4QGVA

Crystal sturcture of the r132k:r111l mutant of cellular retinoic acid binding proteinii complexed with a synthetic ligand (merocyanine) at 1.73 angstrom resolution.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELILTMTADDVVCTKVYVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title "Turn-on" protein fluorescence: in situ formation of cyanine dyes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4qgvA00
3EYCA 5EDCA 5C0NA 4ZFXA 5LKFA 4EXZA 5EEEA 4QZTA 2Q9SA 1NGLA 2RD7C 4ALOA 1E5PA 4RUNA 2Q39A 1XKIA 3GAQA 2FWVA 5JR8A 3AKNA 3K3LA 1BEBA 2QO5A 1AB0A 1IKEA 2OVDA 1HQPA 3FMZA 1LIEA 2AT5X 4TJZA 4ES7A 2CM4A 2WWPA 2W2BA 3FW4A 3F9DA 1T68X 3PECA 3ZUOA 5H8TA 3TGBA 3TF6A 4YFQA 2HMBA 1KGLA 1GT1A 1N0SA 4K19A 4HPBA 3CMPA 1X89A 4OS8A 3B2JA 5KICA 1FELA 1FDQA 2P8GA 2AT0X 1HMTA 3O2YA 1U18A 1A2DA 1DZKA 1S44A 3STKA 1NP1A 3P6CA 3D97A 4IMOA 3CWKA 3CBSA 3O22A 4WFUA 2MO5A 3L4RA 1QG5A 3NQ3A 3VG7A 4AZQA 1KT5A 1OBUA 4IB7A 4ZCBA 4IB6A 1GKAB 5FENA 1DF3A 1I05A 2AT8X 2JU3A 2FR2A 3UEUA 3APXA 5LJEA 1KT7A 3WJEA 3AKMA 1FTPA 2A3FX 4Y0PA 5L8IA 1ZRYA 3FA6A 4ORXA 5HAEA 4YCEA 4OMWA 3BU9A 1VPRA 2K62A 2WUTA 3APWA 1ZNEA 5D4AA 3NQ9A 4YBUA 4QYNA 4YFRA 2JU7A 1ICNA 3VG3A 1GT4A 1YWAA 1GX9A 3QKGA 4I3CA 1IW2A 5F1EA 3KZAA 4I9RA 1B56A 1QY2A 4GRJA 3TGAA 3PPTA 4ORRA 1ERBA 4IBAA 5D47A 1ADLA 2PY1A 2AKQA 5FAZA 1EW3A 4AZPA 1RLBE 2CM9A 3FENA 3PH6A 4YKMA 4QGXA 1DFVA 5HZ6A 1QY0A 4YDAA 5LJGA 1VYFA 1YP7A 3DTQA 3F8AA 1KT3A 2X46A 1CRBA 4NNTA 5LKEA 4ODDA 1IIUA 4BOEA 4EDEA 1LFOA 3ELZA 3NR3A 5AQ6A 3NPOA 4Y0QA 4YCHA 3P6DA 5H9NA 5LJCA 2OVEA 4IAXA 1EIOA 5IO7A 2HZQA 2JN3A 2AMMX 4Y0SA 1UREA 2YG2A 5LJKA 2GJ5A 3BX8A 4XMCA 1I4UA 3NX2A 3B2IA 3B2LA 3I17A 1OBPA 4UU2A 5H9LA 2POAA 1G74A 2N93A 3FA7A 3TZSA 1D2UA 3OJYC 4M6SA 1DC9A 1CBRA 4TLJA 4XMDA 5HCDC 2FR3A 4NNSA 1SY1A 3EM0A 4DQ4A 5HWZA 1SA8A 1FE3A 3BSZE 3P6HA 1X8PA 4PSQA 2WR6A 4ORUA 4QGVA 1CBSA 3JSQA 5EDBA 1KQXA 2FS6A 1SXWA 2CZUA 4MVIA 4NP1A 5BVTA 4R0BA 4ZHCA 2O62A 4A1HA 1HBQA 1OPBA 3HWDA 1KT4A 1P6PA 1YIVA 4OMXA 2LBAA 2GTFX 1G7NA 4YGGA 5EZ2A 5H9KA 1FENA 1A3YA 5B27A 5DG4A 3APUA 5LJBA 2L9CA 1MVGA 4XMGA 3BY0A 1KZWA 1OEKA 4NYRA 1OPAA 1QQSA 2HZRA 3VG2A 1EUOA 1KOIA 3BX7A 4NYQA 4WFVA 1T8VA 1ALBA 1O1VA 1HBPA 3WVMA 5H9AA 1PEEA 1ACDA 4IAWA 3JS1A 1TXLA 1GM6A 4YDBA 1ICMA 4AZMA 5EEDA 1JYDA 2R73A 1SY2A 1GT5A 2A0AA 5HBSA 3KQ0A 2G79A 3FA9A 3PP6A 4D6BA 2L5PA 1EPBA 3SAOA 4YH0A 3WJBA 4NLIA 1D3SA 2XSTA 3MVFA 3O19A 2QOSC 2ALLX 1LIDA 3IA8A 2R74A 5HA0A 1LNMA 1ZNHA 3RSWA 3EBWA 2W2FA 4QAEA 3UEWA 1Z24A 5F6BA 1EQDA 2A13A 4HPCA 3HWEA 1ZNGA 2LKKA 4YKOA 3CR6A 3STNA 4AYHA 5IO5A 2XKLA 2LFOA 5HCCC 3WXQA 1BLRA 1EALA 3NADA 4I3BA 5D48A 1KXOA 1S2PA 2A2GA 4O9SA 1JV4A 5BVQA 2MJIA 1ZNKA 3B2KA 1YWBA 3NX1A 3WJGA 3BDRA 2ASNX 2K23A 1IFBA 2R56A 4A1YA 1KT6A 4GETA 3TGCA 2EU7X 4IMNA 2QO6A 1OEEA 2AL0X 3NP1A 1L6MA 2ACOA 3KFFA 3BU1A 4OS3A 5BVSA 2AH7X 4YFPA 4I3DA 1TW4A 4AZNA 4YMYA 2F73A 3VG4A 3B2HA 2ACPX 4QZUA 4ARHA 2QM9A 5HZQA 5HCEC 1B4MA 4EFGA 1BSQA 3PH5A 3ELXA 4XMHA 3D95A 3FEPA 2BLGA 3BS2A 1LIFA 2NNQA 2MM3A 4I9SA 4Y0RA 3U03A 3T1DA 1DZMA 2CBRA 4OS0A 3C77X 4MVLA 1LICA 1I04A 2HLVA 3Q6LA 1QFTA 4WBKA 1GT3A 1SY3A 4GE1A 1MUPA 1TOUA 1AELA 2WQ9A 1ZNLA 4TNNA 1CJ5A 1U0XA 4BQUA 2JOZA 2HYSA 4ZH9A 4ZH6A 3I0AA 1OEJA 4XMEA 3FR4A 2NNEA 5HTEA 1I06A 4QYPA 4TKHA 2CBSA 5F58A 1BRQA 2G7BA 2OZQA 2GC9A 2LB6A 3FR5A 1BSYA 4CK4A 3CQNA 1GKAA 4EEJA 4GH7A 2DM5A 4ZJ0A 3FW5A 1JYJA 2A2UA 3HWGA 3G7XA 5IO6A 2WEXA 3KFGA 1AQBA 3U0DA 1SY0A 5KIDA 3UEVA 1LPJA 5F7GA 4M7MA 4UU3A 3EBKA 2RQ0A 1H91A 5DPQA 3WJFA 1ERXA 1T0VA 4GNWA 2OVAA 4IB8A 5LJDA 2RA6A 3BRNA 1LF7A 1GX8A 1QWDA 2W2AA 2JU8A 3BLGA 1G85A 2OFRX 1BWYA 3VG5A 2ANSA 4A8ZA 4A60A 1B0OA 3FEKA 1X8QA 1AVGI 1JZUA 1X8NA 3C76X 4HPAA 4D6AA 1U17A 2Q2MA 1PM1X 1FEMA 2HNXA 3KFHA 1SXUA 5L8NA 5F6ZA 3FR2A 5D45A 4AZRA 3WJDA 2X45A 1JJJA 5HZ9A 5D8JA 5FFHA 4LKPA 2Q2PA 2AT3X 3APVA 2WSJA 1JBHA 1A57A 1MX8A 2WEWA 1R0UA 4XMFA 4YGHA 5HZ8A 3IFBA 4N7DA 4TQ2A 2IFBA 3RZYA 3UEXA 1BRPA 2NNDA 4HFOA 1O8VA 2L67A 1EPAA 3EMMA 3VG6A 4ALBA 3P6EA 1EXSA 2Q4NA 3DSZA 1UZ2X 3STMX 1EIIA 2RCTA 3HWFA 1X71A 1KZXA 2FTBA 1O1UA 1MDCA 1E06A 3FELA 4HPDA 1S7DA 5HA1A 2NP1A 4MVKA 1DV9A 1GXAA 1YWCA 1YWDA 1XCAA 2KTDA 3ZQ3A 1IKJA 1E02A 5CE4A 5L8OA 1OBQA 4QGWA 1MX7A 3FLLA 1BSOA 2LBVA 1E00A 1SXYA 4N7CA 4AZOA 4DQ3A 1TOWA 3S26A 4YGZA 5EPQA 4ZHHA 1B8EA 1ML7A 4BVMA 4ZGUA 1JJXA 3MBTA 2CZTA 5B29A 1QY1A 3WBGA 1HMSA 4LKTA 2KT4B 1PMPA 4ORYA 1VYGA 4IB9A 2FT9A 1HN2A 3KFIA 5KHPA 4ORWA 3U9PC 4KIIA 4TKBA 3FA8A 4RUUA 1DZJA 3ZUIA 1TVQA 1QABE 4ZHFA 2FRSA 2E4JA 3P6GA 1IFCA 5HZ5A 1BJ7A 4ORSA 3CBCA 4AW8A 4GNYA 5K06A 1ZNDA 1X8OA 3FIQA 4TKJA 4ZHDA 2G78A 5LJHA 1X8UA 2FS7A 4LZVA 2OFMX 1A18A 1PBOA 1RBPA 4YBPA 4ZHGA 3D96A 1BBPA 2AT6X 1LIBA 4ZR2A 4GKCA 1QFVA 1G5WA 3HK1A 2L68A 1CBIA 2QO4A 5HTDA 1BM5A 1NP4A 1KQWA 1SXXA 1GGLA 2RCQA 3P6FA 1YUPA 3CQRA 1DZPA 2FLJA 3WJCA 2WQAE 3PEDA 4NLJA 1HMRA 1YP6A 1CBQA 3C78X 4LZUA 1LKEA
chains in the Genus database with same CATH superfamily
3EYCA 3D4RA 3OE3A 5EDCA 5C0NA 4ZFXA 4C5PA 5LKFA 3WZOA 3VGWA 4EXZA 1AVDA 4QZTA 5EEEA 5F2BA 2Q9SA 1NGLA 2RD7C 4U46A 4ALOA 1E5PA 2ZSCA 4RUNA 2Q39A 1XKIA 3GAQA 2FWVA 5JR8A 3AKNA 4BJ8A 3K3LA 3SZIA 4BX5A 1BEBA 2QO5A 1AB0A 1IKEA 2DJFA 2OVDA 1HQPA 3FMZA 1I78A 2RTIB 4NV8A 1LIEA 2AT5X 4TJZA 4ES7A 3EW1A 2CM4A 2WWPA 1SWCA 4BX7B 2W2BA 4Y59A 2FKJA 3FW4A 4YVBA 3F9DA 1T68X 3PECA 3ZUOA 5H8TA 3RDSA 4ON1A 3TF6A 3TGBA 5K67A 3SLTA 4YFQA 2HMBA 4CV7A 1GT1A 3ZW0B 1N0SA 1KGLA 3Q34A 2RTJA 4K19A 4CSBA 1E2TA 4HPBA 3CMPA 1X89A 4OS8A 3B2JA 5KICA 1FELA 1FDQA 3OD9A 3RDMA 2P8GA 2AT0X 3S5VA 1NC9A 1HMTA 3O2YA 1SWKA 1U18A 1A2DA 1DZKA 1S44A 3STKA 1NP1A 3P6CA 4BX6B 3D97A 4U9CA 2I5VO 3MM0A 4IMOA 3CWKA 5FQ6E 3CBSA 3O22A 4WFUA 3X00A 2BSZA 2MO5A 1Y9LA 1QG5A 3L4RA 3NQ3A 3RE6A 3VG7A 4AZQA 1KT5A 4NW4A 2IZAA 1OBUA 3N91A 4IB7A 4ZCBA 2OY7A 1VWKB 4IB6A 1GKAB 5FENA 1DF3A 1I05A 1VWNB 2AT8X 2JU3A 2FR2A 3UEUA 4CDEA 3APXA 5LJEA 1KT7A 4JNJA 3WJEA 3AKMA 1FTPA 2OL7A 4IABA 2IZGB 4FBRA 1SWDA 3SLOA 2A3FX 2AVIA 4Y0PA 5L8IA 1ZRYA 3FA6A 4NV7A 4ORXA 5HAEA 4YCEA 4FGIB 4OMWA 1VWEB 3HTYA 1SRJA 3BU9A 1MOYA 1VPRA 2K62A 1SWQA 2IZBA 2WUTA 4Z28A 4OELA 3APWA 1ZNEA 5D4AA 3NQ9A 3RDQA 4YBUA 4QYNA 3RWXA 4YFRA 2JU7A 1ICNA 2RTOB 3VG3A 1GT4A 1YWAA 1GX9A 1KFFA 3EC5A 3QKGA 1IW2A 4I3CA 5F1EA 3KZAA 5IRAA 4I9RA 3RDXA 2IZLB 4O3ZA 5JD2A 3UAQA 1B56A 1Y52X 1QY2A 4GRJA 3TGAA 3PPTA 2RTNB 4ORRA 1ERBA 4IBAA 1LKEA 5D47A 1ADLA 2PY1A 2AKQA 4GGRA 1JJUA 4KC8A 1EW3A 1HXLA 1RLBE 2CM9A 3FENA 3PH6A 4JHQA 4YKMA 4AZPA 1RXHA 4QGXA 1DFVA 1LUQA 5HZ6A 4OEMA 1QY0A 4YDAA 5LJGA 3VE1A 2G5LA 1VYFA 1YP7A 3DTQA 1KL3A 1STSB 2DJGA 2OF9A 4KT5A 3F8AA 1KT3A 2RTHB 2X46A 1CRBA 4JGLA 4NNTA 5LKEA 4ODDA 1IIUA 4BOEA 3AUMO 4EDEA 1LFOA 3ELZA 3NR3A 5AQ6A 1I9HA 2UZ2A 3NPOA 3P6DA 4Y0QA 4YCHA 5H9NA 3RDUA 5LJCA 2OVEA 4IAXA 3U03A 1HXZA 1EIOA 5IO7A 1W5RA 2HZQA 2JN3A 2AMMX 2G8CO 4I6SA 4INNA 4Y0SA 3VPJE 4EKVA 1UREA 2YG2A 1VWOB 2C1SA 3ZW1A 2GJ5A 5LJKA 1RXJA 3BX8A 4XMCA 1I4UA 3NX2A 3B2IA 3B2LA 3I17A 1OBPA 4UU2A 5H9LA 2POAA 1G74A 1HQQA 1LELA 2N93A 2KW1A 2WPUA 3FYFA 1RSTB 3AEHA 4I95A 3FA7A 2OL8O 1NQMA 1D2UA 4CDDA 3OJYC 4M6SA 1DC9A 3TZSA 1CBRA 4TLJA 4XMDA 5HCDC 2PI3O 2FR3A 2JW1A 4U8UO 4NNSA 1SY1A 3EM0A 4DQ4A 5HWZA 1SA8A 4OKAA 4U8UN 1FE3A 3BSZE 3P6HA 1X8PA 4PSQA 3SZHA 2WR6A 1SWUA 3SLJA 5B5FA 1SWAA 4ORUA 1CBSA 4QGVA 3JSQA 2JMBA 5AJCA 5EDBA 1KQXA 1SWGA 2FS6A 1SXWA 2CZUA 1VWMB 4MVIA 2FHLA 2OFBA 4NP1A 5BVTA 2X8TA 4R0BA 4ZHCA 2O62A 2X55A 1MM9A 3LHNA 4A1HA 4GJSA 1LDQA 1HBQA 1OPBA 3HWDA 3PK2A 1VWDB 1KT4A 4BGFA 1P6PA 1YIVA 4OMXA 2LBAA 2GTFX 1G7NA 4YGGA 5EZ2A 1N43A 1FENA 1A3YA 1SRIA 1Y55X 5H9KA 5DG4A 3APUA 5LJBA 2IZFB 2IZDB 2L9CA 2OVSA 1MVGA 4XMGA 3BY0A 3RE5A 4Z2PA 1OEKA 1IJ8A 1VWQB 1KZWA 2FGSA 2OF8A 4FBOA 4NYRA 1OPAA 1QQSA 2HZRA 3VG2A 1EUOA 1KOIA 3BX7A 4NYQA 4WFVA 1T8VA 1ALBA 1O1VA 1HBPA 5K68A 3WVMA 5H9AA 1Y0GA 1PEEA 4I60A 1ACDA 4IAWA 3JS1A 1TXLA 2BS6A 1W6FA 4Z27A 1GM6A 4YDBA 3HOEA 1ICMA 4AZMA 5EEDA 1JYDA 2R73A 1SY2A 1GT5A 2A0AA 2Y3FA 3KQ0A 4QNIA 2G79A 3FA9A 4WHIA 5HBSA 1VWAB 1STPA 2RTLA 4CPHA 1SWJA 2A5BA 3PP6A 1LCZA 4D6BA 2L5PA 2RTBB 1EPBA 1VWIB 3ZZVA 3SAOA 4YH0A 2RTFB 1Y9TA 4HWMA 3WJBA 4NLIA 3T2WA 1D3SA 5AJBA 3EW2A 2XSTA 3MVFA 3O19A 2X32A 4MVEA 2ALLX 2QOSC 1LIDA 3IA8A 2R74A 5HA0A 1LNMA 1ZNHA 3RSWA 3EBWA 2KTSA 3GE2A 2RTDB 3MX7A 2W2FA 4QAEA 2JGSA 3UEWA 1Z24A 5F6BA 1EQDA 2C1QA 2A13A 4HPCA 3HWEA 2X34A 1ZNGA 2LKKA 4YKOA 1VWFB 1NBXA 3CR6A 3STNA 4BX5B 4AYHA 5IO5A 2XKLA 2F01A 2LFOA 5HCCC 2RTPB 3WXQA 1BLRA 3HOLA 1EALA 3NADA 4I3BA 4CPIA 1SWTA 4CDFA 5D48A 1VWJB 1KXOA 1S2PA 2A2GA 4O9SA 1JV4A 1SWOA 5BVQA 2MJIA 4U8UM 1ZNKA 3FIDA 2GH7A 3B2KA 1YWBA 4DCBA 3NX1A 3WJGA 3BDRA 2BC3A 2ASNX 2K23A 1IFBA 2R56A 3P02A 1GX3A 3PDFA 3E3CA 4A1YA 1KT6A 4GETA 4MIRA 4B55A 3TGCA 1MEPA 2EU7X 2OY5O 4IMNA 2IZJA 2QO6A 1OEEA 2QCBA 2AL0X 1UYOX 3NP1A 4GJVA 4EQAC 3PQUA 1L6MA 2ACOA 3SZJA 3JQOA 3P24A 3KFFA 3BU1A 4OS3A 5BVSA 2AH7X 1SWSA 2X56A 1RSUB 2RTKA 5B2AO 4YFPA 5BYPA 1N9YA 4I3DA 1TW4A 3WYPA 3VU1A 4AZNA 4YMYA 2F73A 3VG4A 3B2HA 2ACPX 4QZUA 4ARHA 2QM9A 4GDAA 4O3WA 5HZQA 4CPEA 4O4UA 5HCEC 4BX7A 1PTSA 1B4MA 3T6LA 4EFGA 1BSQA 3PH5A 3ELXA 1UYNX 1VWGB 4XMHA 2Y32A 2GTLO 3D95A 3FEPA 5CE4A 2BLGA 3BS2A 4O3XB 1LIFA 3V8UA 1VWBB 2MM3A 2NNQA 4GD9A 2GTLN 4I9SA 4Y0RA 4JO6A 3T1DA 3ZW0A 1SWNA 1DZMA 1K3BA 1SLDB 2CBRA 3C77X 2Z4HA 4OS0A 4MVLA 4O4OA 1LICA 1I04A 1RXKA 2HLVA 3Q6LA 2A8GA 1QFTA 4WBKA 3SOTA 1GT3A 2RTQB 1SY3A 4GE1A 1MUPA 1TOUA 4IRWA 3KVNA 1AELA 2WQ9A 1ZNLA 4TNNA 4GDZA 1CJ5A 1U0XA 4BQUA 4FBVA 2JOZA 4BX6A 4GZVA 2HYSA 4ZH9A 3CKFA 4ZH6A 3I0AA 1OEJA 1KL5A 4XMEA 3FR4A 4QQ1A 2NNEA 5IRWA 5HTEA 1STRB 1HY2A 1I06A 4QYPA 4TKHA 2CBSA 1SREA 5F58A 1BRQA 2G7BA 4O3YA 2OZQA 3WZPA 1OSPO 2FHNX 2GC9A 2LB6A 1BSYA 3FR5A 3NBXX 2I5ZO 3CQNA 4KC7A 4CK4A 1GKAA 1VWCB 4EEJA 2IZKA 2DM5A 4GH7A 4ZJ0A 3FW5A 2VDFA 3QQ2A 4KH8A 1JYJA 4LQZA 2A2UA 3HWGA 3G7XA 1LCWA 1MK5A 5IO6A 2WEXA 3KFGA 3LV4A 1AQBA 4QRLA 4COTA 1SY0A 5KIDA 3U0DA 1LCVA 3UEVA 1LPJA 1K24A 5F7GA 4M7MA 4UU3A 3EBKA 1AVEA 2M4LA 2MHDA 2RQ0A 3RY1A 1H91A 1SWBA 5DPQA 3WJFA 5B3MO 1ERXA 1SRHA 1SRFA 1T0VA 1WBIA 2OVAA 4GNWA 4IB8A 5LJDA 2RA6A 4ZGFA 3BRNA 1LF7A 1GX8A 1QWDA 2A5CA 1VWPB 2W2AA 2JU8A 2HKDA 1G85A 3BLGA 3LTWA 2OFRX 1BWYA 3VG5A 2ANSA 3ZW2A 4A60A 1B0OA 4A8ZA 3FEKA 1X8QA 3ZW1B 1SLGB 4L1NA 5L3YA 1AVGI 1SWEA 4U3QA 1JZUA 5CSEA 1SWPA 1X8NA 3C76X 4HPAA 4D6AA 1U17A 1VWLB 4MISA 3NQKA 2Q2MA 1PM1X 1FEMA 2YMSA 2HNXA 4FQBB 5FQ8E 3KFHA 1SXUA 5L8NA 5F6ZA 3FR2A 2BT9A 5D45A 2RTGB 4AZRA 3WJDA 2X45A 4Z6JA 1N4JA 1JJJA 5HZ9A 2BS5A 2IZEB 4MEEA 2X8SA 5D8JA 3WOVA 5FFHA 4LKPA 2Q2PA 2AT3X 3APVA 2WSJA 1JBHA 1A57A 1MX8A 2WEWA 1R0UA 4XMFA 4YGHA 3OBLA 5HZ8A 3S60A 3IFBA 2OFAA 4N7DA 2IFBA 2QOMA 1JQPA 3RZYA 4TQ2A 3UEXA 1SRGA 1BRPA 2MF6A 2NNDA 4HFOA 1O8VA 2L67A 4Y5DA 1EPAA 3EMMA 5IRUA 3VG6A 4ALBA 3P6EA 1EXSA 2Q4NA 3DSZA 3FDCA 1UZ2X 3MG5A 3STMX 5B27A 1VYOA 2RCTA 3VHIA 1EIIA 1DF8A 2GTLM 3HWFA 3PQSA 1X71A 1Y53X 1KZXA 2FTBA 1O1UA 1MDCA 5CYBA 1E06A 3CKGA 3FELA 1VWHB 1S7DA 4HPDA 5HA1A 2NP1A 4MVKA 2OYBO 4CPFA 1DV9A 1GXAA 1YWCA 1YWDA 1XCAA 1JMXA 2KTDA 1IKJA 1E02A 4PJ2A 3ZQ3A 1SWLA 2AF5A 3VE2A 5L8OA 1OBQA 3RDOA 4QGWA 1MX7A 1SWHA 2UYWA 3FLLA 1BSOA 2LBVA 1E00A 1SXYA 2RN4A 4ID2A 4N7CA 4AZOA 4DQ3A 3VHHA 4KCAA 1TOWA 3S26A 4YGZA 5EPQA 4ZHHA 1B8EA 1ML7A 2BHVA 2C4IA 2FKGA 3HPEA 5B11O 4BVMA 4DNEA 2X8FA 2IZIA 4ZGUA 1SWRA 2RTEB 3MBTA 2CZTA 2OY8A 3RKGA 5B29A 1QY1A 2RTRB 2CAMA 2IZCB 4O4SA 3WBGA 1HMSA 4LKTA 4BCSA 1W4TA 2KD2A 2KT4B 2RTCB 1PMPA 4GK9A 4ORYA 1VYGA 4GU8A 2FT9A 4IB9A 1JJXA 1HN2A 2IZHB 1JIWI 2F09A 2MWHA 3D9WA 3KFIA 4CPHB 5KHPA 4ORWA 3U9PC 1RAVA 1SWFA 3S5XA 3RBYA 4KIIA 4L3RA 3FA8A 4RUUA 5CHKA 4TKBA 2VFCA 1SLFB 1DZJA 3H3IA 3ZUIA 1TVQA 5AEOA 1QABE 2QMIA 2FRSA 2OY1O 4ZHFA 2Y3EA 2E4JA 3P6GA 1IFCA 5HZ5A 2ZAIA 1BJ7A 1NDJA 4ORSA 3CBCA 1KL4A 1N7YA 4GNYA 2X4MA 4AW8A 5K06A 1ZNDA 3WZQA 1LDOA 1X8OA 3FIQA 1FJ1E 1WUBA 4TKJA 4ZHDA 2G78A 5LJHA 2RTMA 1X8UA 2FS7A 3ZI8A 1SLEB 4LZVA 2OFMX 1A18A 1PBOA 1RBPA 3ZWEA 4YBPA 3D96A 4ZHGA 5FAZA 1BBPA 2AT6X 1LIBA 1NQNA 2LA7A 1VWRB 4GGZA 4ZR2A 3T2XA 3VHMA 2Z4IA 1QFVA 4GKCA 4O49A 3F6ZB 1G5WA 3HK1A 2L68A 3WZNA 5IXGA 1CBIA 4ML7B 2QO4A 4GUZA 5HTDA 1BM5A 1NP4A 1KQWA 1SXXA 1GGLA 2RCQA 3P6FA 3T6FA 1YUPA 3RY2A 3WYQA 5FQ7E 1JMZA 3CQRA 4Z2VA 4GGTA 2VFBA 4CDCA 4Z2OA 2ZAGA 4O4XA 1SMPI 1N9MA 5B5GA 1DZPA 2FLJA 3WJCA 2WQAE 3PEDA 4NLJA 1EI5A 1HMRA 2RTAA 1YP6A 2OL6O 1CBQA 4BBOA 3C78X 5B10O 4LZUA 1PBYA
chains in the Genus database with same CATH topology
3EYCA 3D4RA 3OE3A 5EDCA 5C0NA 4ZFXA 5LKFA 4EXZA 5EEEA 4QZTA 2Q9SA 1NGLA 2RD7C 4ALOA 1E5PA 4RUNA 2Q39A 1XKIA 3GAQA 2FWVA 5JR8A 3AKNA 3K3LA 1BEBA 2QO5A 1AB0A 1IKEA 2OVDA 1HQPA 3FMZA 1LIEA 2AT5X 4TJZA 4ES7A 2CM4A 2WWPA 2W2BA 3FW4A 3F9DA 1T68X 3PECA 3ZUOA 5H8TA 4ON1A 3TF6A 3TGBA 4YFQA 2HMBA 4CV7A 1GT1A 3ZW0B 1N0SA 1KGLA 4K19A 4CSBA 4HPBA 3CMPA 1X89A 4OS8A 3B2JA 5KICA 1FELA 1FDQA 3OD9A 2P8GA 2AT0X 3S5VA 1HMTA 3O2YA 1U18A 1A2DA 1DZKA 1S44A 3STKA 1NP1A 3P6CA 3D97A 4U9CA 4IMOA 3CWKA 5FQ6E 3CBSA 3O22A 4WFUA 2MO5A 1Y9LA 1QG5A 3L4RA 3NQ3A 3VG7A 4AZQA 1KT5A 4NW4A 1OBUA 3N91A 4IB7A 4ZCBA 4IB6A 1GKAB 5FENA 1DF3A 1I05A 2AT8X 2JU3A 2FR2A 3UEUA 3APXA 5LJEA 1KT7A 3WJEA 3AKMA 1FTPA 4IABA 2A3FX 4Y0PA 5L8IA 1ZRYA 3FA6A 4ORXA 5HAEA 4YCEA 4FGIB 4OMWA 3HTYA 3BU9A 1VPRA 2K62A 2WUTA 3APWA 1ZNEA 5D4AA 3NQ9A 4YBUA 4QYNA 3RWXA 4YFRA 2JU7A 1ICNA 3VG3A 1GT4A 1YWAA 1GX9A 3QKGA 4I3CA 1IW2A 5F1EA 3KZAA 4I9RA 3UAQA 4O3ZA 1B56A 1QY2A 4GRJA 3TGAA 3PPTA 4ORRA 1ERBA 4IBAA 5D47A 1ADLA 2PY1A 2AKQA 4KC8A 5FAZA 1EW3A 4AZPA 1RLBE 2CM9A 3FENA 3PH6A 4YKMA 4QGXA 1DFVA 5HZ6A 1QY0A 4YDAA 5LJGA 3VE1A 1VYFA 1YP7A 3DTQA 4KT5A 3F8AA 1KT3A 2X46A 4JGLA 1CRBA 4NNTA 5LKEA 4ODDA 1IIUA 4BOEA 4EDEA 1LFOA 3ELZA 3NR3A 5AQ6A 3NPOA 4Y0QA 4YCHA 3P6DA 5H9NA 4FBRA 5LJCA 2OVEA 4IAXA 1EIOA 5IO7A 2HZQA 2JN3A 2AMMX 4INNA 4I6SA 4Y0SA 3VPJE 1UREA 2YG2A 3ZW1A 2GJ5A 5LJKA 3BX8A 4XMCA 1I4UA 3NX2A 3B2IA 3B2LA 3I17A 1OBPA 4UU2A 5H9LA 2POAA 1G74A 2N93A 2KW1A 3FYFA 4I95A 3FA7A 3TZSA 1D2UA 3OJYC 4M6SA 1DC9A 1CBRA 4TLJA 4XMDA 5HCDC 2FR3A 2JW1A 4U8UO 4NNSA 1SY1A 3EM0A 4DQ4A 5HWZA 1SA8A 4U8UN 1FE3A 3BSZE 3P6HA 1X8PA 4PSQA 2WR6A 4ORUA 4QGVA 1CBSA 3JSQA 2JMBA 5AJCA 5EDBA 1KQXA 2FS6A 1SXWA 2CZUA 4MVIA 4NP1A 5BVTA 2X8TA 4R0BA 4ZHCA 2O62A 3LHNA 4A1HA 1HBQA 1OPBA 3HWDA 1KT4A 1P6PA 1YIVA 4OMXA 2LBAA 2GTFX 1G7NA 4YGGA 5EZ2A 5H9KA 1FENA 1A3YA 5B27A 5DG4A 3APUA 5LJBA 2L9CA 2OVSA 1MVGA 4XMGA 3BY0A 1KZWA 1OEKA 4FBOA 4NYRA 1OPAA 1QQSA 2HZRA 3VG2A 1EUOA 1KOIA 3BX7A 4NYQA 4WFVA 1T8VA 1ALBA 1O1VA 1HBPA 3WVMA 5H9AA 1PEEA 1ACDA 4IAWA 3JS1A 1TXLA 2BS6A 1GM6A 4YDBA 3HOEA 1ICMA 4AZMA 5EEDA 1JYDA 2R73A 1SY2A 1GT5A 2A0AA 5HBSA 3KQ0A 4QNIA 2G79A 3FA9A 4WHIA 3PP6A 4D6BA 2L5PA 1EPBA 3ZZVA 3SAOA 4YH0A 1Y9TA 4HWMA 3WJBA 4NLIA 1D3SA 5AJBA 2XSTA 3MVFA 3O19A 4MVEA 2ALLX 2QOSC 1LIDA 3IA8A 2R74A 5HA0A 1LNMA 1ZNHA 3RSWA 3EBWA 2KTSA 3GE2A 3MX7A 2W2FA 4QAEA 3UEWA 1Z24A 5F6BA 1EQDA 2A13A 4HPCA 3HWEA 1ZNGA 2LKKA 4YKOA 3CR6A 3STNA 4AYHA 5IO5A 2XKLA 2LFOA 5HCCC 3WXQA 1BLRA 3HOLA 1EALA 3NADA 4I3BA 5D48A 1KXOA 1S2PA 2A2GA 4O9SA 1JV4A 5BVQA 2MJIA 4U8UM 1ZNKA 3B2KA 1YWBA 3NX1A 3WJGA 3BDRA 2ASNX 2K23A 1IFBA 2R56A 3P02A 3E3CA 4A1YA 1KT6A 4GETA 4MIRA 3TGCA 2EU7X 4IMNA 2QO6A 1OEEA 2AL0X 3NP1A 4EQAC 3PQUA 1L6MA 2ACOA 3JQOA 3P24A 3KFFA 3BU1A 4OS3A 5BVSA 2AH7X 4YFPA 4I3DA 1TW4A 3VU1A 4AZNA 4YMYA 2F73A 3VG4A 3B2HA 2ACPX 4QZUA 4ARHA 2QM9A 4O3WA 5HZQA 4O4UA 5HCEC 1B4MA 4EFGA 1BSQA 3PH5A 3ELXA 4XMHA 2GTLO 3D95A 3FEPA 5CE4A 2BLGA 3BS2A 4O3XB 1LIFA 3V8UA 2NNQA 2MM3A 4I9SA 4Y0RA 2GTLN 3ZW0A 3U03A 3T1DA 1DZMA 2CBRA 4OS0A 3C77X 2Z4HA 4MVLA 4O4OA 1LICA 1I04A 2HLVA 3Q6LA 1QFTA 4WBKA 3SOTA 1GT3A 1SY3A 4GE1A 1MUPA 1TOUA 1AELA 2WQ9A 1ZNLA 4TNNA 4GDZA 1CJ5A 1U0XA 4BQUA 4FBVA 2JOZA 4GZVA 2HYSA 4ZH9A 4ZH6A 3I0AA 1OEJA 4XMEA 3FR4A 4QQ1A 2NNEA 5HTEA 1I06A 4QYPA 4TKHA 2CBSA 5F58A 1BRQA 2G7BA 4O3YA 2OZQA 2GC9A 2LB6A 3FR5A 3NBXX 1BSYA 4KC7A 4CK4A 3CQNA 1GKAA 4EEJA 4GH7A 2DM5A 4ZJ0A 3FW5A 4KH8A 1JYJA 4LQZA 2A2UA 3HWGA 3G7XA 5IO6A 2WEXA 3KFGA 3LV4A 1AQBA 4QRLA 4COTA 1SY0A 5KIDA 3U0DA 3UEVA 1LPJA 5F7GA 4M7MA 4UU3A 3EBKA 2M4LA 2MHDA 2RQ0A 1H91A 5DPQA 3WJFA 1ERXA 1T0VA 4GNWA 2OVAA 4IB8A 5LJDA 2RA6A 4ZGFA 3BRNA 1LF7A 1GX8A 1QWDA 2W2AA 2JU8A 3BLGA 1G85A 2OFRX 1BWYA 3VG5A 2ANSA 3ZW2A 4A60A 1B0OA 4A8ZA 3FEKA 1X8QA 3ZW1B 4L1NA 1AVGI 4U3QA 1JZUA 1X8NA 3C76X 4HPAA 4D6AA 1U17A 4MISA 3NQKA 2Q2MA 1PM1X 1FEMA 2YMSA 2HNXA 4FQBB 5FQ8E 3KFHA 1SXUA 5L8NA 5F6ZA 3FR2A 2BT9A 5D45A 4AZRA 3WJDA 2X45A 1JJJA 5HZ9A 2BS5A 2X8SA 5D8JA 3WOVA 5FFHA 4LKPA 2Q2PA 2AT3X 3APVA 2WSJA 1JBHA 1A57A 1MX8A 2WEWA 1R0UA 4XMFA 4YGHA 3OBLA 5HZ8A 3S60A 3IFBA 4N7DA 4TQ2A 2IFBA 3RZYA 3UEXA 1BRPA 2NNDA 4HFOA 1O8VA 2L67A 1EPAA 3EMMA 3VG6A 4ALBA 3P6EA 1EXSA 2Q4NA 3DSZA 1UZ2X 3STMX 1EIIA 2RCTA 2GTLM 3PQSA 3HWFA 1X71A 1KZXA 2FTBA 1O1UA 1MDCA 5CYBA 1E06A 3FELA 4HPDA 1S7DA 5HA1A 2NP1A 4MVKA 1DV9A 1GXAA 1YWCA 1YWDA 1XCAA 2KTDA 4PJ2A 1IKJA 1E02A 3ZQ3A 5BYPA 3VE2A 5L8OA 1OBQA 4QGWA 1MX7A 3FLLA 1BSOA 2LBVA 1E00A 1SXYA 2RN4A 4ID2A 4N7CA 4AZOA 4DQ3A 4KCAA 1TOWA 3S26A 4YGZA 5EPQA 4ZHHA 1B8EA 1ML7A 2BHVA 4BVMA 4ZGUA 1JJXA 2X8FA 3MBTA 2CZTA 3RKGA 5B29A 1QY1A 4O4SA 3WBGA 1HMSA 4LKTA 2KD2A 2KT4B 1PMPA 4GK9A 4ORYA 1VYGA 4GU8A 2FT9A 4IB9A 1HN2A 1JIWI 2F09A 2MWHA 3KFIA 5KHPA 4ORWA 3U9PC 3S5XA 3RBYA 4KIIA 4L3RA 3FA8A 4RUUA 4TKBA 1DZJA 3H3IA 3ZUIA 1TVQA 5AEOA 1QABE 2QMIA 2FRSA 4ZHFA 2E4JA 3P6GA 1IFCA 5HZ5A 2ZAIA 1BJ7A 4ORSA 3CBCA 4AW8A 4GNYA 5K06A 1ZNDA 1X8OA 3FIQA 4TKJA 4ZHDA 2G78A 5LJHA 1X8UA 2FS7A 3ZI8A 4LZVA 2OFMX 1A18A 1PBOA 1RBPA 3ZWEA 4YBPA 3D96A 4ZHGA 1BBPA 2AT6X 1LIBA 2LA7A 4ZR2A 2Z4IA 1QFVA 4GKCA 4O49A 3F6ZB 1G5WA 3HK1A 2L68A 1CBIA 4ML7B 2QO4A 5HTDA 1BM5A 1NP4A 1KQWA 1SXXA 1GGLA 2RCQA 3P6FA 1YUPA 5FQ7E 3CQRA 2ZAGA 4O4XA 1SMPI 1DZPA 2FLJA 3WJCA 2WQAE 3PEDA 4NLJA 1EI5A 1HMRA 1YP6A 1CBQA 3C78X 4LZUA 1LKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYC A;  5EDC A;  5C0N A;  4ZFX A;  5LKF A;  4EXZ A;  5EEE A;  4QZT A;  2Q9S A;  1NGL A;  2RD7 C;  4ALO A;  1E5P A;  4RUN A;  2Q39 A;  1XKI A;  3GAQ A;  2FWV A;  5JR8 A;  3AKN A;  3K3L A;  1BEB A;  2QO5 A;  1AB0 A;  1IKE A;  2OVD A;  1HQP A;  3FMZ A;  1LIE A;  2AT5 X;  4TJZ A;  4ES7 A;  2CM4 A;  2WWP A;  2W2B A;  3FW4 A;  3F9D A;  1T68 X;  3PEC A;  3ZUO A;  5H8T A;  3TGB A;  3TF6 A;  4YFQ A;  2HMB A;  1KGL A;  1GT1 A;  1N0S A;  4K19 A;  4HPB A;  3CMP A;  1X89 A;  4OS8 A;  3B2J A;  5KIC A;  1FEL A;  1FDQ A;  2P8G A;  2AT0 X;  1HMT A;  3O2Y A;  1U18 A;  1A2D A;  1DZK A;  1S44 A;  3STK A;  1NP1 A;  3P6C A;  3D97 A;  4IMO A;  3CWK A;  3CBS A;  3O22 A;  4WFU A;  2MO5 A;  3L4R A;  1QG5 A;  3NQ3 A;  3VG7 A;  4AZQ A;  1KT5 A;  1OBU A;  4IB7 A;  4ZCB A;  4IB6 A;  1GKA B;  5FEN A;  1DF3 A;  1I05 A;  2AT8 X;  2JU3 A;  2FR2 A;  3UEU A;  3APX A;  5LJE A;  1KT7 A;  3WJE A;  3AKM A;  1FTP A;  2A3F X;  4Y0P A;  5L8I A;  1ZRY A;  3FA6 A;  4ORX A;  5HAE A;  4YCE A;  4OMW A;  3BU9 A;  1VPR A;  2K62 A;  2WUT A;  3APW A;  1ZNE A;  5D4A A;  3NQ9 A;  4YBU A;  4QYN A;  4YFR A;  2JU7 A;  1ICN A;  3VG3 A;  1GT4 A;  1YWA A;  1GX9 A;  3QKG A;  4I3C A;  1IW2 A;  5F1E A;  3KZA A;  4I9R A;  1B56 A;  1QY2 A;  4GRJ A;  3TGA A;  3PPT A;  4ORR A;  1ERB A;  4IBA A;  5D47 A;  1ADL A;  2PY1 A;  2AKQ A;  5FAZ A;  1EW3 A;  4AZP A;  1RLB E;  2CM9 A;  3FEN A;  3PH6 A;  4YKM A;  4QGX A;  1DFV A;  5HZ6 A;  1QY0 A;  4YDA A;  5LJG A;  1VYF A;  1YP7 A;  3DTQ A;  3F8A A;  1KT3 A;  2X46 A;  1CRB A;  4NNT A;  5LKE A;  4ODD A;  1IIU A;  4BOE A;  4EDE A;  1LFO A;  3ELZ A;  3NR3 A;  5AQ6 A;  3NPO A;  4Y0Q A;  4YCH A;  3P6D A;  5H9N A;  5LJC A;  2OVE A;  4IAX A;  1EIO A;  5IO7 A;  2HZQ A;  2JN3 A;  2AMM X;  4Y0S A;  1URE A;  2YG2 A;  5LJK A;  2GJ5 A;  3BX8 A;  4XMC A;  1I4U A;  3NX2 A;  3B2I A;  3B2L A;  3I17 A;  1OBP A;  4UU2 A;  5H9L A;  2POA A;  1G74 A;  2N93 A;  3FA7 A;  3TZS A;  1D2U A;  3OJY C;  4M6S A;  1DC9 A;  1CBR A;  4TLJ A;  4XMD A;  5HCD C;  2FR3 A;  4NNS A;  1SY1 A;  3EM0 A;  4DQ4 A;  5HWZ A;  1SA8 A;  1FE3 A;  3BSZ E;  3P6H A;  1X8P A;  4PSQ A;  2WR6 A;  4ORU A;  4QGV A;  1CBS A;  3JSQ A;  5EDB A;  1KQX A;  2FS6 A;  1SXW A;  2CZU A;  4MVI A;  4NP1 A;  5BVT A;  4R0B A;  4ZHC A;  2O62 A;  4A1H A;  1HBQ A;  1OPB A;  3HWD A;  1KT4 A;  1P6P A;  1YIV A;  4OMX A;  2LBA A;  2GTF X;  1G7N A;  4YGG A;  5EZ2 A;  5H9K A;  1FEN A;  1A3Y A;  5B27 A;  5DG4 A;  3APU A;  5LJB A;  2L9C A;  1MVG A;  4XMG A;  3BY0 A;  1KZW A;  1OEK A;  4NYR A;  1OPA A;  1QQS A;  2HZR A;  3VG2 A;  1EUO A;  1KOI A;  3BX7 A;  4NYQ A;  4WFV A;  1T8V A;  1ALB A;  1O1V A;  1HBP A;  3WVM A;  5H9A A;  1PEE A;  1ACD A;  4IAW A;  3JS1 A;  1TXL A;  1GM6 A;  4YDB A;  1ICM A;  4AZM A;  5EED A;  1JYD A;  2R73 A;  1SY2 A;  1GT5 A;  2A0A A;  5HBS A;  3KQ0 A;  2G79 A;  3FA9 A;  3PP6 A;  4D6B A;  2L5P A;  1EPB A;  3SAO A;  4YH0 A;  3WJB A;  4NLI A;  1D3S A;  2XST A;  3MVF A;  3O19 A;  2QOS C;  2ALL X;  1LID A;  3IA8 A;  2R74 A;  5HA0 A;  1LNM A;  1ZNH A;  3RSW A;  3EBW A;  2W2F A;  4QAE A;  3UEW A;  1Z24 A;  5F6B A;  1EQD A;  2A13 A;  4HPC A;  3HWE A;  1ZNG A;  2LKK A;  4YKO A;  3CR6 A;  3STN A;  4AYH A;  5IO5 A;  2XKL A;  2LFO A;  5HCC C;  3WXQ A;  1BLR A;  1EAL A;  3NAD A;  4I3B A;  5D48 A;  1KXO A;  1S2P A;  2A2G A;  4O9S A;  1JV4 A;  5BVQ A;  2MJI A;  1ZNK A;  3B2K A;  1YWB A;  3NX1 A;  3WJG A;  3BDR A;  2ASN X;  2K23 A;  1IFB A;  2R56 A;  4A1Y A;  1KT6 A;  4GET A;  3TGC A;  2EU7 X;  4IMN A;  2QO6 A;  1OEE A;  2AL0 X;  3NP1 A;  1L6M A;  2ACO A;  3KFF A;  3BU1 A;  4OS3 A;  5BVS A;  2AH7 X;  4YFP A;  4I3D A;  1TW4 A;  4AZN A;  4YMY A;  2F73 A;  3VG4 A;  3B2H A;  2ACP X;  4QZU A;  4ARH A;  2QM9 A;  5HZQ A;  5HCE C;  1B4M A;  4EFG A;  1BSQ A;  3PH5 A;  3ELX A;  4XMH A;  3D95 A;  3FEP A;  2BLG A;  3BS2 A;  1LIF A;  2NNQ A;  2MM3 A;  4I9S A;  4Y0R A;  3U03 A;  3T1D A;  1DZM A;  2CBR A;  4OS0 A;  3C77 X;  4MVL A;  1LIC A;  1I04 A;  2HLV A;  3Q6L A;  1QFT A;  4WBK A;  1GT3 A;  1SY3 A;  4GE1 A;  1MUP A;  1TOU A;  1AEL A;  2WQ9 A;  1ZNL A;  4TNN A;  1CJ5 A;  1U0X A;  4BQU A;  2JOZ A;  2HYS A;  4ZH9 A;  4ZH6 A;  3I0A A;  1OEJ A;  4XME A;  3FR4 A;  2NNE A;  5HTE A;  1I06 A;  4QYP A;  4TKH A;  2CBS A;  5F58 A;  1BRQ A;  2G7B A;  2OZQ A;  2GC9 A;  2LB6 A;  3FR5 A;  1BSY A;  4CK4 A;  3CQN A;  1GKA A;  4EEJ A;  4GH7 A;  2DM5 A;  4ZJ0 A;  3FW5 A;  1JYJ A;  2A2U A;  3HWG A;  3G7X A;  5IO6 A;  2WEX A;  3KFG A;  1AQB A;  3U0D A;  1SY0 A;  5KID A;  3UEV A;  1LPJ A;  5F7G A;  4M7M A;  4UU3 A;  3EBK A;  2RQ0 A;  1H91 A;  5DPQ A;  3WJF A;  1ERX A;  1T0V A;  4GNW A;  2OVA A;  4IB8 A;  5LJD A;  2RA6 A;  3BRN A;  1LF7 A;  1GX8 A;  1QWD A;  2W2A A;  2JU8 A;  3BLG A;  1G85 A;  2OFR X;  1BWY A;  3VG5 A;  2ANS A;  4A8Z A;  4A60 A;  1B0O A;  3FEK A;  1X8Q A;  1AVG I;  1JZU A;  1X8N A;  3C76 X;  4HPA A;  4D6A A;  1U17 A;  2Q2M A;  1PM1 X;  1FEM A;  2HNX A;  3KFH A;  1SXU A;  5L8N A;  5F6Z A;  3FR2 A;  5D45 A;  4AZR A;  3WJD A;  2X45 A;  1JJJ A;  5HZ9 A;  5D8J A;  5FFH A;  4LKP A;  2Q2P A;  2AT3 X;  3APV A;  2WSJ A;  1JBH A;  1A57 A;  1MX8 A;  2WEW A;  1R0U A;  4XMF A;  4YGH A;  5HZ8 A;  3IFB A;  4N7D A;  4TQ2 A;  2IFB A;  3RZY A;  3UEX A;  1BRP A;  2NND A;  4HFO A;  1O8V A;  2L67 A;  1EPA A;  3EMM A;  3VG6 A;  4ALB A;  3P6E A;  1EXS A;  2Q4N A;  3DSZ A;  1UZ2 X;  3STM X;  1EII A;  2RCT A;  3HWF A;  1X71 A;  1KZX A;  2FTB A;  1O1U A;  1MDC A;  1E06 A;  3FEL A;  4HPD A;  1S7D A;  5HA1 A;  2NP1 A;  4MVK A;  1DV9 A;  1GXA A;  1YWC A;  1YWD A;  1XCA A;  2KTD A;  3ZQ3 A;  1IKJ A;  1E02 A;  5CE4 A;  5L8O A;  1OBQ A;  4QGW A;  1MX7 A;  3FLL A;  1BSO A;  2LBV A;  1E00 A;  1SXY A;  4N7C A;  4AZO A;  4DQ3 A;  1TOW A;  3S26 A;  4YGZ A;  5EPQ A;  4ZHH A;  1B8E A;  1ML7 A;  4BVM A;  4ZGU A;  1JJX A;  3MBT A;  2CZT A;  5B29 A;  1QY1 A;  3WBG A;  1HMS A;  4LKT A;  2KT4 B;  1PMP A;  4ORY A;  1VYG A;  4IB9 A;  2FT9 A;  1HN2 A;  3KFI A;  5KHP A;  4ORW A;  3U9P C;  4KII A;  4TKB A;  3FA8 A;  4RUU A;  1DZJ A;  3ZUI A;  1TVQ A;  1QAB E;  4ZHF A;  2FRS A;  2E4J A;  3P6G A;  1IFC A;  5HZ5 A;  1BJ7 A;  4ORS A;  3CBC A;  4AW8 A;  4GNY A;  5K06 A;  1ZND A;  1X8O A;  3FIQ A;  4TKJ A;  4ZHD A;  2G78 A;  5LJH A;  1X8U A;  2FS7 A;  4LZV A;  2OFM X;  1A18 A;  1PBO A;  1RBP A;  4YBP A;  4ZHG A;  3D96 A;  1BBP A;  2AT6 X;  1LIB A;  4ZR2 A;  4GKC A;  1QFV A;  1G5W A;  3HK1 A;  2L68 A;  1CBI A;  2QO4 A;  5HTD A;  1BM5 A;  1NP4 A;  1KQW A;  1SXX A;  1GGL A;  2RCQ A;  3P6F A;  1YUP A;  3CQR A;  1DZP A;  2FLJ A;  3WJC A;  2WQA E;  3PED A;  4NLJ A;  1HMR A;  1YP6 A;  1CBQ A;  3C78 X;  4LZU A;  1LKE A; 
#chains in the Genus database with same CATH topology
 3EYC A;  3D4R A;  3OE3 A;  5EDC A;  5C0N A;  4ZFX A;  4C5P A;  5LKF A;  3WZO A;  3VGW A;  4EXZ A;  1AVD A;  4QZT A;  5EEE A;  5F2B A;  2Q9S A;  1NGL A;  2RD7 C;  4U46 A;  4ALO A;  1E5P A;  2ZSC A;  4RUN A;  2Q39 A;  1XKI A;  3GAQ A;  2FWV A;  5JR8 A;  3AKN A;  4BJ8 A;  3K3L A;  3SZI A;  4BX5 A;  1BEB A;  2QO5 A;  1AB0 A;  1IKE A;  2DJF A;  2OVD A;  1HQP A;  3FMZ A;  1I78 A;  2RTI B;  4NV8 A;  1LIE A;  2AT5 X;  4TJZ A;  4ES7 A;  3EW1 A;  2CM4 A;  2WWP A;  1SWC A;  4BX7 B;  2W2B A;  4Y59 A;  2FKJ A;  3FW4 A;  4YVB A;  3F9D A;  1T68 X;  3PEC A;  3ZUO A;  5H8T A;  3RDS A;  4ON1 A;  3TF6 A;  3TGB A;  5K67 A;  3SLT A;  4YFQ A;  2HMB A;  4CV7 A;  1GT1 A;  3ZW0 B;  1N0S A;  1KGL A;  3Q34 A;  2RTJ A;  4K19 A;  4CSB A;  1E2T A;  4HPB A;  3CMP A;  1X89 A;  4OS8 A;  3B2J A;  5KIC A;  1FEL A;  1FDQ A;  3OD9 A;  3RDM A;  2P8G A;  2AT0 X;  3S5V A;  1NC9 A;  1HMT A;  3O2Y A;  1SWK A;  1U18 A;  1A2D A;  1DZK A;  1S44 A;  3STK A;  1NP1 A;  3P6C A;  4BX6 B;  3D97 A;  4U9C A;  2I5V O;  3MM0 A;  4IMO A;  3CWK A;  5FQ6 E;  3CBS A;  3O22 A;  4WFU A;  3X00 A;  2BSZ A;  2MO5 A;  1Y9L A;  1QG5 A;  3L4R A;  3NQ3 A;  3RE6 A;  3VG7 A;  4AZQ A;  1KT5 A;  4NW4 A;  2IZA A;  1OBU A;  3N91 A;  4IB7 A;  4ZCB A;  2OY7 A;  1VWK B;  4IB6 A;  1GKA B;  5FEN A;  1DF3 A;  1I05 A;  1VWN B;  2AT8 X;  2JU3 A;  2FR2 A;  3UEU A;  4CDE A;  3APX A;  5LJE A;  1KT7 A;  4JNJ A;  3WJE A;  3AKM A;  1FTP A;  2OL7 A;  4IAB A;  2IZG B;  4FBR A;  1SWD A;  3SLO A;  2A3F X;  2AVI A;  4Y0P A;  5L8I A;  1ZRY A;  3FA6 A;  4NV7 A;  4ORX A;  5HAE A;  4YCE A;  4FGI B;  4OMW A;  1VWE B;  3HTY A;  1SRJ A;  3BU9 A;  1MOY A;  1VPR A;  2K62 A;  1SWQ A;  2IZB A;  2WUT A;  4Z28 A;  4OEL A;  3APW A;  1ZNE A;  5D4A A;  3NQ9 A;  3RDQ A;  4YBU A;  4QYN A;  3RWX A;  4YFR A;  2JU7 A;  1ICN A;  2RTO B;  3VG3 A;  1GT4 A;  1YWA A;  1GX9 A;  1KFF A;  3EC5 A;  3QKG A;  1IW2 A;  4I3C A;  5F1E A;  3KZA A;  5IRA A;  4I9R A;  3RDX A;  2IZL B;  4O3Z A;  5JD2 A;  3UAQ A;  1B56 A;  1Y52 X;  1QY2 A;  4GRJ A;  3TGA A;  3PPT A;  2RTN B;  4ORR A;  1ERB A;  4IBA A;  1LKE A;  5D47 A;  1ADL A;  2PY1 A;  2AKQ A;  4GGR A;  1JJU A;  4KC8 A;  1EW3 A;  1HXL A;  1RLB E;  2CM9 A;  3FEN A;  3PH6 A;  4JHQ A;  4YKM A;  4AZP A;  1RXH A;  4QGX A;  1DFV A;  1LUQ A;  5HZ6 A;  4OEM A;  1QY0 A;  4YDA A;  5LJG A;  3VE1 A;  2G5L A;  1VYF A;  1YP7 A;  3DTQ A;  1KL3 A;  1STS B;  2DJG A;  2OF9 A;  4KT5 A;  3F8A A;  1KT3 A;  2RTH B;  2X46 A;  1CRB A;  4JGL A;  4NNT A;  5LKE A;  4ODD A;  1IIU A;  4BOE A;  3AUM O;  4EDE A;  1LFO A;  3ELZ A;  3NR3 A;  5AQ6 A;  1I9H A;  2UZ2 A;  3NPO A;  3P6D A;  4Y0Q A;  4YCH A;  5H9N A;  3RDU A;  5LJC A;  2OVE A;  4IAX A;  3U03 A;  1HXZ A;  1EIO A;  5IO7 A;  1W5R A;  2HZQ A;  2JN3 A;  2AMM X;  2G8C O;  4I6S A;  4INN A;  4Y0S A;  3VPJ E;  4EKV A;  1URE A;  2YG2 A;  1VWO B;  2C1S A;  3ZW1 A;  2GJ5 A;  5LJK A;  1RXJ A;  3BX8 A;  4XMC A;  1I4U A;  3NX2 A;  3B2I A;  3B2L A;  3I17 A;  1OBP A;  4UU2 A;  5H9L A;  2POA A;  1G74 A;  1HQQ A;  1LEL A;  2N93 A;  2KW1 A;  2WPU A;  3FYF A;  1RST B;  3AEH A;  4I95 A;  3FA7 A;  2OL8 O;  1NQM A;  1D2U A;  4CDD A;  3OJY C;  4M6S A;  1DC9 A;  3TZS A;  1CBR A;  4TLJ A;  4XMD A;  5HCD C;  2PI3 O;  2FR3 A;  2JW1 A;  4U8U O;  4NNS A;  1SY1 A;  3EM0 A;  4DQ4 A;  5HWZ A;  1SA8 A;  4OKA A;  4U8U N;  1FE3 A;  3BSZ E;  3P6H A;  1X8P A;  4PSQ A;  3SZH A;  2WR6 A;  1SWU A;  3SLJ A;  5B5F A;  1SWA A;  4ORU A;  1CBS A;  4QGV A;  3JSQ A;  2JMB A;  5AJC A;  5EDB A;  1KQX A;  1SWG A;  2FS6 A;  1SXW A;  2CZU A;  1VWM B;  4MVI A;  2FHL A;  2OFB A;  4NP1 A;  5BVT A;  2X8T A;  4R0B A;  4ZHC A;  2O62 A;  2X55 A;  1MM9 A;  3LHN A;  4A1H A;  4GJS A;  1LDQ A;  1HBQ A;  1OPB A;  3HWD A;  3PK2 A;  1VWD B;  1KT4 A;  4BGF A;  1P6P A;  1YIV A;  4OMX A;  2LBA A;  2GTF X;  1G7N A;  4YGG A;  5EZ2 A;  1N43 A;  1FEN A;  1A3Y A;  1SRI A;  1Y55 X;  5H9K A;  5DG4 A;  3APU A;  5LJB A;  2IZF B;  2IZD B;  2L9C A;  2OVS A;  1MVG A;  4XMG A;  3BY0 A;  3RE5 A;  4Z2P A;  1OEK A;  1IJ8 A;  1VWQ B;  1KZW A;  2FGS A;  2OF8 A;  4FBO A;  4NYR A;  1OPA A;  1QQS A;  2HZR A;  3VG2 A;  1EUO A;  1KOI A;  3BX7 A;  4NYQ A;  4WFV A;  1T8V A;  1ALB A;  1O1V A;  1HBP A;  5K68 A;  3WVM A;  5H9A A;  1Y0G A;  1PEE A;  4I60 A;  1ACD A;  4IAW A;  3JS1 A;  1TXL A;  2BS6 A;  1W6F A;  4Z27 A;  1GM6 A;  4YDB A;  3HOE A;  1ICM A;  4AZM A;  5EED A;  1JYD A;  2R73 A;  1SY2 A;  1GT5 A;  2A0A A;  2Y3F A;  3KQ0 A;  4QNI A;  2G79 A;  3FA9 A;  4WHI A;  5HBS A;  1VWA B;  1STP A;  2RTL A;  4CPH A;  1SWJ A;  2A5B A;  3PP6 A;  1LCZ A;  4D6B A;  2L5P A;  2RTB B;  1EPB A;  1VWI B;  3ZZV A;  3SAO A;  4YH0 A;  2RTF B;  1Y9T A;  4HWM A;  3WJB A;  4NLI A;  3T2W A;  1D3S A;  5AJB A;  3EW2 A;  2XST A;  3MVF A;  3O19 A;  2X32 A;  4MVE A;  2ALL X;  2QOS C;  1LID A;  3IA8 A;  2R74 A;  5HA0 A;  1LNM A;  1ZNH A;  3RSW A;  3EBW A;  2KTS A;  3GE2 A;  2RTD B;  3MX7 A;  2W2F A;  4QAE A;  2JGS A;  3UEW A;  1Z24 A;  5F6B A;  1EQD A;  2C1Q A;  2A13 A;  4HPC A;  3HWE A;  2X34 A;  1ZNG A;  2LKK A;  4YKO A;  1VWF B;  1NBX A;  3CR6 A;  3STN A;  4BX5 B;  4AYH A;  5IO5 A;  2XKL A;  2F01 A;  2LFO A;  5HCC C;  2RTP B;  3WXQ A;  1BLR A;  3HOL A;  1EAL A;  3NAD A;  4I3B A;  4CPI A;  1SWT A;  4CDF A;  5D48 A;  1VWJ B;  1KXO A;  1S2P A;  2A2G A;  4O9S A;  1JV4 A;  1SWO A;  5BVQ A;  2MJI A;  4U8U M;  1ZNK A;  3FID A;  2GH7 A;  3B2K A;  1YWB A;  4DCB A;  3NX1 A;  3WJG A;  3BDR A;  2BC3 A;  2ASN X;  2K23 A;  1IFB A;  2R56 A;  3P02 A;  1GX3 A;  3PDF A;  3E3C A;  4A1Y A;  1KT6 A;  4GET A;  4MIR A;  4B55 A;  3TGC A;  1MEP A;  2EU7 X;  2OY5 O;  4IMN A;  2IZJ A;  2QO6 A;  1OEE A;  2QCB A;  2AL0 X;  1UYO X;  3NP1 A;  4GJV A;  4EQA C;  3PQU A;  1L6M A;  2ACO A;  3SZJ A;  3JQO A;  3P24 A;  3KFF A;  3BU1 A;  4OS3 A;  5BVS A;  2AH7 X;  1SWS A;  2X56 A;  1RSU B;  2RTK A;  5B2A O;  4YFP A;  5BYP A;  1N9Y A;  4I3D A;  1TW4 A;  3WYP A;  3VU1 A;  4AZN A;  4YMY A;  2F73 A;  3VG4 A;  3B2H A;  2ACP X;  4QZU A;  4ARH A;  2QM9 A;  4GDA A;  4O3W A;  5HZQ A;  4CPE A;  4O4U A;  5HCE C;  4BX7 A;  1PTS A;  1B4M A;  3T6L A;  4EFG A;  1BSQ A;  3PH5 A;  3ELX A;  1UYN X;  1VWG B;  4XMH A;  2Y32 A;  2GTL O;  3D95 A;  3FEP A;  5CE4 A;  2BLG A;  3BS2 A;  4O3X B;  1LIF A;  3V8U A;  1VWB B;  2MM3 A;  2NNQ A;  4GD9 A;  2GTL N;  4I9S A;  4Y0R A;  4JO6 A;  3T1D A;  3ZW0 A;  1SWN A;  1DZM A;  1K3B A;  1SLD B;  2CBR A;  3C77 X;  2Z4H A;  4OS0 A;  4MVL A;  4O4O A;  1LIC A;  1I04 A;  1RXK A;  2HLV A;  3Q6L A;  2A8G A;  1QFT A;  4WBK A;  3SOT A;  1GT3 A;  2RTQ B;  1SY3 A;  4GE1 A;  1MUP A;  1TOU A;  4IRW A;  3KVN A;  1AEL A;  2WQ9 A;  1ZNL A;  4TNN A;  4GDZ A;  1CJ5 A;  1U0X A;  4BQU A;  4FBV A;  2JOZ A;  4BX6 A;  4GZV A;  2HYS A;  4ZH9 A;  3CKF A;  4ZH6 A;  3I0A A;  1OEJ A;  1KL5 A;  4XME A;  3FR4 A;  4QQ1 A;  2NNE A;  5IRW A;  5HTE A;  1STR B;  1HY2 A;  1I06 A;  4QYP A;  4TKH A;  2CBS A;  1SRE A;  5F58 A;  1BRQ A;  2G7B A;  4O3Y A;  2OZQ A;  3WZP A;  1OSP O;  2FHN X;  2GC9 A;  2LB6 A;  1BSY A;  3FR5 A;  3NBX X;  2I5Z O;  3CQN A;  4KC7 A;  4CK4 A;  1GKA A;  1VWC B;  4EEJ A;  2IZK A;  2DM5 A;  4GH7 A;  4ZJ0 A;  3FW5 A;  2VDF A;  3QQ2 A;  4KH8 A;  1JYJ A;  4LQZ A;  2A2U A;  3HWG A;  3G7X A;  1LCW A;  1MK5 A;  5IO6 A;  2WEX A;  3KFG A;  3LV4 A;  1AQB A;  4QRL A;  4COT A;  1SY0 A;  5KID A;  3U0D A;  1LCV A;  3UEV A;  1LPJ A;  1K24 A;  5F7G A;  4M7M A;  4UU3 A;  3EBK A;  1AVE A;  2M4L A;  2MHD A;  2RQ0 A;  3RY1 A;  1H91 A;  1SWB A;  5DPQ A;  3WJF A;  5B3M O;  1ERX A;  1SRH A;  1SRF A;  1T0V A;  1WBI A;  2OVA A;  4GNW A;  4IB8 A;  5LJD A;  2RA6 A;  4ZGF A;  3BRN A;  1LF7 A;  1GX8 A;  1QWD A;  2A5C A;  1VWP B;  2W2A A;  2JU8 A;  2HKD A;  1G85 A;  3BLG A;  3LTW A;  2OFR X;  1BWY A;  3VG5 A;  2ANS A;  3ZW2 A;  4A60 A;  1B0O A;  4A8Z A;  3FEK A;  1X8Q A;  3ZW1 B;  1SLG B;  4L1N A;  5L3Y A;  1AVG I;  1SWE A;  4U3Q A;  1JZU A;  5CSE A;  1SWP A;  1X8N A;  3C76 X;  4HPA A;  4D6A A;  1U17 A;  1VWL B;  4MIS A;  3NQK A;  2Q2M A;  1PM1 X;  1FEM A;  2YMS A;  2HNX A;  4FQB B;  5FQ8 E;  3KFH A;  1SXU A;  5L8N A;  5F6Z A;  3FR2 A;  2BT9 A;  5D45 A;  2RTG B;  4AZR A;  3WJD A;  2X45 A;  4Z6J A;  1N4J A;  1JJJ A;  5HZ9 A;  2BS5 A;  2IZE B;  4MEE A;  2X8S A;  5D8J A;  3WOV A;  5FFH A;  4LKP A;  2Q2P A;  2AT3 X;  3APV A;  2WSJ A;  1JBH A;  1A57 A;  1MX8 A;  2WEW A;  1R0U A;  4XMF A;  4YGH A;  3OBL A;  5HZ8 A;  3S60 A;  3IFB A;  2OFA A;  4N7D A;  2IFB A;  2QOM A;  1JQP A;  3RZY A;  4TQ2 A;  3UEX A;  1SRG A;  1BRP A;  2MF6 A;  2NND A;  4HFO A;  1O8V A;  2L67 A;  4Y5D A;  1EPA A;  3EMM A;  5IRU A;  3VG6 A;  4ALB A;  3P6E A;  1EXS A;  2Q4N A;  3DSZ A;  3FDC A;  1UZ2 X;  3MG5 A;  3STM X;  5B27 A;  1VYO A;  2RCT A;  3VHI A;  1EII A;  1DF8 A;  2GTL M;  3HWF A;  3PQS A;  1X71 A;  1Y53 X;  1KZX A;  2FTB A;  1O1U A;  1MDC A;  5CYB A;  1E06 A;  3CKG A;  3FEL A;  1VWH B;  1S7D A;  4HPD A;  5HA1 A;  2NP1 A;  4MVK A;  2OYB O;  4CPF A;  1DV9 A;  1GXA A;  1YWC A;  1YWD A;  1XCA A;  1JMX A;  2KTD A;  1IKJ A;  1E02 A;  4PJ2 A;  3ZQ3 A;  1SWL A;  2AF5 A;  3VE2 A;  5L8O A;  1OBQ A;  3RDO A;  4QGW A;  1MX7 A;  1SWH A;  2UYW A;  3FLL A;  1BSO A;  2LBV A;  1E00 A;  1SXY A;  2RN4 A;  4ID2 A;  4N7C A;  4AZO A;  4DQ3 A;  3VHH A;  4KCA A;  1TOW A;  3S26 A;  4YGZ A;  5EPQ A;  4ZHH A;  1B8E A;  1ML7 A;  2BHV A;  2C4I A;  2FKG A;  3HPE A;  5B11 O;  4BVM A;  4DNE A;  2X8F A;  2IZI A;  4ZGU A;  1SWR A;  2RTE B;  3MBT A;  2CZT A;  2OY8 A;  3RKG A;  5B29 A;  1QY1 A;  2RTR B;  2CAM A;  2IZC B;  4O4S A;  3WBG A;  1HMS A;  4LKT A;  4BCS A;  1W4T A;  2KD2 A;  2KT4 B;  2RTC B;  1PMP A;  4GK9 A;  4ORY A;  1VYG A;  4GU8 A;  2FT9 A;  4IB9 A;  1JJX A;  1HN2 A;  2IZH B;  1JIW I;  2F09 A;  2MWH A;  3D9W A;  3KFI A;  4CPH B;  5KHP A;  4ORW A;  3U9P C;  1RAV A;  1SWF A;  3S5X A;  3RBY A;  4KII A;  4L3R A;  3FA8 A;  4RUU A;  5CHK A;  4TKB A;  2VFC A;  1SLF B;  1DZJ A;  3H3I A;  3ZUI A;  1TVQ A;  5AEO A;  1QAB E;  2QMI A;  2FRS A;  2OY1 O;  4ZHF A;  2Y3E A;  2E4J A;  3P6G A;  1IFC A;  5HZ5 A;  2ZAI A;  1BJ7 A;  1NDJ A;  4ORS A;  3CBC A;  1KL4 A;  1N7Y A;  4GNY A;  2X4M A;  4AW8 A;  5K06 A;  1ZND A;  3WZQ A;  1LDO A;  1X8O A;  3FIQ A;  1FJ1 E;  1WUB A;  4TKJ A;  4ZHD A;  2G78 A;  5LJH A;  2RTM A;  1X8U A;  2FS7 A;  3ZI8 A;  1SLE B;  4LZV A;  2OFM X;  1A18 A;  1PBO A;  1RBP A;  3ZWE A;  4YBP A;  3D96 A;  4ZHG A;  5FAZ A;  1BBP A;  2AT6 X;  1LIB A;  1NQN A;  2LA7 A;  1VWR B;  4GGZ A;  4ZR2 A;  3T2X A;  3VHM A;  2Z4I A;  1QFV A;  4GKC A;  4O49 A;  3F6Z B;  1G5W A;  3HK1 A;  2L68 A;  3WZN A;  5IXG A;  1CBI A;  4ML7 B;  2QO4 A;  4GUZ A;  5HTD A;  1BM5 A;  1NP4 A;  1KQW A;  1SXX A;  1GGL A;  2RCQ A;  3P6F A;  3T6F A;  1YUP A;  3RY2 A;  3WYQ A;  5FQ7 E;  1JMZ A;  3CQR A;  4Z2V A;  4GGT A;  2VFB A;  4CDC A;  4Z2O A;  2ZAG A;  4O4X A;  1SMP I;  1N9M A;  5B5G A;  1DZP A;  2FLJ A;  3WJC A;  2WQA E;  3PED A;  4NLJ A;  1EI5 A;  1HMR A;  2RTA A;  1YP6 A;  2OL6 O;  1CBQ A;  4BBO A;  3C78 X;  5B10 O;  4LZU A;  1PBY A; 
#chains in the Genus database with same CATH homology
 3EYC A;  3D4R A;  3OE3 A;  5EDC A;  5C0N A;  4ZFX A;  5LKF A;  4EXZ A;  5EEE A;  4QZT A;  2Q9S A;  1NGL A;  2RD7 C;  4ALO A;  1E5P A;  4RUN A;  2Q39 A;  1XKI A;  3GAQ A;  2FWV A;  5JR8 A;  3AKN A;  3K3L A;  1BEB A;  2QO5 A;  1AB0 A;  1IKE A;  2OVD A;  1HQP A;  3FMZ A;  1LIE A;  2AT5 X;  4TJZ A;  4ES7 A;  2CM4 A;  2WWP A;  2W2B A;  3FW4 A;  3F9D A;  1T68 X;  3PEC A;  3ZUO A;  5H8T A;  4ON1 A;  3TF6 A;  3TGB A;  4YFQ A;  2HMB A;  4CV7 A;  1GT1 A;  3ZW0 B;  1N0S A;  1KGL A;  4K19 A;  4CSB A;  4HPB A;  3CMP A;  1X89 A;  4OS8 A;  3B2J A;  5KIC A;  1FEL A;  1FDQ A;  3OD9 A;  2P8G A;  2AT0 X;  3S5V A;  1HMT A;  3O2Y A;  1U18 A;  1A2D A;  1DZK A;  1S44 A;  3STK A;  1NP1 A;  3P6C A;  3D97 A;  4U9C A;  4IMO A;  3CWK A;  5FQ6 E;  3CBS A;  3O22 A;  4WFU A;  2MO5 A;  1Y9L A;  1QG5 A;  3L4R A;  3NQ3 A;  3VG7 A;  4AZQ A;  1KT5 A;  4NW4 A;  1OBU A;  3N91 A;  4IB7 A;  4ZCB A;  4IB6 A;  1GKA B;  5FEN A;  1DF3 A;  1I05 A;  2AT8 X;  2JU3 A;  2FR2 A;  3UEU A;  3APX A;  5LJE A;  1KT7 A;  3WJE A;  3AKM A;  1FTP A;  4IAB A;  2A3F X;  4Y0P A;  5L8I A;  1ZRY A;  3FA6 A;  4ORX A;  5HAE A;  4YCE A;  4FGI B;  4OMW A;  3HTY A;  3BU9 A;  1VPR A;  2K62 A;  2WUT A;  3APW A;  1ZNE A;  5D4A A;  3NQ9 A;  4YBU A;  4QYN A;  3RWX A;  4YFR A;  2JU7 A;  1ICN A;  3VG3 A;  1GT4 A;  1YWA A;  1GX9 A;  3QKG A;  4I3C A;  1IW2 A;  5F1E A;  3KZA A;  4I9R A;  3UAQ A;  4O3Z A;  1B56 A;  1QY2 A;  4GRJ A;  3TGA A;  3PPT A;  4ORR A;  1ERB A;  4IBA A;  5D47 A;  1ADL A;  2PY1 A;  2AKQ A;  4KC8 A;  5FAZ A;  1EW3 A;  4AZP A;  1RLB E;  2CM9 A;  3FEN A;  3PH6 A;  4YKM A;  4QGX A;  1DFV A;  5HZ6 A;  1QY0 A;  4YDA A;  5LJG A;  3VE1 A;  1VYF A;  1YP7 A;  3DTQ A;  4KT5 A;  3F8A A;  1KT3 A;  2X46 A;  4JGL A;  1CRB A;  4NNT A;  5LKE A;  4ODD A;  1IIU A;  4BOE A;  4EDE A;  1LFO A;  3ELZ A;  3NR3 A;  5AQ6 A;  3NPO A;  4Y0Q A;  4YCH A;  3P6D A;  5H9N A;  4FBR A;  5LJC A;  2OVE A;  4IAX A;  1EIO A;  5IO7 A;  2HZQ A;  2JN3 A;  2AMM X;  4INN A;  4I6S A;  4Y0S A;  3VPJ E;  1URE A;  2YG2 A;  3ZW1 A;  2GJ5 A;  5LJK A;  3BX8 A;  4XMC A;  1I4U A;  3NX2 A;  3B2I A;  3B2L A;  3I17 A;  1OBP A;  4UU2 A;  5H9L A;  2POA A;  1G74 A;  2N93 A;  2KW1 A;  3FYF A;  4I95 A;  3FA7 A;  3TZS A;  1D2U A;  3OJY C;  4M6S A;  1DC9 A;  1CBR A;  4TLJ A;  4XMD A;  5HCD C;  2FR3 A;  2JW1 A;  4U8U O;  4NNS A;  1SY1 A;  3EM0 A;  4DQ4 A;  5HWZ A;  1SA8 A;  4U8U N;  1FE3 A;  3BSZ E;  3P6H A;  1X8P A;  4PSQ A;  2WR6 A;  4ORU A;  4QGV A;  1CBS A;  3JSQ A;  2JMB A;  5AJC A;  5EDB A;  1KQX A;  2FS6 A;  1SXW A;  2CZU A;  4MVI A;  4NP1 A;  5BVT A;  2X8T A;  4R0B A;  4ZHC A;  2O62 A;  3LHN A;  4A1H A;  1HBQ A;  1OPB A;  3HWD A;  1KT4 A;  1P6P A;  1YIV A;  4OMX A;  2LBA A;  2GTF X;  1G7N A;  4YGG A;  5EZ2 A;  5H9K A;  1FEN A;  1A3Y A;  5B27 A;  5DG4 A;  3APU A;  5LJB A;  2L9C A;  2OVS A;  1MVG A;  4XMG A;  3BY0 A;  1KZW A;  1OEK A;  4FBO A;  4NYR A;  1OPA A;  1QQS A;  2HZR A;  3VG2 A;  1EUO A;  1KOI A;  3BX7 A;  4NYQ A;  4WFV A;  1T8V A;  1ALB A;  1O1V A;  1HBP A;  3WVM A;  5H9A A;  1PEE A;  1ACD A;  4IAW A;  3JS1 A;  1TXL A;  2BS6 A;  1GM6 A;  4YDB A;  3HOE A;  1ICM A;  4AZM A;  5EED A;  1JYD A;  2R73 A;  1SY2 A;  1GT5 A;  2A0A A;  5HBS A;  3KQ0 A;  4QNI A;  2G79 A;  3FA9 A;  4WHI A;  3PP6 A;  4D6B A;  2L5P A;  1EPB A;  3ZZV A;  3SAO A;  4YH0 A;  1Y9T A;  4HWM A;  3WJB A;  4NLI A;  1D3S A;  5AJB A;  2XST A;  3MVF A;  3O19 A;  4MVE A;  2ALL X;  2QOS C;  1LID A;  3IA8 A;  2R74 A;  5HA0 A;  1LNM A;  1ZNH A;  3RSW A;  3EBW A;  2KTS A;  3GE2 A;  3MX7 A;  2W2F A;  4QAE A;  3UEW A;  1Z24 A;  5F6B A;  1EQD A;  2A13 A;  4HPC A;  3HWE A;  1ZNG A;  2LKK A;  4YKO A;  3CR6 A;  3STN A;  4AYH A;  5IO5 A;  2XKL A;  2LFO A;  5HCC C;  3WXQ A;  1BLR A;  3HOL A;  1EAL A;  3NAD A;  4I3B A;  5D48 A;  1KXO A;  1S2P A;  2A2G A;  4O9S A;  1JV4 A;  5BVQ A;  2MJI A;  4U8U M;  1ZNK A;  3B2K A;  1YWB A;  3NX1 A;  3WJG A;  3BDR A;  2ASN X;  2K23 A;  1IFB A;  2R56 A;  3P02 A;  3E3C A;  4A1Y A;  1KT6 A;  4GET A;  4MIR A;  3TGC A;  2EU7 X;  4IMN A;  2QO6 A;  1OEE A;  2AL0 X;  3NP1 A;  4EQA C;  3PQU A;  1L6M A;  2ACO A;  3JQO A;  3P24 A;  3KFF A;  3BU1 A;  4OS3 A;  5BVS A;  2AH7 X;  4YFP A;  4I3D A;  1TW4 A;  3VU1 A;  4AZN A;  4YMY A;  2F73 A;  3VG4 A;  3B2H A;  2ACP X;  4QZU A;  4ARH A;  2QM9 A;  4O3W A;  5HZQ A;  4O4U A;  5HCE C;  1B4M A;  4EFG A;  1BSQ A;  3PH5 A;  3ELX A;  4XMH A;  2GTL O;  3D95 A;  3FEP A;  5CE4 A;  2BLG A;  3BS2 A;  4O3X B;  1LIF A;  3V8U A;  2NNQ A;  2MM3 A;  4I9S A;  4Y0R A;  2GTL N;  3ZW0 A;  3U03 A;  3T1D A;  1DZM A;  2CBR A;  4OS0 A;  3C77 X;  2Z4H A;  4MVL A;  4O4O A;  1LIC A;  1I04 A;  2HLV A;  3Q6L A;  1QFT A;  4WBK A;  3SOT A;  1GT3 A;  1SY3 A;  4GE1 A;  1MUP A;  1TOU A;  1AEL A;  2WQ9 A;  1ZNL A;  4TNN A;  4GDZ A;  1CJ5 A;  1U0X A;  4BQU A;  4FBV A;  2JOZ A;  4GZV A;  2HYS A;  4ZH9 A;  4ZH6 A;  3I0A A;  1OEJ A;  4XME A;  3FR4 A;  4QQ1 A;  2NNE A;  5HTE A;  1I06 A;  4QYP A;  4TKH A;  2CBS A;  5F58 A;  1BRQ A;  2G7B A;  4O3Y A;  2OZQ A;  2GC9 A;  2LB6 A;  3FR5 A;  3NBX X;  1BSY A;  4KC7 A;  4CK4 A;  3CQN A;  1GKA A;  4EEJ A;  4GH7 A;  2DM5 A;  4ZJ0 A;  3FW5 A;  4KH8 A;  1JYJ A;  4LQZ A;  2A2U A;  3HWG A;  3G7X A;  5IO6 A;  2WEX A;  3KFG A;  3LV4 A;  1AQB A;  4QRL A;  4COT A;  1SY0 A;  5KID A;  3U0D A;  3UEV A;  1LPJ A;  5F7G A;  4M7M A;  4UU3 A;  3EBK A;  2M4L A;  2MHD A;  2RQ0 A;  1H91 A;  5DPQ A;  3WJF A;  1ERX A;  1T0V A;  4GNW A;  2OVA A;  4IB8 A;  5LJD A;  2RA6 A;  4ZGF A;  3BRN A;  1LF7 A;  1GX8 A;  1QWD A;  2W2A A;  2JU8 A;  3BLG A;  1G85 A;  2OFR X;  1BWY A;  3VG5 A;  2ANS A;  3ZW2 A;  4A60 A;  1B0O A;  4A8Z A;  3FEK A;  1X8Q A;  3ZW1 B;  4L1N A;  1AVG I;  4U3Q A;  1JZU A;  1X8N A;  3C76 X;  4HPA A;  4D6A A;  1U17 A;  4MIS A;  3NQK A;  2Q2M A;  1PM1 X;  1FEM A;  2YMS A;  2HNX A;  4FQB B;  5FQ8 E;  3KFH A;  1SXU A;  5L8N A;  5F6Z A;  3FR2 A;  2BT9 A;  5D45 A;  4AZR A;  3WJD A;  2X45 A;  1JJJ A;  5HZ9 A;  2BS5 A;  2X8S A;  5D8J A;  3WOV A;  5FFH A;  4LKP A;  2Q2P A;  2AT3 X;  3APV A;  2WSJ A;  1JBH A;  1A57 A;  1MX8 A;  2WEW A;  1R0U A;  4XMF A;  4YGH A;  3OBL A;  5HZ8 A;  3S60 A;  3IFB A;  4N7D A;  4TQ2 A;  2IFB A;  3RZY A;  3UEX A;  1BRP A;  2NND A;  4HFO A;  1O8V A;  2L67 A;  1EPA A;  3EMM A;  3VG6 A;  4ALB A;  3P6E A;  1EXS A;  2Q4N A;  3DSZ A;  1UZ2 X;  3STM X;  1EII A;  2RCT A;  2GTL M;  3PQS A;  3HWF A;  1X71 A;  1KZX A;  2FTB A;  1O1U A;  1MDC A;  5CYB A;  1E06 A;  3FEL A;  4HPD A;  1S7D A;  5HA1 A;  2NP1 A;  4MVK A;  1DV9 A;  1GXA A;  1YWC A;  1YWD A;  1XCA A;  2KTD A;  4PJ2 A;  1IKJ A;  1E02 A;  3ZQ3 A;  5BYP A;  3VE2 A;  5L8O A;  1OBQ A;  4QGW A;  1MX7 A;  3FLL A;  1BSO A;  2LBV A;  1E00 A;  1SXY A;  2RN4 A;  4ID2 A;  4N7C A;  4AZO A;  4DQ3 A;  4KCA A;  1TOW A;  3S26 A;  4YGZ A;  5EPQ A;  4ZHH A;  1B8E A;  1ML7 A;  2BHV A;  4BVM A;  4ZGU A;  1JJX A;  2X8F A;  3MBT A;  2CZT A;  3RKG A;  5B29 A;  1QY1 A;  4O4S A;  3WBG A;  1HMS A;  4LKT A;  2KD2 A;  2KT4 B;  1PMP A;  4GK9 A;  4ORY A;  1VYG A;  4GU8 A;  2FT9 A;  4IB9 A;  1HN2 A;  1JIW I;  2F09 A;  2MWH A;  3KFI A;  5KHP A;  4ORW A;  3U9P C;  3S5X A;  3RBY A;  4KII A;  4L3R A;  3FA8 A;  4RUU A;  4TKB A;  1DZJ A;  3H3I A;  3ZUI A;  1TVQ A;  5AEO A;  1QAB E;  2QMI A;  2FRS A;  4ZHF A;  2E4J A;  3P6G A;  1IFC A;  5HZ5 A;  2ZAI A;  1BJ7 A;  4ORS A;  3CBC A;  4AW8 A;  4GNY A;  5K06 A;  1ZND A;  1X8O A;  3FIQ A;  4TKJ A;  4ZHD A;  2G78 A;  5LJH A;  1X8U A;  2FS7 A;  3ZI8 A;  4LZV A;  2OFM X;  1A18 A;  1PBO A;  1RBP A;  3ZWE A;  4YBP A;  3D96 A;  4ZHG A;  1BBP A;  2AT6 X;  1LIB A;  2LA7 A;  4ZR2 A;  2Z4I A;  1QFV A;  4GKC A;  4O49 A;  3F6Z B;  1G5W A;  3HK1 A;  2L68 A;  1CBI A;  4ML7 B;  2QO4 A;  5HTD A;  1BM5 A;  1NP4 A;  1KQW A;  1SXX A;  1GGL A;  2RCQ A;  3P6F A;  1YUP A;  5FQ7 E;  3CQR A;  2ZAG A;  4O4X A;  1SMP I;  1DZP A;  2FLJ A;  3WJC A;  2WQA E;  3PED A;  4NLJ A;  1EI5 A;  1HMR A;  1YP6 A;  1CBQ A;  3C78 X;  4LZU A;  1LKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...