4QH0A

Crystal structure of nuca from streptococcus agalactiae with magnesium ion bound
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
SVDTSQEFQNNLKNAIGNLPFQYVNGIYELNNNQTNLNADVNVKAYVQNTIDNQQRPSTANAMLDRTIRQYQNRRDTTLPDANWKPLGWHQVATNDHYGHAVDKGALIAYALAGNFKGWDASVSNPQNVVTQTAHSNQSNQKINRGQNYYESLVRKAVDQNKRVRYRVTPLYRNDTDLVPFAMHLEAKSQDGTLEFNVAIPNTQASYTMDYATGEITLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the virulence factor nuclease A from Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae ilri112
molecule tags Hydrolase
molecule keywords DNA-entry nuclease (Competence-specific nuclease)
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 4qh0A00
2XGRA 1G8TA 5DLVA 5INHA 3NKMA 5L0EA 2XRGA 3NKQA 3WAXA 3NKOA 4QN0A 4A1NA 5DLWA 4QGOA 5GKCA 4GTXA 3S5BA 3NKNA 5IJQA 3WAWA 1ZM8A 4E3YA 3OWVA 4GTYA 1SMNA 4ZG9A 3NKPA 5IJSA 2XH3A 4GTZA 1QAEA 5DLTA 1QL0A 5KXAA 5LIAA 5LQQA 3ISMA 3WAYA 2XR9A 4ZG7A 4GTWA 4ZG6A 3NKRA 3WAVA 5HRTA 5GKPA 5L0KA 4ZGAA 2O3BA 4B56A 5L0BA 4QH0A
chains in the Genus database with same CATH superfamily
2XGRA 1G8TA 5DLVA 5INHA 3NKMA 5L0EA 2XRGA 3NKQA 3WAXA 3NKOA 4QN0A 4A1NA 5DLWA 4QGOA 5GKCA 4GTXA 3S5BA 3NKNA 5IJQA 3WAWA 1ZM8A 4E3YA 3OWVA 4GTYA 1SMNA 4ZG9A 3NKPA 5IJSA 2XH3A 4GTZA 1QAEA 5DLTA 1QL0A 5KXAA 5LIAA 5LQQA 3ISMA 3WAYA 2XR9A 4ZG7A 4GTWA 4ZG6A 3NKRA 3WAVA 5HRTA 5GKPA 5L0KA 4ZGAA 2O3BA 4B56A 5L0BA 4QH0A
chains in the Genus database with same CATH topology
2XGRA 1G8TA 5DLVA 5INHA 3NKMA 5L0EA 2XRGA 3NKQA 3WAXA 3NKOA 4QN0A 4A1NA 5DLWA 4QGOA 5GKCA 4GTXA 3S5BA 3NKNA 5IJQA 3WAWA 1ZM8A 4E3YA 3OWVA 4GTYA 1SMNA 4ZG9A 3NKPA 5IJSA 2XH3A 4GTZA 1QAEA 5DLTA 1QL0A 5KXAA 5LIAA 5LQQA 3ISMA 3WAYA 2XR9A 4ZG7A 4GTWA 4ZG6A 3NKRA 3WAVA 5HRTA 5GKPA 5L0KA 4ZGAA 2O3BA 4B56A 5L0BA 4QH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGR A;  1G8T A;  5DLV A;  5INH A;  3NKM A;  5L0E A;  2XRG A;  3NKQ A;  3WAX A;  3NKO A;  4QN0 A;  4A1N A;  5DLW A;  4QGO A;  5GKC A;  4GTX A;  3S5B A;  3NKN A;  5IJQ A;  3WAW A;  1ZM8 A;  4E3Y A;  3OWV A;  4GTY A;  1SMN A;  4ZG9 A;  3NKP A;  5IJS A;  2XH3 A;  4GTZ A;  1QAE A;  5DLT A;  1QL0 A;  5KXA A;  5LIA A;  5LQQ A;  3ISM A;  3WAY A;  2XR9 A;  4ZG7 A;  4GTW A;  4ZG6 A;  3NKR A;  3WAV A;  5HRT A;  5GKP A;  5L0K A;  4ZGA A;  2O3B A;  4B56 A;  5L0B A;  4QH0 A; 
#chains in the Genus database with same CATH topology
 2XGR A;  1G8T A;  5DLV A;  5INH A;  3NKM A;  5L0E A;  2XRG A;  3NKQ A;  3WAX A;  3NKO A;  4QN0 A;  4A1N A;  5DLW A;  4QGO A;  5GKC A;  4GTX A;  3S5B A;  3NKN A;  5IJQ A;  3WAW A;  1ZM8 A;  4E3Y A;  3OWV A;  4GTY A;  1SMN A;  4ZG9 A;  3NKP A;  5IJS A;  2XH3 A;  4GTZ A;  1QAE A;  5DLT A;  1QL0 A;  5KXA A;  5LIA A;  5LQQ A;  3ISM A;  3WAY A;  2XR9 A;  4ZG7 A;  4GTW A;  4ZG6 A;  3NKR A;  3WAV A;  5HRT A;  5GKP A;  5L0K A;  4ZGA A;  2O3B A;  4B56 A;  5L0B A;  4QH0 A; 
#chains in the Genus database with same CATH homology
 2XGR A;  1G8T A;  5DLV A;  5INH A;  3NKM A;  5L0E A;  2XRG A;  3NKQ A;  3WAX A;  3NKO A;  4QN0 A;  4A1N A;  5DLW A;  4QGO A;  5GKC A;  4GTX A;  3S5B A;  3NKN A;  5IJQ A;  3WAW A;  1ZM8 A;  4E3Y A;  3OWV A;  4GTY A;  1SMN A;  4ZG9 A;  3NKP A;  5IJS A;  2XH3 A;  4GTZ A;  1QAE A;  5DLT A;  1QL0 A;  5KXA A;  5LIA A;  5LQQ A;  3ISM A;  3WAY A;  2XR9 A;  4ZG7 A;  4GTW A;  4ZG6 A;  3NKR A;  3WAV A;  5HRT A;  5GKP A;  5L0K A;  4ZGA A;  2O3B A;  4B56 A;  5L0B A;  4QH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...