4QHMA

I3.1 (unbound) from ch103 lineage
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
b'QVQLQESGPGLVKSSETLSLTCTVSGGSMGGYYWSWLRQSPVKGLEWIGYIFHTGHTNYNPSLESRVTVSVDTSENQFSLRLRSVTAADTAVYYCASLPRGQLVNAFFDNWGQGTLVTVASASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords I3 heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 217
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhmA01
5FYLH 3TBVB 4NUJA 2J5LB 1I9JL 4PJIF 1LK2A 1NAKL 2ED7A 2ZJSL 1U2HA 5C6WH 4BH7B 2B2XH 1CT8A 3TNNB 4GW1A 3IJYA 4KRPB 3H0TB 3JWDL 3IDNA 3CXDH 3STLA 5KTEL 4GRLC 5DJXB 1AY1L 1EO8H 4NM4H 4TSBH 5FUZH 4C56E 2X1WL 1MELA 1T1XB 1KJ2A 1U92B 1F6FB 1DEEA 4HKBA 2Y5TA 1IGJB 1YNKH 5I73C 4XRCB 3B43A 2HKHL 2VL5B 3BDYL 4WO4C 2YBRA 3GJFK 4U7SA 3V7AG 1BJ1J 3GM8A 3H9HA 3L3GA 4MYWB 5DD3H 1HH6A 3MUHL 3SGDH 4BKLA 4O4YH 1CXLA 5C0DA 2V9QA 3DARA 3Q3GB 5BZWB 3JWOC 4C56B 5BCAA 4HPOL 1ZSDA 2B4CL 5D7SH 2XNAA 5HDLA 1D5MB 4X6CE 2FHCA 1MAJA 3T77A 3LRSA 5JQ6H 2Y6SC 4JFDD 4P4RB 1MNUL 5DFVC 4K7FA 1FNEB 4PRHA 4UMGA 4WI3A 2IBBA 1K6QH 4GSDH 1Q94A 1I7ZA 4EDXB 3LQAC 1T66C 5FOBA 2IQ9H 3DETC 4KGJA 4KROB 1E4JA 3U1SH 4G43A 1VHPA 2X2YA 3MV8E 2WIIB 4Y1AA 3T8XB 5DLMH 1KTLB 5TQ2L 5I1EH 1DBJL 3GIVB 2VH5L 3TIDA 2ID5A 2OR8A 1QSEA 4O5LH 1JPFA 3WNPA 1U91A 1F4WL 1PQZB 4L3CA 2LQRA 3UZVB 3L6FB 1BQHG 4Z5RA 1FL6A 3G08A 5C2BH 2ZCKH 4HMEA 4PRBB 3QWRA 2ZCHL 5J56B 2FWOA 5HDBF 3E3QE 3QEHB 1S7WB 1J1OH 4S1QH 2P46B 4OFDA 1B2WL 4P4KA 5TQ0L 4ELKA 4TSAH 4YLQT 5HY9B 3KPRD 2CR3A 2EDOA 4LARH 4LCYB 3MLVL 4NJAL 3MACL 5D7KE 5HHME 1V8HA 2AP2A 4K23H 4UV7H 5HI3C 4BZ1H 1I1YA 3CPLA 1GL4B 3BX7C 3DYOA 3M8OH 3TV3H 5K9QG 3RNKB 4B7IA 3BZFB 3RVTC 4OCNC 3F7QA 5I1AB 5ITFA 4I3SH 3BO8B 3GK8L 2NNAB 1J0IA 4UOW0 1HWGB 3MJ6A 2GUOB 3I50L 1HYSC 5JDJA 2NXZC 5HHMB 3D6GA 4HV8B 4Z9KB 2VDQL 2NY3D 3MLRL 1ACZA 1JPGA 5EUKB 2A1WL 5BVJB 2NY5L 3UTQA 5EN2B 5DA4A 1CFNA 2J6EH 4HS3B 2RHEA 4X8JB 3QUZA 5I0DA 4TOYH 3IETA 3SCMD 2IBGA 3WFCL 2VC2L 2ZG3A 3ALXA 4YIQA 1I9RH 3HE6A 3RWDA 4U1NA 4I48B 1N0XL 2Q8BL 4K8RH 1G7IB 4X7SL 1F6LL 5K9KB 1BVKB 4X7TB 1FZKB 3OXRB 5IGXL 1QR4A 1W72H 2FJGB 5FYJL 2FGZA 1W0WB 4RBPH 2WUCL 4K55A 1UACL 4L4VE 4X0KA 4ZFOA 4BFBD 2XTJD 5LQBH 2F74A 2APBA 5ECJE 2VWEE 1MFNA 2NTFB 2YA0A 4NIKB 5D8JL 1OP3H 4C55A 2FH8A 1PD6A 4LASH 3ULVL 3ARXA 1NGPH 3QP3A 2FR4B 1S5IH 4PB9L 2IQAB 2QQNH 3S97C 3X17A 2H41A 4JANB 4G42B 5DZNA 3N9GH 4RWYL 2AK1H 1BQHA 5DO2D 3NH7L 2DDQH 1NC2D 1DE4B 1T89C 1WBYB 3QQ9C 1P84K 3P0VL 1U8NB 3MCLL 1FCGA 1RULH 4HC1H 3HZVB 3KPSE 3OB0K 3LIZL 3VXTB 4HPYL 4MWFB 4RA3A 4I18A 5T3XD 1RVFL 1JZ3A 4IDJH 2VUYA 5A40E 2FIKB 5FYKL 5FA3A 5F1IA 4DVRL 4K94H 1VESA 3MQIA 1CXEA 4WENB 1L6XA 1JIBA 1PW3A 3D69A 1BVZA 3S37H 4I5BB 2IANB 4X6CF 5DWUH 5KZCD 4NP4L 4EXPX 5F9WB 4L8BB 1I8KB 1LO0L 1A7PL 3PL6D 4TULL 2V7HA 4G6AD 4UB0H 3DX9B 1QLFA 3MROB 4ZPTA 1M7XA 2OR9H 4QY8A 4MD0A 3BDBA 1ES0B 2EEDA 2G5BA 5C08A 4XNXH 4GMTH 3QB7C 4U2ZA 3V4PL 5AYQA 1AQDB 2VN4A 4KUCD 1WFUA 4LBEA 1I8IA 4M1CC 3GJFH 4GKNB 4RX4A 4I0KA 3W9DA 1A4JA 3MUGA 3VMPA 1BJ8A 4XMPH 1FV1B 1A0QH 1K9TA 2DLIA 2MKWA 1F4YH 3WHXB 1MFAH 3C60D 2WZPD 3U7WH 4GRLB 2Q7YA 2Z35B 2VISB 4M61A 5H35A 1GGIL 1ZA3A 4MDIA 4XNQA 2V2WB 4S1DC 3ULSA 1Y6MR 3VI4F 1CGTA 3VD9A 2O61B 5DR5L 3WFHB 1C12A 5JHDB 4TTGA 1EFXA 3BI9X 3S4SG 3ILQD 4ODWA 4OJFH 5GGTA 2AJUH 1UKSA 5F6HJ 3EYFA 1CG9A 4NRZA 1Z5LA 4WO4B 1SYSA 3QDGE 5IJVB 1CE1H 4XHJD 1BD2A 4DWHA 5CWSA 3C5JA 2E7LC 3D2UB 2XKNB 2YSSA 4Y4FD 3G6AA 1Z3GL 3SDCA 1HSAA 4P2RB 4QT5A 4PGDB 3EO1A 3BQUC 3BYYA 3GI8H 1AXTL 1QTYT 1IM9A 3KPPA 4RCAA 3W2DH 3KLAA 3ARYA 3QEQD 4L4TE 3CFCH 2MQ0A 3A0OA 4HZLA 3RVUD 1Q9LA 5EO9B 2VITB 4YQXH 5SWZD 3GSVA 3MLXL 4V1DE 1XZ0A 3KXFA 3EYSH 5T1LD 4LNRB 1G0DA 4QRUB 4J6RL 5FXCH 5C9JB 4LQFH 2XICA 3IU4L 5DJDB 5DTFB 5SWQB 1CU4L 3MRQA 1GGBH 1T1WB 2IMMA 4AEHL 3DX8B 3MRPB 2IGFL 4WI4A 3CGTA 3HPJA 3VXQA 4LPUA 4LOUD 2Z4QB 3QDME 1FP5A 3R06A 4X4ZA 1NL0H 5E2JA 4V1DB 1AGBB 3LPFA 1FIGL 2VL4A 4KMTH 3K0WA 4ZAKB 3WDJA 3V6FA 4QGYA 1BZ7A 4G9FE 1LK3H 5DD0H 1KCRL 1CL7I 1KELH 4L3EB 3KG5A 1DBAH 1M05B 4KRMB 4B53A 4Z0BH 4CJ0A 5B38B 4ONHA 1LQSR 1FVEA 1TZGL 1UWEH 3ECBB 3LQAL 1Q9WB 4RISL 2BVUA 3EDJA 3ZE0F 4GAYB 1JFQH 4N9OB 5IBLD 2HRPH 1QACA 3AROA 5CUSH 3SY0B 3OAZK 4L8CB 5KJRL 4AH2B 1FLRL 9CGTA 3MUZ1 1BF8A 1GVIA 3VH8G 3NN8A 5TDNB 2DJSA 4RGMC 3EDDA 3IFPA 4IOIB 4KHXL 5CP7B 2BOCB 2ADFH 5BW7C 1T0MA 3PJSA 1OGAA 1CD1A 1S5HB 4NGHH 4POUB 1A6TB 2P44B 1IT9H 1UQSA 2FX9L 3QXDA 5IW1B 3PDDA 4XC1L 3IKCA 3EFDL 1JGLH 5JXEC 2Y25A 2JK5B 3EBAA 1XF5B 2ITDA 1S9YB 3O2DA 3P11L 4TNWK 5C09B 4NKQB 4YNYA 4UT6L 2B1AL 2I24N 5FDWA 3LS4H 4XVSH 5C0GB 3QH3B 2NXZB 4KTYA 2NW2A 5IFHL 1IKFH 2A6KA 3L9RA 3WJJC 3RTQD 1LO4L 3BP6A 3GSNH 4HWZA 3TVMD 3RWEB 5D2NA 2FYYB 1CE6B 2IFFH 1TCRB 3MODH 5JZ7C 2Z8RA 4ZUSB 5HYSG 4I77L 1K8DA 2VDKH 2WUBH 1URLA 3FB8B 4R2GD 4IDLA 4YHNB 3ME0A 4JFQA 1RJZB 2NW3B 1HKFA 1AGCB 1KUMA 1TJHL 2D31A 5F7EH 4NUGL 5KSVB 3ARDC 4NT6A 3O41B 5F3BB 4E0RB 2P5EA 5DI8B 4BYHA 1B6UA 4F7EA 5I1JH 3OB0H 5I1IH 3VFPB 4YAQB 2R23B 2WLZA 4I0PD 1XF2A 4KI5C 4LP5A 1R3JB 4MX7B 4D3CL 3D87B 3IDIA 3GKWH 4NRYA 1X3DA 4I2XA 5B8CC 3JV4A 2PYEA 5EZJA 1J8HE 2VLKB 1J10A 3PG2A 4XVUD 3NFPB 3KYKL 4PTUA 1NANI 5ILTL 4PJ9A 3NABL 3K2UL 4Y4KA 2GSIB 2IH3A 1NDGB 1KACB 2DAVA 1U8JB 4LCCA 3IDJA 1I8MA 4Y2DB 2ILLA 3D39B 1S9VA 4JN2B 3MLZH 2APTA 3J8F7 2Q6WB 3P30H 1U2CA 3VH8A 1JPTL 4XP9H 3QUXA 3UZEA 2NXYD 3B9EA 1DBKL 4R4ND 3U6RB 3LZFH 4P2CG 4X6EB 2V2XA 1GOGA 3E8UL 5CP3A 4F15C 2UV3A 1JWSA 3PQYA 3BXNB 1Q0YH 5BRZE 1JF6A 4GQ9H 1N4XH 4FFWC 4JZJA 4MNQA 1TJGL 1OARL 3IFNL 1RI8A 3U0TA 4ZXBC 3FFCD 3UTTA 1HOCA 4PJGE 3LN4A 3TH2T 1KJ2H 4HUKB 1MFCH 3LHPL 2FGWH 2MCG1 3CK0H 1RIUL 4PY7A 1G1YA 4NN5C 4G8GE 3A6BH 4FN0A 2XN9A 4PGBB 3VI3F 3DXAB 4D9RD 2ICEB 4J1UA 2CDEB 2PUQT 3RUGB 4LLVA 1A7RH 3TN0C 1CTNA 5HYSA 3KPOB 4CW1B 1DQLL 4N5EC 4M7JH 5CEZL 3LMJH 4O51A 4C57C 4PJGB 5ABDE 4PR5A 4JO2L 1KT2B 1D5IL 3F7RA 3RGVC 4OCYL 5HHNA 1TVDA 5D9SB 4G8GB 3N1QC 5DRZA 4MJ4A 1C1EL 3BUYA 2ADGB 4RGNC 1FG2A 3HFMH 1N2RA 2GIYA 5LXGH 1QOKA 5GSRA 2QL1A 4XBEH 1KN2H 1CR9L 4PUBL 2FRGP 2F53D 1A4KB 4Y88A 3OGOE 4FTVA 1FZJB 3WUWB 1WWAX 3PABB 1JP5A 1I7UA 1NDMB 1XAUA 2BRRH 3ZO0A 2VQ1A 5EOQH 1KJVB 3SO3C 4Y5YC 5AYUL 1CQYA 3VFNA 1IAII 1HINL 2NY1C 4YHMH 3ILPB 3U4BH 4YPGB 1V5JA 1SYVA 2VKWA 7FABL 1JWUA 4KQ4L 1QLRA 2C26A 2AV1A 1ACYL 1RZJH 1JWMA 4NQSB 3K4AA 2XZCH 3JTTA 4YHLL 2X7LA 1EDQA 2CRIA 3X14A 1OWRM 5HHOA 4I8DA 4XCYB 3V0WL 3IJSB 1MLCB 4MJIE 3WL9A 3HHRB 3KHQA 3VFOA 4P3CL 4EVNB 4R7DB 5D7LD 1ZEAL 1ZS8B 2P8MA 2X4NB 4EN3A 2JJUA 3IAQA 5D71L 3QFJD 3S34L 2CKNA 1S7SB 1S8DA 4UUJB 4G6FD 4JFHE 4I4WB 2IF7A 4RMVA 4GRWE 4LLDA 3FN0H 4LAQL 1LD9A 1DSFL 4NYLB 3C5ZA 3D25B 3RWJA 4Y19E 2IWGA 2Q3ZA 4Z7VB 4HMCA 2YWYA 3BD3A 1UEYA 3PGFL 3GI9H 3LKNB 4CBPA 3EOAA 4NNXA 2UWEA 3K4DA 5GS0L 3CFEB 3KWWB 4DN4L 5TGBA 3NCYS 3TT3L 3WFDL 3CC5B 1NLBH 4XTRC 1X5IA 3WXWL 4FQXD 1AD0A 3WUZA 1BMGA 1OPGH 3QULA 1MCJA 4PJ5B 3RQ3A 4WI9A 3SE4C 2FSEA 2C3XA 2VMFA 5CZXD 2DJUA 1NCWL 3CFDB 1FNSH 5D1QD 3SDXE 1KENH 4QHMB 3L7EB 5BS0E 3QEGL 2ORBH 2VTFA 3KR3L 4UIMB 4LIQH 3VFUA 2GK0B 1V7NH 5D1XD 5HYFA 2I9LA 1FO0B 2XQBH 5K9JH 3AS1A 4F3FB 1FDLH 1JGVL 3PXJA 3OJVC 5T5FH 35C8L 2XV6B 4XXCA 2CKBA 4JM2F 3GBML 1R24B 5HD8C 2AK4A 4MB4A 4YHKH 2NY2C 3GSOB 5HYIA 5I2IB 4FZ8H 5C0EB 3L5WB 5JO5B 2IPTH 3DBXA 5BS0B 4OLVH 4BSWB 3QJHB 1GPOH 3AS0A 4F7TA 1QQDA 4F33B 2Z8SA 3KPQB 5GRXG 4G9DB 4WI6A 2PKDA 1XCQB 2C9AA 4KI5E 4EBQH 2YEZB 1U8MA 3VXPA 2Z31C 4PRAA 1FO0L 3QXAA 5D2LA 4LLQB 3SKOA 1WT5A 1F45A 1R3LB 3OTTA 2VE6A 4DOHE 1DQQB 1PZ5B 1Z2KA 4TVPE 3I9GH 5F8QC 5IVXA 5LGKA 4JVUA 5ADPH 3NPSC 1RU9L 2ICCA 4FQJH 3S35X 2G2RB 1XGQA 1HSBA 4PJEB 4X4YB 1EMTH 3OR7A 5FV1L 3GSQB 3VWKC 5E6IC 3H9SE 5TPWL 2ESVB 5IMKA 4ZTPH 2FEDD 4FHBD 5B8CB 2GW5A 3SKJH 5FECA 1UA6H 3ZL4H 1CFTB 2ZUSA 4GAJL 4NC0B 1TZHB 1D9KA 4KJYA 3GMLA 4MNHB 4JZNA 3RU8L 3QIWA 1G7LB 5HPOA 1XGRA 4UQ3A 5DJ8B 5HYJB 2K9UA 3MZTA 1IC7L 1QSFA 1C08B 1W0VB 2F54A 1H3PL 4I3GA 3VXMA 2JCCA 1SJVA 5C6TL 1OHQA 2YC1B 3BEWB 3C6LC 3H9SB 4HIHA 5D1ZC 3WKML 2BSTB 5EC2A 3HUJB 1KC5L 5D5MA 4MCZB 1UB5B 5E00B 3THML 4HJ0D 1X4YA 4A6YA 4X6DE 4F2MB 4RMTA 5GRZA 5I30L 3MV9B 3QDJB 4OI9A 5INCA 3T0EB 1PGRB 5C0CD 1VGEH 1MOEA 3ULUC 2YRZA 1ED3A 2FJHB 2Q8AL 5K59E 3MGOB 2ATKB 3QIUA 4N0RA 4QHNB 5F21B 4ZXBB 4F9LC 5DQDL 4YX2H 2NY7H 1AD9A 2FZ3A 1BWWA 1JGUL 1S7VA 3P9LB 3Q5YA 1HKLL 3IVKA 3DURB 4Y16D 5LVEA 2JIXB 1WC7A 2EIZB 4NN5B 5GGTH 3W5MA 4R3SA 4C58B 1SJHB 3U7YL 1SM3H 3U30B 4AK1A 5DVMA 1Y0LA 1TDQA 3I75B 4TRPL 5CCKL 3PP4H 4DAGL 1N59A 5FF6A 3OXSB 3OGCB 2VKXA 4JRYE 4POZD 3TN0B 4UTBH 5EORL 5LCVL 2NZ9C 3WN5A 1LP9B 2Y06L 3B2VL 4DW2L 2DQFB 1MVUA 2OMBA 1E4WH 3RGVB 4XI5C 3D3VA 4LL9A 1YEIL 1G7PB 3VXRB 3DIFA 4PBXA 4CADB 5E99L 2VZ1A 5DMGD 3NCYP 2P47B 1MCSA 4RGNB 1FFQA 1JGDB 4LCUB 2EXWD 4PG2A 2V5RA 3SDYL 3MLTA 4DGYL 3N0PB 3ARPA 4Z77A 4LRIA 1BPVA 4M6ML 4OLUL 1I1AC 2EDHA 4CNIB 5GRWA 4QRRB 5DGQA 2BVPB 5EO1B 3V2AR 3O8XD 2ZNXA 3SO3B 4Z7OF 3BN9C 2LTQC 1HN1A 4Y5YB 5EU6D 3SDXF 2NY1B 5IK3B 4AIOA 3FMGH 4K71C 3OZ9L 4YBQD 2HFEB 3WHE1 5MENA 4ENED 4DZBB 1MCOH 5GGVH 5I1KL 1VFUA 2YWZA 2D2OA 5GZNC 5DRXB 3QDHA 1BOYA 1T4KB 4QF1B 4X80H 1OP5K 4GQPH 3O9WC 3MV7B 1UH4A 3BT2L 3QZWG 1YEKH 4JG0L 3RZCC 4JLRA 4XNUL 5DJ2B 1X5XA 3DMMC 4KZEH 2WINB 5LAXA 2C4FU 3K8KA 1ADQL 1UH3A 1ITCA 3IF1A 4OZGE 5T5NF 1CDJA 2HTKC 3KPMB 2M2DA 4QHUA 1HQ4B 1BIIB 3DV6B 3QI9B 4R90L 5JMRA 3FTGA 3FQTA 5L7XH 5BJTA 1IGCL 5J11B 1MCDA 4JR9H 4N0UA 2DKSA 3PWPA 4WUUB 2I25N 2E7BA 4BQ6A 5J1AB 3MRLB 4LSRL 5E08H 1QP1A 1YMHA 3HNSL 3O2DH 1GIGL 5HYEA 5IM7B 3G5ZB 4WDIA 1M4KA 2EIBA 4NQDE 1I7RB 4P2OA 4S10A 1X5KA 3MOQA 4KDTA 4LHUD 1HE7A 1KJMB 2DQCH 5E2VL 4D94A 1KLUB 3FQXB 4PJ8A 5A2JH 1F4XH 3MGTB 4FQPA 4KXZI 1J0KA 1PG7L 4DGVH 4ELMB 4QRPB 1BFVH 5FB8A 2HH0H 5CLTA 1RURL 1ZLUK 4RMQA 5I8KL 1PG7W 2VLLA 5JOFB 2ZKHL 3QUYD 4IRZL 4HSQA 3VWJD 5TDOB 3DECA 2D7TL 1MI5A 4HK3N 3P0YL 3O45A 3PDGA 5T3ZL 4ZFFB 3MBEB 2NY2B 3CMOH 1KB5B 1I1FA 4PJHA 2HJFB 4R7NB 5I17A 5EIIA 4YO0A 4PGEA 1F6AA 2B1HL 4DKDC 1A3RL 2AQ3A 1YYLL 1F90H 5J4MA 5IF0B 3FT2B 2BNRD 3NCEB 4YHOH 4FA8A 2HP4A 1JGEB 3VFRB 4X6DF 1I85C 5ID1B 2PO6A 3JTSB 3HA0A 4JAMA 2Z31B 1JZ4A 1D7FA 3L95A 5K59F 4PLJC 1NEZA 2MQ3A 3EYOA 5INDB 1KPRB 3B5TA 2GJ6B 2XFXB 3T1WA 4P2QE 3T2NL 4ZD3L 3OKNB 5IB4A 1PZUB 5F6IB 3QZWA 2JE8A 1KB5L 1HI6A 1F3JB 2AXFA 3HB3C 2P5WB 3F7PC 3RL1A 3VFWB 4KUZH 3BPNC 1QVOB 2OZ4L 1MCFA 4YE4L 5CSZB 3VFMB 5L2KB 3VWKB 2BVOB 3KYOB 2VLME 5I8EA 3X11A 4AEIL 5IEHB 1FYTE 1OAQL 3Q5OA 3L3OA 3V6OA 3VD7A 5CP3H 2X4RB 5I8OL 4LCWA 2D7OA 3IFOA 2YPLA 5IB5B 5T1KB 1P4BL 4Z7WA 4QRSB 5F96H 3X13B 3OAUH 2MWCA 1CGYA 1YPZF 3BKCL 5JXAL 4GG6A 5L8KB 3GSXA 3RAJL 5IW6A 2ENSA 4FQLH 4RQQA 2G9HA 5D1ZB 4QRQA 3O2WL 5GGRY 4JB9H 3OPZL 3T4AA 3KLHD 3LEVL 1O5DT 2ICWJ 2ZUXA 4M43H 3HMWL 2VIRA 2R0WL 4Y4HC 4TPRL 4Z7QE 3SKMB 3DGGA 1DEDA 2VDNH 4K3DL 3GM0A 1OTUC 4UILL 1Q1JL 2QADD 1WCBA 4U1MA 1EGJH 2GY5A 4GW5B 5DJAA 3IU3A 4FP8H 5E2UL 1OM3H 3U4EB 4G5ZL 1MCEA 1ZLSH 4JKKA 4AG4H 5ICXA 3NCJH 1YN6A 2FIRT 1K8IB 2OJZH 1A9BA 3W0WA 2BSRB 3MRDB 4HXAL 5J9PB 1JV5A 3QBTB 2G60H 4O2CB 3TBVA 3ZTNH 4K3JH 4M5ZL 3DO3A 1OAZH 2ADJB 4OZGF 2AJVH 2FB4L 1FFPB 1A6AB 1AO7B 3IRZA 5GJTH 3H0TA 3F6IA 4DEPB 5DJXA 5FYLL 3RDTD 1YDPB 3QPQD 2D0HA 3VFTB 1INDL 1JHKH 3W82A 1YNTB 3KNBB 5GGRB 1T1XA 2NR6D 2OS7A 3CDGB 4KMLB 4M7LL 5E9DE 4TQEH 1CICB 4HGMA 1IGJA 1PKQB 4XRCA 3TZVC 3BRGC 5EBLA 2VL5A 2R9HC 1EO8L 4ONOA 2CK0H 5B4MD 5CBEB 1WFTA 1T6WA 1HIMH 4FQCL 3TC9A 4FFVD 4QCIB 1FBIH 1WIPA 1OP5H 5EU3A 1YNKL 5C0BD 4LGSB 1QRND 4NBZB 1JTOA 1VPOH 5F88B 4YEFA 2GFBB 3DJ9A 3Q3GA 2KPNA 5BZWA 4C56A 2LTQB 3VGFA 3VXUE 1EO5A 2AEPH 2M26A 1UZ8B 1D5MA 1UJ3C 5GHWH 3ZDXE 2Y9RT 5J12C 1IQWH 5JQHC 4BH8B 2VR4A 4EDXA 3MO1B 4PJBE 2X4QB 3O9WB 5JQ6L 4U1LB 3BOVA 4MSWB 3QCVL 5FFLA 3T8XA 5JNYB 1ETZA 3NA9H 4O58H 3GIVA 1FVDB 2IQ9L 4JKWA 4X5WB 1CLOL 1Q72H 4KWUA 2OL3A 4HG4K 1SHMA 4XP1H 1PQZA 1VACB 2X4PA 3BJ91 3L6FA 3LQZB 1ZVHA 5A2FA 4ZQKB 1E4KA 4PRBA 4O5LL 2HFTA 4NNPH 4MA3B 3QEHA 1S7WA 1NCUA 1E0OB 1T7YA 3MREB 4F7PB 2AJSH 5CINH 2CKBH 1ZLUH 5C2BL 5I1LB 2ZCKL 4U3HA 5HY9A 4X9BA 4YR6B 1KEGH 3V8CA 4LCYA 4P23B 3V4UH 2P48B 4Z7NE 1J1OL 3BGMB 4IRSD 3TP4A 3G6DH 2AAVA 5GGUA 4OAWB 5FYKE 1H3UA 4MQXD 4OZIF 1S9KC 2Z0BA 1VEMA 2YUVA 4XP5H 4XNYH 3QG7L 3LD8C 3O3AB 3EYQD 4NQXB 5IESH 3FZUD 4ZOEA 2E6PA 3NOIA 4WHCA 2GT9B 3IDXL 1IZKA 4F57L 4QOKE 4WFED 3BZFA 4K23L 4GG8B 3ET9F 5I1AA 4DKEL 4WFFD 1Q9KB 5IB2B 3ZYOA 2GUOA 3RGHA 4K7PY 4HV8A 1X5GA 3ALPA 1H5BC 1FYHB 1CLZH 3O3DB 5EUKA 4PJDB 4KK6D 2V5MA 4I3SL 5BVJA 2J8UB 1VENA 1CZ8L 5EN2A 3CU1A 3S35H 4HS3A 4X8JA 4Z7QF 1WAAF 2EDJA 5C07D 3CMGA 5ENWB 1M1SA 1HDMB 1HWHB 4KK8D 4I48A 1V05A 1G7IA 4WCYH 5K9KA 1BVKA 4X7TA 3ZE2E 5HJ3B 2FJGA 4JPWH 5ALCH 4LFHD 1IGIL 3NIFE 1IC4L 1I9RL 1W0WA 2NY3C 3WXVH 4M8VA 1TQBC 3UTPD 2MSPA 3BPNB 3DI3B 5ETUB 4M4RA 5IWLA 1W72L 5E95B 2NTFA 3CSBA 3B8YA 5HHVH 3GNML 5CZVL 4PRHD 3SCMC 3I2CL 2FR4A 3CLEH 2IQAA 1YEJH 2VDPH 1IGFL 5L8LB 4A6YH 1NKOA 2FEEI 4LASL 4Y1AD 1NGPL 3T2PA 2YZ1A 2D9CA 2ZSVB 3C2AH 1WBYA 5E2TL 2QQNL 4QXTB 1J0ZA 4NQCB 2FX8H 5IV2B 3N9GL 2AK1L 3HZVA 2D0FA 4JKPL 5DMYA 2XTJC 4KY1L 3EW3B 3VXTA 4NN7C 4PJFE 3U9PH 4MWFA 5HDOA 5SX4H 4JGMA 5FGBA 1TMCB 4DN3H 4YWGL 5GGQH 4Y4HB 5F3HB 4JG1H 4H8WH 2Y5EA 3L7FB 2JJSA 3BWUC 2HG5B 5DO2C 4WY7H 2VOTA 4I5BA 3SDAB 4U3CA 4WUKH 3WS3B 1EEZB 5C0AE 4Z0XB 1H9VA 4K94L 2KQNA 4L8BA 4E42A 1NH6A 5B38G 1I8KA 43C9A 4JJHA 1GAFH 3SKNB 3AM8A 3BPCB 5CJOH 3DX9A 5C9KA 3L3DB 3MROA 3HRZA 1NBZB 1ES0A 4FFZH 4PJBF 1AQDA 3H3KA 4EOWH 3S7GA 1OB1B 5E5MB 1FORL 4UB0L 2DQTH 2OR9L 4XNXL 4GMTL 1XH3B 4PRNB 2EDNA 1FV1A 3MV8D 4JM4H 3WHXA 1HNGA 4W81A 4GRLA 1UB6B 2VISA 5ADOL 2Z8WC 1LE5B 4NO2B 3PL6C 5MI0C 2V2WA 4YC2B 4WU7B 4G6AC 5TE7L 2O61A 2H2SD 2CQVA 2J1KA 3WFHA 5JHDA 1JPST 2IFGA 4XMPL 1YJDC 5GSVB 1F4YL 1MFAL 3UBXB 4PRPB 3TZVB 3U7WL 1IMHC 1WEJH 4Q6IC 1HHIA 4WO4A 5IJVA 2A83B 4ZNEA 4OUUB 3W39B 3FQUB 4K9EH 3D2UA 4WHYG 2XKNA 2Y36H 4ORGB 5DZLA 3WIHA 1BFTA 1KIQB 2AJUL 3GSUB 4K3EL 1DN0B 4LRNH 4P2RA 4Z76B 2Y7QA 5MEOB 4PGDA 4Z7NF 1CE1L 4J8RB 3C60C 1JNNH 2GSGB 4HQQH 4AIZB 1H8SA 2DLFH 2VXQL 4X9HA 1CGWA 2VDOL 1LEIB 2DTSA 1OD7A 5EO9A 2VITA 3ILQC 2ERJC 4JFDE 1MUJB 1GXEA 2AEIT 4LNRA 4XPTH 5C9JA 3GI8L 3TJEH 4XHJC 4WW1B 3W2DL 5DJDA 1II4E 5SWQA 4Y4FC 4JVWA 1ODAA 1T5XB 4JO3L 4RIRB 3R1GH 3EYSL 4LF3B 3DX8A 3MRPA 3DRQB 4JHAH 4PJAE 4J7RA 3ETBF 1U3HD 2KZ1B 4OZFB 5I15H 1J5OH 2Z4QA 3ROOA 5SWSE 2BOBB 3RVUC 4V1DA 4I3RH 1AGBA 4JPKH 2W60B 1GGBL 4JFDB 4WHTA 4OD1H 3RA7L 2GCYB 1A5FH 2H26B 2A6DB 1IM3B 4L3EA 1M05A 1NL0L 5B38A 5EC1B 1N0LA 3ECBA 4QHLA 5HGDB 1Q9WA 2AKRA 4GAYA 2BHZA 3MYJA 3ZE2F 1EEUA 3BSZH 1AHWC 5DD0L 3SY0A 1KELL 1G9MH 3NIFF 3QDMA 1DBAL 4AH2A 4GAGH 4LOUC 1T04B 2Y07H 3DVNB 2CIKB 5TDNA 1NFDE 5E0QA 4IOIA 5CP7A 2BOCA 3RVXC 2CD0A 4G9FA 5HGAB 4CKVX 1MSPA 1MY5A 1S5HA 3S5LG 1A6TA 3OHXB 2UZIH 3LD8B 4N68A 3RZWA 4YDIH 4L5FH 1TNNA 1AI1H 2ADFL 4X4MA 5IHBA 2JK5A 1KPVB 1TVHA 5IBLC 3SOBH 1S9YA 3BP7B 5C09A 2ZPKL 3V0VB 1EHNA 3KPRB 1IT9L 3GMRB 4X9IA 5C0GA 3QH3A 2P1YA 5C7XL 4XPGL 4PJFF 2RAMA 3DPBA 2JJVA 4ZFGL 1K4CB 1BM3H 3OKOB 3RWEA 3ZMRA 2FYYA 1CE6A 4NO0D 1TCRA 4QXWA 4XVSL 1ONQB 3RIAK 4W70A 4ZUSA 1A1OB 4OLYH 1QA9B 1NGZB 4XCNB 3FB8A 2NLJB 2VLJB 4S0TD 2NYYD 4M93C 3BGFC 1RJZA 4PJXE 2NW3A 1AGCA 2BY3A 4PLOB 3MODL 1P6AB 2NMSA 2VDKL 4JN1H 4U6VH 3SDCD 2F8OA 5H2BB 4AZ8A 2WUBL 4KJPD 4W6WB 4JZOB 1RD6A 3P4LA 5IG7B 5KSVA 2OTUA 4PV8B 5DZOA 3B9DA 2R1XB 3BH8B 5F3BA 3RTQC 5F1NB 4HUUB 5KSBE 5HI5D 3TVMC 4KKLD 4OT1H 3JVGC 5DI8A 4HKXB 3VFPA 4YAQA 2R23A 5F7EL 2XTJE 1XF4B 1R3JA 1G1CA 1KB9J 1IJ9A 4MX7A 1I9JH 3SCMB 4N90E 2BY2A 3GKZA 1NAKH 4LSDA 1ZT7B 2DL9A 3NVQA 5I1IL 2AEWA 1AE6L 1SJEA 3FO9B 4N0YH 4ONFH 3JWDH 1YY9D 2VLKA 5KTEH 4YFLI 1AY1H 1G9NC 3P0GB 3NFPA 3LKPA 1T89A 2NY0D 3O4LD 1BLNB 4IBLT 3N85H 2GSIA 2IJ0C 4J12A 4GW1B 1NDGA 1U8JA 2J2ZA 2HKHH 3GZKA 1LILA 3STLB 4NN7B 4FS0A 4JN2A 3S3SA 2C4FT 4I0PC 2WP3T 2BXZA 1UKQA 3RI5F 2DQIH 2HT4D 5DVOA 1DEEB 4XMKL 4HKBB 5DFVD 3U6RA 3QDGD 2MJWA 3LKRA 4X6EA 3DX7B 3MLZL 1U42A 3BXNA 5AWNH 4HWBL 5HVGB 1T7WA 4HDIB 4XVUC 3KJ6H 3D0VB 3WNLA 4U1KB 3LZFL 5F93C 2V9TA 1MNUH 3BHBB 2VAAB 4OF5A 1X5JA 4DUVA 4X98B 2XT1B 2H3NB 4TSCL 1WLHA 4GQ9L 1ZSDB 4OBRA 3LRSB 4WTZG 1OGAD 1N8ZB 2NXYC 1CXFA 4PGBA 4R4NC 1OSZB 3DXAA 2ICEA 1KJ2L 2AV7B 1INQA 2FGWL 3CK0L 1DBJH 4U1GB 3RUGA 2VH5H 2E9IA 3DUUB 3KPOA 4CW1A 5KZCB 3UBXI 4PJGA 4G8EB 4HEPG 1JYWA 1BOGB 2P8LB 3PL6B 3SGEI 1KSRA 5D9SA 1J12A 4G8GA 3WFZA 1TCMA 2ADGA 2BY1A 2Z93B 1MQKH 4UOJA 1CXIA 1U91B 2E7LA 1A4KA 1B0RB 1RIHH 3RY6C 3G08B 1FZJA 1DQDH 3WUWA 5I74B 5JOPD 3F8UB 3PABA 2JLLA 1NDMA 3BQUA 3BESR 4XBEL 1NFDF 1KJVA 2CPCA 3C60B 3MLVH 3MOAH 1KN2L 4QNPF 1EO7A 4M7KH 4OFIA 3ILPA 4YPGA 4BQBA 1DFBH 2OL3H 4PJCE 4YHIA 2XA8H 2J88H 2BRRL 2AJYL 3MRKB 4HWNA 1RPQA 3B2UD 4NQSA 3T3PF 3AY4C 4YHML 1A6ZB 4M03A 3U4BL 2W9DH 3DROB 1EAPB 3JBG7 4XCYA 3ZYIA 3IJSA 1PLGL 4XWOD 1MLCA 2K7PA 3GK8H 2EYSA 4K07A 1NBYB 1XF3B 1CL7H 5GXBB 4PGCA 3D9AL 4R7DA 5D93C 1ZS8A 2VDQH 1S7SA 3MLRH 3QEQB 2YKLL 2R2HA 1FG9C 5SWZB 4NYLA 3ZDZE 1Q38A 4L4JA 3D25A 5T1LB 4Z7VA 3T3ME 3WFCH 2VC2H 4HKZB 1JPGB 3V95A 4OKVB 4PJXF 5ACZB 3LKNA 1N0XH 1MIEL 4X7SH 5B22A 1CFNB 1K2DA 2MOVA 5IGXH 3CFEA 3KWWA 1RUQL 4P57B 1AHWB 3CC5A 5FYJH 5IQ9B 3H9YA 5DK3A 4WTZA 4JFZL 3HE6B 2L0DA 4U1NB 4QXGL 2WUCH 3GI9L 4PJ5A 5I1GL 5J06A 1XF1A 5KSBF 4NZRH 3CFDA 4H25A 5BW7A 2XYCA 3ULVH 1NLBL 4QHMA 3L7EA 4BFGA 4PFEA 4APQB 4UIMA 1TPXC 1RUPH 2GK0A 5DVLA 1WWWX 1FO0A 1I7TB 2F74B 3JWNC 4GS7C 4RWYH 3T0AA 4F3FA 5JXEA 1Y6KR 1GCFA 1KENL 2ORBL 2A0LD 1R24A 4LIQL 4HKJB 5IVNA 1V7NL 4MXVE 4P59H 5FAAA 4OM0L 3QCUL 1XR9B 3MCLH 4FQXC 1J8HD 3GSOA 2XQBL 5I2IA 5K9JL 5C0EA 2EXYD 3EKCA 5CZXC 3L5WA 5JO5A 4HBCH 4JM2D 2E27H 5GIRB 5D1QC 1FJ1B 5AD0B 5BS0A 4BSWA 3NIGE 4UDUB 4XWGH 5FO9B 2I60H 3RNQB 1E27B 5FCUL 4F33A 4F7MB 5D1XC 5DEFB 2PF6A 3KPQA 4G8FA 4G9DA 1XCQA 2IPTL 5KOMC 2YEZA 4BA8A 4QO1A 1VKXB 1GPOL 4ZFOL 1I3GH 4MJ2A 4LLQA 3ORJA 3AGVA 4FTVD 1R3LA 4PIRF 3O0RL 1A7PH 1BAFL 5BRZD 5KS9E 1DQQA 3MXWL 4TULH 4NBXB 4EBQL 1PZ5A 3D69B 3GMNA 3TH4T 3ARDA 4QRTB 1U8HB 3WS6A 3RTQB 3M17A 2CR6A 2G2RA 3TVMB 4ALAH 3V4PH 3F12A 4M9OA 2CO6B 1FFOB 4PJEA 4X4YA 3UJJH 3RFZC 4K3HA 4MHHG 1NANH 1TZIA 3GSQA 2OR7A 4PGJA 4HUXA 1ZT4B 3FHAA 3CFBA 4R2GB 1KTDB 5ADPL 2ESVA 4NFBA 4FQJL 3HAEB 2J4WL 4M6AA 5B8CA 1MFEH 1T2QH 1CFTA 2BNQE 4CVZB 1TZHA 4MAYD 1S3KL 4MNHA 1GGIH 1G7LA 2CXGA 5DEZA 5CEXB 5DJ8A 5HYJA 1W0VA 1C08A 1FLTX 2EEAA 1JMZA 4O2FB 1FC1A 3H9SA 4I0PB 2BSTA 4YZFE 3HUJA 2C3HA 4MCZA 1UB5A 5E00A 2AGJL 2WQ8A 2FEDC 1LE9B 5I66B 1CI5A 2YD7A 3REWB 1Z5LB 4Z7UE 3ARQA 2WK2A 1OAXH 3ARUA 3HI5H 3T0EA 1X7QB 5CWSB 2IALA 4NBYB 1AXTH 3B9VA 3MRGA 1SEBB 3MGOA 2ATKA 3WO3B 4PJCF 1GGTA 4A2MA 4QHNA 4ZXBA 1NBVH 3RJDA 1NKRA 2G75B 3P9LA 5JDSB 2QSTA 4JREC 3BYTA 3DURA 4YGAB 4J6RH 2H8PA 1VGEL 2EIZA 4GXVL 1SJHA 3MA7B 2NXYB 2NY7L 1W0YT 2EDLA 3I75A 4HJ0C 3LRGA 4ERSH 1I9IL 4LLYB 4D9RE 3OXSA 3OGCA 5CILL 3U4AA 3WIHH 3TN0A 1WUNT 1JBJA 4MJID 3QR2A 2DQFA 2WMPA 3MRQB 3FFCB 3WSQH 1MWAA 3ZDZF 5CSBA 3RGVA 1I3VA 1G7PA 3VXRA 2LVCA 4CADA 4Y16C 3O4OC 1KCRH 5FUOH 4OV5B 1OY3B 4G3YL 1JGDA 4LCUA 1IAIH 1A1MB 1MFDL 1TZGH 1ZANL 4Y19D 3LQAH 5HHXL 3VFSB 4RISH 3O3UN 4OZHE 5FGCE 2GTWB 3EO0B 4KFZC 2F53E 5KJRH 4J3VA 4HHAB 4POZC 1Q8MA 1FLRH 5D7IE 1RMFL 1VFAB 5EO1A 4Y5YA 2RBLA 1JHTB 4KHXH 3K1DA 3HG1D 2HFEA 4JCMA 2YD5A 4EI5B 4DZBA 4LDLB 5DMGC 5CAYB 3MPCA 2QR0B 5DRXA 2EXWC 3QHFL 1JYXA 4ETYA 3EFDH 1NUDA 2F53B 4GLRI 1MCOL 3MV7A 3P11H 2UVFA 5D7IB 4MXVF 2COQA 5DEGB 2BFVH 5FYJU 2B1AH 5D7JD 2HVJA 5DJ2A 5C0RH 5L2JB 3LN5B 3O8XC 2WINA 3RIFF 1SVCP 5D93B 4Y5XC 5IFHH 3PWNA 4PRDB 4P2YA 1DLHB 2LU4A 5D7LE 2BCKB 2H9GA 1GSMA 4YBQC 1RK1B 1LO4H 3U46B 4ZYKB 4MXQD 2DF3A 4KZEL 1A9EB 2N4IA 3KPMA 1X6NA 4HBQA 1BIIA 3DV6A 3WBDA 1EJOH 3WLWD 2NW2B 1G0YR 3QI9A 5DHYB 4HWZB 4XBGB 4QGTA 3T65B 4XCEB 4WUUA 5J1AA 3HE7D 3MRLA 1I9EA 4OF3A 3AB0C 3ABZA 1UT9A 2RR3A 5IM7A 3G5ZA 5KS9F 1T5WB 4NUGH 1S7QB 1I7RA 2MMXA 4JR9L 4XGZA 3SE4A 3QFJB 1UZ6E 4G6FB 3TBSB 2D31B 4WHYH 1CLCA 2DJ4A 4KQ3H 5C86A 1KJMA 4MNGE 1LO2H 5FYKU 4TVPD 1KLUA 3FQXA 1BGXH 4NZTH 4NQED 1ZHBB 3MGTA 4WW2F 2EDDA 1TPXB 4GW4B 2X4OB 4ELMA 1YYMH 3TGXA 4QRPA 2P5EB 2FDBP 5GISH 1S9XB 5JOFA 1D6EB 1E6OH 1LP9F 2HFFB 1F4XL 5TDOA 3IDIB 2X42A 4R6UA 3KYKH 4ZFFA 1QFWM 5EBGA 3NABH 4I2XB 3UTSD 4FQXB 3K2UH 1KB5A 3EDEA 2HH0L 5E8OB 2HJFA 3ZHLA 4R7NA 4LKCB 2OBGA 2APFA 2OZ4A 5D1QB 5M95B 4RDQG 2ATPB 3H7LA 2MPAH 4PTUB 5IF0A 4KK5D 5E8EB 5DD5H 4RA0C 2KDGA 5D1XB 4R26L 4WNQB 3BPOC 2Q1EA 3BMVA 5J3HD 1JGEA 2JELL 5E4EC 3VFRA 4MD5B 4Z7UF 5ID1A 4JQVC 1CK0H 1F90L 5DHVB 4JO1H 2Z31A 3QUYC 3VWJC 5A43C 4PP2B 4OSUL 1EAJA 3QUXB 2A73B 2GK2A 4X9FA 1TJGH 1A7QH 5INDA 1OARH 2V2XB 4QXUL 5CJXA 2XFXA 3P9MB 1DBMH 2C3GA 4CVUA 4UNTA 2VLRE 3PQYB 4JHBA 3OKNA 4EIZC 4N9GB 4NHCL 1F3JA 4F9PA 3LV3B 1RIUH 4FABL 3VFWA 3NZHL 1QVOA 5CSZA 3U2SB 1X4XA 5D72L 4KVNL 3VFMA 5EIVA 3VWKA 1OW0C 2BVOA 3KYOA 5E6IA 3F5WB 1ND0B 5IEHA 1IC1A 1OQOA 1T20B 1NC4D 4ZNCD 1OSPL 3NTCL 3K1KC 4KUZL 3UX9B 2X4RA 3ZSTA 2YD3A 5T1KA 1OT1A 1N5YH 4NWTL 2RQ8A 5CEZH 3HZYA 4J1UB 2BERA 5F89B 3UYOD 2I07B 4QRSA 1D5ZA 4JRYD 2W0FB 1P53A 3X13A 1D5IH 5GRUL 1CGSL 2ITCB 3DHMA 4OGXH 1FRGL 5E70A 1KJ3H 1RJLB 4OCRL 3MNVB 3OF6A 1CDIA 2E8YA 5F96L 5D1ZA 3OAUL 3ZKXC 3G6JB 3MTRA 4OZHF 4PUBH 1PSKH 4NO3A 3HR6A 4U0QB 1EPFA 3SKMA 5HGHB 5BVPH 3RPIB 4ZUWB 3FB7B 1L0XA 3UDWC 4GW5A 5C0CE 4M43L 4CJ1A 4CUCA 4F9LA 4JFXB 1I7UB 4GBXB 2VDNL 1XGYL 5D6DC 1G7JB 2VQ1B 4KQ4H 3JV6B 1ACYH 4U7MA 1EHLH 1OM3L 2AW2A 4XX1E 4YHLH 2H1PL 2LAGB 2BSRA 3VU2A 1ZLSL 3KLHC 4ZDHA 3BIKB 4XBPB 3MRDA 5J9PA 4J4PD 4AG4L 1YUHB 1JWUB 4O2CA 5J6GA 3V0WH 3QCTH 2OJZL 5DUBB 2WQRA 4P3CH 2ADJA 1DUYB 1ZEAH 3OL2A 2QADC 3VW3H 3X14B 1FFPA 1A6AA 1AO7A 5D71H 3S34H 3RX7A 2G60L 4XZUB 1M7IA 4LDEB 1P1ZB 4Z78B 4WGWB 1YDPA 5JIHA 4K3JL 3VFTA 1DSFH 1YNTA 3KNBA 5GGRA 3CDGA 4XPBH 3O4OB 4E41E 1HQRB 1YMME 3GSRB 3HPLB 2KH2B 1PKQA 2DLTA 3FONA 5GJTL 3BN3B 5GS2D 4MJ5B 1CXKA 2QQKH 4LLDB 4OFYD 1JHKL 4NQUA 5CBEA 5I18H 1VA9A 5GS0H 3MJ9L 1SBSH 1N6UA 1Y18B 4TQEL 2E7MA 3MGAA 3J7HA 5FEBA 4QCIA 3TT3H 4PRID 4YK4B 2VZ3A 4M6OL 3L1OL 5F88A 5CSGA 1UZ6F 4HUWB 2BDNL 4AENB 1CS6A 1L0QA 5EUOE 1AIFB 4OGAD 1NCWH 1IGML 4KKCD 3QPQC 4HAGA 4NQDD 1GZQB 5FM4A 2NR6C 2IG2L 4K2UL 3OKDB 4MGXA 1KB9K 3IAPA 2MKLC 5HHPB 4YJZL 3QEGH 3KR3H 1AD0B 2W91A 1T7XA 3WJLC 1BWMA 4BH8A 2AEPL 5TDPA 3GBNL 2OJEB 5B4MC 3MO1A 4F37K 35C8H 4ZMAT 2X4QA 3O9WA 3JUZA 5JORB 1UWGL 1KBGH 4FFVC 3VFGH 4MSWA 5JNYA 3MRFB 4U4BA 1IQWL 5LJYH 3WNOA 3I6GB 5DJZB 3O8XB 4JRXE 1L7TL 1UM5H 1FVDA 4Y5XB 5EU6B 1VSCA 2E7HA 1C5CH 43CAB 4YGVB 1T6VN 1NCCH 3KLSA 2AJXH 3P73B 3WFBL 4BM7A 3NA9L 3NFNB 3FCTA 1VACA 2CIIA 1XR8B 3LQZA 2X89D 1PX4A 5GGSY 4ZQKA 2NY4C 1BHGA 3R0NA 1K3IA 3TYGH 3VG9C 1FO0H 4YH6A 4MA3A 1YEHL 4XP1L 5DYOB 1QUNA 3R8BB 3AB0B 3MREA 2YD4A 4F7PA 2WBJD 2W0LA 3VD3A 4KXZH 5I1LA 1M7DA 3VXPB 4YR6A 4P23A 1RU9H 3BGMA 1WBZB 3CZFA 2VUOA 4P2QD 1ZK9A 3TF7C 2CKBL 1KLGB 4RNRB 1QBBA 2BVYA 2XRAL 4D0DA 2D7NA 4OAWA 1QHOA 1WBXB 4RFNB 1MIML 5AZ2L 5TPWH 1KEGL 5IVXB 1BBJA 3V4UL 5HYQB 4HS6B 4RDQF 5LKNA 3O3AA 2IAMD 4NQXA 4B41A 4F8TA 3C6LD 4IOFD 2VLMD 2GT9A 3R0MA 1FYTD 4JHWL 4GG8A 3RHWF 4OLWL 3GUTB 1WVZA 1U8IB 4XP5L 3SGJC 5HI4D 1Q9KA 2QQLL 5IESL 5ISZE 3KYAA 5DUPH 2VNCA 4IRSC 4UT9H 5GGSB 4PJDA 3P77B 2XZQL 2LE9A 2J8UA 4MQXC 3DSFH 4UZGA 3VXMB 2JCCB 1WICA 3BPOB 2BNRE 3BD5A 3EYQC 1ZGLM 3FZUC 5E4EB 3SJVE 1LO5B 1I85A 5ENWA 3H3PL 5I30H 1KCUH 3QUYB 3VWJB 1JHLH 2D3VA 3S35L 2Q8AH 2V5TA 6CGTA 2DIAA 3QNYB 5MEPB 5JMOC 3UBXG 4PY8J 5DQDH 5HJ3A 3DV4A 4X99A 3MR9A 4Y7MA 1JGUH 2W38A 4X7FC 1HKLH 2WBWB 1A2YB 2J8HA 1ED3B 4KK6C 5JW3H 4ZSOE 2X1XR 3C6SB 4OI8A 5ALCL 1H8NA 2IBZY 3WXVL 4M48H 1WC7B 1WCQA 4KK8C 4R3SB 4ZTOH 4BK5A 4K7PX 2LAAA 1J0JA 2XPGB 5LCVH 3P3YA 5KAQG 2HA1A 2ZSVA 2DQGL 3CLEL 1PDKA 4QXTA 4P5TD 1YEJL 4NQCA 2N1KA 2VDPL 4G7YL 4JJ5A 4A6YL 4W6XB 5E9DD 3ZKXB 3HRPA 3UCRA 4OZFG 3V4VH 3O6KL 4Y4HA 5F3HA 2YD9A 4YDVB 4WWID 1A21A 5BQ7B 3L7FA 3PP3H 1CDYA 2HG5A 3NAAL 4DN3L 5JW4R 1QYGH 3SDAA 3OZ9H 5GGQL 3WS3A 1EEZA 1RUKH 5CJQL 4Z0XA 3A67L 3EHBD 5KW9H 1MWAH 5I1KH 2ZWLT 5DK2A 3VXUD 3BPCA 3L3DA 4WUKL 4LNVA 1NBZA 5F1SA 1RZJC 12E8L 3VGAC 3K2MC 1OB1A 1H3TA 2EC8A 3NACL 3QHTC 3QFDB 1GAFL 5E5MA 5CJOL 5DF0A 4XP4L 1X5HA 4ZO8A 4X5LA 3RX8A 5FYJD 5KSAD 3I02A 1NPUA 1UB6A 4JLRB 2YRLA 1A6VL 4JFFD 1P5UA 1LE5A 5IBTL 4NO2A 4PJIE 2XQYG 1AKJB 3AS3A 4NSKA 4WU7A 4HH8A 2APWA 1YNLL 2P43B 5GSVA 1J87A 3UBXA 4PRPA 3TZVA 5I9QC 3QWOB 4RGOH 2PXYD 3W39A 3FQUA 1E4XL 3M1BB 4ORGA 1GIGH 5BJTB 3RVWD 4IJ3C 4XVTH 5L0QC 4TVSa 1DN0A 1WEJL 3BVNB 3IDUA 4Z76A 5MEOA 3NCMA 4HFUL 3NCCB 1QRNE 2RFXB 4J8RA 4XP6H 3RDTB 2GSGA 4LLWB 4D9LH 2AEQH 1A7NL 4NC1E 1S7UB 5TF0A 1V3KA 3REVB 2H2SC 1LEIA 1WITA 1MUJA 1RZKL 5B39A 1JNNL 2XWJB 4PS4L 2DLFL 4WW1A 5FYKD 4GMSL 5I8KH 2ZKHH 1DVFB 4IRZH 4R0LC 4ZUTB 4R9HA 2D7TH 1KN4H 1T5XA 3E3QC 5C0BB 1ULVA 4RIRA 5FB8B 4LF3A 3TJEL 4QOKD 3DRQA 2PCPB 5I6XC 4XAWL 1VEOA 4OZFA 4JPIB 2PW2B 1YYLH 3VRLE 5F6HI 1MI5B 2BOBA 3R1GL 2W60A 4JFDA 2QLVB 4P5KB 2XACC 1YN7B 4JHAL 2GCYA 5KVFH 4PGEB 2H26A 2A6DA 1J5OL 1IM3A 4BFIB 1HNFA 2VDMH 5I0ZA 2HLAB 2P45B 4JPKL 1F00I 3PV7A 2DQHL 5HGDA 4OD1L 3SGKA 3K81A 1KYOJ 3UYPA 4RZCB 1OTTD 1UYWL 2O5XL 2PO6B 3T2NH 4ZD3H 1T83C 1T80A 1U3HC 4P3WA 1T04A 3AXLB 1KB5H 3DVNA 5HDBE 2IAND 1C7SA 2R29L 1NEZB 1UEMA 3EYOB 3VXSE 5EU4B 5EO0B 2OZ4H 4YE4H 1EV2E 3NFSL 5HGAA 2CRZA 5IB4B 2Y07L 1OAQH 3OHXA 4X4XB 5CGYD 2AXFB 4I18C 4LDOB 3AMKA 4LLUB 4OLEA 1KPVA 3BP7A 4WFEE 2UZIL 3QO0B 3KPRA 1KIPB 3BKCH 4ZOBA 1FIEA 3GMRA 4Q2ZA 3VDBA 1PVHA 4L5FL 5KVEH 2ARWA 2E9JA 3RL2B 3NBNA 3I3BA 3SOBL 1K4CA 1H5BA 5J1SC 3MOBH 3O2WH 4FG6D 3OKOA 4BSVB 4GG6B 3OPZH 1RK0B 1ONQA 1YQVL 5JHDD 3LN9A 1A1OA 3HMWH 4P0DA 4U31A 1QO3B 2R0WH 4TPRH 1QKZH 2VWEC 4I13B 4RQQB 1NGZA 2NLJA 2VLJA 4JY6B 4K3DH 2N7BA 5ICYA 1Q1JH 4LPYA 3FN9A 3T4AB 1U8QB 1KCVH 4WWKD 1U3JA 4XXDA 1Q0XH 2VIRB 3CX5J 4OLYL 5H2BA 2C7UB 4JZOA 2RCSL 5IG7A 4X6FA 2A77L 4PV8A 3MRMB 5C0AD 3IU3B 3BH8A 5F1NA 1MLBB 4HUUA 1UVQB 2YPKB 4CRPA 4EDWH 4HKXA 4HXAH 1C8PA 5ICXB 3BRFA 1XF4A 4G80B 4XMLH 4C4KT 1PEWA 1ZA6B 5C07B 3SCMA 4M5ZH 2NYYC 1ZT7A 4PRHE 4HWBA 4OT1L 2FB4H 4M5YH 4NN6C 3FO9A 3SDCC 4KJPC 1YEEH 3ULUH 1INDH 4Y1AE 5E94B 1BLNA 2VXTH 1JI2A 1J0YA 4QTIL 4M7LH 1NGXB 4WEMB 2R2EB 1OF2B 4S1SH 1GGYA 4N0YL 4ONFL 5HI5C 3MSPA 1REIA 4KKLC 1TTGA 4WGVB 1QSEE 3SDDD 3QISA 5HHQB 2DM4A 3DUHA 4ZAKD 2GQHA 4XVJH 3N85L 3VG0H 4FQCH 1BX2A 4HIJB 4G6JH 3DX7A 2QSCL 3T2OA 5EBLB 4Q0XH 3FB5B 1OWWA 4CVWA 3V6ZB 1YY9C 4HDIA 2DQIL 4JY4B 4X8XA 3D0VA 2NY0C 4PJ7F 3DVIA 4U1KA 5EU3B 1E4XI 5E5RB 4I0CC 3BHBA 2VAAA 4GOSA 4YBHA 4X98A 5AWNL 3KJ4C 2H3NA 4O00A 4L3AA 2JJWA 5FUCE 3KJ6L 1I75A 1UXWB 3SPVB 2HT4C 1N8ZA 3VGAB 1OSZA 3QCVH 4KTDL 1NAMA 2AV7A 2VDLL 3MXVL 3RBGA 1P6FA 3VRLF 3DUUA 4MA7H 3CH8A 5C09D 2FX7L 2EC9U 1CLOH 2HKFH 4Y5VB 1ETZB 4G8EA 3BEVB 1BOGA 2X6MA 2P8LA 3PL6A 3LCYA 1QEWA 1YY8A 3V7AE 4X6CB 5SWSD 4CVXB 2Z93A 4ZPVB 1DJSA 4Q6IA 3QQNA 5I9QB 2OL3B 2EYRB 5AAMA 3BD4A 4LK4A 4OCXL 4RFOH 2X4PB 1JTTA 5TE6L 4LPWA 3VI4E 1B0RA 2ADIB 1KCSL 2PN5A 1S7RA 4IJ3B 5L0QB 2OSLB 2V7NA 1MQKL 1T2JA 4WHDA 3MV8B 5M7QA 2BVTA 1OLLA 4AMKL 2GY7B 3C60A 3MCKB 3E6HB 1RIHL 1GC1C 3ZE1F 4DKFH 1DQDL 3IFLL 1IQDB 1LGVA 1FQ9C 3BKJH 3QG7H 2FBOJ 3MRKA 3MOAL 5GRJH 4F80A 3QIBD 1HXYA 4M7KL 2A9MH 1A6ZA 3IDXH 5GGUB 2OK0H 1FC2D 3B9KD 4F57H 1DFBL 4R0LB 2OL3L 4AIXA 4Y4FA 1QR1B 4ODUB 2XA8L 2J88L 3DROA 1EAPA 4DKEH 4LMQE 1NBYA 1XF3A 4KI1A 4OFPA 4DK6A 2VLKD 3UPAA 2AXJA 2W9DL 2ZP0T 3QEQA 2CDGB 4IS6B 3HAEG 4JFYB 1B0WA 1CZ8H 5SWZA 3NZ8B 4KVCL 4C59B 1CL7L 3B2UC 5T1LA 4P46D 3MUY1 4Y2DD 3D39D 4HKZA 4ZO6A 4HLJA 4OKVA 1BFSA 5A3ID 4LSQL 5ACZA 2X10A 4UOW1 4XWOC 1IAKA 4P57A 4LSTL 5GS1C 1AHWA 4OF7A 5IQ9A 1QBAA 1IGIH 3ESUF 1IC4H 1P4IL 4I9WE 4HZAA 2YD2A 3W5NA 5EPMB 3U7AA 4H88L 1IKNC 1NSNH 3ZE0E 3AAZB 2ICES 3GNMH 5CZVH 4BUHA 3I2CH 4APQA 2R4RH 4I1NB 1PY4A 2XQYK 3OKLA 5EDXA 4NZRL 1CIDA 1I7TA 1IGFH 3T0VA 2QV2A 1N6QH 5C08E 4LHJB 2BC4B 4N90D 1JF5A 3TO4D 4BSJA 4HKJA 1RUPL 3CNKA 5E2TH 3O11B 2XG4A 3OKEB 1XR9A 4HAFA 3FT3A 1MCCA 3EAKA 4JKPH 4PV9B 1OD9A 3ZT6A 4PBWD 4LVNB 4KY1H 5GIRA 1LVEA 3ES6B 1FJ1A 4OM1L 3CUPA 5AD0A 3KS0H 3WNKA 1BQLL 4GRMB 4RMUA 4UDUA 4P59L 4L4VB 1U8PA 5GRVK 4YWGH 5FO9A 4L9LC 5DURD 3RNQA 4ZG1A 1E27A 4S11A 1J05B 4F7MA 5AEAA 1AJ7L 5DEFA 2KZWA 3DSNA 5EOCH 3EGSB 4HBCL 3E2HB 2E27L 4H20H 2J7LA 3UPCA 4PPTA 3C2SA 1YQ2A 1VKXA 4XWGL 2I60L 2A0LC 1SEQH 3AU1B 1BD2E 3S8WA 1BQUA 5J13C 4K7PH 1IEBB 3C08L 2EXYC 3MFGB 4JM2C 4M8QB 5IR1B 1R6VA 1I3GL 4QRTA 1U8HA 5I19L 3RTQA 2Z8VC 3TVMA 3IDGB 3KPSB 4NO0B 4U2YA 3GIZH 1FFOA 3LKSB 4E42B 3BPLC 43C9B 1FORH 1QSZA 1ZT4A 1KTDA 2RB8A 2X9WA 1DTUA 3C8DA 4X6BB 1IARB 3HRZB 5ICZB 3HAEA 1C16B 1KNOB 4ALAL 3FHQA 1A47A 4KZDH 2DMBA 5GS0D 5KVMC 3MLWH 3UJJL 4CVZA 3LY6A 5J6HB 3S88L 1BEYL 5ADOH 4S0SD 5F9OH 2D0GA 1IEAB 1QFWL 5CEXA 3CD4A 5TE7H 1MFEL 1T2QL 3O4LE 4PTTB 2ARJB 1ORQB 4O2FA 3P40A 4DQOH 5TFSL 1I3RB 4LSUH 1U0QA 5ESQB 3S6CA 4YHYC 4I0PA 1N5AB 4E5XB 5KN5A 5FM8A 3FL7A 4ZFZB 3MRCA 1LE9A 5I66A 4K3EH 5I73B 1G6RA 3REWA 1HHIB 3UROR 4MAYC 2WM0A 1X7QA 1WF5A 1RIVL 1TTUA 1SEBA 2VXQH 1LNUA 2VDOH 2Y7QB 1WIUA 1OAXL 3HI5L 4MA8H 3G04B 3BZDA 2G75A 5JDSA 1IVLA 3ZT7A 3DNKA 2DBJA 3MA7A 1L7IH 1F2XK 1T0NB 3SGEH 3QDGB 3QQ4A 4JO3H 1OGAE 1NBVL 3OB8A 3GHBL 2EE9A 4EQ2A 2F5BL 3FO2B 1T22B 4LLYA 1JK8B 2E6QA 2EECA 3EOTH 5EB9A 3MLUH 3VI3E 3FFCA 4ERSL 1NUFA 4NJ9L 3WIHL 3RA7H 2K7QA 3EO9H 4L4TB 3ROOB 4YDLC 3JWOL 5H94B 3WO4C 4OV5A 3ARWA 1A1MA 3WSQL 4WHTB 3RVXD 3VFSA 5D2NE 5JIPA 2ICWB 2GTWA 3RY6A 3EO0A 1KXTB 3EDFA 2BZDA 1OAKL 2VZOA 2ZUQC 2BSED 5FUOL 4HHAA 3TBWB 4LSPL 4XXCC 1VFAA 1FGVH 1IAIL 3DLQR 1C5DB 3S4SB 1OCWL 1XGTB 4QHLB 5JOPE 2XKSA 3MLSL 1JHTA 2AKRB 3MRNB 4OZFH 3MYJB 3FOMB 1DANU 3INUH 1F8TH 3I6LE 3QT2A 2GITB 4EI5A 1B4JL 3OJ2C 1U93B 3QDMB 5LGHH 1P7QD 1KTKE 1DDHB 2Q86B 1HH9B 2QR0A 3UPRA 3AY4A 3TWCL 4ZOAA 4OZ4B 2I9TB 1EH9A 4G9FB 5IJKC 3MRRB 2F53A 3JXAA 2R1WB 3MBXH 4O9HH 5IHUH 1WQVT 5D7IA 2A38A 2ZPKH 5JUEH 1S7XB 5DEGA 3LQMA 2MHAA 1LMKA 2DIBA 5L2JA 2H32B 3LN5A 5C7XH 4XPGH 5CMAB 1WT5C 2PYEE 3QA3A 1TVHB 3AMLA 4PRDA 4Z8FL 4CN1A 1DLHA 2WP3O 2BCKA 4ZFGH 5IB1B 1RK1A 2MCPL 3U46A 1MJJA 4ZYKA 2BFVL 5HYJD 4HIIB 1GC1L 1A9EA 4Q6YA 5C0RL 5DUMH 4LMQI 3OKKB 1QHPA 4W4OA 5DHYA 2OXGA 2VXVH 4N0CD 4RAVB 5JHLL 2X09A 4IRJD 3TESA 4XBGA 3K3QA 3T65A 3AUVA 4XCEA 1ZLWK 3UJTL 3L5XH 1EJOL 1FPTL 4TUJB 5D7JC 4AM0B 1T5WA 1CTOA 4OD3H 1DLFL 3DVGB 3MV9D 5KVGH 3QDJD 1S7QA 3T0ED 1P5VA 2V2TB 3OR6B 1R5IB 3QFJA 1NFKA 3TBSA 4MXQC 4EI6B 5EULV 2PTVA 2OTUB 4JVPA 4WTWA 3WLWC 3UTTE 4HT1L 1ZHBA 1R5VA 5EOTB 4GW4A 2LU3A 2X4OA 2JIXD 3UC0H 1NLDL 5SV3A 4WVRA 1G7MB 4KQ3L 2DN7A 4KH2A 4EIGB 1IC5L 3HE7C 1MHPH 1AE6H 1JRHI 4XB7A 1LO2L 1S9XA 1BGXL 1D6EA 4NZTL 2HFFA 4FXGB 5FHBL 5KBNC 4Q74A 5K9QI 5LGJB 1YYML 2X70B 2BNQD 4FQXA 3PGDA 4MLSA 5GISL 4L8DB 1MEXL 5E8OA 4XNZC 4EUPB 4RRPA 1SJEB 4LKCA 4G8IB 1JNLL 1UM4H 5D1QA 1E6OL 4YDKH 3LKPB 2ATPA 2CLZB 5F72S 4MB5A 1DBBL 4YBLC 4L9LB 5E8EA 4GT7A 1HHJB 4XMKH 1QFWI 5D1XA 4WNQA 5A2IH 1WJ3A 2VYRE 3K46A 4MD5A 2DQDL 5DHVA 4HWBH 2MPAL 4DFHA 3H42L 1WZ1L 4PP2A 3UJIL 5DD5L 2AS5M 4CGTA 2A73A 1F4HA 3TPUB 5J13B 3LKRB 4LSVH 1J8HB 4FTVE 4QRRD 1DQMH 1X9QA 3P9MA 1CK0L 4NKIH 3DHJA 3WN5C 4JO1L 3CDCA 4N9GA 4TSCH 2ARJQ 3VRJB 4YUEH 3LV3A 2C3WA 4XC3H 4KK5C 2Y1VA 1A7QL 4WEBL 4XHQA 4CN4A 3U2SA 1GZPA 1DBML 4YEEA 1H3VA 5LBSL 1OL0A 1BF2A 3H7BB 1ZGLB 4HD9A 1RAMA 4NHUB 5J3HC 3F5WA 3Q1SH 1WGOA 3T04D 1ND0A 1T20A 1NGWB 2SEBA 2ZUYA 1CBVL 4MVBD 3MV7D 1WTGT 3OAYK 3HNTH 5HHOE 2EKJA 2DM7A 5F89A 3GMOB 2I07A 5BRZB 4TUOB 2W0FA 2AJ3B 1INQB 3OG4B 3T0BA 2FO1A 2ITCA 5D70L 4JQXC 1RJLA 5BV7C 3BDXA 5DD1H 1N5YL 1YEGL 1F42A 3MNVA 2AQ1A 3ZLQC 4KC3B 5I75C 1CFVL 3BWAB 5B3JE 4IOSD 3ELAT 5T3XH 3V52L 1RV6X 3G6JA 4NZJA 5DJCB 5DK0B 3PIQB 4OGXL 3I3DA 1KJ3L 1CDGA 1JL8A 5HGHA 1J1XL 4QLRA 3ARGD 4WUUD 1H3XA 4ZUWA 3RPIA 4LPTA 3FB7A 4MAYB 5T3ZD 2QEJA 1F58H 1PSKL 2EDKA 2DL2A 5FDYA 1XIWD 3DI2B 3KPNB 4JFXA 3QXVA 5BVPL 4GBXA 3BQUB 1TTFA 1G7JA 1U6AL 2AJYH 3JV6A 4BFEA 5B3NA 4NDMB 1H3GA 5K33A 3MJ9A 3BIKA 4XBPA 4YHIB 3LKOB 1FGNH 4POYA 1YUHA 3PWJB 5FKAA 5L88L 1PLGH 2EKSB 1F11A 5ACLA 5DUBA 1EHLL 1VFOA 3D9AH 1DUYA 4M1DL 1ZHNB 2W9EL 4A2LA 1JZ5A 4NFCA 4ODBD 4TNVK 3QAZC 4XZUA 2YKLH 3MBED 3QRFM 1CLYL 1P1ZA 3QCTL 2I27N 4Z78A 2EYSB 3CFJB 2AK4E 4PGCB 3BGAA 3O6ML 2ICWI 4WV1C 3VW3L 3OAZH 2QSQA 1HQRA 3GSRA 3HPLA 3PV6A 1T21B 4MJ5A 3MA9H 4DUWA 1MIEH 2R2HB 3RY5A 3VDCA 4J4PC 1P7HL 3CX5K 4BUGA 2DWDA 1Y18A 4D9QD 1RUQH 4XPBL 2ZUQB 1MCHA 3ZKND 4KKNA 4TTDD 4JFZH 5EFIA 2VABB 2BMKB 4QXGH 3QQ3B 2QQKL 4L1HA 5I1GH 4HUWA 4AENA 5IMLA 5JOEA 4MJIB 1K2DB 1G9MC 3DGCR 1AIFA 5I18L 1MCWW 2YN5A 1SBSL 4GLRH 2GJ6D 2YD8A 1GZQA 3RBSA 3ARZA 5L6YL 1R0AL 3OKDA 5HHPA 3HG1E 1BBDH 2VZSA 4M62H 4GRWB 2P5WD 4RGMB 4Z7OE 4H25B 4Y19B 2OJEA 2E3VA 5L2KD 1S9WB 5KSUB 5JORA 4HGWB 3VXNB 4R4BB 3MRFA 5IKCB 4OM0H 4JGJA 3QCUH 1ZLWH 3I6GA 5DJZA 3O8XA 1CFBA 5EU6A 1QSVA 4Y5XA 4OGAC 3CAFA 4KKCC 43CAA 4YGVA 3VJ6A 1KBGL 3VFGL 2YXFA 3CXHJ 5DMIL 4L8SC 5CJBA 4YXLL 3MCG1 3P73A 1HYRC 1GHFH 3NFNA 5FCUH 1JNHB 1UM5L 1QSFE 2BHYA 1XR8A 2F54E 4BJLA 3SDXB 1C5CL 2ZNWA 3O6FD 2P8PB 4IMKA 1CFQB 1NCCL 4ODXB 1FHGA 2L7JA 2CJUH 2KKQA 2AJXL 5DYOA 2KL6A 3O0RH 5D5ME 5D7JB 1ORSB 3ZHKA 4U1HB 4G8FB 5DC4B 1BAFH 3MXWH 2YHGA 3TYGL 4BZ2H 1A64A 5FYLD 2HT3D 5HGGS 4YHPB 1WBZA 1JZ2A 2VLRD 2BJML 4Q58C 5FO7B 1KLGA 4RNRA 4FXLA 3M45A 3EOYG 4DVBB 1WBXA 3GMNB 3VDAA 3ARDB 2W65B 2R0LL 5HYQA 4HS6A 4NQEE 3ZT5A 3M17B 6FABL 2J4WH 5AUMA 3F12B 5DS8A 5C6PB 3HNVL 2ZSWB 4PREB 1TZIB 2AXHA 2WBJC 1MRFL 1S3KH 4HUXB 3CFBB 5HPMB 1BREA 3Q6GH 3GUTA 3SHSA 1U8IA 3JWDC 4FQ1L 5IHLB 1F13A 3V5KB 2YD6A 4XNZB 3UTSE 4PG9B 4LHUA 4DOHB 5B3JF 1YECL 5GGSA 5C0IB 2ZUVA 3B5GA 3NA4A 2ZOKB 3P77A 2FBJL 2Z91B 4YBLB 2HTLD 1AC6A 3MFFB 1MCBA 3D3VE 1CICD 2EC9T 2AGJH 5DUPL 3GDBA 2IAMC 1P2CB 1TVBA 4UT9L 1LO5A 4JQVA 5F1KC 4IOFC 2JJTC 3HAEH 3QUYA 2HT2D 2DQEL 3SE3A 3VWJA 4WEUD 5C70A 3DSFL 2QKIB 2UWEF 5JIIA 3L3JB 5HI4C 3SBWC 3QNYA 4F15B 5MEPA 1G9NH 2BVEA 3OAYH 5BOPA 2B4CC 2NY6D 4RAUA 2UZXB 1KCUL 3CLFH 4JY5H 2EH7L 2IALB 1JHLL 1A2YA 3MRGB 4GXVH 3K8MA 5HVHC 3C6SA 1MF2H 4J3XA 4TVPL 3O3BA 1OW0A 1EUUA 1I9IH 5CILH 2H8PB 3U36A 1Z9MA 5C8JA 1G6RH 5JW3L 2D03L 3TNMB 2XPGA 2VZUA 3HC0B 1KXQE 4UINH 2H45A 4X6DB 3ARED 2HAZA 5HGBB 4M48L 4ZTOL 2HYMA 5BV7B 1IZJA 3IRPX 4G3YH 4OCWL 1MFDH 1MWAB 1ZANH 5HHXH 5I76B 5F70A 3L3HB 4E41D 1YPZE 1BFOA 1YMMD 3IDYC 2DYPD 4LAJH 4YDVA 5DMKB 1MHEB 1RMFH 5BQ7A 4N0UE 2N56A 5D2LF 5ACMA 5DFWH 3PWPE 3UDWA 4JRYB 1WZMA 4OQ1A 3V4VL 2IADB 5F7UA 4P5TC 1FZMB 4P23D 2IBZX 5IVXF 5KANI 4U6XB 3TCLB 4HIEB 2DS4A 1YPZB 3QHFH 1QYGL 5BV7L 4HH9B 3RWCB 1RUKL 2I5YH 3QUMB 5KW9L 1MWAL 3QFDA 1NEZG 2BNUB 4X7DC 4XCFL 5JTWA 4Q9BA 1E6JH 4DKAA 2BSSB 4HUMB 2X1OA 5FM5M 2ZZUT 3I3EA 3QAZB 2NX5D 2VN7A 2OQJB 3KYMB 5GPRA 3D85B 15C8L 4JRXD 3EHBC 2HVJB 3VD4A 3DWTA 4K8RD 4DZ8B 2DLGA 1AKJA 4PB0L 4WV1B 3V5HA 2JCCF 2OTPA 2NY5C 3PWNB 4PJHE 5BOZG 1AQKH 2H9GB 5KOVC 5AZEL 5DQJB 5KVDH 1CD9B 1HHHA 3EUUA 3RVVD 3QWOA 3DOSA 5D5MF 4LSSL 1Q9OB 3M1BA 3QUML 2XWBB 3NCBB 3H8NA 3WV0A 4JDTH 1I3UA 1QFUL 4PRIE 3BVNA 1ZWIB 4C83B 2RFXA 2FD6H 5KSAC 4HWUA 4RGOL 4PJIA 5TF1L 2OXHA 3RDTA 4LLWA 1WSST 4NOBA 2EDQA 4OZGB 5JA9A 1S7UA 1L9NA 2DTML 4XVTL 3REVA 5A16B 2X05A 1J1PL 4XGZB 3WJLA 2HMID 4DGIL 1G7HA 2V17H 4XP6L 4LGRB 4GXUM 2BVQB 4D9LL 5JPNB 2AEQL 2XWJA 2PXYC 2YOCA 1DVFA 2XWTB 4X9GA 1BJ1H 4ZUTA 4PRIB 3MLYH 3RVWC 3GGWB 5C0BA 1QRNA 3V6OE 4ZO9A 5AG9A 4LLAA 2PCPA 2R39A 3S9DB 4LCWE 5K9OB 2YPLE 4JPIA 2PW2A 4NQDB 1NGYA 4EEEA 3QHZH 2CUIA 4GKSB 1I8LC 1MJ7L 1RZ7H 4OQTL 4Z7WE 1KN4L 5ISZD 5ESAB 2PYFB 4NQCD 1CF8L 2Y23A 4P5KA 1YN7A 4R26H 1XMWA 3GSNA 3BJLA 3I85A 2FATL 2JELH 3JZ7A 5FKPB 3G9VA 4BFIA 4PBVC 1EHAA 5CGTA 2HLAA 4LFHG 1MQ8A 3TPKA 4OSUH 3SJVD 5EH1A 5KVFL 4RZCA 1QBML 4QXUH 3FAXA 2VDML 4XCCH 2OLDA 3ARBD 3AXLA 5DJ0B 4FMFA 1NCAH 3MRJB 4NHCH 3SDAD 1I1CA 2R2BB 2AXGB 4FABH 5EU4A 3GMMB 3NZHH 5EO0A 3IJHB 3ARRA 3MZGB 3V8OA 4OIAA 5D72H 1IFHH 4KVNH 4CU7A 1OP3K 1FN4A 2F58H 3NPSB 4X4XA 1OSPH 1JCKA 3NTCH 1U41A 4X7EC 4LLUA 5DHVH 1HZHH 2AI0L 4NWTH 3UTZA 2WBJB 5E6IB 1OTTC 4OZIE 3V79C 4JFED 5GRUH 3BE1H 3QO0A 1KIPA 3SGJA 1CGSH 1FRGH 2HFGL 4OCRH 3RL2A 1CFSB 4R96B 3HZYB 4P2QB 1D5ZB 1JN6B 4BSVA 4FQQB 5CJ8A 3HS0B 5CKGA 1RK0A 1KOAA 4FQIL 4ODSH 5KVEL 5CGYC 4UNVA 1QO3A 2IAMB 3P4OB 1MCNA 5FV2A 3C6LB 4JY6A 3BKML 3SO5A 4LLMB 4UQ2B 3MOBL 4OZIB 1FYTB 1CDBA 1MVFA 2B8OT 1LDPH 2B5IC 4N8CH 1U8QA 1WTLA 2GJJA 4BQ9A 1K5NA 4NO3B 4JO4L 1QKZL 3R4DA 1WAAE 3N50A 4OI7A 2C7UA 1XGYH 3W9EB 4OF0A 4W68A 3MRMA 1KCVL 2DM2A 1W2KT 4FG6C 1MLBA 4LHQB 1Q0XL 1UVQA 2H1PH 2YPKA 3HZKB 5HVHB 1J9CT 3FRPG 3CU7A 4G80A 1Y6NR 4H0GA 1ZA6A 5C07A 3GHEH 1DANT 4HLZG 2FEEL 3QXWA 4EDWL 4WWKC 4ZDHB 5MP6L 1S7TB 5J6GB 4XMLL 3ARSA 1MFBL 1FZOB 1TJIH 5E94A 1ZE3C 3D18B 2QTEA 2F8XC 1NGXA 4PJHF 1FAIL 4JFPB 2R2EA 3TIEB 1OF2A 4M5YL 5CGMA 1M7IB 3ARFD 1BECA 2EYTA 3UZQA 1YEEL 3ULUL 5HHQA 1DQTA 4L9DA 1WFOA 2CK2A 2VXTL 3MJ9H 3MC0A 1X6LA 1B88A 3IDYB 3HLAB 4LVEA 4HIJA 4S1SL 1G0XA 4M6OH 3FONB 1DQJB 3GFUA 3N1MC 1CD0A 3L1OH 3S36L 1EUTA 3FB5A 2BDNH 4JKMA 3V6ZA 5IFAH 4HUVB 1IGMH 1NJ9B 4JY4A 4XVJL 3VG0L 2Q7NA 2EE6A 1ZAGA 2HJKB 5CD5D 4K2UH 1I1AB 2IG2H 4G6JL 1DR9A 4P5TB 4KMQA 3TBYB 1EERB 4Q0XL 5KG9B 4MQ7B 5IBUB 1G6VK 4NCC2 3SDDC 4K71B 5E9DB 3GBNH 3S3JA 4ZAKC 1UXWA 3SPVA 3IDMB 2EE2A 1G84A 1UWGH 5EZIL 2ZUTA 4U6HB 1AR1D 2IPUK 2NY4D 1L7TH 5TDPB 1QBLL 5L8JB 3EZJB 4Z7WF 5BMFL 3RZCB 4Y5VA 3IAGC 3EOBB 3BEVA 3DMMB 1T1YB 5E5UB 5FYJE 4HX1B 3WFBH 4GG6F 1QNZH 3RPKA 4JFFE 3VXUB 1A3LL 1MAML 5EIQA 5C0JB 4X6CA 1GJIA 2EIDA 4MA7L 4CVXA 2HKFL 4ZPVA 3WEXB 3T0WA 3ULVE 2EYRA 1YEHH 5IB3B 5DMJB 1A7OH 3FCTB 2CIIB 3KAAA 2QHRH 2ADIA 2BK8A 1LO3H 4PJBB 2VLJD 5I1HH 3GBLA 2OSLA 5EG6C 4JPVL 3FRPA 3MV8A 3H6JA 4UT7H 3BKYL 1OLZA 4GUPB 4RFOL 5KSAB 3MCKA 4JFFB 3E6HA 4LU5H 2XRAH 1RZFL 1U8KB 1M7DB 1HCVA 3RX5A 1MIMH 1RHFA 5AZ2H 1H8OA 1IQDA 2VXSH 3WKNA 3VXSD 5IMMB 2WLYA 4KKAD 4KRLB 3CZFB 2PXYB 4DKFL 4D0DB 4JHWH 4R0LA 4KV5F 1QR1A 4ODUA 4OLWH 3BKJL 3TA3D 1BBJB 2H6PA 5CIPB 3WFEL 1OGTB 2QQLH 5GRJL 1UWXK 2A9ML 3RY4A 2Z92B 4U1SB 2OK0L 1PJ9A 1IE5A 1HHKB 3BZEB 2CDGA 4BK4A 4DTGL 1P7KB 4IS6A 32C2B 2XZQH 4JFYA 1F97A 1P4LB 3NZ8A 4R4FH 4LEXH 4KDWA 4WU5B 5F7NC 3QIBC 4S1RH 3QG6B 3H3PH 5JW5A 3B9KC 5FK9B 1CQKA 3Q5TA 4JCLA 5ITBL 4OF8A 5CHNB 2PR4L 3OJDB 4QOKB 4MCYB 1T83A 1U3HA 2UYLB 1EBPA 3GMPB 5EPMA 4ODHL 2IANE 1A6PA 3AAZA 1NUGA 1NFIA 3DV4B 3KPLB 4X99B 3MR9B 3PGCB 1NCBL 4P46C 3V5DA 5LWYL 4Y2DC 1A8JH 1KFAH 1V3JA 5A3IC 1NSNL 4Q9QH 3P4NB 4XPHL 1KPUA 2BC4A 2R4RL 2DQGH 3O11A 2VDRH 4PYHA 3OKEA 2CLRB 4G7YH 2NZIA 3CDFA 1N6QL 3QXTA 4PV9A 3ES6A 2CLVA 3IXAB 5DT1H 3ROLB 4GRMA 4L4VA 2UZYB 3BFOA 4JJ5B 3O6KH 1J05A 1KG0B 1VERA 2A9NH 4P5MB 1JZ6A 2XXMB 5JHDE 1QSED 2MFNA 3EGSA 2JB6B 3NAAH 3FOLB 2B5IB 2W07A 3W11D 3TO4C 3AU1A 4ZNEE 4LP4A 2C1OB 5CJQH 1UADC 3QWRD 5EOCL 1C5BL 1P9MA 3A67H 4H20L 2QJDA 1IEBA 1AGEB 1FL3B 5DQ9B 4WFHD 5EU7C 4WTXA 4P2RE 1FSKC 3P4MB 3P2TA 4M8QA 5IR1A 3CFKB 1SEQL 2A74B 4M1GH 4P4KD 3IDGA 3KPSA 4NO0A 4K7PL 12E8H 3LKSA 5F1OB 5DK2B 3NACH 4NWUH 4PJFB 2BXYA 4BELD 1KIUA 3QUKB 4XP4H 4X6BA 3RWFB 5ICZA 1C16A 1KNOA 4Z95L 1QD0A 1EX0A 3G5XB 3GIZL 4WWKB 2YK1H 2PTTB 2XTLA 3CXHK 3VGDA 5J6HA 1A6VH 2HWZH 1IEAA 5IBTH 1J88A 3U9UB 4TYUA 4H26B 2AJZB 5E8PB 3VD5A 4KZDL 5CD3B 4PTTA 5C0AB 5I1DB 2ARJA 1V7MH 2DQUH 1ORQA 4ODVL 1YNLH 3MLWL 5ALBL 4LGPB 4QTHB 3I02B 2X9XA 1I3RA 3ULVF 1EHXA 5ESQA 4LCIL 5F9OL 2YRPA 1N5AA 4NSKB 1BJMA 1E4XH 4E5XA 1CWVA 4ZFZA 3RIAF 3B3IB 5GZOD 5ESVB 4DQOL 5GS0C 4LSUL 3UAJD 4L3EE 4HFUH 5IROC 3F58H 3QUZD 4P9HC 1A7NH 3GJEB 3O4LA 1VEPA 1HEZB 3HE6D 3D0LB 4N1EA 1H0DB 1UCBH 4OD2B 2P24B 4U1IB 3G04A 1RZKH 1M6OB 4FFYL 3SDDB 4PS4H 4QYOB 4GMSH 4WI2A 1UJ3B 4IHOB 3VCLB 1GGCL 1T0NA 4APQD 5J12B 3QDGA 3LSOB 5CS7A 4HGKC 4MA8L 5B39B 3FO2A 1T22A 1JK8A 1D5XB 3RKDD 1CCZA 4XAWH 3L3IB 1L7IL 1UGNA 4X4ME 3UYRH 2R4SH 1RJYB 1X4ZA 2X9YA 3FJTA 4G6ML 5C09E 4ESKA 3AFLA 5IOPB 1IILE 2DKMA 4H1LB 3EOTL 4L4TA 3MLUL 3DUSB 2E9WA 5H94A 4YFDB 1FNGB 1VADB 1EFQA 2DQHH 5F7DB 5F7YC 2OP4H 4NQVB 4EUPG 2ICWA 1XGUA 3EO9L 2FJFB 1UYWH 1FAKT 2O5XH 1FNHA 4Q9RL 4PYGA 3TBWA 3T08A 1XEDA 1PY9A 5EZLB 3S4SA 4CMHC 1C5DA 2R29H 1XGTA 3E1F1 3WD5L 1TQCC 5A2LH 3T09A 4ISVA 3MRNA 4J23A 5H8DA 1UWXH 4FMKA 4PJAB 5TE4H 4BZYA 3FOMA 3VGGA 1UENA 4C4KO 3KPTA 2GITA 4I9WD 2FL5B 1HCFX 2GAZA 3NFSH 1U93A 1HK6A 5SWSB 2EEBA 1DDHA 1FGVL 1BZ9B 2Q86A 1HH9A 2YZ8A 1U58B 2VR5A 4QNPE 4OZ4A 3INUL 4KJQD 1F8TL 4W4NA 8CGTA 2I9TA 3MRRA 4XNMB 4Z18A 5LGHL 2R1WA 5C0ND 3DRTB 3HZMB 1S7XA 3FB6B 3N1FC 5C08D 5C1MB 4MZ2A 4AEFA 2H32A 3BAEH 3T3PE 5F7HA 5CMAA 2QHLA 2AQ2A 1AP2A 1JPSH 3MBXL 4O9HL 5IHUL 2Q3AA 3Q48A 2VLKE 4RX4D 5IB1A 5JUEL 3OKMB 2BRQA 4ELME 4HIIA 4Q2ZB 2V5YA 1NFDB 1YQVH 3WS6C 5E1AB 3OKKA 1IAOB 3QIBB 4RAVA 1H5BB 4B7LA 3B9KB 3D39E 4KAQH 5E8DL 1CDUA 1YZZA 3PWLB 1JNJA 4UTAL 5DUML 1EFXD 3K80A 3PE9A 4TUJA 5GS1A 4AM0A 2MNUA