4QGFA

S.aureus tmk in complex with the potent inhibitor compound 38, 2-(3-chlorophenoxy)-3-methoxy-4-{(1r)-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]propyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 196
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qgfA00
2QSZA 4Q4AB 2GJSA 3K09C 1WCV1 4DDTA 3B6EA 3T1OA 3GPLA 5E7JA 3OIUA 1SXJB 3MJRA 3GJ7A 1NY6A 4LV6A 1IN7A 3O8RA 4AWXA 4DB4A 1W5TA 3B78A 2WOOA 1DO2A 4HUTA 2EW1A 3FOZA 3X1YA 3U4QA 3QKRB 2G0TA 4C0LA 4YMUA 2QAGA 1KK2A 1XCMA 1XD9A 2CE2X 2QE7A 4LX0A 1Z47A 4LUCA 1KI4A 2V3CC 3WY9A 1E2NA 5LD2B 3KQNA 2OZEA 2KJQA 2WSMA 3CX8A 2IYQA 1SGWA 2HLDA 4XH9B 2GA8A 5GJCA 4A0GA 1E69A 5DISB 2R62A 2WJIA 1CJKC 1YKSA 2QI9C 4BE7B 3QVUA 4JVLA 4F4JA 4MITA 3KJIA 4JLBA 4C0BA 4EJSA 5L3QB 2CBZA 3TUJC 5SZJA 2B21A 3B1WA 4GI7A 4PQRA 4URXR 2MSDB 3B1VA 2QP9X 5ANRB 5J40A 4C30A 2EVWX 2B7BA 1D2NA 2CL6X 3RAPR 4KYIB 2ZVPX 2CHVA 4D80A 4DLTA 1W4BA 3GLIA 3QF4A 3C41J 4LPSA 1Q57A 1E99A 1W4CA 4B3DA 3TR5A 2GBLA 3FHCB 1DAKA 2RMKA 2BJVA 2H16A 4TQAA 1YZQA 2A3RA 3TE6A 1UBEA 3WYGA 4NH0A 1G291 5LB2A 3MGCA 5FTNA 4G01B 4FCTA 1GG2A 1XBTA 1H8EA 4MH0R 1E1RD 4P4SB 3ZD7A 4C9BA 4PHHA 4RD2A 1HT1E 3C8UA 4OYHA 4MA4A 2JDIA 2B7CA 4DVGA 1W36B 4POAA 5CK5A 3FMOB 4FD2A 1GKYA 1DPFA 2AN9A 5DYIA 2OXRA 1ZCAA 2QEQA 3LNCA 4GOKA 2ZSEA 2RKOA 4MRSA 4URYR 3J81k 3PITA 5CDFA 1GITA 4EKDA 4FI3C 4NCKA 3ND8A 5HCNA 5ELXA 2A30A 2HLDD 5A4JA 1QHXA 3TW4A 2IEZA 2IYLD 2QZ4A 3RABA 3BAFA 2OE2A 2C9YA 4JVSB 4RKEA 1VCMA 2NG1A 4AKGA 4M9XA 1Z07A 2UVQA 2V9PA 2QP4A 3RYTC 3OE7A 4EFNA 2RGAA 3K9GA 4QBFA 2O5VA 3U4QB 2OG2A 2QTHA 3WYAA 1ANKA 1IBRA 3LQQA 3HU3A 3VKGA 1LS6A 2QAGB 2BVNA 5JI3E 4HZUB 2D4HA 4RD4A 3IUYA 2VH5R 2YOGA 1ESNA 4IKEA 3PFIA 1LF0A 5B2ZA 1KJZA 1W2GA 1F2UA 4KFSA 1OXXK 4DRZA 4TMWA 3Q9LA 2R2AA 4QHSA 1AS0A 2ODNA 4X8HA 4G5OA 2V54A 1II8A 4EPWA 3LFUA 2JLZA 1H8ED 4EJSB 2KE5A 4NYMQ 3HPRA 1Z6TA 2ZRJA 2IEYA 5EUMA 1TTTA 5DLQC 3RS5A 5B30A 4YXWA 2WSSA 4LHXA 1LTQA 2ZVQX 3OZXA 1GUAA 1ZRHA 1ZC3A 3M6AA 4BZPA 3GLIB 3KUCA 3QF4B 5AJVB 1SQ5A 1GL7A 3CF6R 1E2EA 2NO6A 4HLQB 4RJLA 2H17A 1D2MA 2AFIE 1Z0DA 2BMEA 2ZR0A 5FI1B 1XMSA 2AL7A 2CVHA 2Z83A 1N6PA 1OFHA 1KOFA 3LA6A 1FPMA 2BDTA 2YWEA 5EP3A 4CF7A 3FPAA 3IHLA 1RIFA 5J4VA 2LCFA 4M1OA 1KSJA 2J46A 1QHIA 2VF8A 3VQTA 5L3SA 3OE7D 1IN8A 4PC1A 4NHOA 3I62A 4LJ7A 2JLWA 3RRNA 2LWIA 1S3GA 4ABYA 4LHZA 1EWQA 3RS0A 3EA0A 3B9PA 2JJ2A 4DXAA 4RD6A 2XSZA 1CRQA 2RGNA 1QVRA 1CJMA 1E2LA 3UMSA 1UEIA 2ZR9A 1KNQA 3GJ0A 5FTLA 5EUQB 2Z4SA 4HI0E 4P0TA 5JLJA 4PHTA 5IF9A 1G18A 5EP1A 2IA5A 2IYRA 1J8YF 3OEHD 3W8RA 4F7WA 1M6NA 2RGXA 2V6JA 5KSPA 3ZZUA 3GLGA 4HZIA 2WJJA 1DARA 2WSSD 4IOKA 4RD3A 3EXAA 2GCOA 2FG5A 1OH7A 5F9FA 4DDVA 3FMPB 1TPZA 4EPYA 4X8LA 1S8FA 4E09A 1AZTA 2BCJQ 4F38A 1UKEA 3EX7C 4Q1DA 2GXSA 1WP9A 3AM1A 2O8BA 3QG1A 4QGHA 1F2UB 3ZQJA 4IDNA 4UXIA 1FTNA 1U8AA 4B3XA 2AD5A 4JLPA 1II8B 3VR1A 3GP8A 4KSBA 2D3WA 3QXSA 3VFDA 2HT6A 4BLPA 5DHAA 1M74A 1KO7A 1E98A 4PO8A 4AY2A 2BMDA 3Q7PA 1O3YA 4Q1FA 1RRFA 5FL7A 1RKBA 1G20E 3W6OA 2D06A 2Q9CA 4V0ME 1M1YE 3PR1A 1MT0A 1QDEA 2JLRA 1OF1A 2ODEA 4LV5B 3GJ8A 1AS2A 4TL7A 3W34A 4F4IA 5KSYA 4MGKR 2VLIA 5E7IA 3MRSA 4R98A 2FA9A 3QPWA 3H4MA 1RRGA 1ZNZA 2HYDA 3I73A 4NCNA 1R2QA 2JJ2D 2FEOA 4Z54A 2YWHA 4LJAA 1J7KA 1N25A 3GEEA 4DB2A 2A78A 3OFNA 3CM0A 2FEMA 1AK2A 4L8GA 1CJVC 2GZAA 1JALA 1MO4A 2DFTA 4PPQA 3CRRA 3BOSA 1E4VA 1XMJA 4ZDIA 3VKWA 3GMTA 5A5GA 1XTSA 3KXIA 1S1CA 2VHQA 4M22A 5L3SB 1UDXA 2H5EA 1N6HA 1VYTA 2IXFA 4PO1A 5H68A 1P2TA 5JWHA 2W6IA 4HUQA 1X1RA 4V0OA 5FBQB 2P6NA 4AC9A 3EA5A 4DCVA 4D81A 1VMAA 1KK0A 1CR4A 2OO7A 3DMNA 4TN1A 1E94E 4CEIB 2ERYA 2XOKA 4P33A 4HAZA 1DEKA 2C77A 2F9LA 1WB9A 1NMZA 4UNNA 1VG9B 3P32A 1RRCA 3C16C 1P9NA 3N2IA 2BBTA 2P5SA 1CJTC 4JLAA 4QRHA 2IXEA 4M1KA 4Q01A 5AJYA 4PPNA 2XITA 3AKYA 2WVJA 1KAOA 2EYUA 3AH8A 2D74A 3SC3A 4C0AC 1G9XA 1WMSA 4M53A 3RLFA 4BUJA 3RANA 4RD1A 2BKUA 1YJ5A 3CPEA 1T0JB 2GCOB 4WA7A 1NBME 1XDBA 4DT1A 2DCUA 1MO5A 1OHHA 2YYZA 4DSOA 1OE0A 3AF2A 4GT1A 4Q48A 3PXGA 2YZ2A 2CNWA 2FGKA 4ACAA 1ZMXA 2IUSA 4XTCS 5EE0A 2C95A 5KNDA 4TLEA 5LB4A 2O8BB 1N0WA 2FE4A 4TSFD 4AG5A 2ZI3A 1TU4A 3V9PA 3A58B 1W0JA 2FX3A 2HXSA 4DCUA 2ZE8A 3OFND 3AVXA 4R71A 3VU9A 2JAQA 2WOJA 4DDWA 4CEHA 1NVWQ 2IYXA 3BFVA 1YZTA 4EDHA 1GVNB 2VSOA 2JLYA 1OB5A 1ZM2A 3IBGA 5C46F 1ZC4A 1Z22A 2C03A 3LXXA 3A4LA 5KPJA 3B9QA 5G40A 3GFTA 2YC4C 1VPLA 1NMYA 2C8VA 2DB3A 3CRW1 1HH4A 1TQDA 2LKCA 4OK3A 3EWAA 4MRPA 3AVYA 4Q4LA 1SHKA 3ICEA 3VR4A 3JVVA 2CEAA 2XOKD 1S96A 1N6KA 4LJ5A 3U7EB 4AIIA 3B5JA 1COWD 4NBSA 1J90A 1GNRA 1E9DA 2J0UA 1AKEA 4TYPA 4BFTA 2WTUA 2ZRFA 2QNRA 1E2QA 3DL0A 4M9ZA 4TL9A 3I92A 3UWOA 4ZDWA 4A36A 2DBYA 3NIBA 3RC3A 3T35A 1XTKA 1PLLA 4HUQB 2O0KA 4Y0AA 2RCNA 2RB4A 3NVAA 1Z0AA 1HV8A 5TXGA 4NDZA 4Z8YA 4AYXA 1SKQA 3R9IA 4Q4JA 3ZVLA 4BFXA 2Q3MA 1LY1A 1KAGA 1OHHD 1OSNA 3LWNA 4BFWA 3OEEA 4UNRA 2WBLC 4TQUS 1G7SA 1P73A 2PT5A 2YJTD 4Q7KA 2FGJA 2ZUCA 1KSFX 1R8QA 2ZRDA 2HEIA 2GESA 1G1MA 2OUKA 3MCAA 3NBZC 4FW9A 5L3VA 1W0JD 4BASA 4HLCA 4LYJA 1A5TA 3HU1A 4ERNA 4MDFA 4Q7JB 4LI0A 4PXAA 2O8EA 3OIVA 1G7RA 4E22A 4HAXA 1G3IA 1NJFA 1EGAA 1UKZA 3KFVA 4H1UA 4XVUA 4HB3A 2W0SA 4HAVA 3BH6A 2OESA 3VTKA 1Q1QA 4GPTA 4ZIRB 1U9IA 3KUDA 3EPLA 2YOHA 1GWNA 5GVSA 5HZHA 4M1MA 4DT1B 3KKNA 3Q5DA 4S35A 4RZXA 1EWRA 2FWRA 1KI9A 2MMCA 3GD7A 1OPXA 5FOXA 1U0JA 3NG1A 3PIRA 1N2CE 3R9XA 3KDSE 1CEEA 3PENA 3TR0A 4MKIA 3RS2A 4IFBA 2C98A 2Q0HA 1YZKA 1LVGA 2ZRIA 4LJ9A 3GLFE 4ZV4A 1IY1A 5SZHB 2QUZA 3CX6A 4IOLA 3VU9B 1C4OA 3EZ7A 1OYWA 4KODA 5C18A 3IO5A 2Z4RA 4CEHB 1GRRA 2N42A 2F1RA 2ZU6A 3K9HA 4FINA 4A2QA 1MOZA 3I72A 1SHZA 3UANA 2ODBA 1NBMD 2GKSA 1JAHA 1H65A 3I5XA 3CRVA 3UPUA 3OHMA 4PO9A 2YVUA 3BBPA 1WA5A 1DADA 1N5JA 3MLEA 3H2YA 5DN6A 4B48A 2X1VA 3OEED 4LJ4A 3KKQA 4KFRA 3AVTA 3MJHA 1QHSA 2WWFA 1Z06A 5FOWA 2ZRNA 3SNHA 1Q12A 4JLNA 4PPGA 1XFAA 5TVKA 1TUIA 2CLCX 5IK2A 4BFYA 1ZM7A 3FMIA 3U6BA 2IX3A 3ASYA 5FPKA 4C0KA 2IYWA 3T61A 2IYZA 1TNDA 1XRJA 4NU0A 3QXCA 1JR6A 4JYBA 2E1RA 2QTFA 3ZVRA 3LO5A 3N2EA 1I4TD 4Q19A 4W9MC 4FXPA 4MYHA 4OQFA 3Q8XB 4PHGA 1XWIA 1E9RA 4AG6A 3KKOA 4JL8A 3LVRE 4OHZA 1WQ1R 3G82C 4FMCB 3OIYA 2RAPA 1IN5A 2YWFA 3L82B 4DLYA 1Z0FA 3QPVA 1DG3A 4C0JA 1PV4A 1N5IA 1NIPA 3P4YA 5JRZA 3SU8A 4OQMA 4M1TA 1HEIA 5FUVA 1VG0B 2DYKA 3GFPA 4QM7A 4KITB 2NIPA 2O8EB 3A4MA 3KQLA 3FDIA 4OHXA 5KO2A 3QEOA 3REFA 1S9HA 3GLHE 3N5CA 1VCIA 3IPYA 3V00A 4JT4A 3SQXA 4DLVA 4OK6A 1BYIA 1ZCBA 2RGGA 3LY5A 2WWGA 4B6FA 2D7CA 4KBFA 1SXJC 3WYFA 1W48A 3BD9A 4G0NA 4WAUA 3CUEF 4B2LA 3KJHA 1FOEB 2OBLA 4DC9A 2IS4A 1FNMA 3FB4A 1E9BA 2G3YA 3QXJA 3L0IB 2DFKB 4OI4A 2OT3B 3C15C 1YQTA 1GRNA 1QHGA 4BFZA 1DO0A 2GVDC 2NOAA 5FOTA 4ZCMA 5LD2C 1BO6A 1YZLA 3EG5A 3F0TA 3KQHA 1NRJB 2EFHB 5AUPB 3T5GA 1N5LA 1HY3A 2XX3A 1IXZA 4JSTA 4R2IA 2FZLA 5CM8B 1DAGA 4TYNA 3CNNA 1QBKC 3NBXX 1WE2A 3QENA 3K53A 4X8OA 3TSZA 1EX7A 4OI1A 1E79A 2R9VA 3RDPA 4JLKA 4HDOB 4URZR 3EZ6A 5FOSA 3CB4A 4JLDA 1FMJA 4N1AA 1C1YA 4NYIR 1F3OA 1GP2A 1A82A 2FFHA 4MGYR 2QMOA 2ZRCA 2WIAA 1GKIA 1VYVA 2CL0X 2R6DA 3VNVA 2P2LA 3L43A 5TMPA 2RH5A 3EIHA 1ETUA 3RNLA 2XZLA 2OXCA 1XPRA 4H1VA 4TMXA 3LXRA 2BWJA 2DPXA 4DBLC 2ZIAA 3ETLA 4QGFA 1DAMA 4A1FA 3FHTA 2Z43A 4DSNA 3K70D 5CYOA 3W6PA 4YC7A 1Z0IA 1VG1A 1KZ7B 4I81A 3K9LA 1JI0A 4ARZA 1FQJA 1M2OB 4DJTA 2REOA 1S9DA 4FMBB 3WP0A 3U5ZB 2OLJA 5AR1A 1W36C 3FHOA 3IIJA 1IY0A 1CRPA 2ZJBA 1X8LA 3B1XA 3HU2A 1WBBA 3PV0A 1G6HA 2GK6A 1P3JA 1ZD1A 2WM9B 2C96A 5C2JB 2YOFA 3W6NA 5JCPA 1CLUA 3LV8A 2WMNB 1FW6A 2P6UA 3FWYA 4QHYA 2I1QA 2RHDA 1GDDA 1JQJC 1AKYA 4K8OA 4PZLA 2IS6A 4URWR 1XMIA 1DG1G 4C7OB 2NMVA 4C2UA 4KFTA 4IW3B 3B7GA 3NH6A 4TZ0A 3I1FA 1T5LA 3U61B 2KSQA 1E1RA 1MRSA 4GZLA 1AQUA 2H8KA 4PHFA 1HUQA 2QAGC 4NCJA 5LPNA 3HPQA 1G3RA 1XXHE 3PQCA 5JS8A 4R2HA 4URVR 3VX3A 3IO3A 4JJKA 4XD7A 2CMKA 1KJWA 1RE0A 3NHAA 3SOPA 3FMFA 2F1JA 1JJVA 1KIMA 1XEFA 2VP9A 3SJCA 2C5LA 4F91B 2IT1A 3GJ4A 3PUVA 3GLIE 3AF3A 2QAJA 4PAOA 3Q3JB 4KO8A 5EP4A 5AUNB 2O8DA 2WAYA 2FMXA 4LYFA 4RFSB 1CIPA 4WVFA 3HWSA 1G5PA 5JRJA 1U90A 3AEZA 3ZGXA 4EJSC 3AP2A 3LVQE 3WP1B 1W4RA 4BLTA 4FWTA 2J0SA 5DHFA 2JLSA 3CZQA 1G3UA 3ZZTA 3MAAC 4I1OA 2ORWA 1EFHA 4Q02A 3K09A 3I4LA 2JATA 5FOUA 2N46A 3TAUA 1OYYA 4A0FA 3WMEA 3TH5A 3U7GA 4V0NA 3X1XA 5JJKA 3KQKA 5CLLA 2XGJA 3MG9A 3TQCA 1OIVA 5BN5A 3U6KA 2MMGA 1KDRA 2GBLC 3AB3A 3Q72A 5IHPA 2PMDA 1XX6A 1NSTA 4CIDA 2XNDA 1G3MA 1RZ3A 4D4MA 1L7VC 2PCJA 5BQ5A 4BZXA 4YDSA 2BMFA 1RYHA 4ZCIA 2V8OA 4U7DA 4ARZB 4UNQA 1Z29A 5D3MA 2J59A 2O8FA 2X19A 1AM4D 1OFIA 2BBWA 1DAIA 2PLFA 3Q7QA 4LYHA 1CKEA 1XZQA 1KMQA 2QMUA 2VP6A 4KBGA 2ZRPA 3DKVA 3CWQA 4MKHA 4Q9HA 1QG4A 2IHBA 1XJCA 4JMPA 2P65A 1N0VC 4I1UA 3SN6A 1FX0A 1ONBA 3CR8A 4JS0A 3H86A 3W5JA 4QOSA 4XD7D 2VPPA 2IUTA 3F8TA 3LH5A 2AK3A 1P61B 4UXHA 2BBSA 1VG8A 3AKDA 5BN3A 1N6LA 4XVRA 2HV8A 3A1VA 1LNZA 1R6BX 2Q21A 4LJ8A 4RCZA 2GF9A 3C7KA 1AA9A 3NC0C 3T1QA 3N70A 121PA 4PQYA 3TSOA 2J7KA 1TF7A 4LSGA 3S1AA 2OILA 2B92A 2WHXA 4W5HA 1FNNA 3T1TA 3EWSA 1QG2A 2D2EA 5FI0B 4B32A 1ZD8A 2XEXA 2B8TA 3NC1C 1A2BA 4EPTA 2WV9A 4UJ3A 2VL7A 4A2WA 5J5CA 3QKSA 1Q0UA 2P3SA 3SJAA 3AUXA 4QHTA 4IEEA 4XIGS 1UBCA 3AUYA 3NXSA 2V1UA 4MQBA 2K5UA 4US1R 1EG7A 3HR7A 3B85A 3BGWA 2XNDD 3I3SR 5KDDA 2O8DB 1SVSA 4G5RA 4W7SA 3TUZC 4MRRA 1SZPA 3EZ9A 1DS6A 2FN4A 1R4AA 1FUKA 1J8MF 3KB2A 3AVPA 1GM5A 4IDHA 3ZD6A 1T8UA 4B3BA 1I2MA 1M34E 3A36A 3T34A 3CPJB 2EFEB 4B3FX 2QU8A 3G0HA 4OHWA 2XTZA 3DMDA 3OEHA 1M8PA 1I4DD 5JJIA 1UJ2A 1ZINA 1VHTA 1E2DA 2MSEB 2JASA 3K0FA 4LV8B 1NKTA 4TYQA 2ZS8A 3ZH9B 1PZNA 1AGRA 1YR9A 2GRJA 2VHUA 2ZUBA 3AGQA 4JT2A 3U3MA 3UK6A 4LRWA 1NG9A 1KTVA 1R0WA 4RSGA 1Q3HA 4TLAA 4RY2A 4A92A 5CB8A 3X2SA 1Z3IX 4A8JA 5AJWA 1U8YA 2G1KA 3HYRA 5FTKA 1GILA 1YZNA 5E4FA 2WIBA 3PVSA 3QQ5A 3JZAA 1JNYA 4TLCA 3K0EA 1U0HC 3DM9B 5CIWA 5FBRB 2O8FB 2CCJA 4ON9A 5L8VA 2VSFA 4TTQA 1GAJA 1TAGA 2ZANA 1TU3A 4CVNA 3HP1A 3CWZA 2WPDA 4B71A 5B58C 1NVXQ 4QJ5A 2JJ8A 2ZJAA 3AP1A 1LB1B 2YINC 2BBOA 2XB4A 1ZUIA 4OJQA 5JCZA 2GJKA 3BIFA 1FX0B 1I4LD 4WBSA 3KFXA 4DUGA 1N3BA 3AKEA 1W49A 1MABA 1G8PA 4V0LA 3SHWA 1XNJA 5CB6A 2REXB 2ZRKA 4L15A 4JL6A 2RGNC 3EPHA 2FSIA 2ZAOA 2IWRA 2ONJA 1QF9A 2G83A 2PT7A 4OQNA 1IQPA 1P7CA 3LBIA 3P26A 1D9XA 2F43A 2J41A 2J87A 3CNOA 1XD2A 4UJ5A 2EWVA 2IYYA 2TMKA 2WWIA 4TTPA 3S1AB 2GDJA 2WKQA 3LW7A 4QKQA 3NEJA 2ZRGA 4V03A 3U2QA 1KSHA 2ZS9A 2XXAA 4PTLA 3VR3A 2Q9BA 4Q47A 3X1ZA 3BB3A 2FF7A 3QKSB 2ZSAA 4RVCA 3NBYC 3V4FA 1CTQA 3RS3A 1KO4A 2CLDX 4NP6A 1TMKA 4WXRA 3EAQA 1KDTA 1KI6A 1N6NA 5KDLA 4QJ3A 4L9WA 3RWMB 1JB1A 1NSFA 4EFLA 1G64A 2QM7A 2ATXA 3H84A 2NPFA 1JXOA 1Z8FA 721PA 2KBEA 2X8AA 3PEYA 2ZU0C 3L0OA 5J4KA 5UKDA 1MKYA 2WWYA 5EE5B 5DNYB 1G8GA 1JR3E 2VSXA 2WPDD 4A15A 1E96A 1XJ0A 1IJFA 2DHRA 3B8HA 3K0FB 4Q4HA 1P2VA 2AXPA 2QT1A 3U3KA 3E1SA 2C78A 4JIMA 1A1VA 4C3ZA 3UWKA 5HZKA 5FR1A 2ATVA 4I1VA 2FPKA 2J3EA 2V7QD 2QG6A 3H1TA 2XJ4A 4DUGD 2J5XA 2OLKA 2WJGA 3UG7A 4PSAA 3QXXA 4IVQA 3I8SA 1FFHA 4A8JB 2ZSFA 3C5HA 3ZVMA 1PLJA 1Q3TA 1EFRD 4BFUA 1R5BA 5KNBA 5H70A 2YHSA 2WMOB 4FN5A 4XWOA 2ZJYA 3TRFA 3GFOA 2GJAA 4TSFA 4KLNA 2O8CA 4CT4B 5DH9A 1QVAA 1OB2A 4LDJA 5HKKD 4JLOA 4L9SA 3BERA 3THXA 1AS3A 2IL1A 4KXFB 4BRWA 4A0RA 1S4QA 4L5BA 2OFWA 3TKLA 4QXAA 3IHWA 2ANCA 2XTNA 3CRMA 2J1LA 5JI2E 1NL3A 4LC0A 1YU9A 1DAFA 1XPOA 4TYWA 2VTKA 3M1IA 4MGZR 3MUFA 2PL3A 1Z83A 1MABB 4M1SA 4ILEA 2L0XA 1Q1EA 1D8TA 1KZGB 1OFTA 4QM6A 2C9OA 4HYYA 1CP2A 2QRNA 2GILA 5FTJA 2G77B 4QC2A 3DVLA 3TVTA 1NN0A 4O0MA 1CXZA 3LBNA 4RFVA 4D0NA 5CYPA 2OCBA 4Q1BA 3ZYCA 3KTAA 4ASUD 1E2MA 4M1WA 3SYNA 4A82A 1BYUA 2HCBA 1XD2B 1COWA 2A5JA 1U81A 3ADCA 4CDGA 2QROA 3PEVA 3RWOA 2GHIA 4H9GA 3P4XA 4BFVA 3QG5A 5JMTA 2IYSA 4V0MA 4IHQA 1E6CA 3RRYA 2XXAB 2NZ8A 2ZPTX 2HCJB 4M0LA 3GLGB 2C9CA 2P5TB 3VR6A 1K8RA 1NY5A 1Q1BA 2CE7A 1SKYB 1MO3A 3LRPA 2OBNA 4TT3D 4D4LA 1F2TA 3LX5A 1IY2A 6Q21A 1KI6B 1XB2A 2OAQ1 4D4JA 2GZDA 3EASA 4EFMA 1XMVA 1MV5A 2ZM5A 5DO9A 4UXJA 1E0SA 3BB1A 3U7HB 4DLRA 4BZQA 1EFCA 1UFQA 2FPMA 4ZPXA 4R7ZA 2GK7A 1DAEA 2VP5A 1HE8B 2GAOA 4NZYA 3TIFA 3RC8A 1EK0A 4C4PA 1ZJ6A 2GETA 4Q4HB 2NZJA 4RD0A 4B34A 1K5DA 5B57C 4IDOA 1Z6XA 4TLDA 4Q03A 4U5XA 4XSHA 3THOA 2FH5B 1RC8A 2CVFA 4ZCLA 3SR0A 4TTRA 2ORIA 2PLRA 1ZU4A 1SULA 4FMCF 1F48A 2DWPA 4JZKA 3REGA 3LDAA 2NO7A 3T5DA 2R6CA 3VHLB 1SVLA 3IILA 4B3GA 2BIFA 2G0NA 5AUQA 1OXTA 1JPNA 4DEXA 1Q22A 1ZUNB 4RKFA 2YC2C 3THXB 1FUUA 3DDCA 4HLUC 5FBWB 2A5FA 5JJLA 4MUBA 4BECA 4M9SA 3O8CA 2OV2A 5CLQA 2NO9A 1Q20A 5HE8A 4PC2A 2IF2A 2W58A 5AWFC 4PZZA 4HDCA 4D82A 1RFLA 1NBMA 2GF0A 3L0SA 1Z2CA 1P75A 1T3LA 4ITRC 5K8UA 2GJ8A 5JBQA 1II9A 2VA8A 1JBKA 1T5IA 2J9RA 3SJZA 2DY1A 2IF0A 1FTSA 4URUR 4P3YA 3R7WA 4EIWA 4PPFA 4A9AA 3A6PC 2GJ9A 1DBSA 4IOJA 4M4SA 2OFXA 3WRXC 1OFUX 4JKIA 2IBMA 1X6VA 1Z0KA 1KY3A 1M7GA 4BEBA 4XWKA 2VHTA 2C99A 1U9IC 2UZIR 5FUWA 2AWNA 4NPHA 2GEDA 1E2GA 821PA 1BS1A 2B6HA 2ZJ5A 2QBYA 2HT1A 4BQSA 2LKDA 2J7PD 3ECCA 2GWHA 2V4ZA 1F2TB 5AUOB 1K6MA 3CONA 3TNFA 1XTRA 4D6PA 2QPAA 2H92A 4PFSA 1MH1A 1TQ4A 1W47A 1SVOA 2D2FA 3DO6A 1TUEA 1ZU5A 3UATA 3RS4A 5FUYA 1PUJA 1VHLA 1GRQA 1E2FA 3NTUA 2GTPA 2HJVA 2BM0A 1G6OA 5FOVA 5DI3A 1Q21A 4P4UA 1KI2A 1E9EA 5C1BA 5J47A 1RVDA 3BWDD 3DM5A 5H8WA 1U8ZA 5DI9A 2IUUA 1P2UA 1R5OA 5G3ZA 3QF7A 1NN5A 4D0GA 2ZYVX 1VYUA 5KYKA 521PA 1NJGA 1IN6A 4BGDA 1YZGA 1TEVA 3EW9A 1WF3A 2A5GA 3AKCA 3GEHA 3QI2A 1Q44A 3IIKA 4B3CA 3ZS8A 1Y3AA 3QKTA 2F3TA 2WJVA 1KK3A 4TMZA 1Z6YA 4KYUA 3TW8B 1IAQA 1JPJA 1PLKA 5CJPA 4DLUA 3AVWA 4A4DA 1DTSA 5EXSA 2CHGA 3OIWA 4I4LA 1CR1A 1E2PA 3QJYA 2PZEA 4LOAA 2ZYTX 1TX4B 4GOXA 2G1JA 2OCPA 2G9NA 5HR5A 621PA 4GL2A 1J2JA 4D4KA 4XSGA 1ZIPA 5JS7A 2QQEA 2J0UB 5FPTA 4AKEA 3U3OA 4U02A 1G4AE 1W46A 1ZNXA 3AVVA 4I99A 1R7RA 2HF9A 4UQOA 3RHFA 3LAWA 4HEJA 1WRBA 3W5IA 2ZS7A 4GNKA 1KNXA 3CZPA 5EE3A 1LFDB 2R6FA 2ZRBA 2JEOA 3BH0A 1GTVA 3BC1A 3ONWA 4DHEA 4OHVA 1FQKA 1OT3A 2RGCA 4Q4JB 5LBIA 1Q1ZA 4B76A 3TSWA 3MWYW 3R7WB 1OKKD 3SBEA 2AXNA 1N5KA 2CCKA 3JVUA 1VCOA 4JBYA 1MRNA 1SXJE 3GLFA 1E0AA 3GJ6A 3U3JA 2EYQA 3T1VA 2PEZA 2GZHA 1A7JA 5KSZA 3SBDA 1L4YA 1EXMA 3WXMA 1IJEA 4TMKA 5JEDA 2AX4A 2ZR7A 4J0QA 1G17A 1P9WA 3HDTA 1CR2A 2GXQA 3IQWA 2QA5A 3R9WA 2FFBA 4QBGB 3A1WA 2WWWA 2Q9AA 1UBFA 5BYKA 5EP2A 3VKHA 5KPDA 2FOLA 4EPXA 2QBYB 5FFMA 3K0CC 3BH7A 1KI7A 1KKLA 3WNDA 2O0JA 1N6IA 1NLZA 1XEWY 4C0HA 2GAAA 2P0EA 2O0HA 3DZ8A 4M9QA 4QBHA 2OBMA 4QBIA 1HT2E 1CU1A 4PAQA 3LLUA 2AHOA 3ADBA 3PCRB 1R5NA 5JWRA 4G3XA 3M0EA 1GNQA 3CO5A 5DI3B 3X1WA 1DELA 2GXUA 3R8FA 4NONA 1QRAA 2WWXA 2IC5A 1FMLA 3KXLA 3AQ4A 1GSIA 4Q9IA 1SVKA 1E9SA 2OHFA 3QUSA 3T15A 3NKVA 1ZAKA 2VHCA 4O2LA 4W5JA 2VIIA 3C5CA 1L8QA 4V0KA 1AIPA 2E9SA 4GBMA 1UADA 4CZ2A 4CYMA 3AGPA 2PCLA 2IYTA 2QP3A 3VX4A 3GJ5A 3OF5A 2ZRMA 4MUAA 5EXPA 4JKYA 3TAHA 1WBDA 3B2EA 5JHGB 8OHMA 5KOYA 1G7CA 4MGIR 3P1JA 4D2IA 4KU4A 5KSOA 5KTYA 2VEDA 3OESA 3PUXA 3MFYA 1E9FA 3UKDA 2W2VA 3BS4A 5K8LA 1ZM9A 4HAUA 4F4CA 2X2FA 2CLSA 3GLHA 2ANBA 2H57A 2W6JA 2CCGA 1G5TA 3IEUA 4NYMR 3BB4A 4IEIA 5KU1A 4TLBA 1S2MA 1ZYUA 5J4YA 1JEEA 1NN1A 4WXPA 1ZD9A 3IQXA 3D3QA 1ZP6A 1Z0JA 4FMDB 5DGXA 3VR5A 3E70C 1TF2A 4XOIA 2GVZC 3K1JA 3AF1A 1J70A 1TF5A 4G1UC 4ZDKA 4TL6A 4BWYA 5C4MA 1ZM3A 2WKPA 4Q66C 1I2DA 3C14C 3O8BA 2ZEJA 3CF2A 3VMFA 2PEYA 1VCNA 1T3SA 5AK0A 2XTMA 2W2TA 2D7DA 3AVUA 1S1MA 2QL6A 1VIYA 1E2JA 4KCGA 3T06B 4GP7A 3K70B 3KB1A 4FCVA 3P20A 1YHNA 3B1ZA 1XEWX 1X8JA 4PR0A 1UF9A 1W4AA 1KO8A 3ND9A 3L8ZA 3QIAA 5JSZA 4JLVA 3EZFA 1FP6A 1KI8A 3C4JA 4JLMA 2FSFA 4Q9JA 5FPSA 5IDVA 4Z1MD 1G21E 1NI3A 1YR6A 5F3WB 4XTRA 1NVVR 5DSZA 2JGNA 2N1BA 4PC6A 1KDOA 2FNAA 4Q9LA 3SFZA 4MDEA 2Z5FA 4G5GA 4A0HA 1TL7C 3NEYA 4PAMA 2W6JD 4PSKA 2IXGA 3AF4A 1KMHA 1FL9A 3KKPA 1AN0A 3KJEA 3HR8A 4GRAA 2ZSBA 4GZMA 5B64A 1EX6A 1T8TA 3A4NA 3QE0A 4XWAA 2IK8A 5TB5A 4WZ6A 4OL0A 1JECA 5HTKA 2KWIA 1X86B 4HAWA 3WNBA 4B33A 1XTQA 4Z51A 2GNOA 1QZXA 1CBUA 2W00A 1Z6GA 2ZROA 4AKIA 2FSHA 4HLDA 2ORVA 3QNUA 4HZUA 4Z8XA 1UPTA 2WKRA 3GLHB 4MYUA 4QNMA 1NKSA 1EFTA 1LF5A 2IW3A 3BJIC 2BM1A 5CDFE 1G4UR 1U2RA 3DPUA 5AJXA 3ZZ0A 2FU5C 3SS8A 1F6BA 5EJEA 4NKRA 2R6GA 1S0UA 4IVPA 4RZ3A 5F2EA 4HATA 1XXHA 1T91A 4FWIB 3ZQ6A 5AJZA 3DOFA 1W36D 5BWMA 3KJGA 1D9ZA 4S2EA 3FFAA 4L4UA 4DLZA 1P62B 4MKFA 4ZKEA 1B0UA 3CKLA 1T3HA 1CULC 1FZQA 1KI3A 1QHYA 5GADl 2NTYC 4C2TA 4MYCA 4DCNA 4DCSA 4B6EA 3TVDA 2JJ1D 3OAAA 2PX3A 2WZQA 4AKHA 4JJZA 4TWZA 1XU4A 2IYVA 5JZVA 1US8A 3QXHA 4AURA 1W7AA 1BMFA 5FTMA 1OXVA 3QEJA 5JSZB 2X2EA 4LJYA 1KDPA 1W2HA 2VRWA 4PSVA 2I1VB 1XCPA 2KBFA 1E2HA 4QG7A 3AP3A 2HF8A 2QENA 3BE4A 3FVQA 4OBEA 5CIQA 3WMGA 1YRAA 1TADA 1W5SA 4ACBA 2QE7D 3FKSA 1KO1A 2ZJ2A 2HDNB 3IIMA 4Q1CA 5FBVB 3ZIAA 1KMHB 3EPJA 4II7A 2XZPA 4JBXA 2OEPA 2X77A 2QT0A 3BFKA 4LPKA 3QSYA 4LJ6A 4BLQA 3ADDA 4Q1AA 1KGDA 2Q6TA 5FPYA 4RCYA 2NPIA 3QVVA 4F93B 1II0A 4Q7LA 2P67A 1NMXA 4GOJA 2ZI9A 3WBKA 1GIAA 5CITA 4WZBE 1ELOA 5FH9A 2O52A 2QPOA 2PMKA 4A8JC 2PH1A 3TQFA 5DIFA 2HXYA 3R8CA 4B2PA 4US2R 2Z6VA 4EQ6A 1CS4C 4YMTA 1HTWA 4NYIQ 2H18A 2R44A 2Z0MA 1T9HA 4B74A 2CHQA 2F1IA 2C04A 1G16A 3BFXA 3QBTA 4G5SA 1LW7A 4CRWB 3OAAD 1BKDR 4YLGA 5A0FA 3IEVA 4Q21A 1AGPA 1GL6A 3EZ2A 1IXRC 3Q5EA 4DIEA 1P60A 4YMSA 5IT5A 5D3MB 2JLUA 3EPKA 1RPZA 5FUXA 1P5ZB 1R0ZA 2ZYUX 1BMFD 1TEXA 2CL7X 1XXHB 3RSLA 2JDID 3SZRA 4YONB 1TQ2A 2F1HA 2EQBA 4PZYA 4D0LB 1ZVQA 4M2LA 4ZI2A 4B35A 2IYUA 3RS7A 3GLGE 2YV5A 2GXAA 1SKYE 3BORA 3LW8A 2V7QA 4FCWA 2QY9A 2RGEA 3A8TA 3KXKA 2DWOA 4W5WA 3FKSD 2HUPA 4BFSA 2BV3A 5E7MA 2EFCB 3ZVNA 1R8SA 2REBA 1EFRA 3LQRA 4K81B 1QHHA 3ZIAD 3U7FB 2PZFA 1WDTA 4JVMA 2RHMA 2QM8A 3GQBA 1LV7A 2FFQA 4IVRA 3PJRA 1US8B 5HKKA 4A6PA 2PBRA 1GOTA 3CW2A 1KK1A 1T4GA 2ZITA 1ZM4A 1VECA 3PUYA 5GJWC 4DKXA 3PUWA 3PEWA 3MWJA 4IXNA 2OCYC 4GSYA 1OXSC 4M8NE 5CJ2A 5IRCD 2R6AA 3ADKA 3MWKA 1U94A 4CEIA 2J0VA 1KJYA 4PX9A 2ZRLA 5K8TA 4LBVA 3U3RA 2Q3HA 1NVVQ 4ASUA 3THWA 3AF0A 2V6IA 4NYJR 4IDPA 3CH4B 1T0HB 1YRBA 4ZIRA 3VNUA 4ZKDA 3HJNA 4QGAA 2EFGA 4NCIA 2V1XA 1E32A 1IHUA 4IFEA 2XJ9A 4YXWD 1W0KA 5FBLB 1OW3B 2ZSDA 3L8YA 3EARA 3UG6A 3TK1A 2J0QA 3CX7A 1PVOA 4TT3A 1G8FA 3AV0B 2GCPA 4EQ6B 3L2OB 1NNEA 1VDZA 1OIXA 2F7SA 4A2PA 2H1LA 3D7MA 3RVBA 4RZ2A 4HSEA 1R10A 1PUIA 4BLSA 4KSCA 1DOAA 1KKMA 4LBZA 2F3RA 4TZ6A 4EAQA 3B13B 2DFNA 4CT5A 3NHBA 5TY0A 5TDHA 2F55A 1KYIA 3MD0A 3M4YA 2GCNA 5P21A 3TJZA 1UKYA 3TBKA 4DDUA 1R0YA 4HAYA 5JEEA 4BRUA 4PANA 4KHZA 4YQFA 1P72A 4P31A 4V02A 3D6TB 4TMTA 2CJWA 1AJEA 3V4RA 3O47A 5C4GB 4KVAA 3NH9A 4TYYA 4M21A 2A5DA 1W44A 3QKUA 5JFGA 1G41A 1JJ7A 1E2IA 1ESMA 2XSZD 2BC9A 1QHHB 1XJQA 3IBYA 4C0QC 2ZXUA 4O2RA 3FE2A 4OKSA 3U44A 1D6JA 2ECKA 4JLJA 4MYTA 1DE0A 4E5UA 2R8RA 2W0MA 2ZJZA 3K0AA 5HCIA 2F43B 5HPYB 1G8YA 1CJUC 1XCGB 1E3MA 1BOFA 1JR3A 2ZJOA 1XPUA 2A2ZA 2AR7A 2BOVA 3IGFA 4Q00A 4CEJA 2ZREA 2I4IA 4N0EA 2F6RA 4LBWA 4WW0A 1G5RA 3DEFA 1KHTA 4LHWA 1W0KD 3HYTA 4ZO4A 2WJYA 221PA 2ZI5A 2VBCA 1NLYA 4YDHB 1NVUQ 4N0DA 2MSCB 5KNCA 2E87A 5J4HA 1G8HA 5DE3A 3LBHA 3WBJA 1Z28A 2AK2A 1U99A 3VR2A 1WXQA 3FYHA 3AVQA 3DKPA 1KY2A 1X8KA 3A37A 2P6RA 4DCTA 2QGZA 4HB4A 4OJKA 4GMXA 2GEUA 4JVNA 3THWB 2G6BA 1GL9B 1TQ6A 4I1SA 2NO1A 1ODFA 2VP2A 1H8HA 4JBWA 4IDQA 4IJMA 4IOMA 4TMVA 3SDZA 2C2HA 2QSYA 4JL5A 4KV9A 3DHWC 3ZDQA 4Q18A 1ZW6A 2F9MA 3BK7A 1N6RA 5F98A 2QPTA 3X1DA 5FL7D 4OHYA 2ZUDA 2PZGA 4B75A 3G5UA 1GKUB 2PX0A 3H0KA 4QGGA 4DSTA 3I61A 4QJ4A 1NG1A 4KAXA 1RRPA 2J7PA 2IS1A 3VAAA 1O87A 2VP0A 2OFOA 5L3RA 2BCGY 2YNMA 4AYWA 3EC1A 1A2KC 1MR3F 2ZI4A 3U60B 3NDBB 3R20A 5G41A 2O8CB 1D2EA 1IONA 3VHXA 4F92B 1JR3D 4LWZA 1OJLA 4P4TA 5F9HA 5HE9A 3ZLJA 2ZYWX 421PA 5EE9A 3RSOA 3PG5A 1YR8A 4XVQA 4D25A 2QMHA 1HYQA 1E0KA 1P2SA 1R0XA 2WAXA 2CJWB 4Q7MB 2XZOA 1G3QA 2W6ID 5EZ6B 4OI0A 1HURA 2YKGA 3SE0A 3BXZA 2DWQA 1QHNA 1Z5ZA 3Q85A 1IN4A 2JIZA 2ONKA 5E3HA 4CGZA 1NLFA 2QORA 2VQSA 5GJVC 1N0UA 1P4SA 3F3YA 2HJGA 4FIDA 5BYJA 2I3BA 5EXTA 4LGMA 3W3AA 4E07A 3U44B 3KTAB 3SHFA 2FDCA 3CBQA 4GP6A 1OIWA 2ZRAA 3K0AB 3KZ1E 3FGNA 1AQYA 1E9AA 3W3ZB 4TL8A 4YMWA 1NP6A 4NCHA 2G88A 1FP7A 1H8HD 4CEJB 4HLUA 2V55B 1F60A 3FFBA 4JYCA 1ZUHA 1V43A 2IHYA 4LK2A 4OQLA 4G5QA 5GJBA 4NE2A 4PC7A 4D26A 2JLVA 5FR2A 3SFVA 2NO0A 3PUZA 4QL3A 1GFIA 3WNCA 2FPLA 2ZE6A 3UIEA 5JHHB 1AZSC 5E95A 4MKGA 3D8BA 2RGDA 5TARA 3QY0A 3UMRA 3K0SA 1E9CA 4ZI3A 2CNWD 3RRMA 1CF4A 2ZETA 2JLQA 3A1UA 4DLXA 4WIAA 2Y8EA 1OKKA 2WICA 4O25A 1VKJA 4DWJA 3DOEA 1OLOA 1JAIA 1E1QA 2QN6A 2QRZA 2DR3A 4L16A 3I8XA 1E4YA 1UDWA 1W1WA 3CIOA 1KSGA 4NTZA 1NF3A 3B60A 3D31A 4OK5A 2ZI6A 3UXMA 4FMDF 3THYA 5EE1A 3GCGA 4HB2A 4NYJQ 4R9UC 1Z63A 2IWHA 4GFDA 4YMVA 4C0SA 3IKJA 2A7QA 3K9NA 2JIZD 1VTKA 5CM9C 4ESHA 2BHRA 4QFMA 3WRYC 4WZAE 5EQTA 3W8NA 2RGBA 2KB0A 4DSUA 1GNPA 3SQWA 1UAAA 3NDPA 3MSXA 1M7BA 5LDDC 1ZIOA 2CDNA 3B1YA 3NBFA 1G19A 3W9YA 1NIJA 1K5GA 2W2XA 4AK9A 1Z2AA 1ZNYA 2PJRA 4US0R 4DLWA 1JEDA 2QGNA 2AKYA 1ZNWA 1JXMA 1HA3A 4Q1EA 3PEUA 2ERXA 1Z08A 2ASEA 2FZ4A 1HQYE 4CW7A 3SI7A 2ZTSA 2ZE5A 1XTIA 4WOPA 3ZS9A 4ZDJA 4KVGA 4ESVA 2VO1A 3QBVA 5BW8A 2AWOA 1P9RA 3KQUA 4PC3A 1V5WA 4E03A 2XB2A 3FTQA 5FL3A 3CPHA 3BRWD 2NQ2C 1P6XA 2FFAA 1Y63A 4NMMA 5CK4A 1PJRA 1HE1C 3W90A 4K46A 4UNSA 3TUIC 4EPVA 3NWJA 4LBYA 1SVWA 4XJXA 4LHYA 3I32A 1C9KA 4QNRA 1UM8A 3SYKA 2BEKA 2EU8A 1E1QD 2VYFA 1OH5A 1UKVY 2QMEA 1OV4A 4PQFA 3SJBA 1RJ9A 4EUNA 3K70C 1XD8A 4A6XA 4BLOA 1VIAA 1XEXA 4DEYA 5JWOA 4LHVA 3WHKA 4HDQB 3IDQA 2Q3FA 1GZSA 2D62A 1EESA 2EWWA 4GMDA 4KJZA 2OCAA 3IPXA 1IOZA 2XNSA 2JA1A 2BJWA 3GEIA 2ZAMA 3B82A 4OI2A 1D5CA 1XZPA 2OM2A 1RYFA 1JQLB 1OXUA 1UBGA 5G53C 1OH6A 2A5YB 4O3MA 2SHKA 1YVDA 4LY6A 2IS2A 1B23P 1S3SA 2ZRHA 4N3NA 3SYLA 4AYTA 1YZUA 1KO5A 4KLZA 5FPHA 3QPUA 2ZQ5A 1YE8A 3DZDA 2W83A 4LZZA 3EIEA 3GJ3A 1M7HA 1E2KA 1LS1A 5G3YA 2BEJA 3RRZA 4C7OA 3THYB 1J99A 2A9KA 5TV2A 3CRQA 1IM2A 2BKEA 5BXQC 4DZZA 1Z6AA 2CXXA 3K0CA 2R65A 1L2TA 3CH5A 3L0PA 3O8DA 4Q4AA 4Q9KA 5JECA 3KL4A 5DN6D 2ZE7A 3LLMA 1X3SA 1SXJA 4B73A 2XAUA 3CLVA 4OQXA 3CNLA 4Z1MA 2AKAB 1U0LA 1U98A 3P27A 2VP4A 5J4LA 3QKRA 4KFUA 1SVMA 2CK3A 4B47A 5IK2D 2FSGA 4U00A 3SEAA 1CR0A 4GDFA 1X1SA 2OSBA 4B2IA 3LD9A 1A4RA 3T12A 2HYIC 4Q5IA 3ASZA 1L4UA 4UKDA 2JLXA 1ZBDA 5GVRA 4RFSA 3LX8A 2ZI7A 2ODWA 3JZMA 4HB0A 1EFUA 3FKQA 2QTVB 3ICQB 5SZKB 4B43A 4B44A 5H1YA 4BLRA 1BIFA 3I5YA 4P32A 5EZ5A 3CF0A 3WHLA 2FJUA 5L3QA 4Y0VA 1SVIA 2AFHE 1XP8A 4X8MA 5D3QA 4BEJA 1MO6A 1YR7A 2ZJ8A 1E0JA 4JSYA 3MWLA 3TGPA 5EXXA 4EPRA 1XTJA 3GLFB 5K8IA 2JCSA 2YWGA 5SZIA 1RJ9B 3MMPA 5KDOA 1DVRA 4UNPA 4LC1A 1T6NA 1XEXB 1IXSB 3K8YA 3TLXA 3CR7A 1NN3A 1N6OA 4RZUA 2UKDA 2PJZA 2WWHA 2FV8A 3TMKA 3E5HA 3EIQA 2EFDB 3AVOA 4NL4H 4BPBA 3F5FA 5M04A 1BH2A 1HQCA 2VHJA 4TQ9A 1KI1A 2QQ0A 4DIDA 2WJHA 1UEJA 4LCBA 4IRUB 4P4SA 4MRVA 3E2IA 2B8WA 1SXJD 4MRNA 3KKMA 4AD8A 5KHOC 3GJXC 5KUTA 2KI5A 3UMFA 2DFLA 3EC2A 2GEVA 3KX2A 2CK3D 4M1YA 3A1TA 2UZ3A 1OH8A 1G7TA 2H7VA 3A1SA 5BN4A 5DYGA 4DLSA 2OAP1 2VF7A 3ZJYA 1DAHA 4IXMA 3QOFA 1XF9A 1F5NA 2J45A 4LYAA 4AI6A 1RW4A 3WMFA 2JJ1A 2NGRA 2BMJA 4KI0A 2AD1A 1E79D
chains in the Genus database with same CATH superfamily
5JISA 3IR5A 1FJGB 1C30B 2GJSA 3V7YA 2YHIB 4DDTA 2AHRA 4U9UA 1T9DA 3B6EA 4R9RA 4F8YA 1EVKA 5E7JA 1YZHA 3OIUA 1SXJB 3MJRA 1O95D 3DMYA 3MK31 5A4KA 4KQ9A 1IUKA 4Z9BA 2Q7DA 3TLAA 2WOOA 1DO2A 1DXHA 3H2HA 3UN1A 1XVVA 4YV0A 4XYBA 1KPIA 1WXDA 4K1LA 3U4QA 2XXBA 3ZHXA 1VC2A 4D3FA 1KK2A 1U1EA 1XCMA 2DCMA 2LV8A 1XD9A 3TLJA 2CE2X 2WJ3A 2B98A 1X92A 1Z47A 1RQXA 2FUCA 2SKCA 3ZOKA 3HYNA 5KOHB 2IUEA 4K5QA 4DR3B 5LD2B 1EGMB 1H6CA 4ZT6A 4CG1A 3JQFC 4D79A 3S0JA 4EYOA 1MMFB 1BCRA 1WB4A 2IYQA 2J32A 2WSMA 2HLDA 1I5RA 4C4SA 1CIJA 2QXUA 4YRPA 2OKGA 3SDBA 4A0GA 1QTNA 4CBVA 5DISB 3P9ZA 2R62A 3IPRA 5K6AC 1CJKC 1YKSA 2QI9C 3P2OA 3QVUA 3WBBA 5AW5A 5IXJA 4MHOA 4Y3UA 3SF8A 5L3QB 4YMIA 2BMWA 1L8AA 3GW8A 4IF4A 5TPZA 4GI7A 5J2UF 4URXR 2MSDB 2P9YA 2YIMA 3VPXA 2O2EA 5ANRB 2I6UA 3GNTA 2C57A 2BGRA 1D2NA 4MWCA 2ZB8A 2BFOA 3MJDA 4C78A 1VJDA 1U11A 1VKOA 4J1TA 1Z36A 4DLTA 2FKAA 2K6GA 2XDAA 2ZJFA 5B3JC 3DAGA 1QV9A 4ML3A 3B2NA 3IEPA 1Q57A 3OMXA 2WNIA 3FI9A 1AQ6A 1W5EA 2GBLA 2V6FA 4Z9FA 2JIMA 1NBHA 1XHEA 3FTPA 2JAPA 2PN1A 3HU5A 3OY7A 2VNSA 4L95C 4F3NA 3RYCB 2VOJA 4TQAA 3JQRA 4ZICA 4M3NA 4Y1EA 3WYGA 1G291 3CHYA 4G01B 1UWKA 4YEDA 3V2GA 4CLXA 2VHVA 1GPNA 4GE0A 1HNZB 3SEFA 2V8BA 4YY3B 2PUGA 1R6DA 4PZCA 3E18A 3H65A 1PFYA 4C9BA 5CVCA 4PHHA 1FXUA 3R0ZA 3TF5A 3P2IA 4YJHB 4EUEA 5GGXA 4HQ6A 3MGGA 4UFOA 1Z2OX 3JAWB 4BQRA 3GRPA 2BELA 4DLLA 4UMDA 1GKYA 1DPFA 1JZSA 5AJHA 3TCNA 4LXGA 1SD5A 3T52A 4BNTA 2G4VA 3I9OA 1N2JA 4Y0NA 2ZSEA 4HP8A 4BRZA 1NUAA 1OU4A 5HUJA 1JU9A 1GITA 2ZR8A 4ND7A 1VRCA 1L5VA 2CYAA 3N0XA 5HCNA 3F3MA 1QQ6A 2A30A 2HLDD 2VXBA 3DE7X 3KWMA 1NC1A 1MOQA 3BF8A 1R9JA 1GSHA 2IEZA 4LK3A 2BFDB 1RP7A 1D07A 1G5FA 4Z5XA 2HA7A 2WAOA 4YAEA 5K2OA 3FFXA 1AV6A 4O4HB 4RKEA 1VCMA 3CSUA 2NG1A 4U3JA 4M9XA 4C7VA 4JWTA 3RYTC 4UBJA 1CQWA 3MOIA 5A3RA 4DUYB 2UUOA 5EXEA 4GOND 2PZ8A 4EHNA 1U3FA 1YL7A 3DXXA 4E30A 3D6HA 2QTHA 1QRDA 4TVSA 2QAGB 2K2WA 2VJMB 4O4JF 3V7NA 4KGVA 1J8FA 2D4HA 4J6EA 1MG0A 1DJPA 2VH5R 1HFKA 1YQEA 4LZAA 2GR9A 1DFIA 2Y27A 1AB6A 1M5TA 3HJUA 3QU4A 1KYTA 4DRZA 4TMWA 4N3CA 3MM4A 1AS0A 2V54A 3V8PA 5KWJA 3KYIB 4EPWA 1JIIA 4UUNA 1EA5A 1ZAYA 5DMHA 2F8SA 2KE5A 2D5CA 3I6QA 3TWOA 5BRNA 4RX1A 4UHFA 1U9YA 1GQYA 5JUWA 1QRUA 1I30A 3AR6A 3OURA 1PGQA 4KKVA 4YXWA 2WSSA 5ES4B 3ESBA 3P2KA 3ABZA 4M0PA 4WBXC 1N1MA 1ORDA 2VDLB 2H0AA 3E9QA 4LDZA 1WZNA 1ZI6A 1ZRHA 3FCOA 2GYUA 1BE6A 3R6TA 3M6AA 5D2CA 1CEQA 3TZHA 3FCSB 3HHEA 3BXFA 3IT3A 2JFHA 1X7XA 2RHCA 3CF6R 3PDCA 4E4YA 1FK8A 1D2HA 1V8BA 2DTEA 2NO6A 4E46A 4RJLA 1WMFA 4WADA 2C7QA 4JIGA 1YF3A 1N8SA 2O8VA 2PS1A 1HYHA 2F8LA 3HUUA 3OHPA 1ZA1A 1SCNE 4ZCRA 4LFBB 1Z0DA 3I6BA 2IHZA 5FI1B 3WGNA 2QLBA 1PNQA 5EP3A 1LZLA 3UA3A 4TKUA 2BDTA 2AZ4A 1RPNA 3FPAA 3IHLA 4HYTA 1ZCZA 1U3UA 3UJCA 1UBJS 3FPJA 3OFSA 1A1SA 2ECOA 1KSJA 4WZBA 4W5NA 5ALSA 1IN8A 4IJKA 5FA6A 3O03A 4NHOA 3H5RA 1SURA 5CNJA 3A05A 3E3AA 2LWIA 4JQSA 1ZONA 3X1JA 2INGX 1SC6A 3KTFA 3QHQA 1H2BA 3LC1O 2WABA 1KWGA 3EA0A 1CYEA 3B9PA 2XVXA 3M6UA 5TF0A 4DA4A 1DNPA 2QM0A 2YIJA 5BVHB 2FW7A 3R0QA 4RD6A 1EJ6A 3NNSA 3NHMA 2RGNA 1D7AA 1QVRA 3ZWXA 5A4MS 1E7SA 5KREA 1T43A 2E4UA 3LSYA 4NZNA 3NYWA 1KL7A 3ZU2A 5FTLA 1WTCA 3SQLA 3GUHA 3ICVA 4QPPA 2YJ3A 2XGGA 4PHTA 5AVQA 3LRTA 1GZUA 4M0DA 1T1JA 4P7GA 5ECYA 5EP1A 3WG9A 2QYSA 1FCJA 2OA0A 3W8RA 3HUFA 2HZ7A 4F7WA 3GLGA 4QTXA 3FOWA 2IZ0A 3CLSC 3QV1A 4BZZA 5CAEB 3QEMA 4HZIA 4IAOA 2WJJA 2WSSD 3JW8A 3PA8A 4HJXA 4CETA 1H0HA 3I2GA 2R8OA 3EXAA 1JU3A 2FG5A 2UUBB 5F9FA 2R8EA 3L84A 4ND1A 3FMPB 1N7JA 3JWEA 3V55A 2EBFX 3FNFA 3TZKA 1AZTA 3WDMA 1HKHA 1SZDA 2YBDA 5KQPA 3T5PA 2XMBA 3CVVA 3IUNA 3IL2A 4Q1DA 2JFQA 3L02A 1WP9A 3W5VA 1F2UB 3EJ6A 3ZQJA 1BGWA 2OHXA 4QT0A 4C6HA 4IDNA 1YQQA 4UXIA 2F90A 1FTNA 4WE3A 1CV2A 1P1CA 3OKCA 4J75A 4B3XA 4LF9B 3ENZA 3K8ZA 3VR1A 3C3CA 4OPMA 1ULBA 4KSBA 4LDRA 4CKWA 3QOYA 3HKBB 4BB0A 5I51A 4NBTA 4A0SA 1E98A 4PO8A 2BMDA 3Q7PA 3MILA 1TMYA 1CFJA 2PH7A 1U5BA 2QTZA 2RAUA 3IBTA 4HVTA 4Q1FA 3WFZA 5EWLA 3SQNA 3VYUB 3L4JA 2HUNA 3S2ZA 2ZQZA 3M9XA 1TYDE 3AB7A 3E22B 3M2PA 4M6WB 2JFZA 1JEYA 1Y1TA 3P9KA 2J6CA 1TAUA 5C7OO 5ITSA 3DFIA 1QOZA 3BWVA 3EHEA 3W34A 2PUEA 2P2SA 3AUJB 1SUCA 1Y9ZA 2C61A 4QIHA 3MRSA 4UFPA 3QPWA 4HMPA 1U5AA 3A11A 1RRGA 2NAFA 4RVUA 2RHRA 4N5IX 4NCNA 1R2QA 5AM2A 4Z54A 3V9AA 3YASA 2EKZA 2PSSA 2OO5C 1MX3A 3I1YA 4OJTA 2ZJ7A 2A78A 3OFNA 1DRJA 4XIIA 1AK2A 5AM5A 1CJVC 1CQZA 5DVZA 2W6ZA 2DFTA 4PPQA 3V3KA 3VR5H 5CX1A 1XMJA 4ZDIA 3VKWA 4DQDA 3GMTA 2WG2A 1QCDA 3L5OA 1XTSA 4BE9A 5A5GA 3UHOA 1S1CA 1UDXA 2JAHA 2H5EA 1XZEA 3TTYA 3GEMA 1VYTA 3KR9A 4UPEA 1QTIA 3QPCA 3KSAC 1RBYA 3QYFA 4JZYA 3SXUB 3WIDA 5CFPA 1X1RA 3O3OB 2UYCA 2P6NA 2G1PA 1NUHA 2Y6UA 5EJ6A 3DMRA 4HCJA 4DCVA 4WECA 2XGMA 4K0RA 2P2NA 2PWPA 2WC1A 1VMAA 1HSOA 1U2DA 5K51A 1NR5A 1CUBA 4HDNA 5KTOA 1AVTA 1XTBA 1ZJ4A 4DV4B 3DMNA 4H3SA 3RCBA 4ZO7A 2Z1DA 1E94E 3GLSA 2VJBA 1MZVA 1Z0UA 4CEIB 1DO8A 5ABPA 4L72A 1DEKA 1RAFA 5JDCA 2WB2A 2DERA 2OZVA 4GW3A 2J6HA 3GNQA 1VG9B 4P4GA 4UNNA 3C16C 5FTWA 5T8KC 4DXDA 3F7TA 4LOHA 2BBTA 3ELDA 3F6CA 3SP1A 1G8SA 2P5SA 1CJTC 2RGRA 4M1KA 4Q01A 4PPNA 5A4DA 3QVGB 2WVJA 3CVYA 2R2GA 2WFLB 4G1MB 4C0AC 6AT1A 4M53A 1QTRA 4MV1A 3MOGA 3W5AA 1PT5A 4HWPA 2V6GA 4PYKA 3CZ4A 2G63A 3SZ3A 5HKOA 4IIJB 5JQGF 3B5EA 4JOQA 4KVFA 4DT1A 5DNAA 1RNLA 1MO5A 3ZPXA 4FKZA 2CKMA 3AXSA 1QFSA 2CLMB 1UJ4A 2HBZA 2X0JA 2YYZA 3BYZA 4AJJA 4DSOA 4L2IB 1FUIA 2YZ2A 2CNWA 1PN3A 3QVWA 3BMXA 3W7AA 5AQEA 2FE4A 4TSFD 1HNXB 3O8LA 1YBHA 4GOLD 2LTAA 5SY6A 5BY2A 4LQCA 2QPLA 3A58B 3MVEA 5FF9A 1IVSA 1JVBA 4B17A 3KQPA 2ZE8A 1GKKA 3MYYA 4EG0A 3OFND 4CKWB 2B82A 4KWHA 3URMA 3A9RA 2JAQA 3N76A 2WOJA 3PEEA 3IAHA 3RTEA 1NVWQ 1OLXA 5AW6A 2JLYA 1U3WA 3HCBA 3KE9A 3LRXA 3WOHA 1XCOA 3PGLA 1L5GB 4B4UA 1GFZA 3HKEB 3ZE9A 1ZC4A 2CNLA 3CA8A 4NAHA 3ZWKA 2HDOA 2ZAGA 1Z22A 2Z56A 1FDTA 4YB8A 4S1WA 2PE5A 4DMHA 4O1IA 3ASVA 4BJ6A 5C37A 1LDYA 3B9QA 2NV0A 2WD8A 3ZEAA 1H2HA 3UJDA 2RE8A 2LR0A 2Z8ZA 1EBFA 1TQDA 2LKCA 4OK3A 4AM8A 5L45A 2C8JA 2H1FA 5CVEA 7ABPA 4MRPA 2H59A 1UWCA 1SHKA 2R96A 1XCLA 1TJPB 2X2PA 3JQ8A 3L8FA 3N8NA 3OUZA 2HIAA 1O94C 3RVRA 4F96A 3FXAA 4WXEA 3B5JA 4NBSA 2JHFA 4KV7A 4D92A 2A9PA 2Q2NA 1E9DA 2I71A 1K8QA 4IYRA 4TYPA 5DX8A 4AUNA 4CMEA 1ZISA 1HEUA 1ISRA 1NOKA 1PQPA 2GH1A 2YYYA 2ZRFA 3H5VA 3NPMA 4QOEA 1Q1NA 1MGOA 1E2QA 3DL0A 3Q6MA 4M9ZA 4UC0A 4JJEA 5L4SA 2GN1A 1ZVKA 1ORRA 1GZHB 1LVUA 2VYVA 1PLLA 3ROQA 2O0KA 4YRLA 5ALFA 1XZLA 2FWJA 2WJ4A 3WFJA 5AESA 2ZOSA 1QP0A 4JXZA 2VC2B 4I46A 4RF3A 4Z8YA 3R9IA 1HQKA 3E9NA 4N0QA 2Q3MA 1KAGA 2QTBA 3LWNA 2FB9A 4UNRA 3OEEA 2QLTA 4N01A 1ORIA 1D0VA 1RJWA 1W5BA 4P3PA 1LTHR 1XLTC 4RYDA 3T3MB 1G7SA 2PT5A 1K88A 2YJTD 4WNAB 1NQAO 1XROA 3HLTA 4BNMA 3HBMA 2FGJA 5MFZA 1KSFX 1QGED 3MCAA 4ISBA 1G1MA 2OUKA 3NBZC 1V11A 4I1IA 1RZUA 1UMKA 2Z09A 4JNKA 4QUHA 2C4HA 4MDFA 4DJJA 3IT2A 4TKLA 2O1XA 1SXGA 1RXVA 3OIVA 2PUDA 1G7RA 1P7WA 3SKXA 4E22A 1CZRA 3DGEC 5D87A 3UV7A 1EM8B 4NOKA 3KFVA 4TRRA 2HLNA 2C2BA 3WGHA 3P94A 4H7IA 1H42A 2AJTA 2UUPA 4KGDA 2G9QA 3HV0A 3IKVA 3BSFA 4X1OA 1U9IA 4TM7A 3N07A 3N7TA 1Y81A 2FR8C 3BQ9A 2A33A 3GUUA 4LG1A 1Y4UA 2IP2A 3CRZA 3AILA 4J9VA 4QATA 3I9JA 3NG1A 5FOXA 1N2CE 3KDSE 2GGSA 3H18A 3LZ6A 1ZH4A 3R3VA 5FLXA 3WI7A 4Y2RA 3EEIA 4IFBA 1R8XA 1NQ5A 2ZRIA 1O6GA 5ALPA 4LJ9A 4TVOA 4ZV4A 1AKNA 1Z7GA 3W7VA 3M7IA 2QUZA 4ZRNA 1C4OA 4ROSA 5C18A 2M1ZA 5LOVA 4CEHB 4FINA 1D4OA 2A9JA 1KVRA 1ML3A 1W6RA 3P4UA 5H3LA 2MINB 2P4SA 2J4CA 4UEWA 2GKSA 1WZCA 4L7QA 4XD2A 5IANA 1N7HA 1XRMA 2VYVD 1QZZA 3B12A 3CRVA 1R9MA 3SYMA 4XVHA 1OQAA 3EQZA 2WR8A 4PO9A 1LSJA 2YVUA 1XTVA 3BBPA 1R6UA 4R84A 3ZNQA 1DADA 3G59A 1GGJA 2DSNA 1N5JA 2B83A 3AONB 1P19A 3EPRA 3MLEA 3QWFA 4B48A 3OEED 4EHLA 5FCDA 5G0SA 1WIWA 2B8EA 4BLUA 5BW5A 4KFRA 4HNTA 3AVTA 1QHSA 1CEXA 2SKDA 5LYJA 4YK7A 5FOWA 1SPBS 4PGMA 4CIXA 2FG6C 1IRXA 1SBTA 4C3VA 1C3OA 2CLCX 3VPAA 2SKEA 4IS2A 3PIDA 1AK9A 3G79A 1HLFA 1NXWA 2IYWA 2IYZA 4KN5A 4OSOA 1OTYA 1O7JA 1E1MA 4J6FA 1VB5A 3ZCPA 4D4HA 5B7GA 4PYMA 2C7RA 1F4PA 4LWQA 5E6SB 1M2KA 1JR6A 3O3NB 3N05A 3ZVRA 3OTGA 2XODA 3E03A 3ESXA 1X7HA 5C4IA 3E9MA 3HA5A 4MYHA 3Q8XB 4UVHA 4CU2A 1OYVA 3T5MA 3PD1A 3KKOA 5IDWA 1RXWA 4FMPA 1B16A 4PX5A 4UAGA 2H1CA 1YA4A 2BGUA 1JFSA 3H2GA 2PRYA 4GPEA 4OB7A 3QPVA 2DLNA 4C0JA 1JEQB 4YAGA 4IZOA 5ICCA 2VG8A 4F45A 3P4YA 4M1TA 3LK7A 1FDWA 2Z8YM 1ADBA 1HEIA 4BVBA 1RBMA 2CF6A 1V45E 5FUVA 2QRKA 3IA7A 2P9EA 2DYKA 2PKYX 2O8EB 3AFGA 3DPSA 3A4MA 1J7JA 4O2BF 4OHXA 4EA8A 3L1HA 1YONA 3JYQA 4F46A 4NCAA 3RPEA 4F3YA 1RLMA 1AK1A 2F8MA 2A1IA 3I6MA 2BW0A 2VJQA 4HGOA 2QRVB 2VP3A 1U4NA 2E55A 1SXJC 4YR9A 1XJWA 1NP7A 3BD9A 5E8JA 3Q2IA 5K3OA 1TT5B 2WFAA 3KJHA 2OBLA 3R9XB 1EB8A 1UODA 2C2KA 1QLHA 3ZY2A 2FE1A 3QXJA 1GPDG 1SCIA 2JBAB 4BNVA 5KNLA 2FUNB 1X14A 2A9VA 4EITA 2EZ8A 1W8DA 2XXJA 1W1UA 3HDHA 4I1YA 4KN6A 4M55A 4ZCMA 5THXA 5LD2C 3EG5A 4JQYA 4C76A 4EFDA 4IM7A 5AUPB 2E4ZA 2XX3A 1HY3A 3K2BA 1IXZA 1ZOPA 4R2IA 3T5GA 3TL6A 1YUBA 1DAGA 4RXUA 3LUBA 1QFYA 1T5HX 3KHKA 4N8EA 4RPLA 5GV7A 2VPZA 1PGJA 2E4AA 1WE2A 2VDKB 1WDMA 4HXFB 2HJWA 5TPWB 3ZD9A 3K53A 4X8OA 5HQ3B 1OWMA 1V5GA 1IUOA 2B34A 2Y1DA 4QJBA 4OI1A 2O1EA 3TN7A 3WJ1A 1K98A 4BUCA 3RDPA 5IH7A 3LCRA 4HDOB 5D1HA 4N1AA 3R77A 1C1YA 2F3QA 4BB5A 2DZDA 4XVCA 4MGYR 2JKZA 2JVIA 4IRMA 4WXYB 4E15A 1PEDA 2ASVA 2PO7A 2N9UA 2NU7A 5TRTA 2X0KA 2R6DA 5MGNA 2H1VA 1HE3A 1QNLA 3UJBA 1OC2A 3EIHA 2ZB2A 3AI3A 3B6JA 3LF1A 4G9GA 4ZN6A 2WZBA 4TMXA 5PNTA 1RLUA 5FAKA 3HUEA 1JTFA 2A1TR 2ZIAA 1MHPA 1X80B 1XYGA 3A1NA 3ETLA 2JEZA 3FPLA 4QGFA 5DPMA 5E9AA 5FNZA 3FHTA 3GGOA 3FDZA 4KMOA 1Z0IA 1YS4A 4I6GA 2G9ZA 4JJFA 5G0TA 1KZ7B 1N78A 2XTAA 1IEVA 2OBFA 4I81A 4INPA 1WVGA 1JA0A 2BY4A 1M2OB 2PWZA 4DM3A 1T1GA 1C8KA 5DJ5A 4FUQA 2REOA 3WB1A 3KZXA 3RF7A 3WP0A 4FB5A 2RHHA 5E8RA 3FHOA 3GFGA 1CF9A 4DFDA 1IY0A 2WDZA 4F6RA 1LJLA 4MYDA 1X8LA 2HADA 1QPGA 3PV0A 4BNWA 8MHTA 1P3JA 4R69A 1Z6ZA 4DAOA 4FC6A 5HRAA 3G9TA 5LJLA 3LV8A 2IY8A 2WMNB 3I0ZA 2HLHA 2ZYHA 1SCKA 3S44A 3WYCA 4F97A 1KAMA 3ZJ5A 3R23A 2JI6A 1AKYA 4K8OA 4PYNA 5K45A 5ALQA 4K9SA 4RDXA 1UUFA 3KNZA 4DV0B 4UDNA 4URWR 2EKLA 1XMIA 1V0JA 4XYGA 5D5QA 2WP8J 5J2TF 5ARCA 2NMVA 3K7EA 5TSDA 1W87A 1WDKA 1Y7IA 4KFTA 3I9LA 3KLOA 3OF3A 3TZQA 3B7GA 2ENWA 4G2NA 1JB9A 1T5LA 2AFHA 3KT0A 1CFZA 3TPZA 1U0NA 4B4WA 5DM2A 1JZTA 1AQUA 2JFOA 4ZV7A 4PN3A 3H9BA 2QAGC 4NCJA 4NJMA 1I1HA 5JIBA 1NW6A 4F5YA 1Q7CA 2CMKA 3HJHA 1H4TA 4FFNA 2VS1A 3SOPA 2F1JA 4BNFA 2I5PO 1RLJA 1XEFA 5IDQA 1A9PA 1ID1A 2FPUA 3ABQB 4F91B 4MWZA 2PSHA 3RREA 4CN9A 3AF3A 1KC3A 2QAJA 4CM8B 1PIWA 3ZXYA 5BW4A 3ROEA 1Z37A 3FYUB 2G40A 3OJXA 4RFSB 6ABPA 3UJAA 3HWSA 1IZ0A 1BTOA 1Q3KA 4UPDA 4ZOLF 3VR5D 4FWTA 3HTXA 3AP2A 1OGYA 1W4RA 3GQVA 2ZUEA 1M2JA 3ZZTA 1G3UA 1PQUA 2IYOA 4MVJE 2IQ5A 3HB5X 3HN2A 2FI1A 3LZDA 4IHJF 5BSRA 4DNOA 1DCTA 2P3QA 3Q41A 4N3GA 3I4LA 2VDQB 4G23A 3DEKA 1UPCA 4EG3A 1M5RA 3TAUA 2AZTA 3BMQA 4MZDA 4D6XA 1EDZA 4ZO8A 2E18A 5CLLA 2Q49A 3MG9A 4KJXA 3TQCA 4JJ6A 4NBVA 4KQ1A 3MTQA 1KDRA 3Q72A 3OQIB 2J5KA 4BV8A 3SIPA 1NSTA 3EMBA 3VBCA 3WV4A 4MOWA 3AC0A 1XZAA 5TC4A 1E3TA 1I7PA 1L7VC 3LCMA 4OLJA 2E37A 3D1VA 4BZXA 1EVLA 4D8VA 4YDSA 1TZJA 3LKZA 3GWZA 5C8YF 4KRFA 2EX4A 3L01A 3E1KA 1WQ4A 1ENOA 4ARZB 2Y92A 4FZRA 4MKRA 3HFJA 1DAIA 4FHFA 3DOJA 4XUGB 5M5BA 3QMMA 3NJ8A 2VP6A 4DIUA 4TN5A 2EF1A 1XK6A 3Q8WA 2FPIA 4LWPA 5BRJA 2IHBA 2BF7A 2XQFA 2I67A 2BLNA 1RHRA 4QOSA 1YCDA 1JLRA 3ZK7A 2QVGA 2X4DA 1A0OA 2JZCA 2V7VA 3RIGA 1Z4MA 2AK3A 1P61B 1FSFA 1LC0A 4UXHA 3CH7A 4YBRA 5C34B 2B6NA 3FCAA 4XWTA 4XVRA 1GN9A 1E1DA 1R6BX 2Q21A 4JUAA 3SLRA 2BFEA 3G8BA 1SKMA 4NE7A 4OGKA 1AA9A 1YMVA 2C0QA 4RENA 2DM6A 3R5KA 4N3AA 4HWOA 4BQPA 2I7DA 3T1QA 5NULA 121PA 1QFMA 1UOOA 1FYDA 1YD7A 2CNDA 3DWEX 3AJ8A 4AJ9A 4ND8A 3DPIA 1TF7A 3NV7A 3Q12A 1T15A 4K05A 4B4DA 2ZDQA 5LXTA 1TC2A 4H31A 2LCIA 1QG2A 4H7DA 4CV3A 5FI0B 4K8RB 1JYEA 3N9IA 2PUTA 4EGSA 3E9EA 4YCMA 3AB8A 1JI3A 4NE9A 3GOHA 4D9BA 1AHPA 5J5CA 1QP7A 2O05A 4WCVA 4AKSA 2B1RA 2G09A 2HBRA 2P3SA 3ZLTA 4QHTA 3USCS 3VNAA 4NXNB 1GCAA 1JHPA 4FFDA 4MQBA 4GMGA 3TOVA 2ZW9A 3P52A 1QFXA 1BQ3A 1EG7A 2ETXA 3I4FA 5KDDA 3I3SR 3UMJA 4EECA 2O8DB 1CZLA 1WHSA 2BSAA 2QN2A 2Y67A 3KOOA 3RIEA 2RC6A 4BEWA 4YBZA 4W7SA 4DMKA 5B6JA 1T26A 2ZBPA 2FSVC 3AEKB 4RHEA 4G1BA 5L9AA 3LLVA 1IBKB 1KDYA 1Y80A 4K9KA 3DDWA 1FUKA 1GRCA 3OPYI 1FDUA 3TX6A 2QZJA 1QHFA 4AUEA 1GM5A 4IDHA 1T8UA 1ADJA 1ZKDA 4B3BA 3R74A 4BO4A 1M34E 1WJGA 1HNNA 1JWBB 3PQFA 2R1VB 4IDCA 2REQB 4OHWA 3G0HA 3A2KA 1M8PA 1ZINA 4P9NA 2MSEB 3T7TA 2HC9A 3R7NA 5L51A 3G89A 1N2IA 1L5WA 1YR9A 2QR3A 1B73A 4R8VA 2ZUBA 2Z1MA 3U3MA 5JXWA 3IOCA 3UK6A 1T6XA 4LRWA 4BMOB 1KTVA 1LK7A 1R0WA 4RSGA 4RY2A 1GARA 1U2ZA 2IEAA 1F8FA 5EN4A 5IAOA 1U8YA 2G1KA 3V1LA 1LRJA 1QIDA 3HYRA 1TEZA 4AWAA 4GI2A 2YQZA 5JARA 3B70A 2BMVA 1X0XA 4LQLA 4PLYA 4RWEA 3PVSA 3QQ5A 2HIMA 2H2DA 5CW2A 2I8LA 4E2XA 4RE6A 5AW4A 5FBRB 4MS4B 3E35A 4CVNA 3CWZA 2IOHA 1NYLA 4MQEB 5B58C 2PY6A 2JJ8A 2R68A 4QJ5A 5HILA 4JFRA 3WLEA 3WGUA 2BBOA 1QQ5A 5CT8A 1XLVA 2PK3A 1ONPA 1ZKMA 4HFNA 3BIFA 3GJTA 4O0LA 3B52X 2YH2A 4UM8B 2PS3A 4IY1A 5E6UA 1A96A 1N3BA 2HWYA 2O07A 2VNHA 3AKEA 1G8PA 4JYAB 4IHAA 4FFBB 1TE2A 4CQMB 16PKA 1TCUA 1OFGA 2REXB 4L15A 4JUIA 4Y2PA 4FGKA 1RHUA 2PRKA 3DTNA 4JL6A 3THSA 5BN3B 3DBLA 2IWRA 5F2KA 4ZZ2A 3I42A 1RTKA 4QXOA 2LIVA 3ME5A 4C4AA 3EYWA 4I36A 3ENVA 4LFCB 2CZCA 2F43A 2BUCA 2J87A 2OXEA 3OZFA 4H1WA 3HZRA 3I0MA 3UT5A 3CW8X 2CHEA 1FB5A 1SU6A 1UOPA 2EXXA 4TTPA 4DQKA 4LVNA 1T34A 3LW7A 2QRLA 3OQNA 3N8DA 3UA4A 2FDRA 2ZIWB 3RUAA 3JPYA 2ZS9A 5GOTA 4DXHA 2YHAA 2XXAA 3VR3A 1TGYA 3GELA 3ICPA 2RHLA 4JR2A 2NW6A 2VAPA 3FN4A 3QKSB 4NULA 4RA6A 5KYWB 1ZX1A 3I2JA 3LY8A 4NPCA 2EW8A 4WXRA 1Q84A 4AJ1A 1Z7BA 3AG6A 1X7DA 1T3GA 2JGLA 1X77A 3A9WA 2LNDA 2Y9MB 3NT2A 3OZGA 3PE4A 4J3FA 4FE3A 4UHJA 1PFVA 3GGGA 4IPTA 2JGDB 1JB1A 4M98A 4WK4B 4MO9A 1L6IA 2JHPA 4X6XA 1DEAA 4B3IA 2HU7A 2X8AA 3VMMA 2ZU0C 4D4GA 4D9GA 3L0OA 1CY6A 2W6OA 2OENG 2OBXA 2RGUA 1MKYA 3C5EA 1GCIA 1HETA 1JL3A 4KWCA 4RVOA 2HF2A 5EE5B 3ENQA 1G8GA 1JR3E 2PR7A 4ND4A 5JV5A 4A15A 4IF6A 2PKXA 5EJ4A 2GD0A 3DTVB 5C8ZA 1IJFA 2X14A 3GEPA 3GZNA 1KBOA 3B8HA 4KO1S 2AXPA 5ALTA 3U3KA 3E1SA 2C78A 1ZL2A 3G0CA 1W52X 1C7FA 4JP5A 4KUHA 1XRLA 4EABA 4RA9B 1K06A 4DLAA 1E1KA 3FMGA 3PQ8A 1PFUA 3D5QA 1UBNA 4HYEA 4JUCA 1CDOA 4CLRB 3J81A 4PSAA 5AOVA 4A8JB 2C7BA 2ZSFA 3C5HA 1PLJA 1Q3TA 3L5KA 2NUAB 3ANLA 1K7YA 4RDIA 5FI3A 3X43A 5AIBA 5KNBA 1ZOSA 2YHSA 2A35A 2AF4C 2WMOB 3UHAA 4XWOA 1NBOA 3GFOA 3HY6A 1GZ4A 3HYCA 1NOIA 4Z7OB 4Q3EA 2HSWA 1Z26A 3LHSA 5DH9A 1QVAA 1BA3A 4IDFA 4LDJA 2HU5A 2W43A 4LOLA 1O5TA 1QF7A 2LUOA 3E9DA 1WWKA 3LE8A 4ZQIA 4RESA 2ZPAA 4CKZA 3IHWA 2VAWA 4S04A 4GR9A 3N75A 2W70A 1N5OX 1QK4A 2FFRA 2J1LA 2QG9A 2ZT7A 1JDUA 4LC0A 4NENB 4P35A 5AICA 3TCXB 5JI2E 3F4LA 2XVMA 3MUFA 4FJ1A 2PL3A 1JE0A 3GJRA 4O4JB 4QA9A 3T9AA 4ILEA 3O90A 2L0XA 4J29A 1Q1EA 2JFPA 4R4JA 1PP4A 1NPYA 5ECGC 1GJRA 4LZWA 1CJSA 5FTJA 3TVTA 4QC2A 3DVLA 4DY4A 3U19A 4NI5A 1U1FA 4D0NA 1NJ8A 4ARVA 5CYPA 2OCBA 4Q1BA 5AJUA 3ZTTA 3ZYCA 3EMKA 5JE8A 3WSWA 1UQTA 4INZA 2I0FA 1AE1A 2I80A 3W8EA 1WV0A 1HL3A 3EIUA 3JSXA 3WLTA 1W25A 2H2GA 3EOAI 2QUKA 2WFMA 4C14A 1NPDA 2BFBA 3QZUA 3V2IA 3ODPA 4M0MA 4H9GA 3KETA 1L5FA 4TTVA 4TXHA 1DBRA 3L7KA 1N57A 5I9BA 4BFVA 2WMDA 2PYZA 1V2HE 5LCXA 2NZ8A 1G63A 3L0YA 1FW8A 4FFPA 3RRYA 2OK8A 1RYBA 4GKBA 4P80A 1SKYB 3TJRA 3PNOA 3VV2A 2UXBB 3CLSD 1BXZA 3H6KA 2HIHA 1MOSA 3H1BA 2YNMC 2FQWA 2WA1A 3TJMA 1QF6A 4ZODA 3EEOA 4RTOA 1IY2A 4E1BA 1J8VA 1ZZGA 5BUSA 3EASA 1F38A 1L7BA 3DAPA 1MV5A 5AKHA 5KNBD 2XCTB 3JASA 1DDGA 1ZOOA 4RHFA 4YI3A 3ZTYA 3JYLA 2NPOA 5FBZA 5HGXA 3U7HB 4UD2A 1GO2A 1B0ZA 5B3AA 5T8KA 1EFCA 2W98A 4NS4A 3X1KA 1UFQA 3OI7A 1ZGGA 4EB6A 5D5PA 3N2GB 4R7ZA 4LMAA 3UTCA 4CUJA 4PCAA 3TOSA 3IJEB 2GAOA 4WRRA 3BGDA 2GPBA 2EGUA 2HRZA 2NUBA 4BN0A 1Q95A 2PTGA 3Q8KA 4I9GA 4RKRA 4IDOA 3IUPA 4JFAA 4TLDA 3FTFA 4Q03A 2Z3WA 1XEAA 4U5XA 4F9GA 2CVFA 1ZH6A 1PR6A 3SR0A 3VHRA 3WBFA 1KMNA 1IM5A 1OWOA 1UBUS 1HQDA 2ORIA 1ZU4A 4EB3A 1GFWA 1MAVA 3HDVA 2YWBA 4FMCF 3UT6A 4KSYA 3E3MA 4FDLA 3T0IA 3REGA 5CDUA 1LLFA 1JQAA 2EJUA 1ZMTA 3LDAA 1NFFA 2NO7A 4KQEA 1N1EA 4TVBA 1C9NA 2I7VA 1W29A 3B8EA 1UBLS 4Q93A 3PFWO 1N5MA 2H6EA 2GI4A 1ZUNB 3N1UA 4RKFA 1Y3BE 1T8SA 1J9ZA 3RRJA 3THXB 1ODLA 4HLUC 5CCDA 5JJLA 2GTHA 2Q5JA 4BECA 3T1HB 1JPVA 3O8CA 2VK2A 1DFGA 3E4DA 2BHNA 2NO9A 2CF5A 3PGMA 4A5OA 3IDFA 3SQMA 4D82A 1P0FA 1RFLA 4L5YA 1TUBB 3M6VA 1PFGA 1MFPA 1HLDA 2HSZA 1Z2CA 3H9CA 3DS8A 2QLJA 3BSSA 4ITRC 4G0VA 3OJWA 4TROA 3T5CA 5A2GA 1II9A 5JBQA 1Z15A 4MW1A 1CWUA 2JIPA 4RNCA 1YI8A 1Z73A 3K4PA 3LCJA 2DY1A 1DDOA 4HT3B 3BIWA 3PVCA 4URUR 3R7WA 1YACA 4EOGA 4HNGA 3WL3A 1PD0A 1B6SA 2YDYA 2H08A 4YUAA 4PPFA 3HXPA 1P33A 2VPWA 4JX9A 3WRXC 2VNAA 4JKIA 2IBMA 1EFVB 1Z0KA 4BEBA 4HOYA 4RULA 2C99A 1RU3A 4FPXA 4QDTA 5FUWA 1EA7A 2UZ4A 1M1YB 1MTOA 1X1QA 2DP4E 4RY8A 3GAAA 5F4BA 3VVBA 1SCUB 3IAS6 2ZTVA 4PLPA 1Y4DE 4YT5A 3R76A 3U3XA 2I9KA 3LQ2A 1HT0A 1KPHA 5AUOB 2QX7A 4IMRA 4FK8A 4A73A 2H92A 3OF2A 2JANA 4OIFA 4RGBA 4RETA 1G1AA 5KBYA 3ESAA 1W47A 4BJHB 1SUBA 4NJEA 5EMLA 5KCMA 1WEHA 2OXFA 1P5FA 5FUYA 1ZSVA 3TTXA 3W4KA 4DCPA 3GRZA 3NTUA 2EL9A 2GTPA 2HJVA 3FYDA 5A05A 4JP3A 4R5MA 4P4UA 2I2FA 4H4DA 5J47A 3DM5A 1BU5A 3R9KA 5I4IA 1MB4A 3T3EA 3KP1A 4BYGA 1D8AA 3B1JA 5CNIA 1R5OA 2O7RA 3LOPA 1KS9A 1U2SA 1UBOS 1NN5A 1ORHA 2HL6A 4ZP1A 4D0GA 2XE4A 3GVCA 3RJZA 4OOFA 521PA 3PNPA 1CUGA 1NJGA 4XIYA 3S40A 4EKNB 4QPNA 3SHTA 5A02A 5CBPB 4BGDA 4C4TA 1WF3A 3U26A 4QE3A 4DLKA 2A5GA 2H1RA 1HBJA 3NHKA 2RHBA 2IXDA 3RTGA 2QNBA 4Q3OA 3QUTA 2PKQO 2YFHA 3R41A 2CGEA 1VIDA 4RKWA 5CFNA 2F3TA 4UQLA 4EI9A 5KZMB 3L18A 3RVOA 3TW8B 3KQWA 4ECEA 1T36B 2ZJ1A 2PBLA 2FWMX 4WFIA 4M37A 3E05A 5CA0A 4I4LA 1E2PA 2XUQA 2PZEA 1T2DA 3PQ5A 2IPAB 1TX4B 4N7RA 2W6QA 5TEVA 1QQ7A 5DXJA 5IMSA 1O94D 1ZIPA 4F2PA 2PUAA 3ZCVA 5JS7A 4FDTA 5HBGA 3RIMA 4KE8A 2QQEA 1PI3A 1H6AA 4G0MA 1NHWA 1C9MA 4AKEA 2ZUVA 3L92A 4U02A 2XF8A 3MIZA 4Q9DA 1ZXXA 4PNEA 4FZ3A 4I99A 1UKAA 3JARB 4EZBA 4F86A 1KZ9A 4UQOA 5CH3A 3VU8A 4C4ZA 3LAWA