4QGLA

Acireductone dioxygenase from bacillus anthracis with three cadmium ions
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
174
structure length
174
Chain Sequence
GAAAMAQIRIHEVNTRIENEVKVSKFLQEEGVLYEKWNISKLPPHLNENYSLTDENKAEILAVFSKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEGKDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acireductone dioxygenase from Bacillus anthracis with three cadmium ions
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords Acireductone dioxygenase
total genus 51
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.53: Acireductone dioxygenase (Ni(2+)-requiring).
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qglA00
3MPBA 4Q0PA 4HZFA 3SMHA 1QY4A 4XFCA 4XFFA 3U0ZA 4KWJA 3WW4A 1DZTA 3FZ3A 5E1RA 3RZZA 2GH2A 2ET1A 3HQXA 4ORFA 3IBMA 3H1YA 4IEPA 1U12A 2GC2A 4KL1A 3CJXA 3UKVA 2XLAA 1ZZ7A 4YNIA 3RDIA 2FQPA 3EHKA 4MH0E 3PVBB 2ETEA 2XL7A 3LOIA 4XF9A 4IETA 1DZRA 1J1LA 1O4TA 3LA7A 4Z82A 4YARA 4PIZA 1XE7A 4QM8A 4BIFA 1WA4A 1NE4A 2ZCWA 2OYZA 1J3PA 2D5FA 4DINB 4XEZA 4YSFA 5FPZA 4KU8A 5I0UA 1LRHA 4MGYE 4N9IA 1VP6A 4AVBA 1ZRFA 5LRRA 4ZU4A 2PQQA 1O3SA 2QCSB 4H7LA 4OFGA 2BNNA 4D7TA 1CGPA 4J1XA 1GQHA 3PLQA 2WC2A 3BCWA 5EFUA 1IPKA 4WVZA 4YRDA 4HMZA 1G6NA 2VPVA 4UBGA 4MGKE 2EA7A 3MZHA 1CAVA 2BNOA 4I2OA 2DCTA 4K8FA 4E2QA 1YUDA 2IXCA 3S0MA 2VQAA 3DKWA 4ZU5A 3SXWA 3O14A 1CAWB 2XHKA 4QMAA 5FCCA 4ONUA 2IXKA 2PAEA 4HVQA 3E6CC 4Q29A 3ACLA 5F1RA 5CADA 3D0SA 1CAUB 5CU1A 3E5UA 5EZWA 3FJSA 1ZZ8A 3MYXA 5BXXA 4JTNA 1LR5A 2XL9A 4LLOA 4TLFA 2XLGA 1EP0A 2GC0A 2IXIA 2PFWA 1EPZA 2CGPA 4A2UA 4I0AA 4PJYA 3NW4A 4WBBA 3DV8A 4IERA 2D5HA 2VECA 1OMIA 2GC3A 1ZRRA 2F4PA 3FX3A 2WFPA 3G7DA 3IIAA 5KHIA 1O3QA 1QXRA 3M70A 2P17A 3H50A 3MDPA 4MUVA 2D40A 2PTMA 5FLHA 1OI6A 1V70A 4LUKA 2PAKA 1XRUA 1DGWA 5FPXA 1Y3TA 2B9UA 3E6BA 3RNSA 3HIFA 5I0SA 5KBFA 1HW5A 1H1MA 2Z69A 2QJVA 3BALA 4AXOA 3HT2A 4HSJA 1I5ZA 1O5UA 2H6CA 3BB6A 1VJ2A 1YFXA 3B02A 5C6CA 2BEOA 2CAVA 3LAGA 1YHFA 2XKPA 4QM9A 3CF6E 2Q1ZB 3FWEA 4IEQA 5BY5A 4Q0QA 5AVPA 4FAHA 5BV6A 1VR3A 1OFNA 4X6QB 4HVRA 3H1MA 2UYBA 4I02A 5E16A 4UBHA 2H6BA 1ZREA 4Q0UA 2CAUA 1J59A 5FQ0B 4B29A 1ZZ6A 3E97A 4HN1A 4AQ2A 2GU9A 4XF0A 4EV0A 2BYVE 1IPJA 3SHRA 3GBFA 4PIXA 2O1QA 4IEZA 4XFIA 5LRSA 5J3UA 1J58A 3E5XA 1Q3EA 3UKTA 5J7MA 1CAWA 4JV4A 1H1IA 4JTOA 4IEWA 3WW2A 1GQGA 5I0RA 4R52A 3PNAA 3RPQA 1ZRCA 1YFYA 1UPIA 3IDCB 4QGNA 3ST7A 2K9ZA 2I45A 3NKTA 4X6RB 3JZVA 3KGLA 1X8EA 4RD7A 1CAXA 3KMHA 3OD0A 2IXJA 2Q0AA 3CEWA 2BGCA 2B8MA 4IEVA 5CVRA 3CLPA 1O5LA 4EROA 3ROUA 3KGZA 4QGMA 3BU7A 3CL1A 4NVPA 5FLIA 1ZNPA 2Y0OA 1NYWA 3SCFA 1PMIA 3U11A 2BNMA 5JSRA 3NL1A 4OLLA 4I09A 1UCXA 4IEXA 3H9AA 4ZU7A 5JAXA 4YYOA 4L11A 1J3RA 5KHHA 2Q4SA 1XE8A 4XF3A 3TNQA 2PYTA 4XFGA 1EY2A 5KHJA 2PHLA 3LA3A 4KWKA 3S7IA 1NXMA 5LEJA 2QNKA 4MGZE 2EVXA 3WW3A 2B5HA 5BPXA 2MNGA 4KU7A 3ELNA 4XFHA 1UD1A 5BUVA 4D7SA 3QACA 2QVSB 3EO6A 3H7YA 5K8SA 4AQ6A 2UY9A 3OF1A 1YWKA 4I0BA 1Y9QA 5FLJA 4PIYA 2EAAA 5C8WA 2OZJA 4Q0VA 4AVAA 3NSTA 5FQ0A 2MPFA 1QXJA 2HJIA 4HBNA 1RL3A 1Q43A 2XGXA 3L2HA 1O3RA 4J1WA 4E2GA 1X8MA 1RC6A 2UY8A 3ES4A 1CAUA 3SCHA 4XETA 4EWAA 4LA2A 1ZZBA 2ET7A 1ZX5A 1TQ5A 3ES1A 4META 2V09A 4UXAA 1ZZ9A 2FMYA 2PAMA 4EWDA 3UKNA 4HN0A 2UYAA 3EQEA 5LEKA 2XKOA 3EBRA 1CAVB 4CYDA 4XFBA 1SFNA 2XLFA 1O7FA 4Z07A 2HKXA 4LULA 2PA7A 4E2SA 4N9HA 1SEFA 3NJZA 1WGPA 3I7DA 4LEJA 4BYYA 5FDBA 3RYRA 3I54A 5KHKA 5JR7B 1ZRDA 1J3QA 2IXHA 3OGJA 3GYDA 1NZCA 3VHRA 3ZDSA 1RUNA 3H7JA 2ZKLA 1CAXB 5I93A 5KHGA 1X7NA 4QGLA 3H3ZA 4FT8A 4I01A 4EWEA 1WLTA 1RGSA 4LA3A 3S7EA 1OD5A 2GC1A 4MX3A 2OA2A 2N7GA 4LTAA 5JSOA 3D0JA 1ZZCA 2E9QA 4F8AA 4MGIE 4MV2A 1YLLA 3USSA 5I91A 5D1IA 1UIJA 2CV6A 4AVCA 1RUOA 1JUHA 4XF1A 2IXLA 4KWLA 4HSLA 4O9GA 3E6DA 2OZ6A 1CX4A 2Q30A 3IDBB 3TNPB 1YFUA 3ETQA 3LWCA 3I59A 3OCPA 3M3IA 2QDRA 3RYKA 5J48A 3HT1A 3I59B 4WZCA 1O3TA 2PHDA 2GAUA 4IESA 4FBFA 2O8QA 3BPZA 3C3VA 3CO2A 4R8HA 1I6XA 1QWRA 3E5QA 1FT9A 1Q5OA 4IEOA 4XF4A 4F7ZA 3RYPA 4Q0SA 2GZWA 1SQ4A 4L2NA 4FAGA 1NE6A 4BHPA 4GULA 4O9EA 2MHFA 3DL3A 3WW1A 5I8SA 3R6SA 1DGRA 1EYBA 4IEUA 4QXKA 2Z2SB 1FXZA 3QOPA 3N4MA 3DN7A 4XFAA 3D82A 3H3UA 4LUMA 1UW8A 1ZVFA 2H0VA 2K0GA 4I3PA 4HVOA 1LB2A 3H1WA 4HLTA 4QX5A 5I8TA 4MZUA 3FHIB 2C0ZA 2OPKA 4BH9A 3IWZA 4JVAA 2KXLA 5I0TA 1X82A 1LKNA 1RTVA 3EJKA 5JSPA 1L3JA 2ATFA 5JCTA 3FFQA 1UIKA 3U10A 2D93A 1PM7A 4P9GA 2IC1A 3H8UA 3LA2A 3KCCA 4IEYA 1FI2A 3FE5A 1YFWA 3LZZA 3SCGA 3KSCA 5T3NA 5HI0A 3NVCA 5I8YA 3OTFA
chains in the Genus database with same CATH superfamily
2RMU1 3KVAA 1SLIA 3SMHA 1Y43B 1RUH1 3AL6A 1LHUA 1W05A 2ZKNA 1SCRA 3ZM8A 3U0ZA 5A80A 2K46A 1DZTA 4IV3B 4JRLA 5F32A 5JI7A 4NHYA 5CEHA 3B00A 4IEPA 5A6XA 5L73A 2GC2A 5IK8A 1PMHX 4AAXA 3N36A 1ZZ7A 4U36A 1ZA4A 1UU6A 2P3IA 4DRVA 5GKAC 1R1A2 2DUPA 2A3XA 4Y22B 4LO8A 4R4XA 4YM2A 1DG6A 3NKGA 1EPWA 3C8XA 3LOIA 4IETA 1DGLA 1O4TA 4QKFA 4PI0A 2DBNA 5C4WA 2YFZA 4BPZA 4B1LA 1J3PA 2C4XA 2D5FA 1JZ7A 3CMGA 2W91A 5DDJ1 1UQXA 4IL7A 4LPLA 2VL4A 1OXCA 4R9CA 3VDAA 4BDVB 1AJKA 1XXNA 2ZX1A 2EICA 4AVBA 1LGCA 3VZKA 4BM8A 4ZU4A 1LOCA 4DMIA 3CU7A 3S30A 2FDIA 1LOEA 1OBNA 1O3SA 1XYPA 5FZIA 3USUA 5ABJC 5LWBA 2ID4A 4GMP3 4BE3A 2QDNA 4H7LA 4OFGA 5FUPA 2VY0A 4PT6A 3JQWA 2XBO1 5FK8A 2JDMA 5FYSA 2WC2A 3BCWA 5JLVA 3MEPA 5EFUA 1S0DA 4LO5B 2WO1A 1CR7A 1YQCA 4XC9A 3MIHA 3HR9A 4AFDA 1E57A 2DVBA 4P5HA 3RZGA 1R081 3KV4A 1TMF2 3K4ZA 4CCNA 3VZNA 5C33A 4TYSA 2RS13 4Q1RA 5FBJA 4QDQA 2XWBB 1GWLA 2BNOA 2WS91 4CVUA 1S2KA 2HBUA 4K8FA 4KBBA 3TAYA 1H9PA 3S0MA 2VQAA 2XPJA 4BQWA 1PZ9A 1UKRA 2DCJA 3WT3A 3GZAA 5CFCC 1QQP1 5CBLA 4YVWA 2CY6A 1RHI1 4UI9L 5FP9A 4QX7A 5FJKA 4IQPA 3ZDVA 4IGOA 3AP7A 3D5OA 1RMU3 4DXZA 2P3YA 2D97A 3WQBA 1SBEA 2ZGSA 3E6CC 5FYHA 3ZYFA 4YVSC 3ACLA 1H1AA 1RUH2 2A3YA 4AVSA 4K7JA 5FO8B 4OQ9A 3D0SA 4GKYA 1CPNA 5DG1A 1YNAA 1D0HA 3I8TA 2WIIB 3JBG2 4OULA 3VHOA 1UOGA 1WD3A 3I3DA 2JG8C 1VAVA 2YFUA 4JTNA 3IB3A 4MGQA 1QHDA 5CISA 2XL9A 4WM7B 4WVVA 5CG8A 1EP0A 2QQKA 4E4DX 5FZAA 1QJZA 3ACIA 3POWA 1GSLA 2W1QA 5APAA 1YQ8A 1EPZA 1V6OA 1H8VA 1T6BX 2PHRA 1RINA 2DTWA 4A2UA 5C8CB 1OFSA 3LDBA 3NW4A 5FYYA 2EALA 4FXKB 3PUSA 3WF0A 1JOPA 1Y9GA 3RZJA 3A22A 3VBRA 1YRZA 2OXBA 2R073 2VECA 2VUCA 1QXPA 4A6OA 1OMIA 2GC3A 1SHWB 1ZRRA 2F4PA 4LOTA 3IIAA 5KHIA 4OQ8A 3BUCA 1O3QA 3AZWA 1F5FA 3M70A 5F9TA 3CQOA 5FZOA 5TSWA 3H50A 4AYUA 1BYHA 2Y6GA 4P00B 5FZHA 4MUVA 1UY0A 1Q56A 2HEWF 5JOZA 5B4NA 5L19A 2WA3A 1OI6A 5A3MA 1AR61 2Y6FA 3A7QA 1C28A 2XOMA 3POBA 2E51A 2YC2A 1ASJ1 4YG6A 1DGWA 3WHTA 4AK3A 5JUVA 5AVAA 4B4RA 4LBQA 2XQRA 3ENRA 5LY2A 4BA6A 5I0SA 1AR82 2BVBA 1HW5A 5T5PA 2Q8EA 3T1MA 2QJVA 1D4M3 2Y26A 1YI9A 3VDDB 4BISA 1I5ZA 2ORZA 4QU1A 4DY3A 1O5UA 5FMBA 4IV1A 5CKNA 1RUF3 4AQSA 1GQPA 1JYTA 3N7JA 1JBCA 3CF6E 3IMNA 5AC91 5CAZA 1MZEA 1OA4A 2VZSA 3B5LB 4QX8A 3O1VA 5FPLA 5JZGB 3J7LA 4OMDA 3ZMNA 3ZFGC 1XYNA 1RUC2 3Q8BA 1OFNA 3HVDA 5F3EA 1CWPA 4XDOA 3UYJA 2D43A 1H9WA 2W1SA 3OPWA 3LPGA 3H1MA 3PVNA 2HH9A 4LO6B 3T2PA 2PHWA 4XDQA 2P3KA 4Y4YA 3AL5A 5DXDA 1CESA 4IXLA 1R083 1S4CA 3A4UA 3E97A 3J8F1 1BK1A 2RS11 5FZFA 2GU9A 5DMYA 2BYVE 1ONAA 3ME2A 2CDPA 1W9SA 2VH9A 2O1QA 1PK6A 2VNRA 4PIXA 5HXMA 4I3GA 2WFF2 1SLBA 3JBG3 1CVNA 3KLSA 4FPGA 3ZFGB 5J3UA 3O1RA 4E4SA 2V4VA 3ILRA 4NIGA 1DZQA 3DPRC 5FXWA 2GNTA 3GJAA 2JD4A 1CAWA 4JV4A 1ND2A 4JTOA 4OCTA 2V5YA 4DFSA 1REEA 1VBB2 3PVOA 1A34A 1PGSA 2IWGB 4LBOA 4L99A 4R52A 2OUHA 2VNGA 3PMEA 4EN6B 1QU0A 2ES3A 5FY0A 2WBKA 4CDXB 2FCUA 1YFYA 4GH4C 1C1FA 1RUI3 1V0AA 2B7YA 1OURA 2GMMA 4QPIB 1WMEA 3ZFFC 3NKTA 4Q4Y1 1OH4A 4AQTA 1OLQA 4YZ2A 4YGCA 5E6HA 2A6ZA 2E7QA 2ILMA 2ORXA 4JRAA 1VE0A 2WABA 4RD7A 4GAZA 4NHKA 1PZ7A 1S0GA 4Z2WA 1KGYA 3WNMA 5IT6A 1IS3A 4RL7A 2YPDA 4IEVA 3CEWA 1MS8A 2B8MA 1HXS1 5EWSA 5CVRA 2D44A 4QKNA 3CLPA 2VULA 2R043 1GZ9A 5IHRA 3N7KA 2ADDA 3OUHA 4BQYA 2E31A 5FYTA 4ITCA 3OUIA 4NVPA 1ZNPA 2JG9B 1APNA 1S0EA 1D4VB 2A6YA 2Y0OA 1NYWA 5GZGA 1PMIA 3U11A 1QJY1 1MS9A 5I8YA 1PNFA 5GM0A 2DCYA 1BLZA 3HWJA 3PJYA 1PGL2 3GZTB 5FWEA 3UNPA 4PLMA 2PLV3 4BLIA 1A8DA 1QJU2 2GN7A 1H0BA 4UW3A 1WMDA 4QX2A 3KV9A 5JAXA 1AXZA 4R4ZA 4CUAA 2C6SA 2AR6A 5JIUA 2WN3A 5GLUA 4PBOA 1UY3A 5A3LA 3PUAA 3SH5A 2Q4SA 3LKJA 1GBGA 4O65A 2FDFA 1H6XA 4QB1A 3IM0A 1W9WA 2WT1A 4NHMA 5A7WB 4A4AA 3KD4A 5KHJA 3LA3A 1NLSA 4D69A 1ZBA3 5DG2A 1NXMA 1AHSA 3A0KA 2QNKA 2YC4A 5LEJA 2DFBA 2P6CA 4NIAA 3VBHA 1LECA 3VD7A 2QQNA 2B5HA 3TBDA 1DGWX 1VBD2 4FPJA 1H8TA 2EAKA 2NMNA 5FY9A 1UZZA 2MNGA 2WNUB 3J7MA 4URTA 1AL21 1KD7A 3ELNA 2C24A 4LBNA 2RS51 4AVVA 1LULA 2E32A 5BUVA 2DVFA 1K3IA 2E53A 2WLQA 3EO6A 4CA9A 1OC1A 4FTEA 1CJPA 4JGYC 5ANQA 2XQXA 3THDA 2XJSA 4YW5A 5IVEA 1FYUA 4SBVA 1YWKA 4TZDA 2VAUA 1EUTA 1VRBA 2QTWB 2VMGA 4DS0A 3V64A 4RS5A 1XSQA 3LFMA 4JHTA 2HWF1 3MV01 2D3RA 4P02B 3WF4A 4BCUA 1A8MA 2ZHLA 4AVAA 5IYYA 3WCRA 1NA1C 1TVGA 4B4QA 2MPFA 3FHQA 4HL0A 2HJIA 4OI1A 3I3EA 2BOIA 1Q43A 3AKQA 2C1FA 4O61A 3WG2A 1X8MA 3BOPA 1IKQA 4AEDB 3SCHA 5FZ8A 3ZSLA 2VZ3A 1X36A 5A3OA 4D6QA 2RHPA 3NNGA 2P6HA 4EWAA 2VCAA 1LGNA 1BK0A 4D6RA 2JX9A 4ES8A 5CB7A 2CU5A 4LA2A 2LM3A 2B42B 4K8RB 5FXZA 2QQLA 4ES9A 1G9FA 4META 4Q4Y2 2EF6A 4QX3A 5DPNA 3ZXFA 1JZ2A 1CIYA 1ZZ9A 2WNUC 2PAMA 2BTVC 5IAXA 2JDHA 4UW6A 3GF6A 1GLHA 2GDFA 2F17A 2VZRA 2X53S 4HN0A 3WP3A 5LEKA 2RVAA 3EBRA 4GH4B 2WQ8A 4CYDA 3VD4A 4GMP0 3WDWA 3VKOA 2G4IA 2XLFA 1O7FA 5D8AB 2VZUA 3T2TA 1AYM3 1RITA 2HKXA 2VOVA 4LULA 1ND3B 3AP9A 5KC5A 3PU8A 4DNYA 4AZZA 2JEMA 4N9HA 4KH9A 3HQRA 4JDMA 4DEQA 4ZPIA 3DPRB 1XQNA 4L8QA 1TMF3 2WNOA 5FDBA 1RJ7A 3UGGA 2OUJA 2XJUA 5FYIA 2WZR3 3OPZA 1F2NA 1W8OA 1W6OA 3WF2A 1CONA 1OKQA 5J09A 1BBT1 3WNOA 4CRQA 1V9U1 5HCAA 3LEIA 3POEA 4XHBA 2OVUA 3VD9A 4NPLA 4BXFA 4CDWA 5T5OA 4KBZA 4ARYA 1OF4A 5KWRA 3H7JA 2ZKLA 3FLTA 3MIGA 1JYNA 5AFBA 3GJBA 1LU1A 5KC6A 1OUXA 4XUQA 1X50A 2ZMLA 2QQPA 5ANNA 4AE2A 1IHMA 3W59A 2QQJA 3ACFA 1ENRA 5A1AA 1YQ6A 3H42B 4LBLA 3H3ZA 4I01A 2R061 2Q1FA 1DLCA 2WYFA 1DCSA 1RGSA 5DAQA 3M1HA 3S7EA 4LHKA 5JR2A 3ILNA 4ZZ8A 1NT0A 2Q8DA 4P5YA 2AC1A 2GC1A 3RG0A 4MX3A 2TBVA 4UT5A 4E4ZA 5JSOA 2FD8A 3T0DA 1ZZCA 3O1OA 4DQAA 5IK7A 1C5HA 1SFYA 1O91A 5LZ6A 3USSA 4FTSA 2VW0A 5A7OA 3CHXA 1UIJA 2WNUA 2JDNA 1Q8QA 2W5FA 4LO4B 3UV9A 4E27A 1IS5A 2VGDA 1F35A 1C3HA 2A3WA 1RUC1 2IXLA 3RJRA 3AFGA 3QD6A 4O9GA 5CZKA 2HWE1 2V72A 4TWTA 1X33A 4XXAA 3ZN5A 5BNOB 2D6OX 3HN1A 5T5JA 1DYKA 4DB5A 4Q4X2 1Q8PA 4XBQA 4AFMA 1WW5A 3ACHA 3AZVA 4FPYA 4LBKA 3TNPB 1QDCA 4GALA 1NCRC 2AACA 3OCPA 4MHRA 1XNBA 3HT1A 2R0FA 5FPAA 3OBAA 5FV3A 2O8QA 3BPZA 5FFOC 3N9PA 4QPGB 4N8MA 5ACA3 1I6XA 1Q8VA 5L7OC 1QWRA 3E5QA 5C5TA 4TLGA 3GXUA 2PN5A 1TG7A 5F5CA 3NNFA 5F7UA 5JOYA 1POV0 3NNLA 1COV1 1AUYA 4L2NA 3WNLA 3WQ7A 5T55A 4XJUA 3MF6A 4CEYA 3NAPC 1ASJ2 4XMIA 1BEV1 1QH6A 4BHPA 2JIJA 5KR7A 1QJY3 1LOBA 1XSRA 3J4UH 1W2AX 1XNTA 4F83A 3R6SA 1DGRA 2EXIA 2WO3A 4IEUA 2ZACA 2Q8OA 2Z2SB 4XOGA 3VD5A 1Y7BA 3QOPA 5JXHA 1OOPA 4K21A 4YLZA 3DN7A 1S2EA 3D82A 3HN3A 1XNKA 4C91A 3PUHA 2CNAA 3JXSA 3LEKA 3VBOB 5A7SA 2XH6A 1H2MA 1YIFA 2BQPA 1YO8A 4HVOA 5H9QA 4AW7A 4HLTA 4KQ7A 5D8AA 4QX5A 5I8TA 1NX9A 1N3OA 2OPKA 4RR3C 4A45A 2O14A 3S5AA 5IATA 3V0AA 5JMCA 1PO12 2NN8A 3VBSA 1WA6X 1CZSA 1GP6A 2ATFA 1JHNA 2LTNA 2Z4FA 4FQZA 4L0PA 3RRDA 5FZLA 1VALA 2WZR1 3KCYA 2BP6A 2MEV2 4XMAA 3U10A 4A3ZA 5F37A 3WLUA 3I3QA 2YV8A 3GALA 3ECQA 1QOTA 1AR93 3H8UA 4Q4W2 2J1AA 2VBDA 3NV4A 1JU4A 3EB7A 1X9PA 3MFAA 1AR72 2YYOA 5FXVA 1TME2 4QPGC 3ZYHA 2JIGA 3KSCA 4GJZA 5C70A 1PO13 1U0AA 1C8M2 1W8ZA 3OTFA 1COV2 1Q8SA 4RGKA 3PMSA 4IV1B 1GUIA 1QY4A 3CJIC 4GJYA 5A7QA 4XFFA 4KWJA 4JAAA 3SEPA 5GZFA 4RHV1 2GH2A 2ET1A 2I07B 4IV3A 3IBMA 1R091 4ORFA 1Y4WA 2KD7A 3H1YA 3WINE 2JENA 5IVCA 3QCWA 3CJXA 2O0OA 3ZFFB 5CIRA 1MQTB 2D6MA 3N7MA 3LSDA 3OGVA 4QQOA 1WUVA 2FQPA 1REFA 3ACGA 2BWAA 3MBWA 2ZGLA 3OB8A 4KWUA 1C5IA 2XJPA 2C5DA 5SV8A 4CU6A 4Q4X1 1R1A1 3LA7A 1RVF2 4YARA 2VQUA 4QM8A 4BIFA 1WA4A 5C3QA 2OYZA 1W0NA 1KS4A 2QQIA 2WLPA 3RSJA 4H7MA 4AFAA 1LRHA 1W8TA 1GP5A 1YJKA 3ASIA 1T6GC 2QZ2A 2ZEXA 3AZZA 4AFBA 4AI8A 4W6XA 4HXCA 1ZRFA 3VBOC 4CCJA 1W04A 3D6EA 1DYPA 1S0CA 2RR13 4Q1PA 2X29A 1VAMA 4LO7A 1CGPA 3WF3A 1Q8OA 2XG3A 4HPKA 4J1XA 1PO22 4XILA 4AGGA 3PLQA 3R4DB 2J42A 2D7FA 3O1UA 1IPKA 3Q9OA 3OBTA 1VBB3 4HMZA 3U37A 1MS0A 4E8DA 3OUJA 4MYEA 4UBGA 3RZHA 3MZHA 2CHHA 3KCXA 4QPIA 1CAVA 1UYZA 1RVF1 3AJYA 3D8CA 5IVYA 5A6ZA 4RR3B 3PUQA 3MW3A 5ERLA 3O12A 5EP9A 1OHFA 2RM23 2VM9A 3IN9A 5EPAA 4M01A 3PURA 4ZU5A 1VMHA 3O14A 4FOWA 5LBFA 3P3PA 3VL8A 2XHKA 5DAWA 1F4HA 1LODA 1VMJA 3UK9A 2MEV3 4QMAA 2XJQA 4MVTA 2BDRA 2IXKA 2EIDA 1XB9A 3U4SA 3AXDA 4HVQA 5F1RA 5FK7A 2QQOA 2ENRA 4YW2A 4FOVA 5FZGA 1VBE2 5CU1A 5JIAA 2WWSA 4JDNA 1UZWA 2RDRA 5A32B 5C4WC 1AYM1 1MVQA 1ZZ8A 5BXXA 3ZPOA 1JZ6A 1AR71 1LR5A 3P6BA 1AVBA 3N9QA 4BLJA 1VRH1 1GR3A 2GC0A 3N35A 5FY8A 1QNYA 2PFWA 5FYZA 1STMA 4HOOA 1DGRN 1YEWA 4NN0A 3OPTA 1SBFA 4XIKA 1DLLA 3GGLA 4YVSA 5BNNC 2RJKA 3M8LA 1GKBA 3KF5A 1R1ZA 4DUXA 4ET7A 4IERA 1Z7S2 2W3JA 1R092 2QQUA 3ORJA 1W3VA 1PO11 4RHV2 2R30A 3NV2A 2WSUA 2VCMA 2JG8A 2VTXJ 5IVFA 1QXRA 1FMD2 4Q5OA 4AHZA 1AX1A 2P17A 3KV6A 3MDPA 5DZEA 2PHFA 3VHNA 1GZWA 2D40A 2ZGTA 4WM7C 3WP5A 3N9MA 1OD3A 1TME1 1PVC1 3BTZA 2WINB 4UAPA 2ZAHA 3DYOA 1XRUA 3IKWA 4LBQB 1MS3A 5J98B 1K5MC 3JB4C 4W50A 2B9UA 3M3QA 1BCXA 3ZIXA 5GLZA 2RS33 1H2KA 2WZR2 5C3RA 1QH7A 4IUGA 2B46X 1GOHA 1IPSA 3VDDA 4Y20B 3DXUA 3ZVXA 1U5XA 1BEV2 1E5SA 1HQWA 1GMMA 1LOFA 2Y34A 3AMHA 1GZCA 3BB6A 4RN5A 4LITA 5FO7B 4E4HA 5C9AB 1AR63 1ND3C 1V6IA 2BEOA 2ZX4A 3R05A 2RS52 4P9WA 5LY1A 1KRIA 2HWB3 4OUMA 4QM9A 4XTPA 4YFWA 4QWNA 1PGW2 3JB8A 5K9YA 4MGSA 4Q0QA 5EQUA 4IE6A 2BOJA 5AVPA 4WVWA 4FAHA 5DUVA 3BPSA 3PUIA 3ZFEC 1EV12 2GN3A 1RUF1 1CX1A 4X6QB 2B39A 1IG0A 1HN0A 2BJSA 3RS6A 2XONA 2H6BA 5L9RA 5GLWA 2ARCA 2XVLA 2WAAA 2WO7A 5FQ0B 1ZZ6A 3AYAA 3HMYA 4HN1A 4Y1XA 5C3SA 3K48A 2E33A 4IE4A 2Y8KA 5FZ4A 2FDJA 3IAQA 3OJBA 2YGMA 3SHRA 3JCIA 4IEZA 2XVGA 3ZFGA 1OQ1A 4G3YC 1PK6B 3RZKA 2E6VA 3AJZA 2OT7A 5FZEA 3T2OA 3WY6A 1J58A 4ZS2A 1W06A 1HV0A 3LGRA 5BNPC 2J22A 3WW2A 3DUIA 4YW4A 1GQGA 1W2UA 3JD72 5I0RA 3GM8A 2IVIB 4OVEA 4S2DA 3A0NA 1FAYA 4PI2A 3RPQA 2VCBA 1L7LA 1ZRCA 1UXXX 1GFF2 1UPIA 5F2SA 4CDXA 5E88A 4TTGA 4AHXA 1U5YA 4UW5A 5JWPA 1HRI1 4KGGA 5IVBA 3ZN4A 1S0FA 3JZVA 4GD4A 4X6RB 3VDDC 1OA2A 1LOFC 2Y33A 2ZMNA 2VOWA 1T2XA 3M3CA 4NUBA 5FYCA 4IE0A 5JI9A 4IV1C 1QKQA 2ZPXA 3M4FA 2SBAA 3KMHA 1V6KA 3M3OA 3OD0A 1MS4A 1G9AA 1N3QA 4UFKA 1QQP3 4LK6A 2HYXA 4Y1YA 1E5IA 2JWPA 3T0BA 4MG2A 4AFCA 3NRUA 1ZBA2 3MPPG 1OLMA 1CIWA 2AYHA 1VBA2 3FUQA 2VTFA 1C4RA 5FLIA 2KA3A 3TEXA 3B7MA 4M4RA 4AEDC 3LOBA 1HIXA 2JG9A 5DZGA 3SCFA 4Y22A 1DIWA 3NL1A 1O4YA 1UCXA 3AZYA 5FKCA 2JXAA 4XTMA 1ENXA 1WW6A 5FZ7A 1J3RA 1CZTA 1W6QB 5KHHA 1OUSA 4XABA 1SLTA 4LNVA 2HWD3 1NG0A 1UZ0A 1Z0HA 3EYPA 2J1UA 5FREA 4ZHNA 2JDAA 4RFT0 3WG3A 2VZOA 2EXHA 1MZ6A 4XCAA 4BIOA 1WLDA 4FPKA 4XVHA 3TNQA 1HRV3 3BVCA 4Z1VA 5BNQA 2BV4A 1EY2A 2W2IA 1KFXL 3T2QA 4UWDA 4EN8B 2PLV1 4K1YA 3W5MA 5BNPA 2VO5A 2R6QA 1RUD2 3C7EA 3N9NA 3O0XA 4S2FA 1HLCA 4TN7A 2G9GA 5DUUA 2WAOA 1VBC3 5DABA 3C7HA 2VVEA 1QMJA 3ZIWA 5AFEA 4CDQB 2VZTA 3MLKA 3Q8AA 3MHZA 1UU5A 5K8SA 1WZXA 4QB6A 1S0BA 3OF1A 3O5SA 5FLJA 3AC0A 2X05A 5JOXA 1ULCA 2ARXA 3VLBB 1QJEA 1XU2A 4KG0A 4Y5TA 5IVVA 4Q0VA 1GV9A 4N53C 3AYDA 4RA0A 3NSTA 3RFRA 1HXS3 4EZHA 2G9FA 5FQ0A 1ST8A 4LBJA 4CSWA 3V0BA 1MS1A 4M0HA 1C1LA 5JPNB 1RL3A 4N7IA 2XGXA 1IOAA 4NHXA 4J1WA 4WVMA 4AEDA 3MV11 1LHNA 1PNGA 2JG9C 1RC6A 1V6JA 1CAUA 2UY8A 1NUKA 4JKMA 5G05L 2HWB2 4BOWA 2HWF3 4LKEA 5FP7A 1K12A 4M4PA 4RS5C 1RVF3 2IUWA 3WDVA 4LK7A 1LTEA 5A6YA 1RUE3 1JYIA 2QKDA 3UJQA 3J7NA 3L9JT 2ET7A 4PLNA 3ON7A 4XURA 3VBUC 3ES1A 2WRAA 2WQZC 4KGQA 3IDEA 1TZOA 3WR0A 5BNNB 4UW4A 4CCCA 2CGOA 3POGA 1W6NB 4COZA 3F2ZA 3UKNA 2OQ7A 1GYKA 2UYAA 3JD71 3VZOA 5CG9A 2XKOA 4M3CF 4RGAA 4XCBA 4ASLA 1CAVB 4QHBA 4XFBA 2FCVA 3VBHC 1SFNA 3IT8A 1ZBA1 3THCA 1WD4A 2PHTA 2GMPA 2VMHA 4UF0A 1OH3A 1H8TC 1B35A 2PA7A 3WP4A 4FSJA 3ETPA 3MLJA 5LA0A 1LEMA 4OZXA 2ZZJA 3K3OA 2EIEA 1AF9A 1WGPA 2VE1A 5A3TA 1G8WA 1JYCA 4CU7A 4LEJA 4OZOA 4MSVA 4BYYA 5T52A 4R9BA 1VRH3 5FZ1A 4CCOA 1LHWA 2YUEA 1VPHA 2VCCA 3TN92 4OYUA 5EJ3A 5FWJA 4P9LA 1J3QA 3FMGA 2RM22 4XZPA 3NQHA 3HQUA 3ZYGA 3ZDSA 4BMEA 3NJXA 3UESA 4NWVA 1RUNA 1LGBA 2W46A 4N53A 5ABJB 1ULEA 5C7GA 5I93A 1NA1A 1TMF1 4W6YA 5FPUA 3B9CA 4BXSV 2SLIA 1QDOA 4FT8A 3SLIA 4CDQC 3H8OA 5ISLA 1V9U3 1CZVA 4AL9A 2XBO2 1R64A 2VBBA 1JZ8A 3DXTA 3O1PA 1C8M1 1JH5A 1JI6A 5G04L 4K9SA 4F8AA 4MGIE 5IJRA 1U5ZA 2YROA 4CU8A 5GZEA 1IGOA 3AK0A 4WM8A 3OD4A 3PL0A 2VMFA 3RGBA 4AOCA 2VW2A 2CV6A 1BVVA 3HD8B 4AVCA 4LE3A 3LF7A 3ZO0B 4PF5A 4XF1A 4Q8LA 4KWLA 4LBQD 3OBRA 2A6WA 1MS5A 1N1TA 3OY8A 4LIUA 4CCMA 1UZVA 3ZXJA 2OS2A 2Q30A 3DCQA 3TOJA 2Y64A 3IDBB 3P5BA 5CKQA 1YFUA 3LWCA 4R9AA 3I59A 3BTYA 2VOKA 4CCKA 3RYKA 1AYN1 4PDWA 1MACA 4WZCA 1O3TA 2X10A 4Y20A 2X5IA 5T54A 3VBUB 1VB2A 4INDA 1UYPA 1S0JA 4QAWA 4XBNA 3FLRA 4LIVA 1Q5OA 3S57A 4IEOA 3N9LA 4DRRA 3ZLIA 4Q2FA 5A3NA 1RUJ2 4K40A 5HCFA 3B3QE 4XAEA 2XJRA 3WDYA 5J37A 1QJX3 4CXYA 4XJZA 3MIBA 4FFHA 5DAXA 4FAGA 3WX5A 2WZ8A 4LJHA 1NCRA 2VQ0A 1MEC3 2OQ6A 1P8JA 3M3EA 1JZ3A 4QHZA 2W52A 4O9EA 1AYM2 4OUEA 5A32A 3DL3A 1EYBA 2YBPA 4DZGA 1BMV1 4QXKA 4AHYA 1YI7A 1WW7A 1DBNA 4BWOA 1QGLA 3MFCA 4LHSA 3CKHA 4YVWB 2RDSA 3I97A 4QXCA 2R063 4A6SA 4IDZA 1D2QA 3NO8A 3VKLA 3WEZA 4COVA 5LBEA 4LUMA 1ZVFA 2H0VA 2RS32 3PVEA 4QQPA 2ZZQA 3WUCA 1UKGA 3URFA 2VMCA 4LXLA 5DAVA 5LASA 3LFIA 2C0ZA 1HJFA 3SNMA 4Y33A 3IWZA 2OW4A 3PHMA 2KXLA 4NIDA 1KFUL 3WDUA 2YZ4A 1BKZA 5JSPA 4HANA 2XB6C 1KDKA 3POIA 1RMU2 3GNEA 3FFQA 4DUWA 1UIKA 4OI0A 1PM7A 4F3JA 1I5PA 2FBEA 2DUQA 5FY1A 3GCWA 4GA9A 3KCCA 4KMQA 3SQOA 4AI2A 2WL1A 1ZYBA 1FI2A 2ZX2A 2G19A 3WV6A 2P34A 2J1RA 2PHUA 3SCGA 2ADEA 2QZ3A 5M0TA 1SFPA 4GB33 5CFDB 3WZ1A 2VMDA 3MPBA 4Q0PA 3BU0A 1SPPB 5B2GB 2ZGRA 4NO4A 5FOJB 4Q26A 4D0QA 1CJDA 1SACA 3WW4A 1OLME 5DDJ3 3RZZA 3CDZB 3HQXA 4MOAA 4CEWB 3WSOA 3MGUA 4JC1A 4CCLA 1CD3G 4OHWA 3NAPA 5F6LB 1GP4A 1W6OB 1C8M3 2XLAA 4N90A 1H4GA 2VUAA 2CTVA 2R042 4COWA 3RDIA 2VTXA 1MQTA 1WBFA 1XBFA 3TEZA 1RUE1 4FTBA 3OSDA 2ETEA 2XL7A 4XF9A 2DF7A 2RV9A 4Z82A 2W92A 1BBT2 1XE7A 4Y5Z0 5EHDA 5EXOA 1FNZA 2ZCWA 4B7EA 4QPYA 1ZA7A 2ZEWA 1ASJ3 1UWWA 3D3AA 4IV3C 5HCHA 4KU8A 1LU2A 5I0UA 1GNYA 1QJY2 2EIGA 3CZUA 2DUOA 3U4XA 3NJVA 1PX4A 3AP4A 5LRRA 4FCAA 3GZEA 1KDMA 5H9RA 3H8XA 2FDHA 4UFLA 1UY2A 4AF9A 3MLLA 1BQPA 2VVDA 2XXZA 5FMCA 3QBQA 1GQHA 3N7LA 5A3WA 2ZGUA 5CFCA 1AR83 5C3PA 1V00A 3V56A 5FY7A 4WVZA 4YRDA 3U1XA 5L7OB 1XC6A 5FUNA 1G6NA 1POV1 1ULOA 2VPVA 3WD5A 4MGKE 2KM2A 2EA7A 2YBKA 1LAJA 1NCRB 1DYOA 1OSGA 4Y1ZA 3THTA 4I2OA 4Y24A 1S2BA 1SLLA 2DCTA 2NZ9A 4E2QA 4NWWA 1YUDA 2IXCA 1QJU3 2DU0A 3POSA 3RWNA 1DQ5A 3DKWA 1W99A 3SXWA 2W47A 1VBB1 2YBSA 4QQ2A 3AZXA 2ZGOA 2VG9A 1CAWB 1W2TA 1NY72 2ZEZA 4XJ9A 1N1VA 2K2SA 4EN7B 5GLTA 1OVSA 3ZR6A 1F4AA 4DUVA 4V2VA 1R093 3V0BB 2EIBA 3FLPA 4AEMA 4E9KA 5FCCA 4GWJA 4ONUA 5FZ0A 5J1XA 1ENQA 2TUNA 5CADA 1CAUB 2R071 3HOBA 1US3A 1W8HA 2JB4A 3QH6A 4Q4W1 1LOAA 1SCSA 4QKDA 3BTXA 2BBVA 2ZX3A 2AENA 5EZWA 5A3PA 1AJOA 3FJSA 1RIRA 5J36A 4XQDA 5FMDA 1OQDA 2XHNA 4YVWC 4LLOA 1W03A 1YIPA 1G7YA 2JB8A 2IXIA 3MUY1 4EN9B 2YPJA 2VBPA 1Y9MA 4D7YA 1WCUA 4ISRA 3ZR5A 1W8NA 5E8AA 2BFUS 2CWSA 4I0AA 1RMU1 4Q4Y3 1LCLA 3VBOA 2I74A 2JE9A 5EJZB 2AREA 4XQWA 2DFCA 4HG6B 3T4VA 3HNBM 5A7PA 4ZONA 3FX3A 5HV0A 2WFPA 5T5LA 4UF0B 3V0AB 4DEVA 2WKKA 1NQJA 1WCSA 2HWC1 5EIYB 1HB3A 3LDRA 5T50A 4ATEA 1GNHA 2B4KA 2HEVF 2UWBA 1GZWB 2ZBJA 5FLHA 4DO0A 3C7OA 3I2IA 5BNOA 1V70A 4LUKA 2DURA 4QPWA 2PAKA 1QJX1 5DUXA 4Y3OA 5L9BA 2BW8A 4CZSA 4BQ4A 1EAH1 1Y3TA 5CA6A 3E6BA 4MXVA 1KXGA 3HIFA 5JZGC 4Q4V3 5A7WA 5HXVA 4W6WA 2Z69A 5FUIA 3RMYA 3ZYBA 2J1EA 3K4DA 4AXOA 3HT2A 2BERA 2WFF3 2BRTA 1RXGA 3BOWA 1VJ2A 5C6CA 3AX4A 1MVEA 1PVC3 1NCQC 3NJYA 2CAVA 5CYYA 4CE8A 1LNSA 2VQTA 5A1LA 3J8F3 3PIGA 4Y4RA 1H30A 1D2SA 3ZKUA 1K5MB 2RS31 3AMNA 1YXWA 2OX0A 4IEQA 5BY5A 1N3PA 2AUYA 2GP3A 3ZYJB 1BJQA 3ZOIA 2F4LA 1RUG3 2WDBA 4EN0A 3PTYA 4P9XA 3UT0A 3HNMA 4RQPA 5DN2A 4WM8B 3AYCA 2UYBA 4JCKA 3S6PA 1V9U2 5E16A 2W68A 4UBHA 2A7AA 1ZREA 3OYWB 5K0UB 2VJXA 5BNNA 1I9RA 1W6NA 1RUI1 5FZKA 2PMWB 3BGAA 2ZA9A 4J25A 4LR4A 4QDSA 4AQ2A 4CXWA 1SLCA 1VLNA 4B3NA 4XUOA 4EV0A 3KHBA 5KXCA 1F8VA 3GBFA 4YG0A 1REDA 2J1TA 1S0IA 5FMOS 2LS6A 2WNVB 4XFIA 3ZFEA 2DVDA 1GOGA 1D0GA 3VBSB 3E5XA 1HV1A 1VBA1 1SDWA 3UKTA 5ACA2 1H1IA 4WZFA 4GQ7A 4MGTA 3PDQA 4IEWA 5BNOC 1LOGA 2A1XA 1ZM1A 4ZS3A 2A6XA 4YM3A 2VZ1A 1NOVA 5F2WA 3I2KA 2IFRA 2Q1MA 3KS7A 2P5BA 1KEXA 5FOBB 4BH9A 3PU3A 1PM4A 3B93A 2A73B 4HK9A 5FRAA 1AR92 4Q4W3 2DWRA 3ST7A 3ZXEA 2K9ZA 3RZLA 2HYKA 3KGLA 4BZ4A 3ZPYA 1F15A 4CUGA 5HV4A 2J1VA 5FXXA 1I1EA 2R0HA 1HRI2 4Z92B 1O4ZA 1ND3A 3FN9A 1O59A 3Q8CA 1RUJ3 4DOUA 4U2AA 2R16A 3HEIA 3RQ0A 1JYXA 4QKBA 2Q0AA 2E26A 1RUD3 2B45X 4CDUB 3B94A 1O5LA 3ROUA 2BGOA 3K51A 4QGMA 2WWJA 3AKSA 3ZFFA 3BU7A 3CL1A 1GNZA 1PVXA 1CN1A 5F5IA 2LUWA 2ZMKA 2A6VA 4AAPA 2BNMA 4PCRA 5JSRA 2CDOA 2QE3A 4W4ZA 2HWF2 1Z78A 2WT2A 2CL2A 3OBZA 4IEXA 1W6MA 1AXYA 1W6QA 3H9AA 1AL23 1UMIA 4ZU7A 2RS53 3LCPA 1AR62 3KQ4B 4FVVA 3VZMA 3WNXA 2XVKA 3KT7A 4PF1A 4XJWA 2R041 1TNRA 1XE8A 3W9AA 4COUA 2W0XA 1J83A 2PYTA 2HWC2 3TN91 1QF3A 1RYYA 2ARAA 1HJGA 2P1BA 4JGYA 1MPXA 1NLRA 2RDQA 4G4FA 1AXKA 2GP5A 1VBD1 2YMZA 1GWMA 4MGZE 4UYBA 1ULDA 2YGLA 3WW3A 5GJ6A 5BNPB 2AH2A 1PGW1 4XJ8A 5BPXA 3ZYPA 5K4LA 2ZGNA 2WUHA 2R7EB 4KU7A 2E7AA 4MHUA 3VKNA 1A78A 4N7UA 4XFHA 5A70A 5KXBA 2HEYF 4CDXC 4CEWA 2QVSB 5FY4A 2P37A 1F5JA 3K3NA 3ZSEA 3GBWA 3ABZA 4AQ6A 2WT0A 4V2WA 4ASMB 3VBFA 1RUG1 3J7HA 3T0AA 1Y9QA 2UURA 4PIYA 4JKKA 4NOTA 2EAAA 3OOXA 5C8WA 5FP3A 3AXEA 4BQ5A 2JECA 1IS4A 1JODA 2W08A 4JQRA 5FJHA 3LEMA 1YJLA 4GIQA 4H55A 2JKBA 5K0UA 1DQ4A 3CZJA 4D6SA 2AEZA 5CFDC 1PIV1 3O1TA 2DBIA 2BGPA 2B9VA 4NPMA 3UGHA 3ZSKA 4GWIA 2Y60A 4E2GA 3VGIA 1S1AA 3ES4A 4K20A 3T30A 4XAAA 1W90A 3SH4A 3OG2A 4XETA 3O1SA 2R49A 3KV5A 1N1YA 3M2MA 4OMCA 3I2FA 2PLV2 1C8NA 2HWE2 3USUB 3MICA 4AR2A 1FOD2 1NZIA 1ND2B 4XQ4A 4S2GA 1QJU1 3ZSJA 1TQ5A 3IMMA 1FPN2 4CTEA 2V09A 3OGSA 4UXAA 4XW3A 4M3CE 1TEIA 3TYJA 1VRH2 4L92A 4NJ4A 4COYA 3OGGA 1J84A 3EQEA 4CP9B 3IAPA 1UL9A 2AEYA 4PBPA 4BQXA 4XYXA 5F5AA 4AI9A 3C2UA 3AMQA 2DV9A 4FPOB 4Z07A 2JG8B 1RUJ1 2VVFA 3KHCA 3NWKA 4P9JA 2WFF1 2A71A 3HJRA 4Y1UA 1X9TA 1DQ1A 1SEFA 1SPPA 2P4EA 2XMLA 3KM5A 3NJZA 4FI9A 3BTAA 2D6LX 4JGZA 4CEWC 1ZBE3 4NR1A 3I54A 5KHKA 1QEXA 3KT1A 2RDNA 4AWDA 3NAPB 3VBFC 2PQSA 4X8PA 2KR2A 1ZRDA 2IXHA 1UAIA 3QLQA 3PTRB 5FTTC 3AMMA 3OGJA 4UFJA 1NZCA 1HB4A 1B35C 2WQ4A 4UFMA 1JMUB 1PHMA 5FY5A 4N43C 5L36A 5F8PA 3O0VA 4YPJA 1CAXB 1OVPA 2DCKA 1W6MB 1LHVA 5FMOL 1VBE3 1H6YA 2L9LA 2WSVA 5C4WB 1SBDA 4UFIA 3F95A 3B69A 3I2DA 4NIIA 5KHGA 1AX2A 4QGLA 1DQ6A 1V6LA 2NMOA 3OGRA 4BQ2A 4EWEA 4P08A 5F5QA 1H2NA 4LA3A 5BYNA 2YC0A 2HLEA 4OHVA 3MIFA 1W9YA 4D8MA 1VIWB 4FP2A 1UN1A 3TEWA 1RUI2 4QT6A 4LTAA 1OPOA 5FZMA 1EAH3 2IZWA 3D0JA 5JXGA 2E9QA 1ALYA 1SLAA 5LCWL 5FZBA 4RYDA 3WG4A 1VBA3 1H8TB 4HT1T 3ZN6A 1PZ8A 2OPWA 5FZOB 5H9SA 3WNKA 2W94A 1UOBA 5FP8A 3UL2A 3AVSA 5L7OA 4CCEA 3AB0A 5C9AC 3DEMA 4ZKTB 4OHXA 1XPWA 1FOD1 5FZDA 2OZ6A 1COV3 2HWD1 2YY1A 3LE0A 4LMFA 3W58A 4L9BA 1W0OA 4K3UA 1GANA 1GZTA 4HONA 1L7RA 3ETQA 1RUF2 3C7GA 1KITA 3IPVA 4LKFA 3M3IA 4PDWB 3I59B 1WWYA 2PHDA 2GAUA 4IESA 4FBFA 4YW1A 2RJ2A 3C3VA 3CO2A 2WN2A 4JGZC 3MUZ1 2NYYA 3FC0A 4HPKB 4Q4V2 2XUEA 1E5RA 2Q5TA 4MO3M 1WLCA 2Y6KA 3FBMA 4F7ZA 3RYPA 2XWJB 1RUC3 3R4SA 2GZWA 4IGQA 4Q0SA 1OA3A 2VXRA 4ATFA 1NE6A 1UO9A 3NV1A 1C57A 2CWMA 3H8RA 4L97A 1JYWA 2Y6JA 4GULA 4YGBA 5D8AC 2VC9A 2MHFA 4RR3A 1WLWA 2R1DA 2X8KA 3WW1A 3APBA 4R9DA 2JD9A 3CBNA 4LBMA 5IAVA 1FXZA 4A41A 1BHGA 2ZJCA 3W5NA 3I3MA 3N4MA 4GZ9A 1FV2A 1GWKA 4MXWA 4XFAA 2Y6LA 3OYWA 3THPA 5LW9A 2QQMA 3H3UA 2W95A 4CP9A 1W6PA 2RJLA 1UX6A 1UW8A 5GLVA 2J1SA 2VZVA 1G9DA 3TN93 2K0GA 2BFUL 3NMBA 4FPFA 1W28A 1YC61 2VMEA 2LALA 1DF0A 1OQEA 1QQP2 2PELA 3EMRA 3MI8A 4HKLA 4MZUA 2VU9A 3FHIB 5CKMA 2WNVA 1AYN2 2XR4A 1I3HA 2DVAA 2CYFA 3CNAA 1NXD1 4JVAA 3VL9A 1GU3A 4NIHA 4GMP1 2QFEA 5I0TA 1X82A 1LKNA 4AI3A 1L3JA 3WCSA 4PQQA 1DP0A 1OOPC 4QDRA 3RJ2X 2V4AA 2RMU3 5JCTA 1UOJA 2DCZA 2ZABA 2D93A 1UY4A 3NNMA 4P9GA 1YQ5A 2IC1A 2ZX0A 3P1IA 4M0NA 1LENA 3EXUA 4AEKA 3LSEA 4OUSA 2UU8A 4PQ9A 1JZ5A 1FPN3 1JU3A 1XJAA 3KZ4C 4GWNA 4IEYA 4JHZA 3JD73 4NE9A 4XACA 4XZUG 1YFWA 3DYMA 3LZZA 1CQ9A 3NNJA 1XNCA 4JKLA 4A7KA 2BPA2 1SDDB 5T3NA 3VBSC 1E5HA 5HI0A 1B35B 4MADA 4CCDA 4O7XA 2YU1A 3NVCA 1JN2P 4FO9A 4HZFA 5D21A 4NAOA 4W8JA 4Y5SA 4RFRB 4XFCA 2LROA 3POYA 2CSGA 3FZ3A 5E1RA 5AC93 1AZDA 4LKSA 2GNMA 1OPMA 1U12A 4GXLA 4P14A 4KL1A 3UKVA 2YG0A 1G9BA 4XUNA 2P2KA 4YZ3A 5LA9A 5LA2A 1TE1B 4GB31 4YNIA 3W20A 2GSYA 1MZFA 1DQ2A 2NPIA 3EHKA 4MH0E 3GZUC 2VOTA 3PVBB 4FFIA 1QJFA 5ABJA 1DZRA 1EUUA 1J1LA 2W87A 4FPEA 4OI4A 4RQPB 3CJIA 4PIZA 1UYYA 1NE4A 3KWVA 4YWAA 1FOD3 1UYXA 4DINB 4YSFA 4XEZA 4YM0A 1MEC2 1FV3A 5FPZA 5ACA1 1VMFA 3WQ1A 1FMD3 2A70A 2VMIA 3FHAA 4FXGB 4MGYE 1AL0G 3G6JB 4N9IA 2GALA 1VP6A 3A23A 4XUPA 3X29B 1OKOA 1IQAA 3IPVB 2W1WA 1MQTC 1NKGA 3SISA 2PQQA 4A44A 1Z7S3 4QX1A 5A1FA 1SG3A 2QCSB 1UPSA 4B1MA 2BNNA 1IZ3A 4D7TA 2W1UA 3ZXLA 4C1XA 1F9KA 1R1A3 2Q8CA 2Y0IA 5CFCB 3FUOA 4CPBA 1RUE2 3Q8FA 4NPRA 4KNCA 5JOWA 4YZ5A 3OY8B 2JKXA 2ZTNA 5IFTA 4CEYB 3VUOA 2GNBA 1FX5A 3BODA 3P3NA 2DTYA 2WZEA 3IZOA 5F6KA 4KG8A 4G9SB 1NAEA 2D6PA 2Z5WA 5B4XA 4NRMA 3V65A 5LBCA 3VDCA 1POV3 1OOPB 2E63A 2ZGPA 2ZGMA 3IIIA 3O7OA 1DQ0A 2WNEA 4CDUA 1PMJX 1W2OA 4J6GA 4ZZ5A 1YQ2A 1W6PB 5DUWA 3DECA 1UF2C 1D7PM 3CIHA 1IQDC 2PAEA 3AKRA 4MLOA 4QPIC 4Q29A 5FZCA 3UGFA 2BBAA 4HETA 1KJRA 1HQNA 2ERFA 1V6NA 3AM2A 3RI8A 2NQYA 3VD3A 4HKOA 1MEC1 3VBRC 3E5UA 1QJX2 4YGDA 1G9CA 1PX3A 4JZRA 3R0RA 3L2YA 3MYXA 1SMVA 3AFKA 4JDOA 2D6NA 4LKDA 3I2HA 4NRQA 4TLFA 1NLQA 2XLGA 1W39A 4NRPA 5IW0A 5FYBA 4WM7A 2FZ2A 4B4PA 4LHNA 1QIQA 5C8CA 3I49A 2CGPA 2MEV1 1FPN1 1TNFA 2BU9A 2ZHNA 2TNFA 3T09A 2AZ5A 4GWMA 4PJYA 4WBBA 1KQRA 3DV8A 4NMIA 4EQVA 2D3PA 2D5HA 4QU2A 2FZ1A 1UX7A 3ALQA 3LDKA 1F31A 4I30A 4DPNA 1V6MA 3G7DA 4LQRA 4DXTA 2EXJA 5A3UA 1JOJA 4C1WA 4FOYA 2IVJA 3BI3A 4M3CA 3HPNA 5JXIA 3DPRA 2PTMA 4Q4X3 2RG4A 4JGZB 3TWIA 1XE0A 2WWUA 3GDBA 5F39A 1JXNA 1A6CA 3WVJA 5JMOA 2OIIA 4Z2AA 5FPXA 1XNDA 4P9IA 2XJVA 5D2AA 5FAXA 3VBFB 1PO23 2R072 5LATA 5LA1A 3RNSA 5A33B 4LORA 5KBFA 3FBYA 4Q27A 4CDWB 1H1MA 5KXEA 1RUG2 4BQ1A 4FPCA 3BALA 3VKMA 1ZBE2 3Q8EA 4E8CA 2RR12 1WCQA 4HSJA 4CDUC 3HAGA 3ZYIB 3H0OA 2H6CA 4TXWA 3WP6A 1YFXA 1NY71 3B02A 3LAGA 1FMD1 1WMXA 2G9ZA 1ODMA 3LPFA 1SZBA 1YHFA 5IUQA 1DU3D 2XKPA 5A6QA 5JXJA 2Q1ZB 3ZX7A 1W9TA 1FNYA 3FWEA 4IGPA 1BZWA 1K5MA 2JJ6A 2VUJA 2WS92 1Z7S1 4Q4V1 4DXRA 5C3OA 3MW4A 3LD8A 3AKPA 4N43B 1JW6A 5JZGA 4QXHA 3K46A 1PK6C 1R082 3AP6A 3ZKYA 1VR3A 5BV6A 4EE2A 4QQLA 3N9OA 3MW2A 2LW8A 1HRV2 2YHJA 3WG1A 4C0BA 2BWCA 4HVRA 1QNWA 4A42A 1ND2C 4I02A 5C8CC 2RM21 2VNOA 3MF9A 4IE7A 4XUTA 3OEAA 4DXSA 4GKXA 4Q0UA 2CAUA 4QB2A 4LT5A 2IFWA 3JU9A 5LBBA 1UY1A 4C0HA 1J59A 2UWAA 4B29A 1MZ5A 1RJ8A 2A75A 2JDPA 4A7YA 3AKTA 1URXA 4WVMB 4Z8BA 4XF0A 4GH4A 3LIGA 4CPBD 1OF3A 1IPJA 2D6KA 2NLRA 3ZFEB 2WR9A 4JQTA 4XJAA 3VB9A 4LLFA 2Z42A 3VKFC 5LRSA 4CUCA 4UOJA 2ZGQA 4LOSA 1Q3EA 5J7MA 3DF0A 4RQPC 1JYVA 1K42A 5FZ9A 1JUIA 2VD7A 1EV13 1AR73 3BIEA 5FO9B 2JE8A 3PNAA 4UFHA 1HB1A 3TRSB 4TSVA 1DFQA 2VZPA 4QGNA 3IDCB 3WXPA 4YFZA 1WCDJ 2HWD2 2GH8A 2ZHMA 2I45A 5IVJA 4Y26A 5EV7A 4D3WA 5K7PA 1IG3A 5JPMB 4QD2A 5FYUA 1X8EA 3ZYRA 4DY5A 1DHKB 3K77A 3SC7X 4YZ4A 1CAXA 2YU2A 1NCQA 3SEEA 4ASKA 4A3XA 2W39A 3ZXAC 4EJRA 2IXJA 2BGCA 4K6BA 4PLOA 3MO4A 3UETA 2WA4A 1W3XA 2QUOA 1KJLA 3KT4A 2DYCA 3KVBA 1ACCA 3PJQA 3SKVA 4EROA 3IDAA 3KGZA 5E89A 3U78A 3I2OA 2QQVA 2Y38A 4IW3A 3GHNA 4YM1A 4URAA 4LHLA 2R062 2DVGA 4AG4A 4B8EA 3JQXA 4XDPA 4OLLA 3SH3A 4I09A 3DYPA 4YG3A 4ZXEA 4FPHA 1K45A 3POJA 4CP1A 4N53B 3WNNA 5CNAA 1W9FA 4EYUA 4BJ0A 1NA1B 3VDBA 1VBC1 1U5IA 1YCIA 3AMPA 4L11A 4YYOA 3LIHA 4M00A 1PVC2 1QOOA 4ZY9A 1HB2A 5FPVA 5LK5A 1JHJA 1XNAA 3TEYA 3MIEA 3WF1A 3ILFA 4GB32 2HWB1 1WMFA 2I2SA 2ZAAA 4XF3A 4D94A 1XYOA 4XFGA 4YGEA 1UZYA 1VB4A 1W8FA 2PHLA 3VBRB 4JGYB 1HKDA 1L7QA 4KWKA 3S7IA 3VBHB 4OI2A 5EYXA 5FBZA 3VHPA 2EVXA 4BU2A 1WKYA 2JE7A 3HBZA 3I3BA 2HWC3 1S55A 1W8UA 1GOFA 2FHRA 4W65A 1NQDA 1PIV2 2A5ZA 1UD1A 4D7SA 3QACA 2BUKA 3BYWA 5IK4A 2P3JA 2BVVA 3H7YA 1BBT3 2ZOEB 2UY9A 4I0BA 4RS5B 2DU1A 3FFZA 2R1BA 3WUDA 2AGSA 4FFFA 3RMXA 4CU9A 2OZJA 1ODNA 2E7TA 4BB3A 1UMHA 1HQLA 4CDWC 5JDBA 1IS6A 3WDTA 3CJIB 2X5IB 3VBUA 3R4UA 2JDKA 3OEBA 5FP4A 4MXWB 3SITA 3O1MA 1RUD1 5DAPA 2OKXA 3U07A 2R32A 5J96B 1QXJA 2Z79A 2BZDA 3H3LA 4HBNA 2D3SA 3VZJA 3L2HA 3ZXDA 4CP0A 1O3RA 4FOQA 4ARXA 1W2NA 3AYEA 2WS93 3ATGA 1AX0A 1FATA 4XXPA 1HN1A 3LQCA 1HX6A 4FQ4A 4AGVA 4HKWA 4KI5M 3B01A 1HRI3 5F3GA 3B9IA 4C8DA 2W9XA 4RSUA 3N3HA 3TB0A 1ZZBA 1VBC2 1O8SA 1QOSA 3BN6A 5IFPA 1ZX5A 2WZPP 3GCXA 2ZS6B 1N1SA 2LRPA 2FMYA 2VR4A 4Q8KA 4BK4A 2VZQA 3BIWE 2YDEA 5FYMA 4YW7A 1POQA 4LE4A 3KB5A 2HWE3 5A7NA 3ZXGA 4EWDA 4FPLA 1M06G 4BQ3A 3J26N 5H9PA 3C7FA 1PO21 5F3IA 2QBXA 4OHZA 1H2LA 1J1TA 1O8PA 1PGL1 4QX0A 1AL22 1CPMA 2CGNA 3KQRA 3O0WA 1NCQB 3LB9A 1K5JA 1JTZX 4E2SA 3WDXA 5KXDA 1ULGA 5DQ0A 3AP5A 5FPBA 5IWFA 4RHV3 3I7DA 3RYRA 1OLRA 2FCTA 5HCBA 1RHI2 2X09A 3JUUA 5JR7B 5F3CA 4XE9A 4XBLA 2EXKA 4YZ1A 3DKQA 2VXJA 1OT5A 5LK7B 2WO2A 4NAMA 5FKBA 2NP0A 5FR3A 1H4HA 3GYDA 3VHRA 1MR5A 1HRV1 4P9YA 4A7ZA 2WJSA 1UU4A 2UWCA 2WYSA 1N47A 5K0UC 4XIOA 5CFDA 1ULFA 3HNYM 3K2OA 4WM8C 1X7NA 4Y1VA 4CUBA 4AHWA 1GICA 1RUH3 3I2GA 2TEPA 1PIV3 4IE5A 1WLTA 1B09A 5C5UA 3QH7A 3MIDA 3I2JA 4YVSB 1XOYA 1OD5A 2ZHKA 2JDZA 2OA2A 2N7GA 1JOBA 4PHZA 2RR11 4EZ4A 1HXS2 4BMBA 3K4AA 3ZN6B 4JX0A 4K1ZA 4MV2A 1M4WA 3I4IA 1YLLA 4FP3A 4NHLA 4CP2A 5I91A 5D1IA 3AVRA 3T08A 5IK5A 1W8WA 2GNDA 5DDJ2 3WQ0A 5GALA 1RUOA 2RS12 2VOXA 1EV11 1JUHA 2VW1A 3LEGA 4QHOA 4CDQA 2FDKA 1JS9A 4HSLA 1UXZA 2ARBA 3E6DA 1LJ7A 3PIJA 2D98A 1JZ4A 1AR91 1CX4A 2HBTA 3S5QA 5C71A 5JVVA 1XU1A 4H14A 2JICA 2RE9A 2FMDA 4H2AA 2DDUA 3RZMA 5DZFA 5FZ6A 3WNPA 4AGRA 4CEYC 2VUDA 2NM1A 4YW3A 2QDRA 5A33A 5HBAA 3T3YA 5J48A 4OHYA 4SLIA 1VBD3 3VZLA 1BEV3 4QPGA 1W0PA 1LESA 3D4KA 3HBKA 2QQWA 4R8HA 1FT9A 5C9AA 3VV1A 1ZBE1 2XBO3 4XF4A 4C90A 4XHXA 3RVHA 4ZXKA 4NROA 2O8OA 2J7MA 5FYVA 1SQ4A 2C9KA 4CXXA 2RMU2 1BVP1 5FIXA 3KF3A 3J8F2 4AEJA 4DIQA 3ZXKA 1HDKA 4N43A 4RGGA 3SKJE 1BXHA 4H3WA 4PDWC 3VN4A 2V73A 4AI1A 1LEDA 2XJTA 1AYN3 1AR81 1A3KA 2X5IC 5I8SA 1D4M1 1WCKA 1WW4A 2YXSA 1VBE1 4QQHA 1KS5A 3POFA 3RWKX 2G1MA 1YYNA 3ZMOA 2VNVA 3INAA 5LB6A 1RXFA 1ULPA 1VAKA 1WBLA 1RHI3 2ZXQA 2FDGA 2PHXA 1ENSA 5EYYA 1IKPA 4QXBA 3WOGA 2PXJA 2XUMA 2C26A 3E1F1 1UNBA 5GZDA 5AC92 4I3PA 4X8NA 5HPOA 1LB2A 2F6BA 3H1WA 1DDLA 4BK5A 3DGTA 1O6UA 5L9VA 5FZ3A 4HFSA 2ZEYA 3U14A 3K75B 2JDUA 5EJ1B 4M3CB 5SV5A 1UOFA 4I0WB 1RTVA 3EJKA 3GBGA 2GMEA 2ZGKA 3ZSMA 3NV3A 3GHMA 3ITQA 1TME3 2Y6HA 3M7AA 5GZCA 2JDYA 3BKZA 4FFGA 5I0DA 4HK8A 3W21A 4ISQA 1US2A 4XPVA 3T4HB 4S2HA 3WHUA 3J9SA 4YW6A 1EAH2 4V1PA 4AI0A 1LHOA 4B7KA 1RB8G 3LA2A 3T1LA 1BMV2 1D4M2 2YB7A 3UJOA 2H0BA 2XDVA 3FE5A 2V5DA 4WV8A 4AVTA 1UMZA 2WNVC 2C9AA 1ZRIA 3RI9A 3U75A 3JBG1 3FL7A 3A21A 1G86A
chains in the Genus database with same CATH topology
2RMU1 3SMHA 1SLIA 1Y43B 1RUH1 1LHUA 2ZKNA 3U0ZA 1SCRA 4IV3B 1DZTA 4JRLA 5JI7A 3B00A 4IEPA 5L73A 2GC2A 5IK8A 3N36A 1ZZ7A 4U36A 1ZA4A 1UU6A 2P3IA 4DRVA 5GKAC 1R1A2 2DUPA 2A3XA 4Y22B 4LO8A 4R4XA 4YM2A 1DG6A 3NKGA 1EPWA 3LOIA 4IETA 1DGLA 1O4TA 5C4WA 4BPZA 1J3PA 2D5FA 5DDJ1 4IL7A 4R9CA 1AJKA 1XXNA 2ZX1A 4AVBA 1LGCA 3VZKA 4BM8A 4ZU4A 1LOCA 4DMIA 3CU7A 3S30A 1LOEA 1O3SA 1XYPA 3USUA 5ABJC 4GMP3 4BE3A 2QDNA 4H7LA 4OFGA 2VY0A 3JQWA 2XBO1 5JLVA 2WC2A 3BCWA 3MEPA 5EFUA 1S0DA 4LO5B 1CR7A 3MIHA 3HR9A 4AFDA 1E57A 2DVBA 4P5HA 1R081 5C33A 1TMF2 3VZNA 4TYSA 2RS13 4Q1RA 2XWBB 2WS91 2BNOA 1S2KA 4K8FA 4KBBA 3TAYA 1H9PA 3S0MA 2VQAA 2XPJA 1PZ9A 1UKRA 2DCJA 3WT3A 3GZAA 5CFCC 1QQP1 5CBLA 4YVWA 2CY6A 1RHI1 4IQPA 3AP7A 3D5OA 1RMU3 4DXZA 2D97A 1SBEA 2ZGSA 3E6CC 4YVSC 3ACLA 1H1AA 1RUH2 2A3YA 4AVSA 4K7JA 5FO8B 3D0SA 4GKYA 1CPNA 5DG1A 1YNAA 1D0HA 3I8TA 2WIIB 3JBG2 4OULA 3VHOA 1WD3A 2JG8C 1VAVA 4JTNA 1QHDA 2XL9A 4WM7B 4WVVA 5CG8A 1EP0A 4E4DX 1QJZA 3POWA 1GSLA 1EPZA 1V6OA 1H8VA 2PHRA 4A2UA 1RINA 2DTWA 5C8CB 1OFSA 3NW4A 2EALA 4FXKB 3VBRA 1YRZA 2R073 2VECA 1QXPA 1OMIA 2GC3A 1ZRRA 2F4PA 5KHIA 3IIAA 1O3QA 3AZWA 1F5FA 3M70A 5F9TA 5TSWA 3H50A 4AYUA 1BYHA 4MUVA 1Q56A 2HEWF 5JOZA 5L19A 2WA3A 1OI6A 5A3MA 1AR61 1C28A 4AK3A 2E51A 4YG6A 1ASJ1 3WHTA 1DGWA 5AVAA 4B4RA 4LBQA 3ENRA 4BA6A 5I0SA 1AR82 2BVBA 1HW5A 5T5PA 3T1MA 2QJVA 1D4M3 2Y26A 1YI9A 3VDDB 4DY3A 1I5ZA 1O5UA 4IV1A 1RUF3 4AQSA 3N7JA 1JBCA 3CF6E 3IMNA 5AC91 5CAZA 1MZEA 1OA4A 3B5LB 5JZGB 3ZMNA 3ZFGC 1XYNA 1RUC2 1OFNA 2D43A 1H9WA 3H1MA 3PVNA 4LO6B 2PHWA 4XDQA 2P3KA 4Y4YA 5DXDA 1CESA 4IXLA 1R083 3E97A 3A4UA 3J8F1 1BK1A 2RS11 2GU9A 2BYVE 1ONAA 3ME2A 4PIXA 2VH9A 2O1QA 1PK6A 2VNRA 4I3GA 2WFF2 1SLBA 3JBG3 1CVNA 3KLSA 4FPGA 3ZFGB 5J3UA 4E4SA 3ILRA 1DZQA 3DPRC 2GNTA 2JD4A 1CAWA 4JV4A 1ND2A 4JTOA 4DFSA 2V5YA 1REEA 1VBB2 3PVOA 1PGSA 2IWGB 4LBOA 4L99A 4R52A 2OUHA 2VNGA 3PMEA 4EN6B 1QU0A 2ES3A 4CDXB 1YFYA 4GH4C 1C1FA 1RUI3 2B7YA 2GMMA 4QPIB 1WMEA 3ZFFC 3NKTA 4Q4Y1 4AQTA 1OLQA 4YZ2A 4YGCA 2A6ZA 2E7QA 2ILMA 4JRAA 4RD7A 4NHKA 1PZ7A 1S0GA 4Z2WA 5IT6A 1IS3A 4RL7A 4IEVA 3CEWA 1MS8A 2B8MA 1HXS1 5EWSA 5CVRA 2D44A 3CLPA 2VULA 2R043 1GZ9A 3N7KA 4ITCA 4NVPA 1ZNPA 2JG9B 1APNA 1S0EA 1D4VB 2A6YA 2Y0OA 1NYWA 5GZGA 1PMIA 3U11A 1QJY1 1MS9A 1PNFA 5GM0A 2DCYA 3HWJA 3PJYA 1PGL2 3GZTB 4PLMA 2PLV3 4BLIA 1A8DA 1QJU2 2GN7A 1H0BA 4UW3A 1WMDA 5JAXA 1AXZA 4R4ZA 5JIUA 2AR6A 5GLUA 4PBOA 5A3LA 3SH5A 2Q4SA 3LKJA 1GBGA 3IM0A 2WT1A 4NHMA 3KD4A 5KHJA 3LA3A 1NLSA 4D69A 1ZBA3 5DG2A 1NXMA 1AHSA 3A0KA 2QNKA 5LEJA 2DFBA 3VBHA 1LECA 2B5HA 3TBDA 1DGWX 1VBD2 4FPJA 1H8TA 2EAKA 2NMNA 1UZZA 2MNGA 2WNUB 4URTA 1AL21 1KD7A 3ELNA 4LBNA 4AVVA 2RS51 1LULA 5BUVA 2DVFA 2E53A 2WLQA 3EO6A 4FTEA 1CJPA 4JGYC 2XJSA 4YW5A 1FYUA 4SBVA 1YWKA 4TZDA 2VMGA 4DS0A 3V64A 4RS5A 2HWF1 2D3RA 4BCUA 1A8MA 2ZHLA 4AVAA 3WCRA 1NA1C 4B4QA 2MPFA 4HL0A 2HJIA 4OI1A 1Q43A 3AKQA 2C1FA 3WG2A 1X8MA 3BOPA 1IKQA 4AEDB 3SCHA 3ZSLA 1X36A 2RHPA 4EWAA 1LGNA 2JX9A 4ES8A 5CB7A 4LA2A 2LM3A 2B42B 4ES9A 1G9FA 4META 4Q4Y2 2EF6A 3ZXFA 1ZZ9A 2WNUC 2PAMA 2BTVC 4UW6A 3GF6A 1GLHA 2GDFA 2X53S 4HN0A 3WP3A 5LEKA 3EBRA 4GH4B 4CYDA 4GMP0 3WDWA 3VKOA 2G4IA 2XLFA 1O7FA 5D8AB 3T2TA 1AYM3 1RITA 2HKXA 2VOVA 4LULA 1ND3B 3AP9A 5KC5A 4DNYA 2JEMA 4N9HA 4KH9A 4JDMA 3DPRB 1XQNA 4L8QA 1TMF3 5FDBA 1RJ7A 2OUJA 2XJUA 2WZR3 3OPZA 1F2NA 1W6OA 1CONA 1OKQA 5J09A 1BBT1 4CRQA 5HCAA 1V9U1 4XHBA 2OVUA 4CDWA 5T5OA 5KWRA 3H7JA 2ZKLA 3FLTA 3MIGA 5AFBA 5KC6A 1LU1A 1X50A 2ZMLA 2QQPA 4AE2A 1IHMA 3W59A 1ENRA 4LBLA 3H3ZA 4I01A 2R061 1RGSA 3S7EA 3M1HA 4LHKA 3ILNA 2GC1A 3RG0A 4MX3A 2TBVA 4E4ZA 5JSOA 1ZZCA 4DQAA 5IK7A 1C5HA 1SFYA 1O91A 3USSA 4FTSA 2VW0A 1UIJA 2WNUA 1Q8QA 4LO4B 3UV9A 4E27A 1IS5A 2VGDA 1C3HA 2A3WA 1RUC1 2IXLA 3RJRA 3AFGA 3QD6A 4O9GA 2HWE1 3ZN5A 4TWTA 1X33A 4XXAA 5BNOB 2D6OX 3HN1A 5T5JA 1DYKA 4DB5A 4Q4X2 1Q8PA 4XBQA 4AFMA 1WW5A 3AZVA 4FPYA 3TNPB 4LBKA 1QDCA 4GALA 1NCRC 3OCPA 1XNBA 3HT1A 2R0FA 2O8QA 3BPZA 5FFOC 4QPGB 5ACA3 1I6XA 1Q8VA 5L7OC 1QWRA 3E5QA 2PN5A 5JOYA 1POV0 1COV1 1AUYA 4L2NA 3WQ7A 5T55A 4XJUA 3MF6A 4CEYA 3NAPC 1ASJ2 4XMIA 1BEV1 1QH6A 4BHPA 1QJY3 1LOBA 3J4UH 4F83A 3R6SA 1DGRA 2EXIA 4IEUA 2ZACA 2Q8OA 2Z2SB 4XOGA 1Y7BA 3QOPA 1OOPA 4K21A 4YLZA 3DN7A 3D82A 1XNKA 4C91A 2CNAA 3VBOB 2XH6A 1H2MA 1YIFA 2BQPA 1YO8A 4HVOA 5H9QA 4AW7A 4HLTA 4KQ7A 5D8AA 4QX5A 5I8TA 1N3OA 2OPKA 4RR3C 3V0AA 5JMCA 1PO12 2NN8A 3VBSA 4FQZA 2ATFA 1JHNA 2LTNA 3RRDA 1VALA 2WZR1 3KCYA 2MEV2 4XMAA 3U10A 3WLUA 3ECQA 2YV8A 3GALA 1QOTA 1AR93 3H8UA 4Q4W2 3NV4A 3MFAA 1AR72 2YYOA 1TME2 4QPGC 3KSCA 1PO13 1U0AA 1C8M2 3OTFA 1COV2 1Q8SA 3PMSA 4IV1B 1QY4A 3CJIC 4XFFA 4KWJA 4JAAA 5GZFA 4RHV1 2GH2A 2ET1A 2I07B 4IV3A 3IBMA 1R091 4ORFA 3H1YA 3WINE 2JENA 3QCWA 3CJXA 2O0OA 3ZFFB 5CIRA 1MQTB 2D6MA 3N7MA 3LSDA 4QQOA 1WUVA 2FQPA 1REFA 2BWAA 2ZGLA 1C5IA 2XJPA 2C5DA 5SV8A 4Q4X1 1R1A1 3LA7A 1RVF2 4YARA 4QM8A 4BIFA 1WA4A 2OYZA 1KS4A 2WLPA 3RSJA 4H7MA 4AFAA 1LRHA 1YJKA 3ASIA 1T6GC 2QZ2A 3AZZA 4AFBA 4AI8A 4W6XA 1ZRFA 3VBOC 3D6EA 1DYPA 1S0CA 2RR13 4Q1PA 2X29A 1VAMA 4LO7A 1CGPA 1Q8OA 2XG3A 4HPKA 4J1XA 1PO22 4XILA 4AGGA 3PLQA 3R4DB 2D7FA 1IPKA 3Q9OA 3OBTA 1VBB3 4HMZA 1MS0A 4MYEA 4UBGA 3MZHA 3KCXA 4QPIA 1CAVA 3AJYA 1RVF1 3D8CA 4RR3B 3MW3A 3O12A 1OHFA 2RM23 3IN9A 4M01A 4ZU5A 4FOWA 3O14A 3P3PA 3VL8A 2XHKA 1LODA 3UK9A 2MEV3 4QMAA 2XJQA 4MVTA 2IXKA 4HVQA 3AXDA 5F1RA 2ENRA 4YW2A 4FOVA 1VBE2 5CU1A 5JIAA 2WWSA 4JDNA 5A32B 5C4WC 1AYM1 1MVQA 1ZZ8A 5BXXA 1AR71 1LR5A 1AVBA 4BLJA 1VRH1 1GR3A 2GC0A 3N35A 1QNYA 2PFWA 1DGRN 4NN0A 1SBFA 4XIKA 1DLLA 4YVSA 5BNNC 2RJKA 3M8LA 1GKBA 1R1ZA 4IERA 1Z7S2 1R092 1PO11 4RHV2 2R30A 3NV2A 2WSUA 2JG8A 1QXRA 1FMD2 4AHZA 1AX1A 2P17A 3MDPA 5DZEA 2PHFA 3VHNA 1GZWA 2D40A 2ZGTA 4WM7C 3WP5A 1TME1 1PVC1 2WINB 2ZAHA 1XRUA 3IKWA 4LBQB 1MS3A 5J98B 1K5MC 3JB4C 2B9UA 3M3QA 1BCXA 3ZIXA 5GLZA 2RS33 1H2KA 2WZR2 1QH7A 2B46X 3VDDA 4Y20B 3ZVXA 1U5XA 1BEV2 1HQWA 1LOFA 3AMHA 1GZCA 3BB6A 5FO7B 5C9AB 1AR63 1ND3C 1V6IA 2BEOA 2ZX4A 3R05A 2RS52 4P9WA 1KRIA 2HWB3 4OUMA 4QM9A 4XTPA 4YFWA 1PGW2 3JB8A 5K9YA 4Q0QA 5AVPA 4WVWA 4FAHA 5DUVA 3ZFEC 1EV12 2GN3A 1RUF1 4X6QB 2B39A 3RS6A 2H6BA 5GLWA 2XVLA 5FQ0B 1ZZ6A 3AYAA 3HMYA 4HN1A 4Y1XA 3K48A 3OJBA 2YGMA 3SHRA 3JCIA 4IEZA 2XVGA 3ZFGA 1OQ1A 4G3YC 1PK6B 2E6VA 3AJZA 3WY6A 1J58A 3LGRA 1HV0A 5BNPC 3WW2A 3DUIA 4YW4A 1GQGA 1W2UA 3JD72 5I0RA 4OVEA 4S2DA 3A0NA 1FAYA 3RPQA 1ZRCA 1GFF2 1UPIA 4CDXA 5E88A 4AHXA 1U5YA 4UW5A 5JWPA 1HRI1 4KGGA 3ZN4A 1S0FA 3JZVA 4X6RB 3VDDC 1OA2A 1LOFC 2ZMNA 2VOWA 3M3CA 5JI9A 4IV1C 1QKQA 2ZPXA 3M4FA 2SBAA 3KMHA 1V6KA 3M3OA 3OD0A 1MS4A 1G9AA 1N3QA 1QQP3 4Y1YA 4AFCA 1ZBA2 3MPPG 1CIWA 2AYHA 1VBA2 3FUQA 1C4RA 5FLIA 2KA3A 3B7MA 4AEDC 3LOBA 1HIXA 2JG9A 5DZGA 3SCFA 4Y22A 1DIWA 3NL1A 1O4YA 1UCXA 3AZYA 2JXAA 4XTMA 1ENXA 1WW6A 1J3RA 1W6QB 5KHHA 1SLTA 4LNVA 2HWD3 1NG0A 1Z0HA 5FREA 4RFT0 3WG3A 2EXHA 1MZ6A 4BIOA 1WLDA 4FPKA 3TNQA 1HRV3 4Z1VA 5BNQA 1EY2A 1KFXL 4EN8B 2PLV1 4K1YA 5BNPA 2R6QA 1RUD2 3O0XA 4S2FA 1HLCA 2G9GA 5DUUA 1VBC3 2VVEA 1QMJA 3ZIWA 5AFEA 4CDQB 3MLKA 1UU5A 5K8SA 1S0BA 3OF1A 3O5SA 5FLJA 5JOXA 1ULCA 2ARXA 3VLBB 1XU2A 4KG0A 4Q0VA 1GV9A 4N53C 3AYDA 4RA0A 3NSTA 1HXS3 2G9FA 5FQ0A 4LBJA 3V0BA 1MS1A 4M0HA 1C1LA 5JPNB 1RL3A 4N7IA 2XGXA 1IOAA 4WVMA 4J1WA 4AEDA 1LHNA 1PNGA 1RC6A 1V6JA 2JG9C 1CAUA 2UY8A 2HWB2 4BOWA 2HWF3 4RS5C 1RVF3 3WDVA 1LTEA 1RUE3 1JYIA 2QKDA 3UJQA 3L9JT 4PLNA 2ET7A 3VBUC 3ES1A 2WQZC 4KGQA 3IDEA 3WR0A 5BNNB 4UW4A 2CGOA 1W6NB 4COZA 3UKNA 1GYKA 2UYAA 3JD71 3VZOA 5CG9A 2XKOA 4M3CF 4RGAA 4ASLA 1CAVB 4QHBA 4XFBA 3VBHC 1SFNA 3IT8A 1ZBA1 1WD4A 2PHTA 2GMPA 2VMHA 1H8TC 1B35A 2PA7A 3WP4A 4FSJA 3MLJA 1LEMA 4OZXA 2ZZJA 1AF9A 1WGPA 1G8WA 1JYCA 4LEJA 4BYYA 4MSVA 5T52A 4R9BA 1VRH3 1LHWA 2YUEA 3TN92 5EJ3A 4P9LA 1J3QA 3FMGA 2RM22 4XZPA 3ZYGA 3ZDSA 4BMEA 1RUNA 4NWVA 1LGBA 5ABJB 4N53A 1ULEA 5I93A 1NA1A 1TMF1 4W6YA 3B9CA 2SLIA 1QDOA 4FT8A 3SLIA 4CDQC 1V9U3 2XBO2 1C8M1 1JH5A 4K9SA 4F8AA 4MGIE 1U5ZA 2YROA 5GZEA 1IGOA 3AK0A 4WM8A 3OD4A 2VW2A 2CV6A 1BVVA 3HD8B 4AVCA 4LE3A 3ZO0B 4PF5A 4XF1A 4Q8LA 4KWLA 4LBQD 3OBRA 2A6WA 1MS5A 1N1TA 3OY8A 3ZXJA 2Q30A 3TOJA 3IDBB 1YFUA 3LWCA 4R9AA 3I59A 2VOKA 3RYKA 1AYN1 4PDWA 1MACA 4WZCA 1O3TA 4Y20A 2X5IA 5T54A 3VBUB 1VB2A 4INDA 1S0JA 4XBNA 3FLRA 1Q5OA 4IEOA 4DRRA 4Q2FA 1RUJ2 4K40A 5HCFA 3B3QE 2XJRA 3WDYA 5J37A 1QJX3 4XJZA 3MIBA 4FAGA 3WX5A 1NCRA 2VQ0A 1MEC3 3M3EA 2W52A 4O9EA 1AYM2 5A32A 3DL3A 1EYBA 4DZGA 1BMV1 4QXKA 4AHYA 1YI7A 1WW7A 1DBNA 4BWOA 1QGLA 3MFCA 4YVWB 2R063 1D2QA 3NO8A 3VKLA 4COVA 4LUMA 1ZVFA 2H0VA 2RS32 3PVEA 4QQPA 2ZZQA 3WUCA 1UKGA 3URFA 3SNMA 2C0ZA 3IWZA 2OW4A 3PHMA 2KXLA 1KFUL 3WDUA 2YZ4A 1BKZA 5JSPA 4HANA 2XB6C 1KDKA 1RMU2 3GNEA 3FFQA 1UIKA 4OI0A 1PM7A 4F3JA 2FBEA 2DUQA 4GA9A 3KCCA 4AI2A 2WL1A 1ZYBA 1FI2A 2ZX2A 3WV6A 2P34A 2PHUA 3SCGA 2QZ3A 4GB33 5CFDB 3WZ1A 3MPBA 4Q0PA 5B2GB 2ZGRA 4NO4A 5FOJB 4Q26A 1CJDA 1SACA 3WW4A 5DDJ3 3RZZA 3HQXA 4CEWB 3MGUA 4JC1A 1CD3G 4OHWA 3NAPA 5F6LB 1W6OB 1C8M3 2XLAA 4N90A 1H4GA 2VUAA 2CTVA 2R042 4COWA 3RDIA 1MQTA 1WBFA 1RUE1 4FTBA 2ETEA 2XL7A 4XF9A 2DF7A 4Z82A 1BBT2 1XE7A 4Y5Z0 5EXOA 4B7EA 1FNZA 2ZCWA 4QPYA 1ASJ3 4IV3C 4KU8A 1LU2A 5I0UA 1QJY2 2EIGA 2DUOA 3U4XA 3AP4A 5LRRA 4FCAA 1KDMA 5H9RA 4AF9A 3MLLA 1BQPA 2VVDA 3QBQA 1GQHA 3N7LA 2ZGUA 5CFCA 1AR83 1V00A 3V56A 5L7OB 4WVZA 4YRDA 1G6NA 1POV1 2VPVA 3WD5A 4MGKE 2KM2A 2EA7A 1NCRB 1OSGA 4Y1ZA 3THTA 4I2OA 4Y24A 1S2BA 1SLLA 2DCTA 2NZ9A 4E2QA 4NWWA 1YUDA 2IXCA 1QJU3 2DU0A 3POSA 3RWNA 1DQ5A 3DKWA 3SXWA 1VBB1 4QQ2A 3AZXA 2ZGOA 2VG9A 1CAWB 1NY72 4XJ9A 1N1VA 2K2SA 4EN7B 5GLTA 1R093 3V0BB 4AEMA 3FLPA 4E9KA 5FCCA 4ONUA 1ENQA 2TUNA 5CADA 1CAUB 2R071 3QH6A 4Q4W1 2BBVA 1LOAA 1SCSA 2ZX3A 2AENA 5EZWA 1AJOA 3FJSA 1RIRA 5J36A 4XQDA 1OQDA 4YVWC 4LLOA 1YIPA 1G7YA 2IXIA 4EN9B 2YPJA 4D7YA 4ISRA 5E8AA 2BFUS 2CWSA 4I0AA 1RMU1 4Q4Y3 1LCLA 3VBOA 2I74A 2JE9A 2AREA 4XQWA 2DFCA 3FX3A 2WFPA 5T5LA 3V0AB 2WKKA 1NQJA 1WCSA 2HWC1 5T50A 4ATEA 1GNHA 2HEVF 2ZBJA 2UWBA 1GZWB 5FLHA 5BNOA 1V70A 4LUKA 2DURA 2PAKA 1QJX1 5DUXA 2BW8A 4CZSA 1EAH1 1Y3TA 5CA6A 3E6BA 4MXVA 1KXGA 3HIFA 5JZGC 4Q4V3 5HXVA 4W6WA 2Z69A 3RMYA 4AXOA 3HT2A 2WFF3 3BOWA 1VJ2A 5C6CA 3AX4A 1MVEA 1PVC3 1NCQC 2CAVA 3J8F3