4QGFA

S.aureus tmk in complex with the potent inhibitor compound 38, 2-(3-chlorophenoxy)-3-methoxy-4-{(1r)-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]propyl}benzoic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
204
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 82
structure length 196
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qgfA00
1EFTA 3ZVNA 2DWOA 4Y0VA 5FBQB 2WJGA 5HZHA 1E1RA 2AFHE 4BASA 3SNHA 3QNUA 2GXAA 4DEXA 4JLAA 1F48A 3GLHA 1E94E 3U5ZB 4O2RA 4BEJA 1KAGA 3U3KA 4E22A 5FI1B 1Z0KA 1M7GA 3FDIA 3PUWA 1AQYA 2JASA 5JEDA 2V55B 2ZQ5A 3DZ8A 3QXHA 4LV6A 2VP0A 1GWNA 4WXPA 2TMKA 2IYQA 3AF0A 4DKXA 4M1MA 3ZQJA 2OSBA 1X3SA 2XX3A 2P6NA 2EW1A 4LJAA 1E0JA 5E95A 1HT2E 4IDQA 2Q3MA 3EC1A 3BFKA 1TUIA 3MCAA 3EG5A 2CHQA 5D3MB 4LJ4A 2ZETA 1YRAA 1JJ7A 1LF0A 3LRPA 2QMUA 4A36A 1M34E 5FUWA 4BLRA 2O8FA 5CYOA 1KJZA 8OHMA 1ZP6A 1T0HB 2EYUA 2W6IA 4X8HA 4BLTA 4C9BA 3K0EA 4EDHA 4US2R 2AK3A 4ACAA 3C15C 4PPFA 3O8RA 3NBXX 1OHHD 1G64A 3LWNA 5KYKA 3EZ7A 4OK5A 1U0JA 4KVAA 1S1MA 1CRPA 3T1VA 3NWJA 2ZRGA 3BE4A 2I3BA 1G20E 1Q0UA 1N6KA 1Z2AA 2XAUA 3IIJA 4E07A 1RPZA 1KO8A 3RLFA 4GSYA 4OK3A 3Q3JB 4FCTA 2WJIA 1FZQA 1GNPA 1VPLA 4EQ6B 4DSNA 4YC7A 3PEYA 3WBKA 3AM1A 1T8UA 4IJMA 1G17A 1KJYA 3PVSA 4LRWA 5G40A 3LX8A 4AKHA 3HYRA 2CJWA 1VCOA 4GL2A 2UKDA 4AKGA 2GZDA 4B3FX 3O47A 3SN6A 2JDID 2ZEJA 4HUQB 5J5CA 3W3AA 1S3GA 2WAXA 3QXJA 4WOPA 5BQ5A 4N1AA 2BDTA 1DEKA 1CF4A 2WJHA 4IXMA 2AXPA 2J7KA 1M8PA 1WA5A 2O0KA 3WXMA 4HB2A 3FGNA 1NJGA 4Q1CA 2ZI5A 1JBKA 421PA 3PXGA 3AH8A 4Q4JB 1SKYE 2P3SA 2IXFA 3CWQA 4Q19A 4DBLC 4RZ3A 4LYHA 5DYIA 2GETA 3KB2A 3N70A 1R0WA 3JZAA 4TT3D 2F1JA 2R6CA 1GKYA 4JL5A 2AWNA 2GBLC 1DARA 3CH4B 3K1JA 2FX3A 4PO9A 3NHBA 1BYUA 3L0OA 2ZSBA 4M21A 3A4LA 1WBDA 2CEAA 4HDCA 3T34A 3ZGXA 4C0QC 2CCGA 2WOOA 1SXJC 3QKRA 4LI0A 3GLGB 1UEJA 1IXZA 4PR0A 1QBKC 1XD8A 3AP2A 1XF9A 3LQRA 2PJZA 1GOTA 2YC2C 1G9XA 3RSLA 2IA5A 3AB3A 5FBVB 3ZDQA 3ADCA 4FMCB 2ZTSA 1E2IA 2BBOA 1CJMA 3MG9A 5KPJA 2QROA 5H1YA 1JR6A 1E0SA 3QKTA 3NBZC 1EXMA 2QTVB 3KQLA 3ZVLA 2ZI3A 3OIUA 2PZEA 4B74A 1YQTA 3G82C 2VHTA 1NIPA 1JECA 1OT3A 2WWFA 5TDHA 4K46A 2EFGA 2ZU0C 1U2RA 4B3BA 1W4BA 2WM9B 2CMKA 1KIMA 2RGEA 2WWHA 4IOJA 2GVDC 1KSJA 4QOSA 2WMNB 4PHTA 5CK4A 1QRAA 3IQWA 1RYHA 4I99A 4MH0R 2JJ1A 4AYXA 5EE9A 4LC1A 2F1IA 3AP3A 1TF7A 2KI5A 4IDHA 4DLVA 1K8RA 3EIQA 3RC3A 3K70C 3HYTA 3S1AB 1GZSA 2OEPA 3SJAA 4LCBA 4PC2A 2ZVQX 2Q3FA 4BFXA 3Q85A 1E79D 3C16C 3ZZ0A 3BOSA 4DSTA 1XTKA 5FFMA 4JBYA 1ZIPA 4XVRA 1GRRA 4IVPA 2WWGA 3QEJA 2IWHA 4RFVA 3TSZA 1A1VA 1KKMA 4RZUA 2ATVA 5AUQA 2IS2A 3HU2A 4F4IA 4B48A 1N25A 1GTVA 1XMIA 2UVQA 1S3SA 2ZROA 1E2JA 3SHFA 3MJHA 1IN7A 3DM9B 1RZ3A 4GOJA 4ZCLA 3WMEA 4C3ZA 1GITA 4TMXA 5G3YA 1IAQA 4NCIA 4B3GA 3A4NA 3UG7A 5JJIA 1QHNA 4B33A 3W9YA 1CULC 2FSIA 4V0ME 2N46A 2ZAMA 2ZS9A 4KLZA 4DUGD 2VBCA 1TQ6A 4Q1DA 5TMPA 4Q7JB 4QJ3A 1R8QA 4KBGA 1PJRA 4NPHA 2IXEA 2IK8A 1YHNA 2CCKA 4A2WA 3GJ0A 1YR8A 3KUCA 1KO1A 3T35A 4OHYA 2ERYA 4J0QA 2ZRAA 2V1XA 5EZ5A 2XNSA 2PT5A 1O3YA 3MGCA 3LNCA 4TYQA 4XTRA 1IQPA 1T3SA 1KTVA 1W2HA 3IPXA 1R0YA 4MGYR 5AJXA 4ZDIA 2CCJA 2MMGA 2PEZA 1KI9A 3RWMB 3CNLA 5L3QB 4BLPA 1TX4B 2NZJA 4MRSA 2IYVA 1KJWA 1NVVQ 1YU9A 2ZRFA 3SBDA 2REOA 3WMGA 1D2EA 3QG5A 1UKVY 2D62A 1R0XA 1GRNA 1EFUA 3B1VA 4UQOA 3SFVA 3PR1A 1WF3A 3QOFA 2R6AA 3I1FA 3GJXC 2D2EA 2G83A 4DCUA 2CHVA 4P32A 3ZIAD 3B60A 4QHSA 3IHWA 3E5HA 3GJ8A 4NMMA 1W4RA 2OLKA 2UZ3A 4JLJA 5IT5A 2J0QA 821PA 3RS2A 1UBFA 4FD2A 4GMXA 5TB5A 4YQFA 4C2UA 1CRQA 4JKIA 3CF0A 1U8YA 3PUZA 1OFIA 2GHIA 1TU3A 2GEDA 3L0IB 4DIEA 4OI0A 1X1RA 3ZVRA 3UIEA 1DTSA 4WAUA 3RS7A 3PJRA 4PFSA 1CEEA 5SZJA 1RC8A 1T91A 1U9IA 3L0SA 4Q47A 2ZE8A 4YMTA 1AKYA 1ODFA 3VR2A 1IHUA 5J4YA 1JEEA 3I3SR 1XZQA 1NMYA 2NGRA 4Q1FA 2Q0HA 4Q4HB 3WRXC 1NP6A 2FF7A 2GJ8A 2FPLA 3CRMA 5EXPA 3S1AA 2ZVPX 3BFVA 4X8MA 3U2QA 1U98A 1I2MA 4TZ0A 4MUAA 1GIAA 4TTPA 5JJLA 1N3BA 2FEOA 4PSKA 3CZPA 1ZD1A 4Z1MA 3KKNA 3ZD7A 2C5LA 4PAOA 1DAKA 2WV9A 4UNPA 4AC9A 4DDTA 3BORA 3O8BA 2O8CB 3KXIA 2IC5A 4R9UC 3KKPA 3OESA 1CJTC 4DZZA 4HB0A 3GLIE 5KNDA 3K0SA 1COWD 1AS2A 2QEQA 2VF7A 3HPRA 5DYGA 2BCGY 2JIZA 1ZM9A 3QVVA 4C30A 4OHXA 3T12A 4ABYA 4G0NA 4EFLA 2W0SA 5KOYA 2OILA 1XRJA 4TN1A 2E87A 1ZVQA 1XD2B 1RE0A 4GP7A 3SR0A 1ETUA 5EQTA 1RW4A 3WRYC 2HJGA 3Q9LA 3UK6A 4A8JB 1QHSA 4DSUA 1EK0A 5IHPA 2REBA 1Z22A 1N6HA 1GL6A 2WJJA 1NKSA 4XSGA 2B7BA 2D74A 2O5VA 5A4JA 2JJ2A 4CEJA 4MGZR 4DLXA 1OFHA 3MJRA 3PQCA 1NG1A 1NIJA 1KDRA 1AGRA 1SVLA 1KSGA 2FPMA 3RANA 2FFBA 2QG6A 3FFAA 4DDWA 5CB6A 4MA4A 4WW0A 2Y8EA 3G5UA 1TQDA 3QIAA 1NBME 4TQ9A 5L3QA 4L15A 3EXAA 4YMVA 2J1LA 3QUSA 1W49A 3R9XA 5FTLA 3HDTA 3TVDA 4R98A 4RZXA 4F93B 1KSHA 1VECA 2H1LA 4AD8A 3MWKA 4D82A 5TXGA 3A37A 5HE8A 2GEUA 2ZE6A 3TJZA 1IJEA 1X8JA 1NN3A 1Y3AA 1A2BA 1HYQA 1CTQA 3K0AB 4L9WA 3AVOA 4Q7KA 4TL8A 2BBWA 4DSOA 2IWRA 3EPKA 5F3WB 4XH9B 4TZ6A 3PG5A 1SVOA 3Q5EA 1ZUNB 4I1OA 4QBFA 3GLIA 3AUXA 2BJVA 5CLLA 3DKPA 4PPQA 4URVR 1U81A 1GKUB 2WIAA 5JI3E 4LK2A 2AK2A 3KKOA 2P67A 2W6JA 4FCVA 3BERA 1HTWA 2AX4A 2W2TA 2O52A 2AD1A 2HLDA 2V9PA 5E7IA 3VU9B 2IW3A 1KY3A 3DOFA 4Q5IA 4BWYA 4TL6A 2VYFA 2WICA 3L43A 5AJZA 4JT2A 4Q1AA 2GTPA 1VMAA 3CX6A 3A8TA 2XTNA 4JLNA 4BUJA 4IVQA 1NN5A 5DH9A 3MWJA 3TVTA 3EAQA 3W90A 1BYIA 1HT1E 2B8WA 4Q4HA 2FMXA 3PUVA 5C18A 1YZGA 2GA8A 3OIYA 1SXJB 4GPTA 2W83A 2FSHA 3ASYA 4IEEA 4OQMA 4A2PA 4F38A 1OH5A 4ZO4A 3NH6A 2QTHA 3T1TA 2JJ8A 4URWR 1SXJD 1KK0A 1QHHB 2OG2A 3HJNA 3MAAC 2IL1A 4OQLA 5KSZA 5JJKA 3VTKA 3CRVA 1UM8A 2GDJA 1DG3A 4DCVA 2O8CA 4TMWA 4AKEA 2CL6X 2CNWD 2CVHA 2F3RA 4DCNA 2XGJA 4TLAA 5JWOA 2OXCA 2RGAA 5AJYA 1TUEA 2PMDA 5C2JB 5JZVA 4AIIA 2ZRIA 1P75A 4TMKA 2KBEA 3IUYA 2LWIA 1Z83A 2OT3B 3PEUA 1P9NA 5B57C 1CP2A 4ESHA 4UJ5A 3OHMA 5CIWA 4I4LA 1CBUA 3QQ5A 2O8BB 1IBRA 2QE7D 2ODWA 3CRRA 1JPNA 1GFIA 3HR7A 4NHOA 1OW3B 2H8KA 5KSYA 2YOFA 3TUJC 4A8JA 3SQXA 1TF2A 1FQKA 1JQLB 1TQ4A 3LO5A 2JLXA 1ZJ6A 2RHMA 2QAGA 1JR3D 2QUZA 4HAXA 1G4AE 2BV3A 3B5JA 3K70D 3QENA 4QJ5A 3RHFA 1U9IC 1GILA 3GFTA 4KVGA 4OQFA 3TSOA 4CT4B 5FPSA 1Q1BA 2OLJA 5HTKA 1PLKA 1Z0DA 3NHAA 5FUXA 3R8FA 4P31A 4IFEA 1T3LA 2GJSA 4NE2A 5FL3A 4ZDKA 2ZJ8A 3EIEA 3X2SA 3GEEA 1BO6A 4BRWA 4PO1A 2VHQA 4ZI3A 4OHZA 2QRNA 4UNQA 3VHXA 4IW3B 1JEDA 1NRJB 1OYWA 3K9GA 5DNYB 4DVGA 2DYKA 2DFKB 5DLQC 3RRMA 4MDFA 2OFXA 1DS6A 2C96A 3RS0A 3K0AA 1IY2A 4C0HA 3RC8A 5BN4A 5EP4A 2A9KA 1TMKA 1F2UB 3HWSA 3QBTA 5IF9A 4QG7A 2RGCA 2NO7A 3IDQA 4KJZA 4MRPA 2ZI6A 3KKQA 2H16A 2PLFA 4LYAA 3MRSA 5DO9A 4QNRA 3LBHA 4B71A 3TQFA 4QBGB 2FU5C 3AKDA 1E2PA 3OE7A 1CIPA 5BW8A 2VHUA 2Z4RA 4Y0AA 2OO7A 2JGNA 1D9XA 2ZJAA 2ODBA 4C4PA 3QXSA 1MRSA 3B6EA 1CR0A 4KODA 3EZ6A 1RIFA 2G0NA 4A82A 4KBFA 2IYTA 1JNYA 1M7BA 3BS4A 1E2KA 3QF4B 4HI0E 2O8FB 4QBHA 2DHRA 3KQHA 1N6LA 1ZD9A 3A1TA 3X1ZA 4L9SA 4LBVA 1ZM4A 2EWVA 2VIIA 4JYBA 1I4DD 1W0JA 3KJIA 5CM9C 4B2LA 3VFDA 4LV8B 5E4FA 3TE6A 2W6ID 1QHIA 4RCZA 3ZH9B 2QRZA 3PCRB 3UXMA 2GAOA 2FJUA 3AGPA 2I1VB 2R8RA 1QHGA 3LW7A 4OL0A 1OKKA 2Z6VA 3NDPA 1W2GA 3PUYA 2P65A 4M0LA 3D7MA 4UJ3A 5CM8B 1IN8A 4Z51A 4CF7A 1P73A 5LD2B 1UBEA 3MSXA 1UFQA 1IN6A 4QNMA 4MKIA 4PQYA 4ARZA 1WXQA 4A0GA 1GDDA 4TLBA 2VP5A 3SZRA 1VCNA 3VKGA 2O8BA 2XZPA 3FMIA 5FPTA 2QNRA 3EPLA 2J0SA 1Y63A 3E70C 4GBMA 2GVZC 2F7SA 2WWXA 2QSYA 4F4CA 4L5BA 1HV8A 2RGXA 4DIDA 3U60B 3ADBA 4G5QA 1K5GA 2W58A 3OEED 2A5GA 1J8MF 2HDNB 2PCJA 2O8EB 5K8UA 4OQNA 3CW2A 2HCJB 4X8OA 2FN4A 1XMJA 2ANCA 2CL0X 4X8LA 4S2EA 2JLSA 2YWGA 2WAYA 2IF2A 4LOAA 2D4HA 3UATA 3U7EB 1IXSB 4CDGA 2ZRNA 1FP6A 4JSTA 3HU1A 4AYTA 1IN5A 2A2ZA 3FKQA 3GFOA 4V03A 3TUZC 2C77A 3D6TB 1UDXA 4Q48A 3QKRB 4L4UA 4NYIR 1HUQA 2B6HA 1WCV1 3BXZA 2JA1A 1C9KA 2FFHA 2J45A 3TW4A 2QGZA 4IDNA 5GJVC 3SEAA 3TQCA 3C5HA 4AKIA 1F2UA 3NBFA 621PA 3CR8A 4BZXA 3RABA 4XWKA 5GVRA 1KHTA 1ZU5A 2K5UA 5DI3A 5E3HA 4CW7A 1JPJA 2Z4SA 2IS4A 3Q72A 4JVLA 4DLZA 4OJQA 2RH5A 1OIVA 1ESMA 5AUNB 1Z0AA 2YWEA 2ODEA 2CLCX 1JALA 3A1UA 4DCTA 4XIGS 4EPYA 5C46F 1VG1A 2RHDA 4C0LA 1H8EA 2WSSA 3GFPA 4QGFA 3I92A 4Q7LA 2ZI4A 3VNUA 4A8JC 1SHZA 2C98A 2JJ1D 1GL7A 3B82A 4BRUA 4D25A 3LLMA 1IOZA 2H7VA 4PSAA 3B9PA 3AVXA 1FMLA 1SKYB 3NXSA 2OCAA 4QJ4A 5J4LA 2QQEA 4HYYA 1II9A 2F1HA 1PLJA 2FPKA 3DEFA 3QF4A 3W6PA 4CRWB 1VIAA 1F3OA 1VG8A 3CX8A 3ZJYA 2ZJ2A 4DCSA 1YZLA 1RYFA 2FNAA 3OF5A 3U4QA 1DAFA 1GNRA 2J59A 4HLUA 3ZVMA 2WWWA 4LPSA 5AK0A 4EFNA 5DE3A 1FW6A 3U7HB 1JQJC 4H9GA 4KYIB 4XD7A 3CONA 1E0AA 2QT0A 3A1VA 4WA7A 3ZLJA 4NYMR 1X86B 4MQBA 5JWRA 5JRJA 2WZQA 1SVKA 3M6AA 3NG1A 5LDDC 4AI6A 2J46A 1TNDA 4D26A 1YR9A 2PBRA 4UXHA 1Q3HA 2ZRJA 1G8FA 5AUPB 3LY5A 1ZU4A 4JLPA 2WJYA 1YR6A 4MRNA 5FH9A 721PA 2YKGA 4IRUB 1G7TA 3TW8B 2VL7A 1E9DA 1FL9A 3FMOB 2HCBA 2FV8A 2ERXA 1TEXA 2IYRA 1Q21A 3ONWA 4O2LA 3TGPA 3N2EA 4BFZA 3V4FA 2JLWA 3K53A 1VIYA 1RRGA 3DPUA 1K5DA 3EWAA 1GNQA 1MO3A 2GILA 3CUEF 3DKVA 2O8EA 4A1FA 3KKMA 4BFSA 4NH0A 1G291 2OCYC 5BWMA 2ZAOA 1N6PA 4K81B 5LBIA 2FWRA 1DOAA 1OIWA 1GSIA 4M1OA 2RGNA 3ZYCA 2OE2A 3T15A 4B73A 1EFRA 5K8IA 2OZEA 1P2UA 3THWA 4PPGA 1Z08A 2IYZA 2ZSFA 4E09A 3RDPA 1B0UA 3U6KA 1VHTA 2QN6A 4M1KA 4KCGA 5FBWB 1NLZA 3VR5A 2PJRA 4UKDA 5P21A 2QTFA 2ORIA 5FR2A 3WHLA 1A82A 2A5YB 1P4SA 4BLSA 3UKDA 2B92A 2QU8A 1Q12A 2C9CA 4ZKDA 1P5ZB 4KU4A 3JVUA 1G41A 1W46A 2P2LA 2X2FA 1FTSA 4RD6A 4LHXA 4Z54A 2DBYA 2MSDB 4PAMA 1OXVA 6Q21A 1SVIA 4A6PA 4MKGA 2B7CA 2F9MA 5H68A 3F8TA 3UMRA 4M9XA 3N2IA 3CPJB 5C1BA 1E9SA 1SZPA 4KSBA 5BN5A 5FTMA 2XTZA 3THXB 1TEVA 1T0JB 4KSCA 4MDEA 3BIFA 2W0MA 1NKTA 2JAQA 1ZC4A 1E1QD 1AGPA 2V7QA 3DL0A 5SZIA 3R9WA 3MD0A 1KMHA 1G3MA 4Q9KA 4DJTA 1ZM2A 1KZ7B 2N1BA 1E2QA 2NZ8A 5FOVA 3TIFA 3U7FB 2CDNA 4MKHA 2Q9AA 2G3YA 1PLLA 1XTRA 4ZDWA 3P4YA 5FPHA 4B44A 2VF8A 1D2MA 1RVDA 3RVBA 3K09A 3FYHA 1E0KA 2D7DA 4L16A 5H70A 1UKYA 5L3VA 5SZKB 4C2TA 1VTKA 5HPYB 1UJ2A 5J4VA 1G3QA 4GZMA 4Q9JA 3WNCA 5GJCA 2QMHA 2W2VA 2BEJA 3V4RA 5J47A 2GXQA 1IM2A 1OXSC 2HYIC 4RCYA 4UNRA 4TMVA 2C04A 3FTQA 4GZLA 4HSEA 3KTAA 2E1RA 2JIZD 5KDLA 2CK3A 4D4JA 1I4TD 1KI3A 4YXWA 4IOMA 3GP8A 4HDQB 2B21A 3QF7A 4KFTA 4KLNA 3AP1A 1XB2A 3CF6R 1TQ2A 5KO2A 2Q6TA 2W2XA 1WP9A 4JVMA 2GESA 3SJZA 3KJEA 1N6OA 5KTYA 1HQCA 1E99A 3T1OA 2EVWX 1KGDA 1DAEA 4P4SA 1QF9A 1G3UA 4Q1EA 1G7CA 1LB1B 1P9WA 3ZD6A 2QZ4A 4CEJB 1JI0A 1BH2A 3CB4A 2P0EA 2VHCA 5K8TA 3IBGA 4JJZA 2JJ2D 3QBVA 4FW9A 4LHWA 1DAGA 2ZE5A 3W3ZB 2J87A 1IY1A 3QEOA 3GJ3A 1H8HA 4KV9A 4II7A 2OAQ1 1H65A 1P2TA 4JBXA 4C0SA 3R20A 2ANBA 2ODNA 4PPNA 1MT0A 4UXJA 1G19A 1R4AA 2JLRA 1FTNA 1NVWQ 4H1UA 4QBIA 1AJEA 1XEWX 5TV2A 2IYWA 3LX5A 1A7JA 1NVUQ 5KNBA 1ZRHA 1YRBA 1XEWY 1J8YF 1LS1A 4IHQA 5J4KA 1L7VC 1LTQA 4C0BA 1S96A 1W36B 4G1UC 3U44B 1T5LA 4HLUC 2AD5A 2V1UA 1XTQA 3VMFA 3GLIB 3K0FB 1W36D 2OM2A 4OHVA 1FMJA 1S9HA 5A5GA 3IO5A 4V0MA 4AYWA 2REXB 2G1JA 2PH1A 4RD2A 3I8XA 1U94A 4QFMA 3R7WB 2W6JD 3W6OA 5LD2C 2VP9A 4FXPA 4MRRA 2Q9BA 2J9RA 1IONA 1G7RA 5KDDA 2HLDD 1GG2A 5GADl 2IEYA 1UPTA 5L8VA 4HAUA 1XCMA 2BVNA 2WPDD 3M4YA 3THXA 2BMFA 2CLSA 1XP8A 1OIXA 1KAOA 1U8AA 3FMFA 4C0KA 3SS8A 3TAUA 2G77B 3CR7A 2J7PA 5ANRB 5KPDA 3QXXA 4TTQA 1UDWA 3FHTA 2KSQA 1VHLA 4A92A 2WHXA 3BH0A 1AS3A 1VCIA 1ZCBA 4GT1A 3PITA 5E7JA 2WMOB 1YR7A 1GVNB 1T9HA 1NSFA 1A4RA 3AF3A 1X6VA 2GCPA 4RVCA 2RGNC 2VLIA 4GRAA 4DT1B 1O87A 5D3QA 3I32A 1N0UA 1A2KC 1C4OA 2ZYWX 4GDFA 4LJ6A 5DN6A 5L3SB 3CPEA 2A3RA 1DG1G 3SC3A 4JLBA 2KJQA 4D2IA 1FNMA 1PUIA 1XFAA 2CBZA 2Z83A 1W4AA 4LHZA 4A9AA 1CJUC 4NL4H 3TR0A 4YMWA 4NCHA 1J99A 4C0AC 1J90A 2P5SA 5EP2A 4AG6A 1WDTA 2QM7A 4RZ2A 4V0KA 4KYUA 2VSOA 3RAPR 1EFHA 4Q4LA 1P3JA 3W6NA 1S1CA 1LY1A 4M9SA 4TTRA 4CVNA 3ND9A 5JHGB 3EPHA 1D8TA 4YDHB 2QAGB 5HZKA 2YOHA 1V43A 1XJ0A 4FWTA 2PZGA 1ZNXA 2OFWA 3CO5A 4EPXA 1P7CA 5JRZA 1D2NA 3SJBA 3AVUA 3BB3A 1CR2A 1NMZA 1OLOA 4P33A 1B23P 4LJ7A 3C8UA 3WMFA 5FOWA 2A7QA 4W5JA 4FMDF 4RY2A 1G16A 3TNFA 4BZPA 2ZRCA 3KB1A 1IJFA 1VCMA 3UMSA 2GJAA 2JEOA 2DR3A 3F0TA 2ZYTX 3X1YA 1T5IA 2OBMA 2JATA 4CEIB 1LFDB 1OFUX 2NMVA 4PZYA 1QVRA 2VP6A 3LXXA 2MSEB 1AN0A 1Z0FA 3NKVA 5EUQB 4LYFA 3GPLA 4MUBA 2FOLA 2C2HA 1Z8FA 5AWFC 1HE1C 3K09C 4EPVA 1T3HA 2ORVA 1HH4A 1ONBA 2XZLA 5FR1A 4ASUA 3U44A 3W8NA 3WYGA 3ADKA 4PSVA 5LB2A 3WBJA 1LNZA 3C14C 2FSFA 3K0FA 5K8LA 3A36A 3DZDA 1KOFA 2ZRBA 1YZQA 4IVRA 5EE0A 2VO1A 4TQAA 1XTIA 3PFIA 3W34A 1CJVC 4US0R 3J81k 4I1VA 3R7WA 1KK1A 2Q3HA 1DO0A 1P62B 5CJPA 1UBCA 4BFVA 1KI7A 4NCKA 4NYJQ 3X1WA 1BMFA 3OE7D 5DHFA 1R5BA 4DHEA 4DDVA 2IEZA 1OB5A 1KI4A 4V0OA 3MUFA 4Q9IA 2NO1A 2BM0A 1W0KA 1DE0A 4LHYA 2EYQA 2AHOA 3VR3A 2GWHA 2ZITA 5FI0B 2ZE7A 4D4MA 2PX3A 1OH8A 1E9BA 1YE8A 1CXZA 3SYNA 3K9HA 3QY0A 2FFAA 3BH6A 3TAHA 4TYWA 1NBMA 1AZSC 2BHRA 5EP3A 4I1UA 2VP4A 4TMZA 4D0GA 4Q01A 4LX0A 1N5JA 4H1VA 2J0UB 1QVAA 1XD9A 5KDOA 1W0JD 1VG0B 1GRQA 2X1VA 1XXHE 4FIDA 4DT1A 3EX7C 1L2TA 3RSOA 3IGFA 4M2LA 5L3SA 1OKKD 4V0NA 4XWAA 5EXXA 1Q1QA 4HAYA 2BIFA 1OFTA 2ZRDA 2QSZA 1FQJA 1MOZA 2V4ZA 3IHLA 5JS7A 3PEWA 3I72A 1YJ5A 4HZIA 4ZPXA 4DLRA 5JCPA 1KDTA 2IF0A 2W00A 4M53A 2JLYA 4MYUA 1SQ5A 4ARZB 3L82B 3LQQA 4M9QA 2EWWA 3GCGA 4TSFA 3TKLA 1VDZA 1W48A 2OV2A 4CEHA 4D4LA 3KJGA 1COWA 3OZXA 3MMPA 2A30A 3BGWA 3ICEA 1QG2A 4MITA 1V5WA 4JLDA 4Q4AB 2C9YA 2VP2A 4WZBE 1E98A 1N5KA 5DSZA 5EP1A 4W9MC 4QGAA 1KO7A 2ZREA 4LY6A 4BLQA 3KFVA 1G18A 5JBQA 2E9SA 1OSNA 2IT1A 2VTKA 1GKIA 1SKQA 2BCJQ 1E9EA 4KFUA 3H86A 1Z6YA 4EPRA 1F60A 2BKEA 1F2TB 1L4YA 4TWZA 5KUTA 1CR1A 1EFCA 2XSZA 3T1QA 2ZUBA 4BFYA 1G8HA 1SVSA 1YZNA 4W7SA 5AJWA 1WE2A 3VR4A 4CEIA 1ZINA 2X2EA 4NDZA 1W47A 1NLYA 2ORWA 1GP2A 4FINA 4UXIA 1Q22A 5AUOB 3FHOA 4RD4A 1KK3A 2QP4A 2GF0A 2PX0A 3SHWA 2HV8A 3K9LA 4DLUA 1U90A 2J41A 3VR1A 1S8FA 3QE0A 2YV5A 2NG1A 2ZI7A 4XSHA 1W7AA 1LS6A 1IY0A 2GCOB 2YZ2A 5CDFE 3AF2A 5DI3B 2XOKA 2QA5A 5JMTA 3ECCA 2RB4A 4JMPA 1Z6AA 3EIHA 4GP6A 1K6MA 1FOEB 2VH5R 2PEYA 2QT1A 1KMQA 1E1RD 2YYZA 4Q66C 4V02A 5CIQA 2ASEA 3R9IA 1CLUA 5F9FA 3EW9A 4D80A 3GLFE 2NTYC 4JLOA 4JYCA 4G5GA 1Z07A 1N6RA 5KU1A 2V3CC 1XBTA 4LV5B 3K0CA 3Q5DA 2GNOA 5AR1A 1H8ED 3CF2A 3TSWA 2WSSD 2XNDA 3C41J 1ZBDA 5CJ2A 2Q9CA 2C8VA 2MSCB 4PX9A 1Q1EA 3BB4A 4OK6A 1ZIOA 1E96A 2R65A 3IO3A 1FUUA 1HA3A 1OXUA 1XCPA 4NBSA 1YZTA 1DAHA 1XEXB 4M4SA 4MRVA 4YMSA 5EXTA 3OFNA 1KY2A 4B76A 1JR3E 4ITRC 4HLQB 2UZIR 1D5CA 1ZUIA 3Q8XB 2IBMA 5JECA 2O8DA 4HLDA 3QI2A 4WVFA 1CU1A 4PANA 1QHXA 4DLWA 1E9AA 2P6RA 1JXOA 3LDAA 1NNEA 3U4QB 2ZJ5A 5JSZA 2QP9X 4D4KA 5G41A 4B32A 2O0JA 2J0UA 3CNOA 4P0TA 3GEHA 3ICQB 4A15A 1SVWA 1XWIA 1R7RA 1N6IA 4QL3A 4E03A 1TAGA 1R5OA 2A5DA 2GBLA 1P2SA 3THYB 2LCFA 5EZ6B 3N5CA 3G0HA 1G3RA 3BRWD 5FUYA 1KO5A 4XD7D 2X8AA 2G6BA 2GZHA 2N42A 4TQUS 4M8NE 1C1YA 1EWQA 3CLVA 1UEIA 2FZLA 1W36C 1Q1ZA 4OHWA 1OH6A 3B1YA 4NYIQ 4HATA 5CDFA 4IKEA 4NP6A 1G8PA 4BFWA 2EFDB 4LBYA 1DADA 4FWIB 4DLTA 1MH1A 3D3QA 4GFDA 4KXFB 1IXRC 2CLDX 4S35A 1OXTA 2Z0MA 3B1WA 1E2EA 2A78A 2ZUDA 4OI1A 2F9LA 3JVVA 3IKJA 4Q4AA 1NY6A 5EUMA 3WYFA 2X77A 3MWLA 1RJ9B 2EFCB 3M0EA 1RRFA 2JLUA 4FMCF 1M6NA 3LFUA 2FZ4A 3ND8A 2IYYA 1Q20A 2ZSAA 3VU9A 2BEKA 3C7KA 3FMPB 3QG1A 3OEHA 3GLHE 1CJKC 1NI3A 1OYYA 2RGGA 1G6HA 5LB4A 1E2GA 3E2IA 2AKYA 3KL4A 3L8YA 4N0EA 4HZUA 3IEVA 4QHYA 1NMXA 1US8B 2OESA 1F2TA 3EC2A 4RJLA 3AVTA 2R2AA 2EFEB 4Q7MB 1E2HA 5E7MA 2AFIE 3THWB 4PHHA 2PT7A 1ZCAA 3RRYA 1KI6B 1M2OB 4KAXA 2WKQA 1EFRD 4ZKEA 1N5LA 1J70A 3BC1A 3ZZTA 2NIPA 1RKBA 1WMSA 5IK2A 2DCUA 5EE3A 1G4UR 2J5XA 1VYUA 4OBEA 3SOPA 2F1RA 4LHVA 3M1IA 3Q7PA 4A6XA 2ZYVX 3B1ZA 3X1XA 1J7KA 3OAAA 3CBQA 1WQ1R 1E2FA 4DB2A 2GCOA 2QP3A 4ACBA 3AVWA 3EASA 4Q18A 2QPOA 4JLMA 3SE0A 3SYKA 2ZJBA 3AKCA 2GJ9A 2XB2A 4U02A 4ILEA 2QMEA 3LW8A 4Z8YA 1X8LA 3FVQA 3NVAA 4DLSA 5HKKA 2ZR7A 3A1WA 2GJKA 3RS4A 3KQUA 4NYMQ 4WBSA 1LW7A 4PC7A 3U3MA 1JJVA 2XJ4A 3AF4A 4MGIR 1RFLA 4KHZA 3D31A 1SHKA 3MLEA 2AWOA 2D2FA 1KMHB 5KHOC 2AKAB 5F9HA 2QAGC 2V7QD 1Z63A 1XEXA 4LYJA 1OF1A 3F5FA 4KFSA 3TMKA 3UANA 1HY3A 4LJ5A 1E2MA 4TYYA 4DLYA 1OE0A 2HJVA 4P3YA 1W1WA 2ZJYA 3FKSA 1Q44A 2GCNA 1UF9A 3KFXA 2QENA 5FBLB 3I8SA 2BKUA 4N3NA 4DXAA 1E2NA 5JEEA 2AXNA 4JVSB 3KQKA 4F91B 1P2VA 3THYA 3TH5A 3E1SA 1W44A 2WBLC 1Z6XA 3B85A 3KTAB 2QAJA 4U5XA 3VX4A 3RNLA 2ZUCA 4GMDA 1FX0B 1VKJA 2OCPA 1NN1A 2CK3D 4YXWD 4QRHA 5TARA 2MMCA 3PEVA 1XEFA 2ECKA 2EFHB 3VR6A 1TTTA 1PZNA 4URZR 4P4SB 3BK7A 2QBYB 3AVPA 1FP7A 4MYHA 3A6PC 1GUAA 1MO5A 4Q02A 1RJ9A 3IQXA 4A4DA 3IPYA 3EA5A 4XWOA 1XNJA 2BWJA 5FL7A 4ZV4A 4M22A 2XITA 2C95A 4TL9A 4QM6A 2ZR0A 3K0CC 4LJ9A 3HR8A 1I2DA 1AM4D 2IYLD 1S4QA 4G5SA 2HT6A 3CZQA 1G3IA 3UWOA 1JXMA 2ZRHA 1QDEA 1H8HD 4HB3A 1P60A 1US8A 2ZSEA 1KI8A 3KX2A 1E69A 3ZS9A 4ZCIA 1Z3IX 1Q3TA 3TR5A 2ONKA 4IOKA 5JLJA 4GNKA 3OEEA 1EX7A 4EIWA 3UPUA 3GJ4A 3H2YA 1KI6A 4JIMA 4A0FA 3LLUA 2ZPTX 1WB9A 3CRW1 3U6BA 2QPTA 1KNQA 4WZAE 3RS3A 3AVVA 2F43A 1MKYA 4JLVA 1AK2A 4Q03A 3RWOA 1WRBA 3O8CA 4XOIA 3UWKA 2ZI9A 3PIRA 4NTZA 4M1TA 4MGKR 4BECA 2FH5B 1RRPA 2VSFA 1P6XA 2OHFA 2JLZA 2H17A 1R10A 1XTJA 2HUPA 3AKYA 4M1YA 3CIOA 4BPBA 5HE9A 2DFLA 3UG6A 5TY0A 1LV7A 1XZPA 4QGGA 2FA9A 1DELA 2QI9C 4B47A 2RCNA 2NO0A 2AR7A 3DHWC 4QKQA 5TVKA 5BYKA 4FCWA 4PO8A 3U7GA 4NZYA 5CITA 4EJSB 4HAVA 1II0A 2YOGA 4PHFA 4EUNA 1VYVA 3P27A 3FOZA 2NOAA 1TPZA 4V0LA 4EAQA 3R8CA 1DAMA 1GAJA 2FEMA 3SBEA 3I73A 3VNVA 2IUSA 4Z8XA 2GEVA 1DBSA 2J7PD 4PZZA 4XJXA 3CM0A 4W5HA 2QY9A 1XX6A 2GF9A 3QPUA 2QMOA 4IXNA 1LVGA 1X1SA 2CL7X 3SI7A 4R71A 4JVNA 1XMSA 2ZRPA 2ZRLA 4MYTA 2HT1A 1DPFA 4Z1MD 3EPJA 2BOVA 3KDSE 1FPMA 4OQXA 5JHHB 1M7HA 1KI1A 3GJ7A 5LPNA 2H18A 1AA9A 3FE2A 1MABB 1N2CE 2JCSA 1XU4A 2ZIAA 4M9ZA 4AY2A 4B3XA 3VHLB 1OXXK 4HUTA 2ZRKA 4TMTA 5DN6D 1UKZA 5D3MA 1UADA 1W5SA 1T6NA 4QHTA 4JT4A 2AN9A 4RSGA 5L3RA 2LKCA 1PUJA 3SDZA 3AKEA 1XCGB 1FX0A 2CE7A 4A0HA 3GLGE 1KKLA 2RKOA 1OHHA 1VG9B 4AK9A 4AURA 1NN0A 2F3TA 2I4IA 2C99A 1JAHA 1HEIA 1KNXA 1E9FA 3SJCA 4ZCMA 3EARA 4JL8A 4IEIA 4XVUA 2H5EA 1S0UA 2QBYA 4CT5A 4G01B 1P72A 5FOUA 2FG5A 3B1XA 4QC2A 5JS8A 4QM7A 1KDOA 4EQ6A 4O25A 2WOJA 3REGA 4LGMA 1M74A 4RFSB 1S2MA 3IEUA 1EX6A 1KSFX 1TF5A 3NEJA 2JDIA 2J0VA 2KWIA 4HB4A 4Q9LA 5CYPA 4LC0A 3WNBA 5FTKA 2IYXA 5HCNA 3QJYA 3T5DA 2HXYA 2GXSA 2PL3A 3PUXA 1AIPA 3KJHA 4HUQA 4PZLA 4L8GA 2RGBA 1XMVA 2CE2X 2DWPA 3B78A 1IN4A 4BGDA 3EA0A 4G5RA 1EESA 1ELOA 3U3OA 3WHKA 4LSGA 2NO6A 4ZDJA 4DDUA 5KSPA 4PC1A 3FWYA 1TU4A 4ON9A 1XJQA 1AKEA 4Q4JA 4TT3A 5C4GB 2QL6A 1HE8B 3EZFA 5FOTA 3GJ5A 4C0JA 5FUVA 4ASUD 4C7OB 3RRZA 1NL3A 2IXGA 3K8YA 2PCLA 2QM8A 4PAQA 3P32A 521PA 3SFZA 4BE7B 3DOEA 3KUDA 3WP0A 2D3WA 2IHYA 2J3EA 4HAWA 4YLGA 5G53C 3GLGA 1KK2A 3FPAA 1LF5A 3AV0B 2IYSA 2BJWA 1YZKA 4MKFA 4RD3A 5G3ZA 4ZI2A 1E2LA 3KXLA 4NCNA 4IDOA 4CYMA 4TYPA 5FOSA 5B30A 1E32A 1BMFD 1R8SA 3DDCA 3P20A 4PC3A 4WXRA 1DVRA 4JSYA 4B35A 2OAP1 4D81A 4EJSA 3AVYA 4HEJA 3H4MA 121PA 5KNCA 4NONA 5DIFA 1CR4A 3I61A 2ATXA 4B43A 3THOA 2ZYUX 1MV5A 2VSXA 3H1TA 2H92A 3KZ1E 1PVOA 1W0KD 3HPQA 1OPXA 1DO2A 2IYUA 1ZYUA 2V54A 1G5PA 1OV4A 2X19A 3RS5A 1UAAA 1GM5A 1OJLA 4EFMA 1DAIA 1NVVR 4ERNA 1NBMD 1NF3A 1BS1A 3TBKA 1L8QA 2H57A 2R62A 1E1QA 2GAAA 2QORA 3DVLA 1G1MA 2VRWA 2OUKA 1MABA 1U0LA 4OJKA 3C5CA 1E79A 5M04A 2C78A 4LUCA 2Z5FA 3WNDA 4LDJA 1I4LD 5HR5A 4A2QA 4AG5A 1G5TA 4AWXA 4G5OA 2FDCA 2G88A 4FMBB 3AQ4A 4OI4A 3NEYA 3KQNA 3CWZA 3L0PA 2ZR9A 2R9VA 4ZIRB 4QXAA 4CEHB 1II8B 1N0VC 3BWDD 1ZNZA 4RKFA 1T8TA 3LV8A 4TSFD 1Z0JA 3QPVA 3I5YA 1XPUA 2G1KA 2CVFA 4O0MA 4RKEA 4PQFA 3FHCB 4OI2A 2XB4A 4DUGA 3A4MA 2GZAA 1P9RA 2R6DA 3SYLA 1EG7A 2NQ2C 1U99A 2VQSA 5EE1A 4JKYA 1N0WA 4G3XA 4KI0A 4RFSA 4U7DA 4FN5A 2VPPA 3WYAA 3U61B 2YWHA 1BKDR 4D0NA 2EQBA 3EWSA 2BC9A 4B3CA 2QGNA 1QZXA 4XVQA 2XSZD 4W5WA 2ZANA 2KBFA 3LBNA 4TLDA 1F5NA 3P26A 3V00A 1Z2CA 3ZS8A 2YNMA 3KXKA 2KE5A 4A0RA 5H8WA 2ZSDA 2BMEA 5FOXA 1W5TA 2WWYA 4I1SA 1XXHB 1Z6GA 3AUYA 4CGZA 5IRCD 4LJ8A 5BN3A 1Z5ZA 4RD0A 2BBSA 2C03A 1BIFA 1TADA 2WIBA 2FGKA 5BYJA 4LJYA 4BLOA 1Z0IA 2XEXA 3QXCA 4C7OA 4R7ZA 5KSOA 4PHGA 2D7CA 1EWRA 3HU3A 4MYCA 3DM5A 2XOKD 2GKSA 2A5FA 3EZ9A 2YINC 3TUIC 3ZIAA 3ASZA 1D9ZA 3H0KA 5EJEA 4QGHA 1ESNA 5DHAA 2HYDA 1R6BX 3FB4A 1WBBA 4KO8A 1MRNA 4XTCS 3VQTA 2RAPA 3U3RA 3SU8A 1E9RA 4CIDA 1MO4A 2P5TB 4DC9A 2YVUA 3AEZA 4GI7A 1S9DA 2IS6A 1KI2A 2QPAA 1AS0A 4OKSA 2ZXUA 2XNDD 4B34A 2IX3A 2WTUA 2DB3A 3B2EA 3CPHA 4LWZA 3DMDA 1SVMA 1ZM7A 1KYIA 4NU0A 3ZQ6A 3LXRA 2Z43A 2F55A 4NCJA 2O8DB 3BJIC 2R6FA 5DI9A 3OFND 1R0ZA 2WPDA 4BEBA 1ANKA 2V6JA 3CKLA 4EPWA 1A5TA 5JSZB 3U3JA 2XXAB 4GOXA 3CRQA 1CKEA 5SZHB 4JLKA 1FNNA 1XJCA 1R5NA 3QKUA 4FI3C 2V6IA 2WKRA 3UMFA 3ETLA 3OIWA 3A1SA 2YHSA 3JZMA 4N0DA 2O0HA 3T5GA 4LBWA 1QHYA 2IHBA 2PZFA 1AZTA 2WJVA 3NC0C 3BH7A 3AF1A 3GQBA 5JFGA 4IOLA 1ZNWA 4JZKA 1BOFA 2QQ0A 3DMNA 4DRZA 3NDBB 1MR3F 2ZS7A 3CH5A 3QPWA 1ZM3A 3B8HA 4ZIRA 5HCIA 1II8A 4Q9HA 4EKDA 3LD9A 1KO4A 3LBIA 221PA 2RGDA 3AGQA 1XDBA 3QVUA 5GVSA 4NYJR 3GLFB 2DWQA 2IS1A 1OH7A 5FPYA 2HF9A 3I4LA 3H84A 4YDSA 4Q1BA 4WIAA 1G7SA 1N5IA 1UKEA 4F7WA 1VYTA 4B2IA 1Z06A 3LVRE 4TLCA 5AJVB 3TRFA 2F6RA 1R2QA 2CXXA 2V8OA 3LH5A 3P4XA 4BFUA 2PMKA 4JJKA 4CZ2A 5ELXA 1W4CA 3I62A 3X1DA 3QKSB 5GJWC 4EJSC 3DO6A 1XD2A 2PLRA 5DGXA 4NKRA 2HXSA 4HZUB 3OEHD 1NJFA 4BZQA 4Q00A 4F92B 4F4JA 2FFQA 2BM1A 4M1SA 1FUKA 3L2OB 4B6EA 1NSTA 3SQWA 3K70B 5JCZA 1UBGA 3VKWA 3GD7A 1U0HC 1HURA 1YKSA 2GRJA 2DFNA 3BB1A 5B64A 4HLCA 1U8ZA 4EPTA 2GK7A 3K9NA 1JB1A 4P4TA 1FFHA 1Z6TA 4KITB 1XPRA 1XXHA 1SXJE 1F6BA 5IK2D 4B2PA 1Q57A 4PQRA 2DY1A 3NC1C 3CNNA 2ZRMA 3D8BA 3MFYA 3LAWA 3NH9A 1RRCA 4O3MA 3OAAD 3LVQE 2ONJA 3P1JA 2NPIA 2R6GA 4UNSA 4US1R 2OCBA 4IDPA 2KB0A 3NIBA 3FFBA 1E4VA 1G6OA 4I81A 3T06B 3BFXA 1J2JA 3B9QA 2WKPA 3GJ6A 3PENA 2OXRA 1XPOA 1E2DA 5DISB 1G8YA 2P6UA 2I1QA 4TL7A 5HKKD 4KFRA 1GL9B 2BMDA 4URXR 4LZZA 1M1YE 1KZGB 3F3YA 1SGWA 3AVQA 1X8KA 2ZS8A 2YJTD 5B58C 4TLEA 3RRNA 1Z47A 1HQYE 4FMDB 1JAIA 1QG4A 2BMJA 4LBZA 3GLHB 3ADDA 3ZZUA 2XJ9A 3REFA 4HAZA 2G0TA 4WZ6A 1P61B 3B7GA 2NO9A 2JLVA 1YZUA 2FSGA 1NY5A 2VA8A 2IUUA 2CHGA 1MO6A 2XXAA 3I5XA 3C4JA 3IBYA 1G5RA 5EE5B 3EZ2A 3NTUA 5F2EA 3BD9A 4LPKA 3FKSD 2WVJA 2G9NA 3TLXA 2YWFA 3Q7QA 5FTNA 3T61A 1TL7C 1ZC3A 2ZJOA 2YC4C 3BAFA 5JI2E 1N6NA 2ZM5A 1EGAA 2B8TA 4JBWA 4PC6A 4OYHA 1ZMXA 1SXJA 1G8GA 2FGJA 5JWHA 2WWIA 3QSYA 1ZNYA 4U00A 1E3MA 4K8OA 3GMTA 3IILA 2FE4A 4E5UA 1QHHA 1NVXQ 4YONB 4R2HA 3VKHA 1CS4C 1NG9A 2OFOA 4D0LB 5F98A 5GJBA 3HP1A 1ZUHA 3W5JA 2CNWA 2VEDA 2NPFA 5CB8A 4JS0A 4B6FA 3B13B 4B3DA 1Z28A 2AL7A 4B75A 1AQUA 2HEIA 5FTJA 1ZW6A 4RD1A 3GLFA 3VAAA 1Z29A 1ZAKA 3TK1A 3W8RA 3PV0A 3NBYC 4P4UA 3WY9A 4PXAA 1OB2A 2ZJZA 2QE7A 3IIMA 5BXQC 1YVDA 2D06A 2SHKA 5FL7D 1E6CA 3QKSA 2XTMA 2C9OA 2CJWB 3BBPA 3L8ZA 4POAA 5CK5A 2GK6A 2A5JA 2ZU6A 5B2ZA 4Q21A 3V9PA 5FBRB 3W5IA 1D6JA 1KDPA 2IUTA 4JL6A 3RYTC 1JR3A 2OBNA 1E4YA 3GEIA 3VX3A 3CX7A 2LKDA 2JLQA 2DPXA 5J4HA 2HF8A 1T4GA 2VHJA 2F43B 4GOKA 1G21E 5J40A 2L0XA 4M1WA 5UKDA 4URYR 2WSMA 1ZD8A 4PTLA 4DB4A 2R44A 5FPKA 2RMKA 1NLFA 1SULA 5CLQA 4DWJA 4YMUA 2GXUA 5EXSA 4IFBA 4DEYA 2OBLA 2BBTA 3LA6A 4R2IA 1PV4A 5A0FA 1L4UA 3WP1B 4URUR 4TYNA 3IIKA 4BQSA 4UNNA 2EU8A 4D6PA 3A58B 3OIVA 4ESVA 5C4MA 2DFTA 1E9CA 4BFTA 1XTSA 4HDOB 3MWYW 2XZOA 2Q21A 5IDVA 3O8DA
chains in the Genus database with same CATH superfamily
3DEYX 2R4QA 1EFTA 1F8XA 1PS9A 2HQBA 5CCXA 2CKMA 1E0AA 3GP5A 5ITWA 4JD5A 2C3PA 1N0IA 2FR8C 3OZDA 4QDXA 4Y0VA 2BD0A 3RODA 1DRVA 3AT1A 1P3DA 1MC1A 2AFHE 3H3FA 5E9JA 3KRTA 4M88A 1HEUA 3SNHA 4DNXA 3G5TA 1IOWA 2R2GA 3Q0TA 3ANMA 1BVUA 3MLAA 3OBIA 5MN6A 4RFLA 3D6VA 1E94E 5JVDB 1U3DA 4I5FA 5K3CA 1KAGA 2H07A 2PIAA 5FWNA 3U3KA 4OSEA 5A2GA 1DJNA 2HMAA 1RI5A 1X7ZA 3BQMB 3JAWA 3WGHA 3AR8A 1H6CA 1Z0KA 5KWVA 2GMWA 2JASA 1EE9A 5DP1A 1BDJA 3DAFA 2V55B 3VC1A 2FN9A 2V5AA 2JHPA 2F17A 2V7GA 3ZDEA 2GHRA 4YRGA 1KGSA 4G4SO 4AZ0B 3AF0A 2IYQA 5HILA 4EARA 2HSZA 2PRYA 4M1MA 5AK4A 3OECA 1X3SA 2XX3A 4JC4A 1TB4A 5TJHA 2ROQA 4FJ2A 4XPIB 5BSVA 4GR5A 1LRJA 4G0XA 4BTLA 4P34A 3E61A 3EC1A 4WZAB 3BFKA 4E08A 1TZJA 5D00A 1G21A 2R60A 3G6WA 2R87A 1KC3A 2QMUA 3O8OB 3A6GA 2M6SA 5FUWA 4A1OA 4BLRA 1IK6A 2HNKA 4JBHA 8OHMA 2VI5A 2EYUA 3IOCA 4C9BA 1OYOA 1I5OA 2BAGA 4EDHA 1T13A 3DLAA 3HLKA 1SHJA 2C8LA 4TQGA 4XGKA 1I4EB 3DCYA 2C3MA 3QX3A 3O8RA 1OHHD 2Z57A 3MFQA 4J0KA 5KYKA 2FY8A 1G8JA 3DUFA 4MUHA 1IXKA 1S1MA 1X1EA 3HYLA 3OICA 4JDPA 1V6SA 3BSWA 2F4NA 3F7OA 3RSHA 3IDZA 3T1VA 3BE4A 1WUIS 1G20E 1PT7A 1N6KA 1Q0UA 2A84A 2I3BA 2JFUA 3MTQA 4E07A 4KIJA 5KKCA 1RPZA 2X8LA 3B3AA 3AHJA 3MCUA 1GNPA 4Y2XA 4EQ6B 4EZEA 4KQHA 4C5AA 5JC8A 4PN3A 2AC4A 5EQDA 1S2NA 2MHCA 2FKAA 4IJMA 2F2TA 3OX3A 1OT5A 3S68A 4LRWA 5EJ7A 2GZSA 4MR7B 4DLPA 2R00C 2AFHA 3OZBA 1QRUA 4IIFA 1Z4LA 2VQEB 2BTOA 4B3FX 2AS0A 5F7JA 3CS3A 1R3UA 3M2PA 3SN6A 1A8HA 2JHAA 2ZEJA 4HUQB 4Z9FA 1JFVA 2O6HA 3Q3HA 2BTEA 1NWHA 2WSYB 2GEBA 1DC6A 2N0SA 3QXJA 4WOPA 4F6RA 1DFGA 1JN0A 4MWCA 2WJHA 5HRAA 2AXPA 1EFPA 5E1DA 1KEZA 3LTEA 3V8EA 1WA5A 2BL4A 3WXMA 2QUBA 2NYRA 2YXNA 5MF6A 5LXTF 1FRNA 2B99A 4RJIA 4E2YA 2ZI5A 4NZOA 5AW6A 3L6CA 2Y2VA 5FAXA 3WWDA 1XQ6A 2IXFA 3T6KA 6NULA 1AK9A 1SG9A 1B0PA 1T4DA 1YZ3A 3AUTA 3OOJA 4EB6A 4RTMA 2Q50A 3OY2A 5DYIA 3KR1A 2R6CA 2AWNA 2GBLC 2PD3A 2VTDA 4PG6A 3VKFA 3NHBA 5K8CA 2ZSBA 4M21A 4TTVA 1P5JA 2CEAA 2FN8A 1LWNA 2XF2A 4G09A 2CCGA 2H9IA 4W8HA 2TMGA 3F7NA 3C70A 4LI0A 4XYGA 1UEJA 1WXGA 3AP2A 1XD8A 2IIQA 4TKVB 5GONB 4NE7A 3MTEA 2YC2C 2J9ZB 5IAEA 2PBLA 5JAUA 1KEUA 3CSDA 3BE8A 2FZEA 4KXXA 2Y99A 4Y2JA 2ZTSA 2WU4A 3BPSA 3OQIB 4GGMX 3QKWA 1DSSG 1E0SA 5B1EA 5DCWA 2FHPA 2ZI3A 4HVCA 4X91A 5ESXA 1GQQA 2GM3A 3EF3A 4B74A 4DSZA 4OSOA 5ADVA 1C3JA 2VHTA 2H1FA 1NIPA 1OT3A 1THMA 1XA0A 3AETB 3HCBA 2O2YA 4K46A 2ZU0C 4PX5A 4E11A 3Q6IA 3JQGA 3ESDA 3AI1A 3M5DA 4H7EA 2VDKB 1OUMA 4ZGBA 4JNKA 1P1RA 3M34A 3SKVA 4FYMA 4AULA 3RG2A 2ZVDA 2ARKA 5CX4A 4EB8A 3LHSA 1KSJA 4W8GA 1ATZA 1RJEA 4M3NA 5I7RA 3C8HA 2Y9MB 5LMCA 3WGJA 4OU5A 3U17A 2JJ1A 5CFNA 1RWVA 1NYQA 3IC5A 2KI5A 1Z4MA 2GJ4A 4GXRA 4IINA 4TTAA 3ZDAA 3KOUA 4IDHA 4DLVA 1K8RA 3T4XA 1NE2A 2WD7B 3BULA 3K70C 5HIMA 3TLYA 1GZSA 4MVJM 3JR7A 4ZAFA 4LCBA 4RMIA 2ZVQX 4W5NA 2IP2A 2Q3FA 1RACA 2VQDA 3FCUB 5LZ5A 5FFMA 3H6KA 1CUZA 1ZA1A 1ZEJA 4YBZA 3HKCA 3Q8LA 2G25A 2H54A 5K0LA 1C0IA 1WY7A 3HU2A 4QU0A 4I5EA 5HX7A 2UVQA 1S3SA 2FQQA 2FSVC 1TPYA 5T5QA 1E2JA 3GEBA 3E27A 4TVKA 1QCZA 3V7FA 2BGUA 3LCJA 3WMEA 1X74A 4ZCLA 4C3ZA 1H9AA 1Y3CE 4EGJA 1I7PA 2PV0A 1TRKA 3PXCX 4NCIA 5I7HA 3A4NA 3UG7A 4B3GA 3IR6A 4NEHB 4A8HA 1AQJA 5K99A 4XGRA 3T0FA 3W2FA 4AB1A 4HVAA 4WXEA 3GGJA 1H5UA 4CMJA 1P3Y1 2O2IA 1B2RA 2NLOA 4Q1DA 1I7SB 3U16A 3JALB 3SZMA 1BXRB 2ZWAA 5K8VA 2DEUA 1U6KA 3IA7A 1B8OA 1AHPA 1QYXA 1IG3A 4BKRA 1A8UA 1U8CB 2V45A 1YR8A 2ZLBA 2PLAA 4YRMA 4MVJE 3OCXA 2JBWA 3NAMA 1YR2A 3KWFA 3OJOA 2CD9A 4NESA 4OTZA 4BC0A 1XTPA 4LRYA 3LX6A 1A88A 2KQUA 3M5CA 3N0TA 3U5TA 4BVKA 3VDQA 3LNCA 4UAUA 4WY8A 2P27A 4QXOA 4F2WA 1IQPA 2PKQP 2YNMD 3D81A 1KEKA 3JATB 3FGOA 1O0SA 4I55B 1NVTA 1ZL2A 2YY5A 3QWBA 2MMGA 4OXNA 1AX9A 5THQA 3RWMB 3WGNA 2F59A 2K87A 3MBIA 4BLPA 1L4EA 1TX4B 4MRSA 1FFEA 2YW2A 2O19A 3R9XB 1I5RA 2QRKA 3LBFA 1NHGA 2IP4A 4BB0A 4RTPA 1EVIA 1UKVY 3UUGA 4DV5B 3F2VA 3DE2X 2WTEA 5DNCA 5J3JA 3FOAA 1ZRSA 2Q6LA 3VO2A 3BL6A 1N34B 1I3KA 1LDBA 3FM9A 4UQOA 3WA7A 3QOFA 1WF3A 3UWDA 5JO0A 3LY8A 2I66A 4L5AA 4D44A 4XWWA 2FRDA 5IDQA 4P32A 4GF5A 3T95A 3EZLA 3ZIAD 3B60A 3MA0A 4LF5B 2Q5HA 1X7XA 3IHWA 1B15A 3V7YA 1GNVA 3GJ8A 3LYUA 2R0QC 1RM5A 3OIFA 4F3TA 1SHLA 1W4RA 4ZOCA 2QI9F 3I30X 3GZJA 3BE5A 1R00A 2ACWA 1CRQA 3L6EA 3LCVB 1XYYA 2I1WA 1L7OA 3CF0A 3HN6A 3BXGA 5L51A 4CLRB 3V97A 3GJQA 4X20B 3UIEA 1C8VB 3RFUA 1HMPA 2FWAA 4PFSA 3RS7A 4BV8A 2M2IA 3HXTA 5EEHA 3WK7A 5J1TB 3L0SA 4E5KA 2Q7XA 4LXIA 4Q47A 8LDHA 1TIPA 2ZE8A 4YMTA 4AJEA 3F67A 2RHBA 1XR3A 5T67A 3I3SR 2JGEA 2QTLA 4AQDA 1J39A 4Q1FA 4Q4HB 1YNOA 2QTZA 2FF7A 2W6MA 3F97A 3S1AA 1KBZA 4BQEA 4C1BA 1AT1A 1I2MA 3UN1A 3EA4A 1QO0D 2D2VA 1S02A 3A1DA 4HGPA 3NBQA 5JATA 4ZO6A 4OUDB 3Q8WA 1E3TA 4CUJA 4E3ZA 3N5KA 4DW8A 2Y6VA 4PSKA 3CZPA 3EGCA 1JG3A 4REOA 3TNJA 3VGJA 3KKNA 1H6BA 4EX6A 1J09A 2C5LA 1Q1NA 3N0RA 4GWLA 3DAPA 4UNPA 4AC9A 1H2YA 2C4VA 2C5EA 4DDTA 5ECDA 2JI7A 3CLTC 1SBIA 3ZV3A 3C3PA 3BORA 1BROA 4J1QA 3O8BA 5A0TA 3FRIA 5IN4A 2A9OA 1B73A 2IC5A 5F2KA 1V7CA 4BO8A 2JKYA 1TLFA 1UBHS 3C3MA 1KH3A 4MW9A 3GLIE 2I4MA 3WRWA 1U9CA 1DEHA 3S70A 2BCGY 4H6WA 4P36A 2VJLA 4V2UA 1ULUA 4G0NA 4LSWA 4EFLA 3VA7A 1XRJA 1ZK2A 5LZ7A 1J22A 3AL3A 4R7TA 4XDHA 3O8LA 2V7TA 1E3DA 5HHTA 1O96B 4IDCA 4EJ6A 4HXYA 2WSLA 1I4WA 3R6TA 2DAPA 4DS3A 2XB6A 4HV4A 3PHHA 3A0RB 4NPCA 1PWYE 2B4TO 2G9RA 3OUUA 2HJGA 3Q9LA 4L6IA 4XASA 1JFTA 1QHSA 5DBHX 4DSUA 4GQIA 3WK4A 1Z22A 1CUFA 1JKMA 4WLNA 4E30A 3G9QA 4MDHA 1GL6A 4R1TA 4XSGA 2B7BA 3R0ZA 3IP6A 4CEJA 5ALZA 3GBPA 2W2LD 1QDUA 3DEHA 1OFHA 1UBUS 3MJRA 1UXHA 1R6VA 3PQCA 3OTQA 1KDRA 4M0FA 4Z99A 2HN9A 3F47A 3V4VB 1BXGA 5EMNA 1YZFA 4DDWA 1Y81A 3NEAA 3KLNA 4BWGA 2QKYA 2UZAA 1TD9A 5DGCA 1XU7A 3G5UA 4LFCB 2DPLA 3ZX4A 3BMQA 3H8WA 1QFYA 1SEVA 2C4NA 4L5IA 5JJBA 5L3QA 4L15A 2W6QA 3EXAA 1STOA 2J1LA 1YS9A 3BFJA 1W49A 2ZPUA 4KNVA 5CYFA 4PZUA 1QS0B 3TVDA 1RTKA 1QFJA 2LUOA 2H1LA 3MWKA 5TXGA 2BGWA 2GEUA 2P4SA 3DEZA 4N39A 1JSLA 4W5TA 5ALKA 4RV4A 4ZK2A 2PUBA 1FVOA 4F2GA 1V8FA 4EVQA 3GT3A 4DR1B 1MORA 4TL8A 4BO6A 2PMEA 5CGQB 2OAGA 4BZWA 5HM6A 4TZ6A 1SCDA 3PG5A 1PBTA 1SVOA 3Q5EA 3GLIA 4N3BA 1FU7A 1JA0A 3AUXA 5CLLA 4ARUA 5HSGA 2OYRA 4DE5A 1U81A 1GKUB 2I2XB 5DTEA 1M66A 4H7PA 4LK2A 1AGNA 1JGTA 1Z26A 2ZT6A 3EVNA 2AI2A 2Q5FA 3JR3A 1K6IA 4WCFA 5LNK6 5HF5A 1HTWA 2C7BA 3A6FA 3E5RA 1ULBA 2IVZA 3A3NA 1UKBA 4MV5A 2AIRA 4PZ9A 2H2GA 2VZEA 2AD1A 4TV9F 5E7IA 5AVJA 1KY3A 1OYVA 4BFTA 1QB8A 4BWYA 1XMQB 5TR9A 2OP1A 3JQBC 3GUHA 3OKPA 4JT2A 2P9YA 1U1IA 1VMAA 1K98A 2IITA 4H6VA 3L1JA 4KR9A 3QLUC 4WECA 3TM5A 2CJPA 2M1XA 3AFOA 1E8MA 4DMUB 4PLTA 3MRXA 4D79A 5T3UA 3C3DA 3GUCA 1ABBA 2ZJFA 4WNAA 4G26A 5TQ2B 3R5FA 2DE0X 2OTCA 2B8WA 1I1NA 3UJBA 3WK9A 3O74A 1N4AA 2XKBA 1U3WA 3OIYA 4UUOA 5HOEA 3LHIA 4LS3A 3EEBA 2FSHA 4OQMA 2E89A 4IEEA 4DWWA 1IQUA 1I2BA 1PTJA 5C7OO 3NH6A 1DAPA 2QTHA 3O93A 3WWEA 3H5OA 3GFVA 4KWIA 3PSAA 3QU4A 2PUHA 3U4GA 1K08A 2OG2A 3HJNA 4XIYA 5DW0A 2COKA 5KSZA 1QYRA 3G7NA 1SM4A 3AZPA 3CRVA 3PPYA 5HF8A 4NENA 4LTNA 3VTKA 3BSFA 2JCYA 2WLTA 3G88A 4KDEA 1C0EA 1PFVA 3G2IA 3WHPA 3ZWOA 4DCVA 1SQSA 2ZAYA 4DCNA 4B46A 1NXXA 4PBSA 4TLAA 2OXCA 2AE1A 4DA7A 2JLAA 5TEWA 3URMA 2YZGA 2D59A 1DBWA 1DC5A 3WLRA 2AJCA 4K6MA 3KFLA 2LWIA 5AK6A 3ZZ1A 3I9KA 1VP3A 3QI7A 2OT3B 1JPUA 4R1UA 4UFPA 4ESHA 2OV3A 5FYQA 3OHMA 4DCUA 4OJYA 4CUKA 5A6VA 2QN3A 1EP9A 5IBCA 4HDKA 1SB8A 2AN5A 1IBRA 2QRHA 2J6BA 2OL4A 4MI6A 4XYEA 2JLCA 5L4NA 3K1TA 1U0TA 2JI9A 1GU7A 2YOFA 3P9ZA 2BMAA 3ZKWA 4A8JA 4MS3A 2XA2A 1FQKA 1Q0ZA 3GAZA 4NBRA 1TQ4A 3N9IA 3LO5A 4OXRA 4E1AA 5BMVA 3ROZA 1ZJ6A 1DWUA 2VZ8A 4QOGA 2HDOA 2Y1CA 4AN0A 2QAGA 3UUWA 5LUAA 3W5AA 3U1VA 5C4IA 5B1YA 5IKPA 1BVHA 2CY0A 4LXHA 1SUCA 4JI1B 3H2GA 1SUWA 3R0VA 3WL5A 4ZVMA 3JVDA 4IF6A 1HETA 2K2WA 2YWXA 4CCYA 5AW4A 1VLHA 1HGXA 1SU7A 2AJDA 3F71A 5CAEB 3AR9A 2ODPA 1Z0DA 1T36A 1WSDA 1YCHA 3ED5A 2XBUA 2QRLA 4U7FA 4XJVA 5EQFA 3PCTA 3WWPA 5CFRA 3E4DA 5ALNA 2EG9A 3ISJA 3ROQA 4LYDA 3F6PA 3QUBA 1VA4A 4UNQA 5E9AA 3VHXA 1R0CA 4AZ3A 2D8MA 4X95A 2WDZA 3K9GA 5DNYB 5FQOA 3ROGA 2B1GA 3W9SA 1DS6A 1HLPA 1O94A 2C96A 1WDKA 4C4AA 5BN4A 1RWNA 2VAMA 3PNVA 1XDWA 1E7WA 1NLMA 3HWSA 3VZDA 1C8BA 5IF9A 1ZUNA 3LIIA 3VR6H 2W93A 1DKOA 3OPMA 4ZYXA 1W8IA 1ZICA 4HF7A 2PLFA 3VYTB 1LCIA 3MRSA 1H05A 1XEAA 4U9UA 2P8SA 5D3KA 2VJYA 2ALJA 1Y1KE 2AOTB 3E9EA 5EG5A 3HWRA 4BMZA 3AKDA 3ZHOA 2VJMB 1KAMA 2B9VA 2UVPA 4D3FA 2Z4RA 2HNBA 1XRMA 1V4BA 5BQFA 5AJTA 4Y0AA 4FYWA 4UHBA 2OO7A 5FKJA 1MUUA 1VJRA 1D9XA 4ERXA 5DCLA 1PVDA 1VI6A 1Y0BA 1C1DB 1MTZA 2ZJ4A 2O7SA 2MDTA 4F3KA 3UFBA 2W4QA 1ADCA 1VPVA 2OZLA 3B53X 1UINA 2BFDA 1WXWA 3BJRA 2P9ZA 2HLHA 1J33A 1SCBA 1PJCA 1ABEA 2AJLI 3CUSA 3H5NA 3NHMA 4JHXA 3RK0A 4A82A 1JNYA 4H2DA 1E2KA 3D6MA 4HI0E 3OKAA 3T7RA 2WD8A 3KQHA 1MJNA 2HRQA 3HDJA 1DB3A 4JYBA 4QYSA 5B7PA 5A3RA 3KJIA 3FCXA 3VFDA 4LV8B 4B2LA 2W6ID 4OB6A 4JJAA 2QRZA 3SC6A 2PZLA 2JVKA 2PMCA 3H5LA 2FJUA 5KWIA 1LJ8A 5DYTA 2I1VB 1UFOA 1DIGA 1QHGA 4OL0A 4ZVNA 1YGYA 3QVLA 1UP6A 1BJTA 2BGIA 2FPSA 2P65A 4AF7A 5K2OA 4Y6GB 3PSHA 3HCPA 3HI4A 4C21A 4UJ3A 3EH2A 1UL1X 4CF7A 3KAKA 2O2GA 4LNUB 2F3PA 2VVTA 2OD2A 1UFQA 1IN6A 2FR0A 3R77A 4PY2A 1LPSA 1GVHA 4QNMA 3TW0A 4BQFA 3HNPA 1FRFS 1QR2A 4JJ7A 3V8BA 1M1YA 1WXQA 1GDDA 4AUKA 3VKGA 2GN2A 3EIOA 1ZGGA 4I1RA 4PNZA 1Z17A 2QNRA 3EPLA 1Y63A 1O97C 2GVZC 2OCIA 2WWXA 3BXFA 3LY9A 5AVKA 4D9IA 1QH1A 3AR7A 1TM5E 1AC5A 2NUPB 3AHHA 1DZIA 1HV8A 4QECA 3WK8A 3QTTA 2OHIA 4QELA 4O3MA 1MW9X 1OAOA 2I7DA 2C00A 3GRKA 4G5QA 3W3AD 5KCZA 3VZBA 2HDNB 3OG9A 1GYRA 1B16A 5K8UA 4QLAA 3ZLVA 4W63A 2ANCA 2FWIA 2GPBA 2P78A 1C1XB 3ONFA 2WAYA 2YN4A 5KTOA 4HO1X 3LUGA 1MXHA 4KGZA 1ZH8A 2A94A 3R5TA 3U7EB 5KTKA 2ZRNA 4JSTA 2QUJA 3JQAB 1VE3A 3JYQA 3N05A 2D0OB 5KWSA 4D4JA 1JHVA 1QO9A 3BAZA 4AYTA 1IN5A 2PH7A 2XCQA 3RF7A 3VPCA 4N76A 3RVLA 1LW6E 2C77A 4QODA 3A9WA 3ESQA 3ZW7A 4MWEA 1YTLA 1USGA 5E0KB 3ZHXA 5IS2A 1N8SA 1D7AA 3OA2A 1U9JA 1O2DA 3G02A 3CZCA 3IP8A 4M0KA 3KQMA 1D4ZA 4KUGA 2WTBA 1VMIA 2XYPA 1C9KA 2Z1MA 4ND4A 3TW4A 3HP4A 3KZKA 5K05A 3FWNA 2GX6A 4IDNA 4YJDA 2WWTA 3OWOA 2K7FA 1EBUA 1DJOA 1O95A 2H1OA 3AJ8A 1G2IA 2HDHA 3C5HA 3MGBA 5TQ0A 3NBFA 3CR8A 3FPEA 4PNPA 3RABA 3TOXA 1UBOS 5C32A 5KYYA 3UXHA 1EXDA 1VKOA 3N7UA 4TVBA 4DCPA 4F3NA 4RQBA 4CW7A 3AI2A 4IWNA 4G8JA 4DLZA 2NV6A 2JIQA 3PD7A 4TROA 1ESMA 4YIKA 5AUNB 4N8SA 3TLZA 2I4OA 4Q3DA 1PJZA 1RWKA 1BEUB 2CLCX 1JALA 3IESA 3DG9A 3STXA 2CDRA 4XIGS 3OT4A 1IPFA 1M1NA 4OKNA 3GAFA 3SIWA 3H9JA 5FWDA 1E2BA 3G8AA 1EZ4A 4FT4A 3UUEA 4PZPA 3GELA 1KC1A 1PSZA 1SHZA 1XLTA 1TQ8A 1ZOPA 2C98A 4UVEA 3B82A 4WK0B 3VBEA 1N2EA 3IP9A 2R47A 1QH8B 1H5QA 4RZSA 1XN1A 2DJ5A 3LLMA 4OKIA 3IMEA 3IJRA 2WUWE 3B9PA 5ALWA 3BMNA 3RSCA 1SKYB 4X41A 2OCAA 2W43A 4HYYA 5DCYA 1PLJA 2FPKA 3ILSA 4G1BA 3QYAA 4CRWB 1VIAA 1YCGA 2JK1A 4O29A 1QTQA 1F3OA 3ZJYA 3CX8A 3T3OA 2QVCA 2PSFA 4DCSA 4EHHA 3MYRA 5KJCA 2OECA 3ANYB 3U4QA 3JQFC 5JD5A 1MB3A 2ZQZA 1E8DA 3HU5A 3IQZA 3T4PA 1SBHA 3DV2A 3DKKA 4IIHA 2WWWA 4X62B 2F8MA 3QWAA 3ZVMA 2QX7A 1CDOA 3WG9A 3KSAC 5THXA 3ZGNA 2HQOA 3F98A 3QPAA 1AG9A 1R6XA 4KYIB 1XVUA 4Q37A 4ZCPA 3VV3A 3ZLJA 4BB6A 3TLGA 3UY4A 2VAPA 4D6XA 4Z9AA 3WWOA 1QVVA 4MQBA 4A23A 1QAOA 3G2PA 1Z0UA 2Q5JA 3HUTA 1K7CA 2YRXA 4A6DA 3TZCA 1TAUA 4TTTS 5BN1A 5AUPB 4UXHA 1Q3HA 1FP2A 3ND6A 4X1YA 4JLPA 3TDKA 2HIHA 4L7QA 5FH9A 3GFQA 2YKGA 2NU7B 1W5FA 3GLSA 1QRTA 1KZ4A 3DFUA 4V0QA 1A3CA 1GD1O 3TW8B 2ECFA 2PL1A 2YIJA 2ERXA 3KD3A 1XV5A 1U2EA 5JNUA 1PT6A 1TEXA 2IYRA 3H2KA 2P5UA 3OTWA 5T4FA 3TLJA 3I6ZA 1ZSVA 5DB4A 5EJFA 3WXBA 4I1PA 4C0XA 2GPWA 1VCHA 1C4KA 2O23A 4Y1EA 2JLWA 2N9UA 1ULHA 3OCJA 4JC0A 4YECA 4FE7A 1WW3A 2GPYA 4MQ6A 2WIKA 1QIJA 4JUFA 2GILA 2PDAA 3DKVA 3HVIA 3D7RA 3WV4A 2GTHA 3ZVKA 3KKMA 2NXJA 4KQ2A 2WA1A 5BVGB 2RBKA 3VC3A 3DEJA 2QM0A 3ZY5A 2DSNA 3B3JA 2QXUA 5CT9A 4BTEA 3RUIA 1QR6A 1F51E 3ZYCA 4IZOA 3HP7A 3T15A 3U13A 2R4TA 2GBGA 1ACMA 5ESRA 1A97A 3DL4A 3HJCA 3RVNA 4DYHA 2WQ7A 2VCYA 1NC1A 4DIBA 4GNRA 3VZPA 1KOGA 1UIMA 2HIGA 2P4UA 5EKXA 4CIAA 4GZ3A 4EB3A 5JNWA 4YJ2F 1XK6A 3U6KA 4I5IA 4NZMA 3FIUA 3QTLA 4YJ3A 2DUMA 1NLZA 1CUEA 1QRDA 1NYLA 4JQYA 5P21A 1QLHA 2IPNA 2CLMB 1RXYA 2PGIA 2QTFA 5FR2A 3M1LA 2XECA 2A5YB 3WHLA 1FNCA 1NV9A 2B92A 2NN3C 5JE8A 4A5OA 1Q12A 3G2QA 3ZDFA 1QU3A 5LP6F 1A77A 3QW4B 4KPUB 4H0CA 5K0FA 4CM3A 1HDYA 4PF1A 1VE1A 4HDMA 1AHNA 2GLUA 3GYGA 4TV8B 3ZNQA 2MSDB 1RM3A 3KKZA 4PAMA 1OXVA 6Q21A 1SVIA 3DHYA 1T4MA 1T9KA 2NAPA 3RU2A 3H5VA 5H68A 1MN6A 3VUFA 2JAWA 3IEXA 4L4SA 1SUEA 4QO7A 4GWKA 1KVSA 2WZBA 1N3IA 4OQQA 4KE7A 4FP9A 2PQ6A 5BN5A 1I7DA 2QTBA 2R8ZA 4CE6A 1YMVA 1K3UB 3V42A 3KHUA 1IATA 1WZCA 5LBTA 3V2GA 1U1FA 2AN1A 1NKTA 2NNLD 3EEQA 1XQYA 3ANLA 3DL0A 3EULA 3IP5A 4B87A 3BXPA 3M1AA 5IC4A 1KMHA 2JFFA 1C9DB 2DTDA 3SSNA 2CLKB 1YTUA 4Q9KA 4DJTA 1ZM2A 2N1BA 3FR7A 4QPZA 4F5YA 5KIAA 1JTEA 4DC0A 4LOHA 3RUAA 1Y1SA 3Q8MA 1GV1A 1PLLA 4HQNA 1YIAA 2FDRA 1XTRA 1MX9A 3WRVA 4OLFA 2C83A 5EI5A 5A5FA 5HA5A 3R5KA 4EMTA 4IDAA 2EX1A 4RL4A 4AJNA 5I7VA 3FYHA 3U09A 1R0LA 4D9NA 1M33A 4KAFA 4L16A 2R7AA 1QZ3A 1Y1LA 1WXIA 1Z39A 2FQYA 3PZBA 4E46A 1VJ0A 3MOSA 5FHRA 2X4GA 5J4VA 4Q9JA 1IUNA 4H60A 4RLQA 2QMHA 3QFSA 1YCDA 3U3XA 1ARZA 4WXMA 4DR4B 1IM2A 4O1HA 3MLBA 5A5EA 1OXSC 1RSZA 3NOQA 4RIEA 3HTXA 4UD2A 2JG3A 4UNRA 3WDKA 4TMVA 4GZLA 3FYSA 3NZEA 3FPGA 4H0FA 2G76A 2VTVA 5ENDA 1SAYA 3MWFA 1O1YA 4DC1A 4V1CA 2CK3A 2OYSA 1V8PA 2WK1A 2NZXA 4CG1A 3RROA 3HHEA 2GNPA 3T0GA 5KVVA 1UMDA 2V58A 3MIIA 4KLNA 3AP1A 2ZIVB 2FZGA 3CF6R 1WPQA 3CLRC 1OMOA 4P83A 4UREA 1CYDA 4YP6A 4BOYA 3SJZA 3KB6A 3PFKA 2H4ZA 1E99A 2G7ZA 2EVWX 2PE5A 1ZMOA 4Q1EA 3TIXB 4RPJA 1RC0A 1XTZA 3A11A 4H15A 3KAJA 1PDVA 4IIJA 4Z0PA 3NYWA 2IUFA 2VF4X 2QZ4A 4JI0B 3C4VA 4CIBA 1BH2A 3CB4A 5K8TA 1YV9A 2YRWA 3H4TA 3IBGA 3OM8A 4JJZA 3QBVA 4E6PA 5HQ3A 3FDJA 1DAGA 3C85A 3OQHA 5DEIA 4RTJA 4LF7B 5FTWA 3IVRA 2WA2A 1N57A 3N8DA 1A5BB 1DTEA 1GPAA 3R20A 3EQ8A 3W1EA 2P69A 2YHUA 4BU1A 1Z3CA 5LYJF 2I54A 4QBIA 4EO7A 5BQXA 4ZT4A 5CDUA 2MSLA 2XXJA 5EMLA 4OH7A 1P1CA 1P4JA 2VDWB 3C8ZA 3U9LA 2Q46A 4JP3A 1QWOA 1GQFA 5JZSA 4LXQA 4QA9A 2PHZA 4JN6B 1ZVMA 3JXEA 3RSGA 1K8YB 4C7XA 2GN8A 4C0BA 4EECA 3LP6A 1IEQA 3IB6A 3PFWO 3TOSA 3D7KA 2ZYSA 2XQIA 1XTQA 4QOIA 2FG7C 3K0FB 3O4GA 4U2DA 5TLSA 2W8ZA 5IEBA 1MZVA 2O2EA 3K31A 5A5GA 3PKIA 5DIZA 5AOVA 5LLSA 1L5OA 2ZPAA 1JZSA 3F3KA 3I8XA 4Z86A 2G40A 4G56A 3LKVA 2QMYA 1B6TA 1K0UA 2VP9A 1NNLA 3V34A 2A0FA 2X1MA 4RF4A 3VJMA 1L5MA 4CWAA 3AONB 1PDOA 3LGSA 4JCOA 5KDDA 2GRAA 2PKRA 1NRWA 5D2CA 2Q4EA 4BJ6A 1UPTA 3A6ZA 4HFRA 2O7QA 3UCFA 3L7KA 1YFJA 4WPGA 4F56A 5L4LA 2IZ5A 2DECA 5EIBC 1OIXA 2FEWB 3FMFA 4XUGB 3QWFA 1ONNA 4EJMA 2GBFA 3DJYA 5DX8A 4TTQA 3PA8A 4CQMB 1P0QA 3D6FA 2RHOA 1AS3A 2X40A 3EXG1 1VCIA 1FUEA 1YOVB 4IDBA 4I4TA 3B6ZA 1Y33E 1YR7A 2QSJA 3SYMA 2P1RA 5C8ZA 4OBWA 2VT2A 4Q7EA 5CA0F 5DW3A 1A4RA 1XKTA 5AVWA 3KPJA 1CJSA 2EGGA 5D5QA 2WWVD 1X6VA 3S1LA 4XXHA 2H2WA 1GQRA 5F51A 1ZVJA 5BNIA 2H1SA 3LK7A 1S3FA 4UASA 1HRDA 1TM1E 5LNK1 2RAVA 4F2DA 4B8WA 4GDFA 1JDBB 3NIGB 5DN6A 1FDOA 4RIHA 1WDWB 4YP5A 3VO8A 3K96A 1JHQA 2VT7A 3E82A 2HBRA 3GWZA 3PRKE 1FPQA 3RGWS 2WUEA 4DLAA 1HSZA 1FYWA 1LVHA 5BW4A 3JQRA 2QLLA 3IQIX 2BELA 1WKBA 1RAGA 1PGPA 1U7XA 4R2WA 1N2SA 4B31A 1LEHA 4NL4H 4GRDA 1G6Q1 3IDFA 3AW8A 1KXJA 2OGSA 2VH2A 1K89A 1J90A 2E21A 4Q93A 1WDTA 4NFYA 2QM7A 4RZ2A 5AW7A 3LQ4A 2E0IA 4IYJA 4JP1A 3RAPR 4Q4LA 4MEAA 1OI3A 3QU5A 1H1DA 1P3JA 4DBVO 1S1CA 1TYAE 1SIUA 1LY1A 3IBCA 3SOZA 4YAGA 3F73A 5JR3A 2A0XA 2X9GA 3K92A 3HKEB 5C8XA 4KAAA 2ADFA 2O3SA 3EPHA 3N39C 1RAFA 1K7FB 5HZKA 2YOHA 1XJ0A 1JZTA 1M83A 2GWRA 4FWTA 1TYZA 2A86A 2H06A 2A1IA 5HS6A 4EPXA 1CW2B 1BQ3A 1D2NA 2FWMX 3GZ4A 4MWDA 3SJBA 4AO7A 2ZBVA 2ONZA 2PKYX 5TC4A 1UC8A 2OAEA 4BGIA 3C8UA 9MHTA 1GARA 3WMFA 3P0HA 4FCCA 4M54A 3CN7A 5FOWA 3P45A 4GPD1 3DMRA 3GFSA 3JYPA 4RPLA 2CFOA 2ZRCA 4BZPA 2DT5A 2VRBA 3UMSA 4CR8A 3BIXA 1JWLA 2JEOA 1IEXA 2FMKA 3CKKA 1PFYA 1ZGCA 4MVJG 1LPPA 2OBMA 1LPNA 4M1EA 4PGHA 1MO2A 1TE2A 1MOQA 3OFVA 1Y6RA 2PX8A 3GLVA 3L8CA 2EZTA 2O48X 3AEYA 1QM5A 2PYZA 3IV7A 1QGUB 5EUQB 4YCLA 3RYCA 4ZC8A 3K09C 2VQ6A 4LRTB 1FXSA 3ZCRA 1SRQA 1UMKA 4KE8A 1G1AA 1ZJ4A 1KPGA 2X8BA 4ASUA 5B12A 3U44A 3STHA 3ADKA 4PSVA 5LB2A 3WYGA 3PDJA 3FY4A 1LNZA 2FSFA 3A36A 1LWOA 1KOFA 1PCXA 5EE0A 3NHKA 3Q1LA 4LRSB 4TQAA 4ZWNA 4ML3A 3RBAA 1R5JA 4RPIA 1W94A 1PR4A 1VA5A 3R3UA 2XQGA 2VPZA 4E32A 4DTCA 1YA6A 2O3JA 5CYGA 1U3TA 4US0R 3R74A 3OF3A 2VYVA 1GZVA 1K1EA 1QO7A 2O0MA 1DO0A 2Q3HA 5AXDA 5JANA 1XN4A 4F1WA 4EVIA 4NYJQ 4NCKA 4F96A 4GLJA 3OE7D 1BN7A 4IQFA 5FRDA 5BR7A 5K45A 3GLKA 2RI1A 2IEZA 3DFFA 1KI4A 3TX2A 4V0OA 4BBAA 1J23A 5CFOA 3V1UA 3MUFA 2QJOA 7AT1A 3IJPA 1AKUA 2FR1A 4W7IA 4EYGA 3DQPA 2QN7A 4QPPA 4WQMA 4YRFA 5HKBA 2QF7A 4IF4A 3VR3A 2GWHA 1CF9A 4MINA 4AJJA 1WXHA 1CX9B 5E9WA 4C3VA 2I3AA 1YC2A 4ER7A 3KG2A 2CXRA 1WETA 4L95C 1ZLXA 2FFAA 2EJTA 3QA3E 4IILA 3TAHA 5I4KA 1WZ2A 4INOA 3ZI7A 2VP4A 3PQFA 1VE5A 3IURA 4GVPA 4R4JA 2V7UA 1FS4A 3EQ6A 3SNKA 4D0GA 1QVWA 4Q01A 1NW6A 3L4JA 3OPYB 4U63A 2J0UB 1CPYA 1VG0B 3EE6A 4H08A 4BDSA 4DT1A 3EX7C 1L2TA 1M76A 4ALKA 4P92A 2ID9A 2IELA 2Z2IA 4PX2A 2CNKA 1PYDA 3M3PA 2VAXA 2ZBQA 2VHZA 1WOMA 4XWAA 3S0JA 1YI0A 3IHLA 3V46A 2IPAB 1PWEA 1RBQA 1MDFA 3I72A 4HZIA 4TXHA 4DLRA 1KDTA 1GN9A 3FNIA 4MB2A 5ICEA 3PTAA 4DMRA 5BMOA 3LQQA 4CN9A 1GLGA 1L4FA 1PF7E 1TC1A 2XLBA 1SC3A 3O73A 4RHTA 1DT3A 4FYJA 4TSFA 4QJIA 4V39A 3E3MA 3TKLA 2KYRA 2WFLB 2PD6A 3FMVA 4B6RA 4D4LA 1COWA 5AXBA 3IUJA 1VI5A 1XZHA 2ZFUA 4JASB 3S1SA 1QG2A 4OG2A 3Q6NA 1F7UA 2ZUVA 3BGIA 2C9YA 3JYNA 5DNEA 4OLAA 1YDFA 5T3YA 5DSZA 5EP1A 3ZHYA 4FGSA 4W9MC 3DWGA 3FAZA 2ZREA 3HCWA 1GTG1 4LY6A 1Q6ZA 2OXTA 3TW6A 5JT1A 4L4RA 3CH6A 1Z75A 2NU8B 3D5QA 4DV4B 3CH7A 4Y2PA 1XRRA 3TEJA 1P74A 3FH0A 1W88A 3PZRA 1Z16A 1DKLA 1QRRA 1SKQA 4LZLA 1JXAA 3BQ9A 1Z6YA 4J4HA 4YROA 1DXQA 1RQNA 1F60A 2O14A 2PYDA 3I6BA 1JP7A 2XCUA 5DNVA 1LLQA 2RAFA 4JJ6A 4F5ZA 1FTYA 2PMWB 2X13A 5E2IA 1WE2A 2R25B 2B69A 2DMRA 3OT1A 4YV2A 2J3LA 2X2EA 1RD4A 3MZ0A 1NLYA 2ORWA 1JWAB 2CUZA 3PFFA 4O2BF 3V48A 4YCSA 1W8DA 1A2OA 3BGVA 3FHOA 3HDVA 3P9NA 4NNOA 4NV0A 4RD4A