71A 1VLLA 3PFFA 3VHXB 1IB0A 2R1TA 3FRJA 1E4EA 4XGQA 3PRYA 1HNWB 1SCBA 2WPDD 4Z9BA 1P1JA 4Q9DA 3R3JA 4IVRA 5HIMA 4II3A 4RFSA 1N5RA 1OBHA 3PDHA 4ZI3A 1D4ZA 5HG0A 5IPFA 4CLRA 1ULHA 3N6XA 3KOMA 1TLLA 3EXEA 3ZU3A 1U3GA 2Z2YA 1LDNA 2PKEA 4A3SA 2ZB8A 1DX4A 1WHTA 2X5JO 2WINI 4GYWA 4YGYA 3QSYA 2O8EA 4I8DA 2IHZA 2C99A 4CRWB 3W4JA 3JYPA 1T0PA 2YZ7A 2I2XB 1L5GB 3ZXSA 3CVVA 3AFHA 1D2RA 3CUWA 2AJCA 1QH8B 5K51A 4DR1B 4KQEA 3AM1A 1E98A 3LPAA 2DYKA 2QMUA 5FPKA 4BMZA 3NBUA 1E2MA 1XZFA 4GT1A 2BKUA 3WLOA 4D3FA 1XVUA 2WAMA 3A9WA 4EHJA 4X44A 3LT5A 4MV4A 5K0CA 5SZIA 4TYNA 2CLFB 4NZZA 1L7VC 2G5GX 1N6OA 2ZRAA 1MC5A 5TDHA 3RLIA 4ETWA 4ZK6A 1CUAA 5CA1F 2BDUA 3D3JA 1W93A 1FU7A 1UBFA 1WXXA 4IIJF 5E6UB 5A7GA 1NJ5A 1FSFA 1KFBB 2NZXA 3BGOS 3E22B 4LQDA 1PWYE 2NQ2C 3A4MA 2GB4A 3P45A 4OI1A 1RYDA 2FX2A 2G09A 1DKPA 3FDZA 4LTNA 1Y7TA 4O4LF 1R5BA 3H2YA 3IHKA 3SDSA 4B3DA 1A2OA 4GQIA 2JIZD 3N2ZB 5TXGA 5BOSA 5AJHA 2EBUA 1YR6A 1LBQA 1P7YA 1MG0A 2NUPB 1IATA 3IT0A 3ZNOA 4KXLA 5CTAA 1FNSA 1JAZA 1FW8A 5TS2A 1UBUS 1XA0A 1CUDA 1Z39A 4I1YA 4UHFA 2X0FA 4DMCA 1DELA 2BF7A 3B89A 2XYHA 1H8ED 3V7FA 4RD4A 5JSFA 1OFHA 4MV1A 5KQLA 2PBFA 4HQRA 1IMOA 1JG2A 1UFOA 1YJCA 2HI0A 2WA1A 4W8HA 5C35A 4OBBA 4RPHA 1UT6A 2IW3A 5FPPA 2G28A 4C4SA 4F96A 5A1TA 2GD6A 5IT4A 2HGZA 2Z2XA 4BYGA 4Z9YA 5HQ3A 2VEDA 1XBTA 4N3CA 4IILA 1ZSYA 4X6YA 3RV4A 3CNHA 1J0BA 1UMBA 2NU7B 4FFDA 4WFIA 2HCTA 1H0RA 1O9HA 2QRVA 3A37A 2Z1DA 3I0NA 4R3NA 4UNSA 4JOCA 2V7TA 5KTRA 1G8MA 2VJDA 2MYPA 5G0WA 1NP7A 2J3JA 5M5BA 5MN4A 5K0BA 5LUBA 2DCUA 4JEHA 1YR1A 2HSGA 5E9QA 3U40A 1AXEA 1A5SB 4EY5A 5ES4B 1SC1A 1R8JA 2VK2A 1NXVA 4ISCA 2EJCA 3KAJA 3BIJA 5ITVA 2R11A 3BKXA 2XUJA 4IIVA 4FYPA 4TVOA 1CLEA 3HXMA 1J5PA 5BN3B 4J0KA 2A9RA 3FFBA 2R751 1IAVA 2QDXA 3I2YX 4II7A 1SMKA 3SBEA 3SKXA 1T2FA 4QIHA 1L7MA 3T1OA 5HKKA 2BGJA 2YN2A 3F46A 3KHTA 4IDHA 2BDEA 3Q3GE 2NQ8A 4Y0AA 2BKAA 3RODA 4QTYA 5B1EA 7REQA 3N8KA 2R86A 4LGYA 3IP9A 5I7OA 5ALHA 4V0MA 1Z6PA 4UVGA 1P1HA 3IILA 3MJ4A 1DAPA 1FBNA 1M6YA 1RI5A 2HHCA 2NAPA 1BW9B 1NA5A 1X70A 3OQHA 3S5JA 4ABYA 4AS2A 4URUR 3QLUA 3HN7A 2WKPA 3K1AA 4HH1A 5EE5B 3EW9A 5FHRA 3UHJA 4YV2A 1JDUA 1GP2A 4RTPA 2AD1A 5IJWA 2B8JA 1S8OA 2B4RO 4JXJA 1RD4A 2I03A 1M1NB 4ZCRA 1PJ3A 3WMWA 1NASA 1LK7A 4D9BA 1EIZA 4NICA 3HJTA 5ALSA 2ZZKA 5F23A 4FZ5A 1TUEA 3L8GA 1S7GA 1H0SA 3HHEA 4G5FA 5BV2P 1WBBA 2B30A 5JQWA 1RAAA 4I1IA 2QAJA 5SYMA 4CZ2A 3UA3A 1YJAA 4JZYA 4CNQA 3PLAE 5EIHA 3RABA 4MW0A 5L4SA 2Q9BA 3T4PA 3P32A 5EHZA 1CETA 3PKZA 1Z0AA 3EIWA 1KZ6A 1Z6AA 2GTPA 3KZCA 4FHFA 5TARA 5GZ3A 2Q4DA 4PLZA 5EP2A 4FNOA 2NPIA 1SB8A 1LBSA 1PF7E 5E4TA 1QZZA 3LCVB 5I8PA 3UHFA 1T36A 5AW8A 2A8YA 1CQPA 4BAZA 3N0WA 3F73A 3BSWA 3FGPA 3CXUA 3AF3A 1ZCZA 2B2XA 2VNSA 4KOAA 4S35A 2SCUB 2HRDA 4MQ4A 5DH9A 2P2DA 1H85A 2V4UA 3PXDA 4Z8XA 1GPH1 1ODLA 2AOVA 3ZBTA 5AVVA 2J3QA 5JD5A 1ZVMA 2JC3A 4TV9F 3QBDA 3QYAA 3K9WA 5ALNA 1CE8B 2I29A 1JJ7A 2D5AA 1GEGA 4OI0A 1C5KA 1BGXT 2CDBA 1FUIA 1PU2A 5LQJA 1SQ5A 1HLGA 3D7NA 4WN3A 3IEVA 3OZ7A 4XVHA 4KBYA 2WUVA 3HJBA 2VQSA 4NX2A 4ZU3A 2IX9A 4ETMA 3I1IA 1RXEA 2IHUA 5ILOA 2QUJA 5LBIA 2ILVA 1X0XA 1ADCA 3I6YA 3PCTA 2XNJA 3A0RB 3K2BA 1N7JA 1Z0JA 1MQSA 2NO7A 3LIPA 1EU1A 2OFOA 3K4PA 3QE3A 4JMLA 4PC3A 4YT5A 2JFFA 4E2WA 2SKDA 2YHBA 5JNTA 2I9KA 1BD4A 5M29A 5IVPA 4O2BA 5DM2A 2VP2A 3OFND 5IUKC 3S8YA 5J9FA 4IPTA 5ALFA 5ALVA 5DLDA 1WA5A 3NHMA 2XSZA 3AEZA 4JOQA 4J76A 4Y2RA 2H85A 3T6KA 1KYTA 4JEIA 4CM1A 1VM6A 4Q4JB 3RK4A 2VHVA 3T1NA 1RABA 3GDGA 5I7VA 3OZEA 1UEJA 1HMYA 3LVBA 3QVWA 4QKQA 4QUBA 5EZYB 1Q77A 3IUYA 1W75A 5DHPA 1U7UA 1ICEA 4BBZA 1U90A 3C4QA 4R3UC 4UBOA 4V03A 2FCRA 2LCQA 4BMPB 3MMSA 3BORA 4JCCA 2K7ZA 4DQLA 2I6UA 4H7FA 3KZXA 5DCUA 5U4QA 3MHTA 2FJUA 1T5HX 1YB5A 1L4EA 1RXCA 2FTKE 2LV8A 1U0TA 2PDAA 4IOJA 1XI2A 2FW8A 4ZARA 1KJ8A 4RE5A 4Q18A 5FB3A 3QITA 2ODEA 3E27A 3UH1A 4PLYA 3F3YA 1H4TA 4MJLA 1BRMA 2QXUA 4LX0A 3ZV7A 1KU6A 2VH5R 3ESXA 4EYEA 2O3QA 3QU9A 3FZEA 1U1GA 4GP9A 1KDYA 3BE5A 3KWFA 1KP9A 5K0LA 3Q6NA 4PC1A 2EHJA 4GS5A 2RMKA 2BFBA 1KPGA 2ZR7A 1K89A 4JU8A 4PQRA 2Y93A 4X7RA 1YVEI 3K8YA 3RQSA 3S2UA 1XXLA 4X92A 2EP8A 3HDYA 4HQNA 5FFMA 3ZGZA 4MI6A 2GJ8A 1YCGA 3JASA 2GPJA 4BWVA 4B73A 5KTNA 4EB0A 1Z7EA 3V4PB 5JJLA 3QVGA 4TRJA 1BQ3A 4G23A 1Z56C 1AVTA 1FXSA 2CXSA 4ZDKA 3B9PA 1V5IA 2QG4A 3DLIA 3FB4A 3GWZA 1GO2A 4MVJG 3UMFA 3TF5A 3N6RA 1ZIPA 4UMDA 3F9RA 5FEMA 5CIWA 1JHVA 2JNWA 3VO8A 3VSAA 1LRJA 1Q1AA 5G41A 3AUFA 1TZBA 3B60A 4R9UC 1T15A 3MLBA 2GHRA 3DT8A 3PPYA 4HAXA 5J40A 4EABA 4D3YA 1J9ZA 3DHNA 3PD1A 2DPLA 2VHEA 1G6OA 3WJ7A 4B45A 3CLRD 4AROA 5LBUA 4KXVA 4HTFA 1X19A 4R7GA 4PONA 1PYGA 2PS9A 4RTLA 2KX7A 5BV0A 2B94A 4O2BF 2QSYA 1I7QB 1UFQA 3LSTA 8OHMA 2I2FA 1MEEA 3SS9X 1IVNA 4MYRA 3SQMA 1IL0A 4Q1DA 4HNSA 1JSXA 3NR2A 1D6SA 5C81A 4RMIA 1HQKA 1HG1A 1RXSA 4RXTA 4YXFA 3V2HA 2C5SA 5KOHB 4OFXA 1KYWA 1KARA 2X0NA 5DDIP 5DK6A 3IP5A 1G4HA 2PMBA 2WP0A 3TGPA 2ZANA 1DBQA 1PFUA 2RJ3A 1ZOPA 3FNEA 3K9LA 4OI2A 3DVAB 3LPCA 4EVIA 2XDYA 1HQDA 1E5VA 3D8SA 1T4DA 2I6SA 1HWYA 3CA8A 2H00A 1ZUNB 2ID7A 3WWZA 1ZVKA 3COVA 3ZV5A 4ZI7A 1UQUA 1VA5A 1ZGCA 3HCDA 4F7DA 4ASUD 3IJ5A 4MAAA 3SF8A 5C7IO 5L53A 1K88A 5B3LA 2J48A 1HF3A 3QE0A 2CMDA 1RBZA 2MSWA 3OBBA 1AKUA 3G1WA 4I50A 2FN9A 3TQIA 4ARAA 2DB3A 3SSAA 3EK2A 1UBLS 5FBWB 1AQJA 2GZRA 3GCWA 3AZQA 4UZEA 5EKTA 3RJ9A 1P75A 4FPXA 4BNXA 1QFSA 4CXMA 2HSEA 1QZ3A 3ZOKA 1QHSA 1UOQA 1T9HA 4Y1FA 3Q0EA 5FBRB 1PWHA 3R24A 3G1TA 1I3NA 4QHYA 3H16A 2RB4A 4D4JA 4B2YA 2WJJA 3LIIA 1N6RA 4RKEA 3FG9A 4A15A 3MLAA 2HR1A 3LQ1A 3NRBA 1CNFA 3AI1A 4IDPA 3BX1A 3QBJA 4TKVB 2FAXA 4P3XA 2OXCA 2JJ8A 3L8MA 1UKAA 2DMRA 2VPIA 3G8DA 1Y1QA 3L1JA 3ZJTA 3UMSA 4M6WA 4HV4A 2XR1A 1J6UA 2JFVA 3ZHUA 4BB6A 5L7YA 2OB1A 2RIRA 1NVKA 2GS9A 4US0R 5HNKA 4AJOA 2DKOA 3T35A 1XTPA 3C3PA 3VKVA 3IERA 1N0VC 5IWAB 4EYOA 5EXDA 1EP9A 1PJ8A 2WJAA 3GRUA 4XA8A 1V7ZA 2WKSA 4G67A 5KREA 3O84A 5DMHA 1K8RA 3FLAA 3D3KA 3CZ4A 2JFXA 1ZXLA 3UB3A 3IKLA 5I47A 2K5UA 1P3JA 1YI8A 4F3RA 2EFGA 3V1LA 2BUBA 3BDVA 4P5EA 1URPA 1NUTA 3KQNA 4LECA 3M4YA 2YNMA 1EWYA 2ZE7A 3M7IA 4HUJA 1NIPA 1XMOB 3MJCA 1TF5A 3UW3A 1MC1A 2IP4A 4EHHA 1G6KA 1QG2A 2EFHB 1Q95A 2ZJBA 2YCBA 3GPDG 4YTEA 1YVRA 4KHPB 3OF2A 2LZ0A 4A92A 5BWNA 4QTZA 3F1KA 3ZZNA 1V2HE 4FUTA 4BNNA 1QNLA 1D09A 3CF6R 5AM4A 2HEIA 1UMKA 1L4KA 5CT8A 4B3MB 2ZKLA 3VR2D 3HACA 2WJ3A 5JSZA 1KYIA 1RPTA 3BBLA 2Q5FA 3SYRA 4L95C 4TT3A 1UKCA 2BJVA 2WDZA 1QUFA 1WW3A 4XJTA 4AWAA 3QUBA 1DAIA 4X93A 3SYNA 4KQIA 1JIUA 3RHTA 5IK2D 2LNDA 2AZMA 1U0JA 1QM5A 4Q3OA 3JRNA 2BFAA 1I1HA 3ZV6A 3OURA 3ZDDA 4RANA 1E2JA 1NQOA 2HXGA 1SHJA 4N0MA 1SHZA 4NFSA 4FC6A 2BT4A 2KS6A 2X4GA 3CMMA 4J1TA 3TQRA 1MHTA 3S2GA 1HY3A 4G1MB 3OPYA 4MZXA 1EE1A 3PE4A 2INGX 5ITWA 2FP3A 2WYHA 5E7MA 1DCMA 1I8TA 1RM5A 2YXDA 2B9VA 5AT1A 3TLGB 1QANA 2P79A 1SHLA 2RBGA 1JKMA 3EVTA 1KZGB 4FMBB 1G9XA 3K05A 4IHKA 4KAXA 3WC4A 3ZW7A 3S70A 4KK4A 1Z0FA 4MKXA 2JAWA 2EBWA 4Q9KA 5EQDA 5IKOA 3RS0A 4EJ2A 2XEXA 4FCTA 4S1WA 3U3ZA 1Q0ZA 4C2TA 5IM4A 4UHEA 5JAQA 2A33A 2YBDA 4FYYA 2GRUA 3MGBA 1PKXA 1OT5A 4Y9SA 3G9ZA 4UU0A 4PZLA 4Y1RB 1E4VA 1M7GA 1PVDA 2PKQO 4KVZA 4L7VA 4TLDA 4D26A 3SR4A 4HP8A 1JECA 4XTRA 3B51X 2Q2WA 4OL9A 2GCOA 4QTUB 2X13A 4M7RA 2A14A 4FDMA 3UJNA 4YHHB 3I64A 5AI6A 4KIGA 1XQWA 1BHO1 3H1TA 4HWOA 4W4TA 5JNWA 3TRKA 4RJTA 3F5QA 5JXHA 5AR1A 3P2IA 4UZSA 1AM4D 2DSNA 4H6PA 3PNVA 1HQCA 3U3MA 2OD9A 1E8DA 2J09A 4EGFA 3HH8A 1NVVR 5IDVA 3ORHA 3JYNA 4JIMA 4Y9TA 4K1LA 3O4RA 5AKJA 1KI1A 1F8YA 1DG9A 1D4AA 2B4YA 4GUDA 2WVAA 1GLGA 2BFOA 1VI5A 2JLAA 3EC2A 3ZXXA 4AJHA 1O1YA 2D1QA 3LZDA 4RACA 5J59A 4MQEB 3BERA 3M5CA 1WKBA 1WE2A 3R6WA 4GEGA 1O95A 3CONA 4S24A 1VSBA 4FCWA 5A1JA 1JFVA 1H94A 3WYBA 4UNNA 5DGTA 3KSMA 1QGZA 4GBGA 5BSRA 3S1AA 3SOZA 4ENSA 3WLMA 5BWLA 4TVSA 1FXWA 4WESA 3K3PA 3KJXA 2CJFA 2AKAB 3SJ7A 3VMMA 3BXEA 4BVKA 3FTEA 4BN4A 1DBRA 4YFYA 3SX0A 1J2UA 5IF9A 2H9YA 1RCTE 1MRNA 3MJVA 4GC9A 3TJRA 4B32A 2XIJA 1E1KA 4FR2A 5KYXA 1QMPA 1UBEA 2I4MA 5IJXA 1CB0A 1CPYA 2QUIA 1XD2B 1P0CA 2PT5A 3DONA 4HBGA 5BYBA 3VHXA 2J0UA 3C8ZA 3CG4A 1F2UB 2EX1A 1G8PA 3GFOA 3LCMA 1TMOA 3GDFA 1OLUA 4IS3A 2AJDA 2XAAA 4O2AF 3ROZA 4BUCA 3H04A 4JLUA 1NVMB 1XAGA 4O4JA 3HK2A 2O2SA 1OLXA 2XE4A 2X8BA 1G21B 3O7MA 1DADA 1I7SB 1W2HA 4BUZA 2NXWA 4EVQA 3OTQA 1HYHA 4Z3DA 2J3HA 4JY7A 4KAFA 1JPUA 2BSXA 3I53A 4GR4A 3A4IA 3VFDA 4PHCA 3ZI7A 2J67A 4EUEA 4UNIA 3D59A 3QG5A 4HLNA 3WBFA 3DO5A 3GLUA 2JF0A 4DBZA 3WGLA 1OR8A 3IURA 1ONBA 4HWSA 1XCLA 3BEDA 1CS0B 2JANA 5ED0A 5H3HA 5LB2A 3VU0A 3ANLA 4AZVA 1KK0A 4TWAA 4OHBA 1C7JA 3QU2A 3P5BA 4M0LA 4L8GA 1EJBA 3VVLA 4B6PA 1YFLA 3DHVA 5HYVA 1FB5A 4R1LA 1CY6A 1FFDA 3FPBA 3ONNA 2FWRA 4ZQGA 2C7RA 2XECA 5AVQA 3OZFA 1X1BA 2BM0A 3KX2A 1RYZA 1G3MA 1YGYA 2UU9B 5F5NA 2F43B 3W7VA 2X0KA 1N8NA 2KW5A 2WJYA 4JUFA 1UDRA 1YOVB 1Z9BA 2AH5A 5H4HA 3WWPA 5CLFA 1ST3A 3RADC 1SG6A 3H05A 3KQTA 4NBRA 3U9SA 1WUTA 1XLUA 3IDZA 1Z36A 1KERA 2GYVA 3ETCA 3IPRA 3O9MA 2VXOA 1OTXA 3DLCA 3VAZA 4HMPA 1K3UB 1BCSA 3W34A 1ODCA 4BCCA 1RLIA 4I4TF 4CMIA 5BNIA 2Q1WA 3VZCA 2BN4A 3NCHA 3L40A 1PR2A 4CQLB 3HJFA 4RHTA 3WNBA 3WYDA 4YV0A 2XNDA 1R50A 2AFHB 1YK1A 4RPIA 3JAWA 5EAIA 5A5FA 3RC9A 2PCLA 4G5HA 4J0CA 1MW8X 2H9IA 1DO0A 2CKDA 5HQJA 3Q2KA 3KYDA 4A91A 1NNUA 1CQJB 1PT6A 1YULA 3MWKA 2BR4A 2QR5A 4G89A 4L8VA 4MMXB 5DHSA 3R8CA 3L0ZA 3SNHA 3FCYA 2PGAA 2QNIA 3L41A 2BE9A 2ZAIA 4JBHA 4PYLA 4MVJI 1E8NA 1ZD9A 2GH1A 1X7YB 3TW0A 5A5VA 5FBZA 1V26A 3SQDA 1NC1A 2V3CC 4NECA 1OBVA 2PUBA 5CX1A 2YASA 5ECGC 3I5AA 3LKDA 3W5BA 5B1SA 5D01A 2HSWA 3EDYA 3FOFC 2C4UA 1DTEA