The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
70
|
sequence length |
222
|
structure length |
215
|
Chain Sequence |
AASSVDTSQEFQNNLKNAIGNLPFQYVNGIYELNNNQTNLNADVNVKAYVQNTIDNQQRPSTANAMLDRTIRQYQNRRNWKPLGWHQVATNDHYGHAVDKGALIAYALAGNFKGWDASVSNPQNVVTQTAHSNQSNQKINRGQNYYESLVRKAVDQNKRVRYRVTPLYRNDTDLVPFAMHLEAKSQDGTLEFNVAIPNTQASYTMDYATGEITLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural characterization of the virulence factor nuclease A from Streptococcus agalactiae.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Streptococcus agalactiae ilri112
|
| molecule keywords |
DNA-entry nuclease (Competence-specific nuclease)
|
| total genus |
70
|
| structure length |
215
|
| sequence length |
222
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2014-05-23 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Extracellular Endonuclease; Chain A | Extracellular Endonuclease, subunit A |
#chains in the Genus database with same CATH superfamily 1QL0 A; 4E3Y A; 3ISM A; 5GKC A; 2XH3 A; 3S5B A; 5DLW A; 4ZG6 A; 4GTY A; 5INH A; 5IJQ A; 4GTW A; 1ZM8 A; 4QH0 A; 4QN0 A; 5DLT A; 3WAY A; 3NKP A; 4ZG7 A; 1QAE A; 4ZGA A; 5L0E A; 3NKM A; 3OWV A; 4ZG9 A; 5HRT A; 3WAX A; 2XR9 A; 1G8T A; 3NKR A; 5DLV A; 5LIA A; 3NKQ A; 4GTZ A; 3NKN A; 5GKP A; 5L0B A; 4QGO A; 2XGR A; 3WAW A; 4B56 A; 5KXA A; 4GTX A; 3WAV A; 4A1N A; 1SMN A; 2XRG A; 3NKO A; 5L0K A; 2O3B A; 5LQQ A; 5IJS A; #chains in the Genus database with same CATH topology 1QL0 A; 4E3Y A; 3ISM A; 5GKC A; 2XH3 A; 3S5B A; 5DLW A; 4ZG6 A; 4GTY A; 5INH A; 5IJQ A; 4GTW A; 1ZM8 A; 4QH0 A; 4QN0 A; 5DLT A; 3WAY A; 3NKP A; 4ZG7 A; 1QAE A; 4ZGA A; 5L0E A; 3NKM A; 3OWV A; 4ZG9 A; 5HRT A; 3WAX A; 2XR9 A; 1G8T A; 3NKR A; 5DLV A; 5LIA A; 3NKQ A; 4GTZ A; 3NKN A; 5GKP A; 5L0B A; 4QGO A; 2XGR A; 3WAW A; 4B56 A; 5KXA A; 4GTX A; 3WAV A; 4A1N A; 1SMN A; 2XRG A; 3NKO A; 5L0K A; 2O3B A; 5LQQ A; 5IJS A; #chains in the Genus database with same CATH homology 1QL0 A; 4E3Y A; 3ISM A; 5GKC A; 2XH3 A; 3S5B A; 5DLW A; 4ZG6 A; 4GTY A; 5INH A; 5IJQ A; 4GTW A; 1ZM8 A; 4QH0 A; 4QN0 A; 5DLT A; 3WAY A; 3NKP A; 4ZG7 A; 1QAE A; 4ZGA A; 5L0E A; 3NKM A; 3OWV A; 4ZG9 A; 5HRT A; 3WAX A; 2XR9 A; 1G8T A; 3NKR A; 5DLV A; 5LIA A; 3NKQ A; 4GTZ A; 3NKN A; 5GKP A; 5L0B A; 4QGO A; 2XGR A; 3WAW A; 4B56 A; 5KXA A; 4GTX A; 3WAV A; 4A1N A; 1SMN A; 2XRG A; 3NKO A; 5L0K A; 2O3B A; 5LQQ A; 5IJS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
