4QGOA

Crystal structure of nuca from streptococcus agalactiae with no metal bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
222
structure length
215
Chain Sequence
AASSVDTSQEFQNNLKNAIGNLPFQYVNGIYELNNNQTNLNADVNVKAYVQNTIDNQQRPSTANAMLDRTIRQYQNRRNWKPLGWHQVATNDHYGHAVDKGALIAYALAGNFKGWDASVSNPQNVVTQTAHSNQSNQKINRGQNYYESLVRKAVDQNKRVRYRVTPLYRNDTDLVPFAMHLEAKSQDGTLEFNVAIPNTQASYTMDYATGEITLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-entry nuclease (Competence-specific nuclease)
publication title Structural characterization of the virulence factor nuclease A from Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae ilri112
molecule tags Hydrolase
total genus 70
structure length 215
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 4qgoA00
1G8TA 4GTWA 5L0KA 5HRTA 4GTZA 5KXAA 4QGOA 5DLVA 5INHA 4ZG7A 5IJQA 2XGRA 4ZG6A 2XRGA 2XH3A 4QN0A 1QAEA 5L0BA 3NKNA 1SMNA 5IJSA 5GKPA 5GKCA 1QL0A 4B56A 3NKOA 5LIAA 3NKRA 3NKMA 3WAWA 2XR9A 4ZGAA 2O3BA 3WAXA 1ZM8A 3ISMA 4GTXA 4QH0A 4ZG9A 5DLWA 3WAYA 3NKPA 4A1NA 3NKQA 4E3YA 5DLTA 5LQQA 4GTYA 3OWVA 3S5BA 3WAVA 5L0EA
chains in the Genus database with same CATH superfamily
1G8TA 4GTWA 5L0KA 5HRTA 4GTZA 5KXAA 4QGOA 5DLVA 5INHA 4ZG7A 5IJQA 2XGRA 4ZG6A 2XRGA 2XH3A 4QN0A 1QAEA 5L0BA 3NKNA 1SMNA 5IJSA 5GKPA 5GKCA 1QL0A 4B56A 3NKOA 5LIAA 3NKRA 3NKMA 3WAWA 2XR9A 4ZGAA 2O3BA 3WAXA 1ZM8A 3ISMA 4GTXA 4QH0A 4ZG9A 5DLWA 3WAYA 3NKPA 4A1NA 3NKQA 4E3YA 5DLTA 5LQQA 4GTYA 3OWVA 3S5BA 3WAVA 5L0EA
chains in the Genus database with same CATH topology
1G8TA 4GTWA 5L0KA 5HRTA 4GTZA 5KXAA 4QGOA 5DLVA 5INHA 4ZG7A 5IJQA 2XGRA 4ZG6A 2XRGA 2XH3A 4QN0A 1QAEA 5L0BA 3NKNA 1SMNA 5IJSA 5GKPA 5GKCA 1QL0A 4B56A 3NKOA 5LIAA 3NKRA 3NKMA 3WAWA 2XR9A 4ZGAA 2O3BA 3WAXA 1ZM8A 3ISMA 4GTXA 4QH0A 4ZG9A 5DLWA 3WAYA 3NKPA 4A1NA 3NKQA 4E3YA 5DLTA 5LQQA 4GTYA 3OWVA 3S5BA 3WAVA 5L0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8T A;  4GTW A;  5L0K A;  5HRT A;  4GTZ A;  5KXA A;  4QGO A;  5DLV A;  5INH A;  4ZG7 A;  5IJQ A;  2XGR A;  4ZG6 A;  2XRG A;  2XH3 A;  4QN0 A;  1QAE A;  5L0B A;  3NKN A;  1SMN A;  5IJS A;  5GKP A;  5GKC A;  1QL0 A;  4B56 A;  3NKO A;  5LIA A;  3NKR A;  3NKM A;  3WAW A;  2XR9 A;  4ZGA A;  2O3B A;  3WAX A;  1ZM8 A;  3ISM A;  4GTX A;  4QH0 A;  4ZG9 A;  5DLW A;  3WAY A;  3NKP A;  4A1N A;  3NKQ A;  4E3Y A;  5DLT A;  5LQQ A;  4GTY A;  3OWV A;  3S5B A;  3WAV A;  5L0E A; 
#chains in the Genus database with same CATH topology
 1G8T A;  4GTW A;  5L0K A;  5HRT A;  4GTZ A;  5KXA A;  4QGO A;  5DLV A;  5INH A;  4ZG7 A;  5IJQ A;  2XGR A;  4ZG6 A;  2XRG A;  2XH3 A;  4QN0 A;  1QAE A;  5L0B A;  3NKN A;  1SMN A;  5IJS A;  5GKP A;  5GKC A;  1QL0 A;  4B56 A;  3NKO A;  5LIA A;  3NKR A;  3NKM A;  3WAW A;  2XR9 A;  4ZGA A;  2O3B A;  3WAX A;  1ZM8 A;  3ISM A;  4GTX A;  4QH0 A;  4ZG9 A;  5DLW A;  3WAY A;  3NKP A;  4A1N A;  3NKQ A;  4E3Y A;  5DLT A;  5LQQ A;  4GTY A;  3OWV A;  3S5B A;  3WAV A;  5L0E A; 
#chains in the Genus database with same CATH homology
 1G8T A;  4GTW A;  5L0K A;  5HRT A;  4GTZ A;  5KXA A;  4QGO A;  5DLV A;  5INH A;  4ZG7 A;  5IJQ A;  2XGR A;  4ZG6 A;  2XRG A;  2XH3 A;  4QN0 A;  1QAE A;  5L0B A;  3NKN A;  1SMN A;  5IJS A;  5GKP A;  5GKC A;  1QL0 A;  4B56 A;  3NKO A;  5LIA A;  3NKR A;  3NKM A;  3WAW A;  2XR9 A;  4ZGA A;  2O3B A;  3WAX A;  1ZM8 A;  3ISM A;  4GTX A;  4QH0 A;  4ZG9 A;  5DLW A;  3WAY A;  3NKP A;  4A1N A;  3NKQ A;  4E3Y A;  5DLT A;  5LQQ A;  4GTY A;  3OWV A;  3S5B A;  3WAV A;  5L0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...