4QHMA

I3.1 (unbound) from ch103 lineage
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
QVQLQESGPGLVKSSETLSLTCTVSGGSMGGYYWSWLRQSPVKGLEWIGYIFHTGHTNYNPSLESRVTVSVDTSENQFSLRLRSVTAADTAVYYCASLPRGQLVNAFFDNWGQGTLVTVASASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords I3 heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 217
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhmA01
4R96B 2OR9H 1YN7B 2EDQA 15C8H 3GMQA 5DVNA 5MEPB 5EIIA 5C0BA 4S0TD 4WY7L 1QFUL 4HF5H 4HBCL 3WKNA 1GGTA 4KKLD 1UB6A 2VISA 1K6QH 3IJYB 2ENSA 1IGCH 1J8HA 5DRXB 1BBJB 5I1LA 4LHQB 4DCQA 5FA3A 3WL9A 1A7PH 5BZDA 1T1ZA 3MFFB 4PJBA 5AWNH 3LRHA 5HY9B 1CU4H 4G9FE 5A2LH 3W0WE 3EGSA 1AD9B 5CFHA 2ATKA 3HE7C 5SWSD 4KI5E 1U8JA 2MCPL 5EU4B 1TTUA 3QFDA 4KJPC 4OKVA 4RIRB 4YLQT 1JYWA 5DS8B 1RZJC 1DBBH 4MD0B 2R1WA 5HHME 3DVNA 2YMXH 1TJGL 3L3IA 1WIOA 4TTDC 1L6ZA 3SCMB 2AQ1A 1GZPA 5D1QB 3MRIA 3A6BH 3MREA 5DJYA 3HI5L 3AS0A 4UU9A 5BRZD 1S3KH 4AEEA 3KYKL 4WUKH 2EDKA 3ULSA 1KEML 2ZCKH 1XGRA 5EO0B 1MCFA 5L9DL 1YPZE 4TNVF 4PJBF 3S4SG 4HS3A 4KI1A 3TIDB 2NXYD 4PJ8A 3H2WA 4WO4C 5L2JB 3MNZB 1LO5B 1JGUH 1MUJA 3VXRD 1N6QL 4M00A 3ARTA 4B5EA 3KPRE 3BP4B 3TO2B 3C5ZD 4L29A 3GEWB 1RZ8A 1DQQA 1ZT1A 5T1MA 1D5BA 1ZVSB 1VGKB 3D39A 5CP7A 3ZYZA 5IB3A 4OTXH 1Y6KR 4S1RL 3SKOB 3I6GA 5BV7B 5KSAB 1S7TB 2GT9B 5DHVA 4P3CH 3FO2B 3DYMA 3VWJC 5T5FL 1JL8A 2HWZL 1L0QA 4NRZA 5CJXC 4YXHL 4PG2A 4CVZB 3ARRA 4JM4H 4UBDC 4F7EB 4L5FH 2KKQA 2EDBA 4KMQA 4PRPA 1BD2A 5T1KB 4NYLB 1N4XH 2FRGP 5GRVL 1F6LL 3TV3H 4HXAH 3TNMB 4GQ9H 5JQHC 4HGWB 4FQ1H 2P42B 4WV1C 4CN6A 4JRXB 1JZ5A 3X13B 5KVFH 5FIEA 1NBQA 3PV6B 1TZGH 1FNSL 3MOBL 1AD0B 4HWZB 1N64L 3JUYA 4Z8FL 3IJHB 5C0FA 2CDEB 5ACMA 3SKMB 1QLFA 2Y1VA 4HUMB 4LSPL 3K8LA 3EJYD 3IU3A 3TT1H 3RVTD 3S3PA 5IW1A 4LEOB 5J06A 1NKOA 1MRDH 1DE4B 1GL4B 4JO2L 4KZEH 4TQEL 2XTJC 2BNQB 5KANI 4Q6YA 1ETZA 4HG4J 3E3QE 2A1WL 1Z9SA 3DETD 1TVHB 1RUKL 2X4QA 3OJMB 1XGTB 4CDHA 3BKJL 4Q58C 3X12A 4CADB 4LHUG 2CLZB 5D7LB 3IGAB 3L7FA 4PJDA 1F13A 1NUGA 3VU2A 4QWWD 2ICWI 4BYHA 5C0AA 4I0PB 3V52L 3PHOA 5C0CD 3VXMB 3CFCH 4OQ1A 3ARBB 5F88B 3JWOL 3HG1E 3Q1SL 1HWGB 1S7QB 3T4YA 5C6PB 5KG9B 3H42H 5J1AB 1B3JA 4PS4L 3SEPA 3NTCH 4RAUA 1QFPA 1RJLA 5C08A 1O7VA 5JHLH 4YPGB 2JJVA 3HCVA 1NBYA 1CF8H 6FABH 3BN9D 3LS4H 2A6JB 1GGBL 2DBLL 2CXGA 3FB5B 3GMPA 1C5CL 4JZNB 4H5SB 1TVBA 4EVNA 5EH1A 3MRJB 2X1WL 2QSVA 4AM0B 5HYSB 3V6OC 3JZ7A 5F1KC 1G9ML 2MQ0A 3GSOA 3UAJD 1AQKH 4M8QA 4IRJB 1LEGB 1W0YT 1MCEA 5IWLA 1XCTA 4RFNC 4DKDC 3ME0A 4PV8A 5I15L 1GGYA 1KTDB 4JG1H 5IV2B 1A6TB 2KH2B 4LNRB 2XKUA 1YMHB 3B4NA 1A1MA 1NFDB 1BVKB 3DI2B 4XVUC 1I4FA 3NPZB 3JWNC 4O02H 4UTAH 1RD6A 5H35A 1Z5LA 3NFPB 5ESQA 3UTSD 3U4BL 4EN3C 4UOW1 2ATPB 2GSGA 5ALCH 5CIPB 4P5MA 3REVB 4W70A 4NZUH 1XFPA 4K3DL 4PJ7A 2DTSA 2BNUA 4QHNB 4U1KA 2VXUL 3C2SA 1NCWH 5A16B 4Y4FB 2P44B 4J8RA 4FTVB 4MA8H 3KGRA 4RMQA 3QI9C 2R69L 3QG6A 5FOJA 3QPXL 3QJHB 3DXAD 1T2XA 1NH6A 1BQLL 2ZUTA 2QQNH 3F12B 4YO0B 5ENWA 4QRPA 4XTRC 3BO8B 2DQFB 1JE6A 1ZLUH 1CFNB 4PR5B 2YPLD 4LLDB 5IGXH 2H2SC 5I8CB 1F58L 1SYSB 3AS2A 3RDTA 4PJ7F 5J9PB 1HEZA 2R39A 1NDMB 2OR8A 2EEAA 1RK1A 3CFEB 5F7KC 3E8UH 4Q2ZB 1IEBA 3PE9A 4YHMH 1DSFL 4GXUN 2WBWB 1NBVL 1MPAL 1LO3H 2VLJB 4LF3A 4LLWB 4G6FD 1TJIL 2EIBA 1AGFA 2NR6D 3QQNA 3AREA 1F4WH 3MJ8A 4KPHL 1NGWB 3KXFD 3OKNB 4PJ5E 2PYEB 5IVZB 1XF3B 1RZ7H 4HGMA 3WXWL 1ADQA 1YEHH 4QTIH 4OGZA 1FYTA 3LN5A 4F33B 2D31A 3MA9L 2B20A 4G9DA 3F65A 4ZTOH 1GGCH 4G3YH 2BNRB 4NKIL 5FO8B 1JYVA 4Y16A 2NYYD 4WGWB 2D7TL 3A6CH 1HILA 3FOMA 1G6RA 2Z35A 2V5YA 4I5BB 1KB5B 4JFXB 4QHUB 4ZUVB 1FH5L 4X9FA 4X6CE 3ZDXE 5IESL 2EDEA 3QFJB 2I27N 3VH8G 4XNXL 3S6CA 4G6KH 3KPTA 2Q20A 1BVLA 3QUXB 1PW3A 1NJ9B 4GS7C 4N9OB 4X0KB 2ZZUT 5GGRY 3GSNB 1OGAB 1CDGA 2HJKB 3UZQA 1UC6A 3O6FA 2NW2A 3EO1A 4K55A 3JVGA 4O9HL 4OZFH 5FDWA 2NY1D 3ZKMD 2BY1A 2YXFA 5IR1B 4WHYG 4R9HA 5JOFA 1MCIA 2VITB 2NY3C 2AJYH 4JGUA 4G8GE 1DEDA 1MFAL 2HJLB 3NVQA 5FM8A 3UROR 1WCQA 2VO5A 3V4PH 1YY8A 4NN6B 1ZGLM 5DGQA 5EB9A 4G8FB 4ODTH 4BQCA 3KS0H 4QNPE 1FVCA 4LLYA 2F74B 4KK5D 4PJCB 1CGTA 3QDJA 1IQWL 5FO7A 1RMFL 3BPNC 4JPKL 4L3CA 5IQ9A 4I18B 1CD9B 3QCUL 3U9PH 4ZQKB 4XP6L 3QA3A 3FFCD 1E28A 5HHOB 5D8JH 2NTSP 3JXAA 4YXLL 4NCDA 3HRPA 1OAUL 3WIHL 2WWMD 2D7QA 3O8XC 4HJJL 4XC1L 5DRNB 4WNQB 5L2KA 1DN0B 1XT5A 2WANA 4JE4B 3U1SH 2ICWJ 5IVXA 4JPIB 2YS4A 3G6JA 3ILQD 2YZ1A 3QUML 5FYJL 4X4ME 4KXZI 5DJ2A 1A1OB 4N0UB 3LEYH 4HKXB 1A14H 5D7JC 1WBZA 2EIDA 1JHKL 1QBML 2EDJA 3FO0H 3KYNA 4LVEA 4NN5C 4OF8A 2AXFB 4LLMB 4HS8H 1IGIH 2FO1A 4TUJB 3BIKA 4LSQH 4ZAKB 4IOSD 5GGVL 1BAFL 3SE9H 4FFYH 1EEYB 4LLQB 4PTUB 1FZJB 3U0PA 2X9XA 4ZXBA 1U8NA 3P3YA 2VABB 3BT2H 1FQ9C 1V7MH 3PHQA 4OJFL 4JJHA 3R0MA 3U82B 3QUYA 5ITFA 4ONFH 2VE6B 3IVKB 1KFAL 3FOLB 3G6JF 5DUBA 1ACZA 2G5BB 3UJJH 5KAQG 4C57C 2Y7QB 2H32B 3V6OE 3RDTC 2OI9B 1ZHKB 3SOBL 3V4UL 4A6YB 1SJEA 4I4WA 2QADD 1YQVH 3QAZB 2DD8L 3I6LE 5F44A 4BFEA 3HZVB 3L5HA 2DQJH 3S34H 4HIJB 5E4IA 1RUPL 3N85H 3O3UN 1WT5A 4XMLH 4JRYD 3JBG7 3MCLH 5EUKB 4ZO9A 3BDYL 4Y1AD 4RGNE 4PG9A 5C2BL 4FQIH 43CAB 4IRZH 2Y6SC 4S1SL 3OJ2C 3CLEL 2A6KA 3B43A 3BJLA 3T77B 2ESVD 2G5RA 3RX7A 1AGCB 1F4YH 3QPQD 1G7PB 2B1AH 4XAKE 3QH3A 2LABA 4UAOC 1M05B 1TVDA 4OZHE 4GRWH 2WAHA 4UUJA 3BPCA 2WBJD 2Q8BL 3V0VA 3CDCA 2J8UA 5DLML 1QBLL 1T2JA 1ZANL 4JO1H 2Z93B 2OR9L 4WEBH 4PRDB 3MFGB 15C8L 4TRPH 1X9QA 5FB8B 5L7XH 4HF5L 1I1FA 2FECI 4WJ5B 5A2IH 2AV1A 4LSRH 5MENB 3L6FA 1IGCL 4PP2B 2CGRH 4MSWA 1JNHA 4R0LB 1E4KA 1UH4A 1A7PL 4C56D 3DX6A 2D3VA 2VDKL 5ACZA 1CU4L 4KMLB 1IFHH 5D7IE 4HH9B 3LPWA 2SEBA 3VXNA 2J2ZA 1JCKA 3SJVA 1HOCB 2EDXA 5ID0A 4BFGA 3HAEH 3NCMA 1XH3B 4AK1A 3BI9X 1G7MB 1CR9H 1NC2D 1T20B 1WVZA 3TA3C 1N5AA 4PB9H 4Q0XL 5J3HC 3VG0L 4GJTB 3VD3A 1JYNA 3BKYL 5FM4A 2NXZC 3I6KA 3VGDA 1NFKA 5EIIB 5C0BB 5T3ZL 5D2NA 4JFFA 1F4HA 1UB6B 2VISB 3MUY1 1IAIM 3W11D 1J8HB 1QR1A 1TTFA 2D0HA 5I1LB 3ESUF 5T1LD 4DCQB 1IGFL 1S3KL 5BQ7A 3GJFA 5IB1A 5FA3B 3WL9B 4WUKL 4EXPX 5BZDB 1T1ZB 4NQEA 2AQ2A 3NCCB 5HD8C 4OAWA 4YDVA 3EGSB 2ATKB 3RZWA 1U8JB 1YYMH 3QFDB 4OKVB 2R1WB 4PBWD 4NRYA 3DVNB 1TPXB 4V1DD 3L3IB 1QA9A 4YFLI 1GZPB 2L4OA 3MRIB 5ALBL 4L4TE 3MREB 5DJYB 1JN6B 2JJWA 3RUGF 1RZKC 2YUVA 1WC7A 4NNXA 4OTXL 3NA9L 3ULSB 4NUJA 2OMNA 3ISWA 7FABL 1XGRB 1NCAL 1INEH 1G7JA 4NO3A 3PDDA 2XNAA 5I1HH 4K94H 4HS3B 4GKOA 2HAZA 4HWEL 4OLWL 3PIQA 4PJ8B 4IOIA 2Z31C 4HT1L 4ZUSA 1RIUH 5BW7C 4JM4L 3ARDA 4CNIA 4L5FL 3QSKB 4L29B 5ITBL 1RZ8B 1DQQB 1N4XL 1G7LA 1ZT1B 3TT3L 5T1MB 1D5BB 3TV3L 4HXAL 1FJ1A 3D39B 4GQ9L 5CP7B 5IB3B 1BM3H 4ODHL 4FQ1L 4YNYB 1F90L 3I6GB 4PGCB 2NPLX 5KVFL 5I17A 4RGMB 5DHVB 1K5NA 2V5TA 4LRNH 1U3ZA 5TJWK 4GO6B 3C8DA 1RIHH 3L5WA 4NRZB 5IFAL 4O2CA 2CIIA 1KCSH 3FO9A 3QXDA 5E6ZA 4PRPB 1BD2B 3WLWC 5BVPH 5CJBA 5K59F 3RIFK 1MRDL 4OQTH 4KZEL 2Q86A 1II4E 5BJTA 1NL0H 3R8BB 1MJ7H 1L0YA 4RMTA 3MV7B 3EHBC 1N2RA 5HHXH 1SMAA 4TNWF 1NMAL 1DBKL 2JIXD 4OV6F 2C1OA 4UNVA 1S9XA 3BDXA 5C0FB 4XCEA 1EUTA 5SWZA 1QLFB 3CFCL 1ZTXH 2FGZA 1GOFA 4L3EA 3IU3B 2JELH 5IW1B 5ABDE 3NTCL 2YUWA 1PG7L 3RVUD 4C54A 5HDLA 1J0IA 4HJ0D 4UDUA 1R5VA 1I9JH 4YK4B 1QVOA 1ETZB 6FABL 2VSDA 5KVMC 1CE6B 3F8UB 2P46B 3S8WA 1XR9B 2X4QB 2PO6C 4U1MA 2W38A 3X12B 2NY4C 1M7DA 5IMLA 3C6LD 3UTTD 3L7FB 1Q9KA 1E4KC 2VOTA 4PJDB 4J6RH 4OZFG 4Z76A 5C0AB 2YD4A 1KLUA 3PHOB 4KVNH 1LP9A 5E1HB 2NTFA 3THMH 2ENYA 1N59A 2XOTA 3T4YB 5C0JA 3H6JA 4I3RH 4EBQL 4JG1L 3MRBA 4RAUB 4BM7A 4DOHB 1RJLB 5C08B 4DK3A 2DYPD 5T3XD 3HCVB 4X9GA 1I8LA 3FONA 2EH7L 4LHUA 5D2NC 3TN0A 3GMPB 2C3GA 4O02L 1QRND 4M5YH 1TVBB 4EVNB 2AI0H 3MR9A 1U36A 2MKWA 5B38G 2DJ4A 3P0GB 1ULVA 5ALCL 2B5IC 3DHJA 3GSOB 2K3TA 3VGBA 1XCQB 3DSFH 4P2RA 4RSVA 5B39A 1XCTB 2E8ZA 4XP5H 1KPUA 1CXKA 1UZ6E 4PV8B 1LP9F 2LU4A 3VXSA 2XPGA 2OXHA 1HYSD 3BPOB 4O51B 2ARJA 4RRPA 3U2SA 3U4AA 2CUMA 1MAKA 1A1MB 4XBPA 3ZT6A 1PQZB 3DVIA 1X5XA 1I4FB 4YHOH 4UILL 1B2WH 3DX8B 3VGHA 5H35B 2QQNL 1Z5LB 3QQ4B 3HMWH 5ESQB 3SE4A 4ODBD 3JWOC 4LBEA 4CU6A 3WNKA 2GSGB 1G6VK 4P5MB 3RQ3A 2Z8SA 4HIIB 4PJ7B 5HI4D 5C71A 3B9AA 5IGXL 2BNUB 2C3HA 4BKLA 4QGTA 4U1KB 4G42A 1E0OB 2OZ4L 4Z7NF 3ZT7A 4J8RB 3AFLA 4H8WC 2WQRA 3RX8A 1MOEA 4H1LH 3QG6B 5F7FA 3CGTA 4X4ZA 5A43C 4ZYKA 3A67L 1G9MC 5ENWB 4NQUA 3ZKNC 2Q3ZA 4QRPB 1J5OL 5JOPE 1RZ7L 1EJOL 4KHTH 4GKZA 5BS0E 1HI6A 5B3JE 2DDQH 2YN3A 1XIWD 1J0ZA 2VQ1A 5FHAH 2PUQT 2NX5D 5F96L 1GPOL 1UA6H 1IAOA 3RDTB 3WIHA 4ZTOL 1HEZB 1GGCL 5DJAA 5DHYA 1YEEH 2NZ9D 4G3YL 3U83A 3MBXH 1D5MA 5DT1H 1J1PL 1IM3A 4P23D 2KQNA 1IEBB 3A6CL 4QXTB 2VH5H 3UEZA 3QUMA 3MO1A 4LF3B 2UZXB 4MNQD 4GW1A 1JZ6A 5JPMA 1AGFB 5DF0A 2JB5L 3AREB 1D5IH 1IARB 3H3PH 4K8RD 3FT4A 3MJ8B 4G6KL 4UQ3B 5L8JB 2APWA 2R29L 4NP4H 1ZT7A 4GOSA 3NCYS 3BIAX 1FYTB 3LN5B 4YX2H 4JFED 2D31B 4XXDA 1UM6H 3RZCD 1CDCA 4G9DB 1UYWH 4FFVD 2UVFA 5EZOH 3CMOH 4Y16B 2X4RA 4M7ZC 3FOMB 1HILB 1WGOA 2Z35B 3MLUL 4EI5D 3PWNA 4U6VH 2R8SH 3ES6A 4BK4A 1J9CT 3WEXA 3BP6A 4KRPD 4LCWE 1KENH 5HXMA 1CXIA 3BESR 1OM3H 1ZLWH 2AABL 1IEHA 1BVLB 2DKUA 2ILLA 3KPLA 4ODTL 3H9SE 2KBGA 4PJHF 1RZFH 1JWSA 3TVMB 3QXUA 1QRKA 3O6FB 2IF7A 3QQ9C 2NW2B 3U9UA 3EO1B 3LQAC 5FDWB 2PXYA 3HAEG 3KYOA 2MHAA 4P46D 1LO4L 2V7NA 3SKNA 3D2UD 4OM0H 3VH8A 4JJ5A 2DQCH 5D8JL 5HVHC 4LAQH 3AMLA 1H8NA 4MB3A 4AIZA 1YY8B 4P4KD 5B4MD 4CU8A 4YEFA 1YNTA 3KG5A 4KK8D 5E6YA 3UYPA 1K8IA 2OBGA 1RURH 3NOIA 5C9KA 4AEHH 1FVCB 4LLYB 3MXWH 3U1SL 3CIQA 2A9MH 3ZHLA 1PX4A 3QDJB 2BVQA 4ETYA 5FO7B 3VXUA 1S7SA 3ARZA 4OCXH 5IQ9B 4L3CB 1CD0A 5E08H 4TVPD 3LEYL 1A14L 5KVEL 1E4XI 2ZUUA 3QA3B 1E28B 4PJIA 3M17A 4R90L 2P5WE 4HS8L 2H2PD 4NHUA 1IGIL 1BOGA 1H3PH 4P9MH 3HFMH 4S1QH 4FFYL 5EG6C 4WW1B 3QNYA 5D6DA 3SE9L 1JZ2A 2BOCA 5AYQA 5L2KB 2Q76A 1SVZA 5IVXB 1BLNA 1V7ML 1SBSL 4HLZH 2F5BH 3G6JB 4Y88A 4G8GD 4ONFL 3BOVA 5IBUB 1YNLH 5DJ2B 1T04A 1A1NA 2CR3A 4YIQA 3LRSA 3LEXA 3I3EA 1WBZB 4U6HA 5HDBF 3KYNB 2JCCB 3BIBX 1NKRA 3ZSSA 4P2OC 4YBLC 3AGVA 4PLKD 3RU8H 1YQVL 3BIKB 1O0VA 3HRZB 2I60L 3TFKC 1MLBA 3V6BR 2PCPA 3N85L 3U0PB 4ZXBB 1U8NB 4XMLL 2HKHH 5GGUA 5HYQA 5GS1C 3O9WA 2PR4H 1ZLWK 3PHQB 4NQXA 2J1KA 2QHRH 4XCCH 3RUGE 3QUYB 5EUOA 3K74B 1KJVA 2FJGA 2DM3A 1LWRA 5DUBB 1K4DA 2VAAA 3KR3H 1F4YL 1OW0A 3U7AA 4QRRA 3CFBA 4UT9H 3LVEA 1SJEB 4I4WB 3UC0L 3SO5A 1S7WA 5JDSB 4AT6A 3STZA 3P2TA 5IMMA 1LO0H 2F9BT 4WFFE 4JO1L 4GRLD 4QLRA 4HS6A 3TBYA 1QSEA 2I26N 5EOQL 4PRHD 4WEBL 5FYKD 4IMKC 4TRPL 3KPSE 3MV8E 4WUUA 5HSFA 3QO0A 1G9NC 4PG9B 2KPNA 2VR9A 3STBA 5KBNC 1T6WA 4XRCA 2CGRL 2KL6A 3KWWA 3KYAA 3PDGA 5E70A 1HSAA 3VD7A 2A6KB 4NBZB 5EUOF 3EYUL 3GHEH 3PNWB 5JDJA 1KB9K 1YJDC 3K80A 3UPRA 3G5YA 1KYOK 2AJUH 4U1GC 1IFHL 3QH3B 4NNYA 4EXKA 5I1GL 4MJIA 5I1EH 3RGVD 4UUJB 3BPCB 1OARL 4GAYA 1A6AA 2J8UB 1CR9L 2GW5A 3MLTA 2DRUA 2PETA 3WJLA 3OSKA 1DUYB 5K59E 4MB5A 1I1FB 5ELIA 4YDIL 2AV1B 5MHSD 3L6FB 4BSVA 4MSWB 3UJIH 1JNHB 3G6DL 4YBQD 4Y4KD 3DMMD 5AAMA 5J12B 4MDIA 1LILA 2XQYK 3WUWG 1G0XA 1MI5A 4LK4A 4Y4HC 5JMRA 1EZVY 4JEGB 2HT4D 2SEBB 2VLMD 3VXNB 3SJVB 1YYML 4ODXA 1WK0A 5ID0B 1F2QA 5HVWA 1QKZH 5HYEA 1JP5A 1T0PB 1N5AB 3TCLA 3RBSA 1WWBX 3I6KB 1J1XL 1IAIH 1CE1H 5D2NB 4F7MA 5JMOC 1MFBH 2YA0A 4JFFB 1K9TA 5EOCH 1MCCA 3PDOA 1QR1B 2O5XH 1QEWA 4U2YA 1W8NA 1JHLH 5BQ7B 3GJFB 4OF0A 3RVVD 5IB1B 3C8HA 4MLSA 4NQEB 1N0XH 3Q5YA 1FYHB 2ZCLH 1X5FA 4OAWB 5IQ7L 1INEL 2ED9A 4H88H 4YDVB 3Q6FA 3S36X 3T0EC 3PL6A 5I1HL 4K94L 3T08A 4V2CB 1PVHA 4R8WH 3EJZC 4NRYB 1VFUA 1AHWA 3SPVA 3Q48A 4M1CC 4QHMA 4U7SA 1XF4A 1QA9B 4MX7A 4NKDA 4KV5F 5HYJE 3CFIC 4JKMA 3STLA 3V5KA 3WIFA 4MXQD 1I8MA 3OWEA 1AIFA 5HVGB 3NFSH 1WC7B 4NNXB 1F3DH 3KLSA 4UNTA 1BM3L 1M6OA 4NUJB 2EDRA 3ULVH 4U7MA 3RTQC 3DPBA 3WXVH 3O3EA 3WHE1 4NO3B 2XNAB 3HR5A 2VERN 4LRNL 4G8EA 1MCJA 3PIQB 5GGSA 4IOIB 3P9MA 4ZUSB 5E8DH 3GSUA 4LQ1A 3ARDB 3ZTJH 4CNIB 4MYWB 4PJXA 4H1LG 5IJKC 2WW8A 1KCSL 3D85A 1G7LB 5J1SC 2ERJC 5DEFA 4OQTL 1FJ1B 1ZT4A 1RV6X 4JN2A 2EICA 4B7LA 4NDMA 2PYFA 1WJ3A 2MFNA 5HHXL 5IFHH 5I17B 2X5PA 3MRHA 2V2TA 1K5NB 3CX5K 2OXGA 3BKMH 3BEWA 3P0YH 5CUSL 3L5WB 4P59H 1OAZH 3VGGA 5IBTL 3IAQA 2EXYD 4WDIA 3DSNA 3IKKA 4O2CB 2CIIB 3FO9B 1JBJA 2JELL 4GAFB 1D6VH 2WQ8A 1MHPH 4PJXF 1Z9LA 1PJ9A 2FDBP 2Q86B 5BJTB 4JG0L 4R26L 3WLBA 2IALA 5INDB 1I8KA 1YMMA 3CPLA 4WHTA 5DMYA 4JKPH 2X7LA 3L7EA 2OZ4A 3LPFA 3QXVA 1FAIH 5JXAL 2AK4E 2C1OB 2BSSA 1S9XB 4OLVH 4XCEB 1V05A 3GSXA 4CJ1A 4DQOH 3IDXH 1T5XA 3LDBC 1T1XA 3V5DA 3FT2A 4XX1G 1MRCL 3G5VA 3SDCA 1MWAH 4L3EB 2DTMH 1H3WM 4IOFC 3WJLC 1A6VL 1A7QH 4UDUB 1R5VB 4F37K 1QVOB 4KROB 5JW5A 1JNJA 4FTVE 2EE2A 1LEKA 4N8VG 1MIMH 4M5YL 1A5FL 4U1MB 2AI0L 5IMLB 1M7DB 1Q9KB 2NY2B 4WENB 3ABZA 5CBEA 2ZUQB 5JUEH 4Z76B 2ORBH 1KLUB 1DN2A 4ETQA 1LP9B 2NTFB 1FO0L 1N59B 4D9LL 3TC9A 2Y9RT 4YGAB 5C0JB 2J5LC 4O5LL 4L9DA 4GW5A 3MRBB 2XQBH 4NHCH 3W9DA 1A6UH 5EU6D 4M6OH 4OUUA 1MHCA 4PJ9D 3FONB 1ACYH 3O3BA 3SDAA 1CXFA 1YEFH 3LS5H 4LHUB 4RMWA 3V6FA 5KTEH 3TN0B 1W0VA 1KNOA 2JB6A 3MV9A 1KJMA 3V0AC 4OZFA 2R2EA 3V0WH 3MR9B 3QXAA 4IHOA 3HMWL 4KUZH 3VDBA 2GJ6E 2AJXH 3JWDH 4PJHE 4IRSD 1FFOA 4YZFF 25C8H 4WI8A 1NCDH 3MRQB 4LCCA 3M1BA 5LQBH 3BEVA 1Z2KA 4N5EC 4P2RB 5B39B 3PGFH 1KPUB 2IPTH 4GBXB 3VXSB 2XPGB 2ARJB 2MQ3A 3VRIA 1DBAH 3U2SB 1AHWC 5CINH 4XBPB 4ZS6C 3VGAB 5B38A 1JZ8A 4WCYH 4HLZG 2R4SL 4LQFH 4ZG1A 1A9EA 1I3GL 5K9KA 3OGCA 4LBEB 3OAYH 4KHTL 2XT1B 4UB0H 5E95B 5FHAL 4BKLB 3RVXD 1IGJA 3WFZA 1UA6L 2IBBA 2R9HD 4G42B 4E0RA 5IHUH 4MQSB 3H3BC 3MBXL 4NKOA 4R7NA 4PGZA 5DT1L 2YRLA 4WFED 1VFBA 1LE9A 4K3EL 1FRGH 5M7QA 1EFXA 2VLLA 2VH5L 3T0VA 2MKLC 4ZYKB 2HLFC 4R4ND 1RU9H 4X9IA 4MGXA 1OT1A 3H3PL 3KHQA 4JZOA 1X44A 2FJFA 4KTYA 3G5XA 2AXJA 4OLUL 1JFQH 3BH8A 4X8XA 4GKZB 1HI6B 1BHGA 4C83A 4UTBH 1UM6L 3T0BA 2VQ1B 1EVUA 4IEFB 1IAOB 3BPLC 3O4LD 5DJAB 4K7PH 4YHIA 4ISVA 5DHYB 3T0EE 4D0BA 5LGHH 3QDME 5JXEA 3MA7A 5EZOL 1D5MB 3CMOL 5E6ID 5HDBE 1IM3B 1TCRA 2NY5H 2OCFD 2ICEB 1IAKA 4QKXB 2R8SL 3QUMB 4OM1H 1FFQA 3ZL4L 3C6SA 4GW1B 3ZKSD 3C5JA 5JPMB 4U05A 1J8KA 4P2QE 3FT4B 4ENEC 5D2LA 1ZT7B 4NC0B 4XPGH 1W72L 5F9OH 1IM9D 3QWQB 1GYAA 4TYUA 3LKNA 4XXDB 1RZFL 3EYVA 4M43H 4XPAH 4ODWA 3N1GC 4XH2A 1RJCA 4OKDA 3PG2A 5IM7A 2X4RB 4IMLA 3SDCC 5T3ZE 3O2DL 4OM0L 3ES6B 5C07E 5J57B 3WEXB 2YPVL 5HDOA 3QIWD 1HXYA 1CTNA 4I3GA 1A0QH 3MSPA 3UPAA 4PPTA 3AB0C 4PB0L 4NQDD 3CCHA 1XGQA 2FSEA 4S1DC 3KPLB 4KKCC 4AEHL 1FVEA 4AEIH 2A9ML 1JGLH 1JWSB 1YY9C 3OAYK 3U9UB 2M1KA 4OCXL 1NGXA 4Y5XC 1Q0YH 2EDOA 2PXYB 3AM8C 1J10A 4Y0GA 3KYOB 2MHAB 3BZEA 2V7NB 4YHYC 3SKNB 4HULB 2B4CL 3VH8B 4JJ5B 1CCZA 4Y2DA 1CDYA 1BIHA 1JZ7A 4XCYA 4P9ML 3HFML 1YNTB 4RDQG 4HUWB 1FDLL 3TESA 3SDAC 1Z0MA 3QHTC 1K8IB 2VLRA 5EN2A 1CFTA 1S7RA 1KG0A 4E41D 4KRLB 2F5BL 2BVQB 3HAEA 3Q0HA 3VI3F 3F6IA 4PJFA 1S7SB 2WBKA 4JN1H 1YNLL 4GRWF 5ILTL 3BUYA 2C3VA 2Q7YA 1F6AA 1CIDA 1DLHA 1U95B 4MAYD 3GO1H 4PJIB 3M17B 3H9SD 5IHLB 3PABB 2P48B 4NHUB 2Y4SA 1UJTA 3RU8L 4HPOH 2UZIH 4M6AA 3SO3B 3EBAA 4FQXC 1BOGB 2P8LA 4JGJA 4ONOA 1MQKH 1IBGH 3QNYB 5C0RH 4B50A 2BOCB 4HUNB 5DUMH 5FYJU 2XXMB 2EZ0D 2PR4L 2Q76B 3SDDD 2QHRL 4XCCL 4MA3A 3BZFA 1AP2A 5GRJH 2APTA 1T04B 1NLDH 3WBDA 3MRDA 1A1NB 4Z7WA 4Z7UE 5DMKA 4PJFF 3LRSB 1EERB 3KR3L 3LEXB 1LO2L 1REIA 4U6HB 3ARFA 4BK5A 4F80A 4UT9L 1MI5E 2FZ3A 3ZTJG 1QSFA 3FN0H 4WU5A 4BQ6A 4FZ8H 1MLBB 1QP1A 4GSDL 4MMXC 1H9VA 2PCPB 2ERJB 2VLKD 2VRAA 5GGUB 5HYQB 4CVXA 3O9WB 1U8KA 5IB4A 4NQXB 3MJ6A 4ERSH 1GZQB 3SQOH 5EWIH 1YDPA 1KJVB 4FRWA 2FJGB 3EOYG 3K2MC 3VRJA 1AGDB 1ZMYA 2QTEA 4HWBH 1FGVL 1K4DB 2VAAB 4P5TD 5CSBA 4Z7QE 3L3KA 5GXBB 1UJ3B 4QRRB 4NQCA 3CFBB 4ORZC 4Z7WF 3EYFA 2DL9A 4E5XA 5JIPA 3ARYA 5I1EL 5JXEC 1EJ6A 1P84J 1S7WB 4KMTL 5D9SA 3ULUC 5LCVH 2E9JA 3DTXA 4AT6B 4KY1H 5I66A 1I9RH 5IMMB 1T21A 4HS6B 3TBYB 2I9TA 1QSEB 4OCSH 3B9KD 1CT8A 3QO0B 5JZ7C 4HCRH 4XRCB 3KWWB 1HSAB 1GC1H 2DJSA 3RWEA 3E2HB 3OQ3B 5CWSA 1FP5A 2IQ9H 1BX2A 2X89A 1OAYH 3UPRB 3G5YB 2E9BA 1H3TA 4OCRL 3PQYB 3H9HA 3ARGD 3C08L 4NNYB 2DQHH 1MCQA 2IAMC 3KPPB 1YECH 4MJIB 3VI4E 4OQTA 5L6YH 4OGXH 1HWHB 3X3FH 4GAYB 2Q1EA 2NY0C 1A6AB 4H0IA 1T7WA 3MLTB 5DD1H 4PJAF 1IAIL 1CE1L 3R8QA 3NCYP 4KK6D 4C4KT 1MFBL 5DUPH 4M62H 5EOCL 4KVCL 5E2JA 1CLYH 3DI3B 4URTB 4BSVB 1OTTD 3B9EA 3DWTA 4G43A 4O2FA 1JHLL 1S9VA 4L4VA 1ZK9A 4MDIB 4LU5H 5CD5D 2V7HA 1N0XL 2ZCLL 1NCNA 4H88L 4NSKA 3MX0A 2NNAA 3MLYH 4K9EC 3ARUA 4U3XA 4ODXB 3SDXF 3QYCA 5BCAA 2B0SH 4R8WL 1QTYT 1E27A 1Y18A 4KKNA 3TCLB 3W9EA 1B0RA 3SCMD 5TF1L 5D1QD 4TPRL 4J7RA 4XC3H 4F7MB 1JRHH 3PDOB 2FEEI 2DQTH 1RFDL 3HUJA 1QEWB 2GJJA 1PEZA 4ZUWA 1SY6L 3NFSL 5FOBA 1CGUA 2ZWLT 4IDLA 1N6UA 1RHHA 5EBGA 3ARPA 5HGDA 4EQ2A 2BY0A 3F5WA 4JREB 3ULVL 4L4JA 3IAPA 3Q6FB 1FLRH 5AD0A 3PL6B 4LVHB 4PP1C 3MV7E 4XNUH 2CUHA 3GKWH 2BFVH 5E8DL 1RJZA 3ARVA 3SPVB 4A2LA 4QHMB 1XF4B 4MX7B 1BREA 4NKDB 5KS9A 1WITA 3LHPH 3RY5A 3STLB 3V5KB 3WIFB 1I8MB 4MNHB 2Y5EA 2IBGA 2VZ3A 1O5DT 1AIFB 4N0CD 3UYRH 4Y5VA 1FO0A 5F7MC 1EMTH 2YD9A 5K93A 1M6OB 1CLZH 2FX7L 3HUJF 2F15A 1A2YA 2DQIL 3QEQE 5IFHL 1VGEH 4HIEA 2OM5A 4MJ2A 3HR5B 1GIGH 1RZJH 4HUUA 3QUZA 4G8EB 3BKML 5GGSB 5HGGS 3P0YL 3B2UD 3P9MB 5FHBH 3MACL 5D7SL 3ARFC 1OAZL 2IANE 3MPCA 1DBJH 1CL7H 3GSUB 4PJXB 4I8DA 5T1KD 5DC0A 3D85B 4YHPA 1D6VL 1R0AH 1MHPL 3DYPA 4Q9QH 4XNYL 5DEFB 4QO1A 1ZT4B 4ELMA 4JN2B 4QOKA 4JRXD 2KUTA 4KJQC 3GBNH 4NDMB 2PYFB 4ZOBA 2V5MA 4JKPL 1EHXA 3MRHB 4K2UH 1FAIL 2V2TB 1FFRA 2P4AB 3BEWB 3QO1A 4H1LA 4CDGC 4DQOL 2LU7A 3D25A 3PWPE 4WDIB 3RRQA 1MWAL 5ADPH 1UVQA 4EJ1C 4S11A 1MFDL 2C1PB 2BNQD 4LDOB 1EHAA 1MAJA 1A7QL 4POZC 3WLBB 2IALB 1JGDA 5I19H 2FR4B 2R0WH 3OKDA 1JHTA 1I8KB 1YMMB 2CD0A 3CPLB 2DI9A 4WHTB 5DTFA 2VN7A 4XXCA 1MIML 2X7LB 5D7LD 5IROA 3L7EB 2HYMA 1BEYL 1KIRA 2E9IA 3T1FA 3QEGL 5BZWA 3NACL 4I0PD 1D5XA 2LVEA 4ZSOA 3TZVC 2BSSB 4I3SL 2CO6B 5JUEL 3VXMD 2ORBL 3ARBD 3BQUA 3GSXB 3D69A 3UMTA 1TQCC 1T5XB 2WUCH 1UACL 3V5DB 3FT2B 3TP4A 2MSPA 3G5VB 2BVEA 2DS4A 4LASH 3SBWA 3NCBB 4Z5RA 3T2QA 4NHCL 1A6UL 3SGEH 4Y5YA 1ACYL 3LS5L 5KJRL 4K7PY 5KTEL 5JW5B 1LEKB 3UTQA 3CNKA 1T66D 4OBSA 5C2UB 4M7KH 1VACA 4GKNA 2AJXL 3JWDL 5CBEB 3CD4A 4X80H 3VXRA 1ZHNA 25C8L 4IRJD 1NCDL 4ETQB 1NANH 3PGFL 1QACA 1N26A 4GW5B 1SBBA 2IPTL 3W9DB 1W72A 1CS6A 4OUUB 4WFHE 5C8JA 3ULUE 1DBAL 1MHCB 4HFWA 3O3BB 1FPTH 3V6FB 5CEXA 1PZ5A 1OLZA 4NM8H 1KNOB 2JB6B 3QP3A 2HLAA 1KJMB 3MV9B 4KU1A 4OZFB 4WCYL 5E5UB 1HKLH 2R2EB 4LQFL 5FKPA 5DXWA 3QXAB 4FQLH 4IHOB 1X5YA 1T7XA 3WO3B 5I1DA 1FN4A 3H9ZA 4GG6A 1X5AA 1KUMA 1S5HA 1ZGLA 1FFOB 3S35H 5IT2H 1EAJA 4LCCB 3VXTA 3M1BB 4DW2L 1OSPH 4XMKL 3P9LA 2YKLH 1IQDA 2ZUSA 1JWMA 4POUB 4Y4FD 1CICB 5IHUL 4FTVD 4NRXB 3L3GA 4DUVA 3VRIB 2UY7A 1FRGL 2M2DA 4D2NA 5B38B 1S8DA 5D1XA 5L0QB 1RU9L 4GG8A 4YXKH 1A9EB 4MDJA 2BHUA 3H9YA 5K9KB 3OGCB 2DKSA 1JFQL 1H5BC 4KK9C 1WFOA 2P5EE 2ADIA 2A73A 4GG6F 5J6GA 5ISZA 3GJEA 1IGJB 2ZP0T 3L1OH 4E0RB 3HPLA 4K7PL 5JIKA 1MCHA 2VTFA 4N8CH 4NKOB 2W07A 3BKCH 4R7NB 4XBGA 1F5WA 2A38A 2WIMA 2DLEA 1VFBB 3ZE1F 1U8HA 1VEPA 2VLJD 1EFXB 2VLLB 5JHDE 3EDJA 4AG4H 1HSBA 1H0DB 2P8PA 5KVDH 2IADA 1UKQA 3WFEH 1HHHA 4JZOB 2PYED 5I8OL 1WISA 2FJFB 4QRTA 1MY5A 3G5XB 5C0CA 5CZXC 5ECJE 3BH8B 3RY4A 1CG9A 1TQBC 4XPGL 1MQ8A 3MTRA 4C83B 2XV6B 3O2WH 3HC0A 1PKQA 3B5GA 4WVRA 5GRUH 3RVWD 2DQEH 2HTLC 2BNRD 4JZJA 4XHJD 4IJ3B 1T83A 3QULA 4M43L 4YHIB 4D0BB 4ISVB 1G7QA 3MA7B 1AO7E 1TCRB 3ZDZF 3D3VE 5E9DE 1CXLA 1YEDA 4X7FC 1Z0NA 4KKLC 5EULV 2JE8A 5SX5H 3QFJD 3C6SB 5MEQA 1EH9A 3C5JB 1A0QL 3WO4C 4HHAA 4CJ0A 5D2LB 4OCMC 3H7LA 1OGAD 4ODVH 4P9HL 3AU1A 4YE4H 3LKNB 5GHWH 3G6AA 1JGLL 3VA6A 1LGVA 3B2VH 1HDMA 5T1DH 2AW2A 4ODWB 1Q0YL 3MRMA 4XH2B 3SKUD 2D03H 3WYRA 4R7DA 5J89A 4ZFFA 2I5YL 5IM7B 1BF8A 1U92A 3DURA 1NCTA 5F9JA 2QBWA 4IMLB 5C09B 4Y89A 3EO9L 3VXQB 3SBWC 1JZ3A 4BQ9A 1S9YB 5K9QG 3DOSA 2ARWA 2X4NA 5D71H 4DN4H 5DJDA 3CCHB 1KC5H 2FSEB 3WFHA 1FC2D 4JCMA 4TNVK 4GRWB 2VDOL 3IF1A 2NXYC 2JJTC 3ELAT 4TULH 5I1CH 4U1LA 5LJYH 4OCNC 4L8SA 4GW4A 1DTUA 2WZPD 4WTWA 3MRFA 3C5ZC 3GIVA 3DXAA 4OFPA 3GO1L 1T22A 3S5LG 4Y2DB 4RQQA 4HPOL 2UZIL 4NJAL 4XCYB 1A7RH 1IBGL 4PJAE 4Q74A 3M45A 2B7DT 5C0RL 3VRLE 5EN2B 1LK2B 1RVFH 2VLRB 5DUML 1J0JA 1CFTB 2J6EL 1HE7A 4Q9BA 5FGSA 1S7RB 1KG0B 4LSVL 5JR1L 3HAEB 4PJFB 4HX1A 5GRJL 5C07D 4N0YH 3I02A 3BUYB 1NLDL 1TZIA 3LKSB 3VWKD 1JGEA 4WI9A 2C3VB 5GZND 2Q7YB 1UM5H 4RAVA 1DLHB 5LKNA 1HQ4A 3SDXE 1WAAA 4ZAKD 5GQBA 3FN0L 3REWA 1EDQA 2P8LB 1ZLVH 1RULH 4N90E 4M1DH 1IL1A 3OX8A 3BAEH 1EO8L 1TETH 4RMRA 3MNWA 2J88H 3EYOA 3BZFB 5EWIL 5IVOA 2YC1A 4JY5H 1AP2B 4G80A 3MRPA 2B4CC 3C87A 3EJYC 3MRDB 1SM3L 4HWBL 4Z7WB 1RQ5A 5DMKB 3RVTC 3LAFA 3BMVA 4XB8A 3WDHA 3ARFB 4U1SA 3KS0J 4DTGH 3CU1A 2FZ3B 3BGAA 1QSFB 2W9LA 1SY6A 4WU5B 1I9RL 5JW4M 3HLAA 1UENA 3DETC 4U2ZA 5DO2D 1UGNA 2XN9E 1SJXA 1OWRM 2HTKD 4P5KA 1U8KB 5IB4B 1KULA 3HHRB 2D0GA 1YDPB 4QWWC 4V2BA 3E6FA 1AKJD 1GC1L 3VRJB 1MJUH 2IQ9L 1NCBL 3L3KB 4FFZH 5GS2D 3TH2T 4NQCB 5GIRA 1FCCA 5DURB 1Y6MR 5TDOA 3LKOA 3EYFB 1I1AA 4E5XB 2DQHL 1YECL 1UG9A 5D9SB 7CGTA 5L6YL 4OGXL 2CK2A 3DTXB 4L3AA 4XVSH 3X3FL 3BN9C 5I66B 5GZOD 3MQIA 1NGPL 1E4JA 2YA1A 5E4EC 2I9TB 5LXGH 2HFFA 3IDGA 1CT8B 2F53E 3BYTA 1LEIA 4XZUA 3ULVF 5MEND 3FTGA 5DUPL 1BGXL 2O5ZH 4F9PA 4XWGL 1CLYL 3UAJC 3RWEB 5CWSB 4LU5L 4BH7A 1BX2B 3GRWL 3QWOA 3GSWA 1ZA3A 3HR6A 3ZKXC 2EH8L 3TYFA 1NDGA 2IEPA 5D6CA 5DFVD 2B0SL 4Z0XA 4J23A 4MD4A 1F11A 1IC5H 5C0BD 1NUDA 3BVNA 5FUOL 5FYLD 3L9RA 2DQUL 1ZLVK 1J0YA 3MLSH 4XC3L 1EA9C 1J8HD 2HT3C 2X2YA 5KW9H 2XWJA 4RAHA 2CSPA 1XEDA 1WCBA 4G43B 2CH8A 4O2FB 4X7SH 3MODH 1S9VB 5H8DA 2WM0A 2IWGA 4L4VB 5E2WH 1MWAA 2V7HB 4ZUTA 2QEJA 3PP4H 4NSKB 1FLRL 2NNAB 4Y19A 1DL7H 2GYSA 4M6ML 3PWVA 4XP1H 4L8SC 1G6RH 4XNUL 1JPFA 3GKWL 1E27B 1ITBB 1Y18B 5KSBE 1KELH 2BFVL 3W9EB 4DGVH 1B0RB 4XP4H 3NABL 4XVUD 3LN4A 2CQVA 3GIZH 1AY1H 1F2XK 4LCUA 1ZEAH 3VMOA 1A02N 2F54B 4UINH 5CJOH 3HUJB 3ZTNL 4ZUWB 1EBAA 3UYRL 5FOBB 3QHFH 1EMTL 1KN2H 1RHHB 5HGDB 2Q8AL 5TE4H 3F5WB 4YR6A 4GH7B 4U3HA 5AD0B 1AI1L 5SWSE 1VGEL 4PJ8D 1GIGL 2CKBH 4U31A 5IHZA 2YUXA 3MNVA 4OZ4A 4XNQA 5E5RB 2E6QA 5FHBL 4B7IA 4APQB 2A74A 1CL7L 1U8IA 2NR6C 4MA7H 1RJZB 4KTDH 5TDNA 5DRWA 5KS9B 4ZO6A 3VD9A 2FCBA 3D39D 1YA5A 5BRZE 5DZOA 5SV3A 4M3KB 2MWCA 4Y5VB 1I7UA 5D72L 3CXHJ 3GBNL 4YC2C 2OJZH 1A2YB 3INUH 1A4KA 4G8IA 4I2XE 4JFZH 4HIEB 2WBJA 4K2UL 4OBRA 1BECA 1F6FB 3DV6A 4HUUB 3QUZB 4UIKH 4TVPL 3QIUA 3PGDA 1ES0A 2W9DL 4PRPD 1BD2D 4HC1H 2D2OA 4WEMB 1RZKH 4YHPB 1P9MA 2O5YH 1UXWA 4HWUA 3MROA 4DGYH 4X5WA 4ELMB 1FFNA 4QOKB 2R0WL 3MV7D 4BA8A 4TSCH 3WUZA 2AXGA 1BFOA 1Z3GL 2NY1C 4Z7VE 5DSCA 3ZKMC 4W4OA 3QIBA 5BOZG 3P30L 4G7YL 3SKJH 5JW3L 1GH7A 1X5LA 4HBCH 3QO1B 4H1LB 4YDLC 1MFNA 4GG6E 3K4ZA 1I9EA 1P4LB 1X5GA 1R3IL 4AYFA 1UVQB 4LASL 2O26U 4ONGL 3NZHH 2VKXA 4F8QA 3ZE1E 4OGAD 3OKYA 1B6DA 4Z18A 4KK5C 1YUHA 4PLOB 5CEYA 2XZAH 3O11A 4X5XA 3OKDB 1JHTB 4OGYL 5DTFB 1NGYA 4F9PC 3JTTA 4GMTH 2NMSA 4M7KL 1KIRB 5I73B 1OAQH 2GI7A 2P24A 4FFWD 5C0AD 3AC0A 3OKOA 1D5XB 1LDPH 1B90A 2FHCA 4X80L 4ZSOB 3T4AA 3BQUB 3D69B 1PLGL 1T6VN 3OHXA 4HEPG 1UKTA 4I48A 1X6NA 2LU3A 3MJ9H 3KYKH 5F70A 2WWMC 5IHBA 5C08D 2W0KA 4Z5RB 4EEEA 5L9DH 4Y5YB 2KZWA 4R97B 5C3LD 3ILQC 1FPTL 3GI8H 5FYKL 4NM8L 3IDNA 3UTQB 3ALXA 1HKLL 3WHE0 4J3UA 1VACB 4GKNB 3H7BA 3EDKA 3OAZH 2FATL 3MGAA 5CZVL 3HE6A 5E0QA 3VXRB 1ZHNB 5C0CE 3RWIA 5E99H 1KTRL 1P7KA 3S35L 1T03H 5IT2L 2NY6B 2JLLA 4WW2A 3VFSA 1IKNA 1QFHA 2CDGA 1P1ZA 4NCC1 5MERA 1ZV5A 1H3XA 4PIRF 2G9HA 2ZOLA 4G9FA 4QHKI 3W0WA 4L8DA 4CVWA 1W72B 1MCWM 4JFDE 1J86A 1DEEA 2ZPKH 1A22B 5CEXB 1PZ5B 3RWHA 1WFNA 4YXHH 1DQLH 2HLAB 3GB7A 4YXKL 5FKPB 3TPUA 2WWKT 3FRUA 4KGLA 5I1DB 1FN4B 1S5HB 1ZGLB 3I3BA 4LSSH 2QADC 2CRYA 3VXTB 1JNLH 5EBWA 3BP7A 1I75A 3P9LB 4QCIA 3O0RH 1M7IA 1IQDB 1JWMB 3VG9B 4D9QE 1KGCD 3ARSA 1YPZA 3BKCL 3KJ4C 3RP1A 3L3GB 2UV3A 1OTUD 4Z8FH 5LAXA 3O6ML 5F9WC 4J4PD 5JIIA 4AG4L 1VDGA 1S8DB 3JWDC 5D1XB 1F02I 4GG8B 2YR3A 3KPRA 3NA4A 5I75C 3WFEL 4QRPD 3UTSE 1JJUA 4MDJB 4KUCD 2BERA 4NKMA 1LNUA 3QPQC 1KOAA 3QISA 2ADIB 1WSST 2A73B 2WBJC 1R24A 3RDTD 3C09B 5J6GB 5ISZB 1ZAGA 5GRUL 4HKBA 2DQEL 1SJHA 3HPLB 1EEZA 2ICES 5EZJA 4NBYB 4XBGB 3BKJH 3NAAH 1U8HB 3NGBC 5K9OA 3WS6C 5CEZD 3OKEA 3IYLW 3ARED 2P8PB 2IADB 5FCSH 1HHHB 3JWOH 5CJ5A 4QRTB 3EYQD 4MWFA 4R4FL 1CG9B 1FYTD 1H15A 2UY6A 2YPLE 1ED3A 3JV6A 5GHWL 3OAZK 4JHZA 2RGSA 1PKQB 1INQA 2DBLH 1GGBH 3WN5A 4JZJB 5T1DL 3QULB 1KCKA 2PW1B 4Y16D 3BUTA 4H8WH 1G7QB 2D03L 4YGVA 5HVFB 1T5WA 1YEDB 1ZHBA 3LKRA 4DVBA 4MS8D 3W11C 1RUAH 1G9MH 5MEQB 2NY7H 4HHAB 4HWBA 5FGBA 3KXFE 4DN4L 1KC5L 5I15H 1WV7T 3CAFA 2F8XC 1LK3L 5MI0B 3AU1B 3TVMD 1FL6A 3O6FD 2HMID 3G6AB 5GS0D 5JPNA 5FUZH 1B4RA 2ZG1A 1U3HA 4TULL 5I1CL 1HDMB 2OK0H 5GRVK 4HK3N 3MRMB 3GMMA 4R7DB 1M71A 4ZFFB 1ONQA 1U92B 3DURB 5F9JB 3U4BH 3QEHA 4HCRA 4NJ9L 4LPWA 4LRIA 3QG7H 4L9LA 4K3DH 3JV0A 3HG1A 4XWOD 1VEOA 2APVA 2X4NB 1A7RL 1JWUA 5DJDB 3C5SA 2X1OA 2DWDA 3WFHB 1RVFL 1J0KA 3GJFK 3EFFB 3OGOE 3QDJD 5I9QC 3IF1B 1AQDA 1OD9A 3U48A 3UTPE 3QPXH 4U1LB 1OAKL 5EA0H 3P11L 4FQJH 4L8SB 4GW4B 1IKNC 1UM5L 1CFVH 3GIVB 1P5VA 2EC9U 3DXAB 3CVHH 1T22B 5DQDL 4RQQB 5JLZB 1FG2A 4P9HC 1RULL 3FKUS 4M1DL 5L2KD 3BAEL 3QZWG 3ZE2E 35C8L 1JF1A 1MREH 3KLAA 1TETL 2I25N 5FK9A 3RJDA 4OB5H 3LQAH 5AG8A 4JY5L 4HX1B 5DK0A 5FGCE 5F6IB 1TJIH 3I02B 5DQJA 1TZIB 3S5LA 1JGEB 4LVNB 4OCYH 3FFCE 4RAVB 4KKBD 2B1HH 1HQ4B 3WXWH 4KJWD 3ZT5A 3RGHA 3TBWA 3MA9H 5A2KH 3REWB 1QZ1A 5ETUA 4ZXBD 5GRZA 1GGUA 4OZGF 3MRNA 1IL1B 3OX8B 2EDDA 4HZAA 3IDIA 3RZCA 3RWGA 3QUYD 4FQHA 4TNWK 2D7TH 2H9GA 3MNWB 2LAGB 3WKMH 3I75A 2YC1B 1QSZA 3KLDA 1FH5H 3MRRA 1T1YA 4G80B 3MRPB 3ETBF 4QHKJ 1MJUL 2D0FA 3F7VA 4MD5A 4EI5A 5FDYA 4FFZL 3OZ9H 2HRPH 4JLRA 4U1SB 5C3TA 5D4QA 5KOMC 3RVUC 1XGUA 1AR2A 4LSDA 4JKWA 2QR0A 4EDXA 5HPMA 4HJ0C 4ZUUA 1KB9J 2DMBA 1R3KA 1CFBA 1KYOJ 4LPTA 2ICCA 4MJ6A 3T2NH 3HLAB 2HVJA 4U1IA 4UMGA 3G04A 3HE7A 5LXGL 4P5KB 4LCIH 1Q8MA 3C6LC 1TTGA 3FMGH 3WDIA 3WE6A 5HHQA 2EYRA 3E6FB 5IW3A 5DMGD 5ID1A 4P46A 4BJLA 1EPFA 1ZVHA 4PJ5A 4HW6A 5GIRB 3Q5OA 5TDOB 3B6SA 3LKOB 1I1AB 4K71C 4P4KA 1D9KD 2QLVB 1ZS8A 2UUDH 4DZ8B 4JRYE 2AEIT 1C16A 1IC5L 5I16A 4W4NA 4X98A 1G7HA 2HFFB 2OQJA 2HT2D 4Y1AE 1LEIB 3MLSL 4XZUB 4WO4A 5FGBC 4XP6H 5E2VL 3FTGB 5EBLA 2YD3A 4X6CA 5KW9L 1P5UA 5HJ3A 3MODL 1CDJA 2ESVE 4YXLH 4LOUD 4BH7B 5E2WL 1OAUH 3WIHH 3JTSA 3QWOB 3GSWB 1ZA3B 3SJVD 3E3QC 1HYSC 4XC1H 4CMHB 2VXQL 3DVFA 1NDGB 3TYFB 4XP1L 5D6CB 1XF5A 5B3NA 2W0PA 4HZLA 4Z0XB 1N7MH 5EIVA 4NZRH 5F7EH 4MD4B 1F11B 1Z9OA 3VWJA 3BVNB 1G9NH 5DJZA 1Q72H 3P73A 4JFFD 4LFHD 4G8GA 3DYOA 1MCPH 1WBYA 1AY1L 3GIZL 3MBEA 1ZEAL 3O6LL 4FMKA 4H26A 4UINL 4MA1C 3IKCA 2XWJB 1WCBB 5HI4C 1YJDH 4C56E 1KN2L 4X6CF 5GJSH 1MWAB 3SE8H 1IVLA 1BAFH 5TE4L 4ZUTB 3BHBA 3P9WB 4Y19B 2VB5A 1N3NA 1VPOH 2CKBL 1DVFB 2XKSA 3PWVB 2F53D 4WV1A 3VXOB 3UBXG 2IJ0C 1JPFB 3FAWA 1KFAH 3HTLX 3ZHKA 4MA7L 3CK0H 2DN7A 2WP3O 5CSGA 3SE3C 1PG7W 3LH2L 3LN4B 1WUNT 4LCUB 5I6XC 1JF6A 1L4IA 2BVOA 1XIWC 4GRMA 2A6IA 1WIUA 2DD8H 3ZSTA 4YR6B 4AH2A 3NPSC 1RHFA 2NZ9C 4JFZL 3EFDL 4P23C 2XWBA 1FAKT 4QNPF 4UIKL 5IHZB 4GRLA 4OZ4B 3I50H 4JANA 5C2BH 4HMEA 4FABH 4X4MA 3ARDD 1U8IB 4F7TA 4V1DE 3CLEH 1Z6JT 5TDNB 3I85A 4PREA 4K8RC 5CGTA 2UUDK 3CX5J 4I1NB 5DRWB 2IBZX 1J1OH 1CDHA 1PEWA 4YUEL 1A7NL 1RZKL 2D7OA 4LPYA 5LBSL 3TBVA 2O5YL 5HYIA 3VFRA 3FQWA 1S9KC 1FL5A 1I7UB 3RZCC 1A47A 4FFVC 4D0CA 2RB8A 3V8CA 1QBLH 4ZFOL 3K7UA 4G8IB 3RGVA 4LKXB 3QCVH 3DV6B 3CLFH 3SKJL 2DM4A 4EI5C 4U6YA 2RJMA 3QIUB 3PGDB 3ARXA 4KRPC 2MOVA 1DR9A 4PRIE 3NGBB 1FNLA 4TOYL 5FV1L 1JI2A 3NZHL 4NN7C 1DJSA 2VDKH 3V6OA 4NQVA 3K2UL 3C2AL 5ACLA 1UXWB 3MROB 3F58L 4X5WB 4O2EA 5ESVA 3KPMA 1JNNH 2XZAL 4I9WD 1FFNB 3OR6A 2F8VA 2AXGB 3VG0H 4Q0XH 3W39A 3OG6B 5DSCB 1OD7A 4CW1B 3BKYH 4GMTL 3QIBB 2AJVH 4P46C 1OAQL 2Z0BA 5T3ZH 1FORL 3KPOA 3GGWA 1LDPL 4CKVX 3MMEA 3TCXA 3HI1A 1UCBH 4L3ED 1IGFH 2X10A 3MJ9L 4P4KC 4EN3A 5B4MC 1BP3B 1DQDL 4YWGL 1R5IA 1T0NA 3N1FC 4FOMA 4KK8C 1CXHA 1QBAA 4O58H 2GTWA 4OZHA 1YUHB 4S10A 4X7CC 4KROD 4QHLA 2FH8A 5CEYB 3O11B 1A3LH 4A2MA 4C59B 4X5XB 5LGJA 1OQOA 3GI8L 1MAMH 1NGYB 3MCKA 3JTTB 4KXZH 2NY2D 3P40A 3QI9A 2OL3H 4JR9L 3CC5A 4JM2D 4UIMA 2P24B 3OKOB 3T4AB 2Y07H 1J18A 5E99L 5ALBH 1T03L 2UWEE 1CLOH 3OHXB 4NPYA 2H2PC 3ZYIA 2VZUA 4I48B 3LPGA 4WFGD 3NA9H 3U79A 2IH3A 4U4BA 7FABH 4KJYA 1NCAH 5D7IA 3T0DA 4BSWA 3MZTA 4ZNCD 1M1SA 5ANME 1RUQH 4LHUD 3TN0D 2ZPKL 4UDTA 5D96B 4OLWH 4OZHF 4HWEH 5TDPA 3MBEC 1LDSA 5E8EA 4HT1H 4WHCA 3IDNB 1DQLL 1K85A 2MTPA 2Z4QA 4YPJA 3WNPA 3UTTE 4HWNA 4M1GH 5CKGA 3H7BB 2DMKA 2AVGA 3HE6B 5ITBH 2H6PA 4R2GB 5KSUA 1P7KB 3TT3H 4LSSL 4P2RD 4PLKC 4WW2B 3VFSB 3HB3D 1JNLL 4MNGE 4TSAL 3P4OB 1AGEA 1UEMA 1P1ZB 3O0RL 5MERB 4ODHH 2G9HB 4GBXD 4G9FB 3OKMA 1HZHH 4L8DB 3VXSD 1F90H 3W0WB 2BC4A 4QYOA 1N8ZA 4LVOC 4DEPB 5T3XE 2VZVA 5D7IF 1DEEB 1RAMA 1QRNE 3RWHB 2VZ1A 5HHMB 3HN3A 2H26A 4CN4A 3GB7B 4HXBH 5DMIL 5TGBA 3TPUB 1UH2A 5IFAH 3DIFA 3FRUB 2QV2A 1MSPA 4NBXB 4XCNA 1C12A 4L4TA 4BUGA 5EBWB 4K3JH 1RJYA 3BP7B 2OTPA 4ESKA 4QCIB 3FO1A 4DFHA 1M7IB 3GMLA 1K3ZA 4F15C 4XNZC 4GRLC 3RI5F 4OZIF 1I3RA 3BWAA 5D1ZD 1YPZB 3C9NA 1KPVA 3T2PA 2J7LA 4NZDA 5KANG 4MCZA 4U0RC 1NMAH 1DBKH 3NAAL 5LAXB 3BGFB 3PUCA 5T33H 1LHZA 3BDBA 3KPRB 1NAMH 5C09E 3OTTA 1VFMA 1MCRA 2Z92A 4NKMB 1LNUB 4W6XB 1OPGH 5B39G 1PG7H 3MLVL 3RGVC 1J0HA 5FA4A 1R24B 4JFDD 4HKBB 1XF1A 2AV7A 1SJHB 4P3WA 1KEGL 1EEZB 4RRPG 1VEMA 5EZJB 4H8WL 4KRNA 1S7XA 2VDLL 1UM4L 4Y7MA 5H2BA 5K9OB 2E7HA 2DQGL 1I85C 3OKEB 5FYJD 3VJ6A 1RUAL 2J8HA 2YZ8A 4YBQC 2NY7L 4Y4KC 4OZGE 3DMMC 4XBEL 5DD6A 3MRGA 4H25A 1I8IA 4MWFB 2BSRA 2EIEA 1L7IL 1TJHL 4KQ4L 1DANU 3WNOA 4EBQH 1H15B 4D9QD 2C4FT 2HT4C 1PGRB 3JV6B 4ZPVA 5BV7L 2NX5E 5LGKA 5FUZL 3P77A 4Z7OF 2EH7H 1INQB 4RGNC 4I77L 3WN5B 3O8XA 2OK0L 4OD3L 4PJEF 5J13B 2VDMH 3S97C 1B0GA 3T3ME 4YDKH 4YGVB 3O45A 1T5WB 5IMOB 1VCAA 1T89C 2CKNA 3LKRB 4DVBB 4MNQE 3U6RA 3T0AA 3QG7L 3AY4C 1UCTA 5D7JA 3RVVC 2C7UA 1JK8A 4IRSA 2LVCA 3KVQA 4GLRI 4JFEE 1FL6B 5A40E 5JPNB 2WV3A 5CSZA 3BSZL 1U3HB 1RI8A 3VGEA 2PXYD 5EA0L 3MYJA 4UILH 4FQJL 4G5ZL 4GFTB 3GMMB 2XA8H 5CJQL 1M71B 1ONQB 1TCMA 5ICXA 1CFVL 1AR1D 3QEHB 3B9VA 3CVHL 4N9GA 1KN4H 4MXQC 4HAFA 1FZOA 1I7ZA 4NO2B 2ARJQ 4L9LB 5JW4Q 1BWMA 3HG1B 2E8YA 3QJFA 1I1CA 4NCC2 1JWUB 4ELKA 3C5SB 4MA1B 2DWDB 1Q0XH 2AJZA 3OF6A 2OZ4H 4MVBD 5DDHA 1MREL 4BQBA 1XZ0A 1AQDB 5GGQL 4OB5L 3LQAL 2GY7B 5JW4N 3WCYA 4M3JA 3A67H 3X11A 4OCYL 4XPHL 3CZJA 1J5OH 2B1HL 1EJOH 1ZA6A 1B9ZA 5IG7A 4PLJD 1F3JA 1FG2B 1DLFH 5F96H 2V2XA 4RBPH 2MPAH 1GPOH 1F4XH 1IMHC 1OB1B 2C26A 3OPZH 5EIQA 1J1PH 3KLAB 4Z9KB 4WWID 5FK9B 4DFIA 3WKML 4K3HA 5DK0B 4TVPE 5DQJB 2XZCL 2EXYC 3ZE0F 4LARH 2JB5H 3S5LB 3AROA 4OT1H 3OZ9L 2HRPL 4ALAH 1FSKC 2ITCA 2R29H 4KC3B 1PY4A 1RK0A 3S9DB 2BHYA 3TBWB 3QZWA 3S35X 3T2NL 3MRNB 4E42A 2EKJA 3UTPD 3O9WD 1FE8L 5KVGL 3IDIB 5I71B 4LCIL 5DD3H 1UZ6F 3RZCB 3JV5A 2BY2A 2CKBA 3FMGL 4FQHB 2H9GB 3DGGA 3MLUH 2ID5A 3R06A 3TA3A 1WTLA 2EO9A 3MRRB 1T1YB 3IDYC 2CMRH 2JF1A 2CLVA 5BXFA 1H3VA 3F7VB 4MD5B 4QRRD 4WIQA 4HBQA 2AABH 1J12A 4JLRB 2QKIA 5BS0A 3C60D 1XGUB 5HBBA 3ZZ1A 4M93C 3Q3GA 2ADGA 2QR0B 4EDXB 2UYLA 1AC6A 5HPMB 5JIHA 3S37H 1KJ2H 1R3KB 1QSED 1ZLUK 3O3AA 4MJ6B 2HVJB 4U1IB 3G04B 5DJ6A 3VFTA 4X6BA 3GM8A 3HE7B 3Q6GH 3D1MC 3RWCA 1LO4H 5HHQB 3WE6B 2EYRB 3DLQR 2DI7A 2AAVA 1MCNA 1C5BH 1HCFX 5ID1B 4P46B 2F54E 3PQYD 2A77H 2E7CA 4PJ5B 4HC1A 4MJID 3B6SB 4P4KB 4PJ9C 1ZS8B 3L3JA 3L5IA 2ZCHL 5B3JF 1N7ML 4NZRL 5F7EL 2XYCA 1C16B 4PRHE 5BOPA 3LZFH 1KJ3L 4PJGB 5FYKE 4ZFOA 2GKIA 4X98B 5I16B 1G9NL 2OQJB 1Q72L 3D9AH 1G9EA 3WS3A 4KWUA 5KVEH 1MCPL 1IE5A 4WO4B 2Z31A 2A83A 5EBLB 4X6CB 4IRSC 5BW7A 5HJ3B 1LVEA 3ZDYF 4R90H 4LCWA 1YJDL 4FQQB 4UZGA 5GJSL 3SE8L 1HH6A 3JTSB 4BZYA 4Q97A 3H9SA 2G2RA 12E8H 3ULUH 4OFIA 3HNTH 1VPOL 2YBRA 4QXGH 1SBSH 1XF5B 9CGTA 4HZLB 3U30C 5E2TL 3ILPA 4TN9A 4JO3L 4XT1C 5F8RC 2VDNH 3CK0L 3VWJB 5DJZB 4LSTL 3D48R 3P73B 1WBYB 3RFZC 3MBEB 4H26B 5MHSE 5DJCA 3IKCB 3L3DA 3U36A 3OB8A 5ESAA 2V2WA 3GSNL 4M02A 1GVIA 2DJUA 3RVXC 3MJ9A 2I60H 4D8PA 3N1MC 2R9HC 4PD4K 3PL6D 2VKWA 3BHBB 1C5DA 2VLME 2QSTA 2GITA 1EO7A 1N3NB 2FLRT 4WV1B 1NMCC 5TH2A 4ZNEE 3I50L 3QT2A 4DKAA 4LVOB 4FABL 5I0DA 4R4NC 4GMSL 2E6PA 2IGFL 1X5KA 1U3YA 1J1OL 2H8PA 1DP0A 1DQML 1AH1A 2P5WA 4HK0A 2BVOB 4GRMB 3UC0H 2A6IB 2GFBA 4AH2B 4K9EH 1L9NA 1VFAA 3UBXA 2XTJB 5EOQH 3QCVL 5E6IC 3Q2CA 5DZNA 2XWBB 3CLFL 2DM7A 3MOAH 4JANB 2FGWH 3RWDA 1UB5A 2PO6A 3TJHD 4X5LA 4GUPA 5DR5H 4F7TB 3D85D 4PREB 3EYUH 2IPKA 1B0WA 1JPSH 3DVGA 3TBVB 5J0BA 5I1GH 3FQWB 1CGXA 2VZOA 1JNNL 1FL5B 2AKRA 3T0WA 1OARH 1VKXA 3EO0A 1H8OA 3ARGA 4D0CB 3FT3A 3EYSL 2AJVL 3GMQB 5LVEA 1HNFA 3EOTH 1WZKA 1FNEA 3LKQA 4NQSA 5EO1A 3RUGA 2YSSA 4YDIH 4U6YB 4Z0BH 5B8CC 3QIWC 1UCBL 4X4YA 4NO0A 3G6DH 4OZIE 2VXSL 4PJBB 4O4YH 4O58L 4NQVB 1QPXA 4O2EB 5ESVB 3KPMB 3DX9A 4RFNB 1A3LL 4JKKA 1YMMD 3HC3H 3TO4D 1MAML 3OR6B 3TWCL 3W39B 4DWHA 4UQ2A 5DS8A 3KPSA 3MV8A 2OL3L 1FCGA 1J1XH 2EC8A 1MY7A 4RGNB 1WWWX 3KPOB 1E4XH 3RBGA 3GGWB 2CRZA 2Y07L 3MMEB 1CDIA 3HI1B 1CLOL 4KKAD 4UU9B 5F1IA 4A6YL 4EN3B 1R5IB 1T0NB 4MQTB 3QDGE 5IQ7H 2GTWB 1L9MA 4OZHB 3X3GH 1OQXA 4RMVA 4QHLB 1RUQL 5LGJB 1NPUA 4OSUH 4RISH 1RIVH 2J12B 2ITDA 3KYMA 1OWWA 3FZUD 3MCKB 1MUJB 3KLHD 1SEQH 3QI9B 4M1GL 5L2JA 3CC5B 3KPQA 1PX3A 3OXSA 4FMFA 5D5ME 5CKAA 4UIMB 4PRID 4HUVA 4MAYC 1JUFA 4YAQA 4NO5A 4FG6D 4NPYB 4Z7OE 1MFEH 1FNAA 4N0FA 5F7NC 4PJEE 4LKCA 2IH3B 1HZHL 4NWUH 4YFEA 4JFOA 2IG2H 2WIIA 5FYKU 4BSWB 4XGZA 2EZ0C 1QFWI 2V5RA 2BVUA 3SDDC 4UDTB 5EDXA 5TDPB 3MV9D 5FO9A 1WTGT 2Z4QB 4HXBL 2FX8H 3CFDA 1NC4A 2DF3A 3MLRH 5IKCA 3UCRA 1TIUA 3MYZA 1UFUA 3GHBH 2H6PB 4ZTPH 5KSUB 5FAAA 5L8KB 2X4PA 4M4PA 4K3JL 1AGEB 2EE3A 1CICD 2Y25A 3OKMB 1WEJL 2BC4B 4QYOB 1N8ZB 5DMJB 5EU6E 1I1YA 1UXSA 1B6UA 4M61A 4EDWH 2X44D 4AL8H 4LDEB 3NIDE 2FECL 1TFHA 5T33L 5CUSH 4IIQA 2H26B 1NAML 5AG9A 5TGBB 3PV7A 5IBTH 4P5TC 3DIFB 4X6EA 1C12B 2LTQC 4XCNB 5HYJA 4L4TB 4RZCA 3CVHA 1XMWA 1OPGL 2WWKO 2QJDA 1GGIL 1RJYB 3PWUA 1QQDA 3MCG1 4JG0H 4R26H 3SGJA 3GMLB 1DE4A 4GS7B 4HUXA 1I3RB 1YZZA 2EDWA 3L5JA 5C70A 3B9KC 3C9NB 1KPVB 1WZLA 5JXAH 4MCZB 1EFXD 3CXDH 1XGTA 5I1AA 2IFGA 1MJ8L 3AAZA 4PRAA 4AY0A 3F6LA 3EUUA 1JZ4A 2NY3B 2Z92B 5E1AA 1MRCH 5IK3A 3WHXA 2JJSC 1S7UA 3V7AE 1CN4A 3ARGC 1S7QA 4F7CA 2R15A 1DZBA 1V3LA 3R1GL 4ODUA 1A6VH 2F58L 5FA4B 1IGMH 1NBYB 1JMZA 2VXVH 3W5NA 4JO4L 2AV7B 3ZE0E 5HYFA 1U42A 1EGJH 2VDML 3GK8H 1A5FH 4WFEE 3L3OA 4YDKL 3QNZA 4X6DE 1S7XB 1U93A 4KK6C 4GT7A 5E2UH 3BPNB 3N06B 4KFZC 1WWAX 3G5ZA 3T8XA 3VJ6B 1KBGH 2X1QA 1OTTC 4Y8AA 4TUKH 2ICWA 4M8QB 1NCCH 1FO0H 3UPCA 4D9LH 2I9LA 5DD6B 3MRGB 5CD5C 1I8IB 4O5LH 2BSRB 2GJZA 4R6UA 1HHGA 4W6WB 1TDQA 2FYYA 4QGYA 1QPPA 4ZPVB 3QHZH 2E3VA 1JVKA 4U0QB 2EYTA 5DFTA 2N1KA 3P77B 5SX4I 3O4LE 3O8XB 1GXEA 2OYPA 4FZEH 1B0GB 3GMNA 2XA8L 3SCMC 3HI6L 2FH6A 4XMPH 5C09D 4RX4A 3PWLA 3O45B 5D1QC 2AK4A 1IJ9A 3WJJC 4JY6A 1KN4L 3NFPA 3U6RB 1BF2A 4MQXD 2IMNA 5FF6A 5D7JB 1CGSH 2C7UB 2K7QA 1VERA 1JK8B 4JPWL 3VA2C 4IRSB 4NN5B 1Q0XL 1Q1JH 4P2OA 4OFYA 3KJ6L 3B3IA 4RA3A 2APBA 2YHGA 1GOHA 2D7MA 2Y06H 4FTVA 1G0DA 2RFXA 3PGCA 3MYJB 4U3CA 3ESVF 3GMRA 5GS1A 2R4SH 3UDWA 1I3GH 5ICXB 5F7LB 1HHKA 5BMFH 1YEKL 3BN3B 4Y2DD 3F12A 4N9GB 1FZOB 1I7ZB 4YHKH 4N0CC 3L3HA 1JPST 1DLFL 3KDMA 4NQDE 3SGKC 1FV1A 3QJFB 2CJUH 3N1QC 5BV7C 2VLRD 4ELKB 2MPAL 3WIIH 1F4XL 2P43B 2AJZB 3RHWF 5I8CA 1T0MA 1RK1B 3OPZL 1PDKA 3TH4T 1XZ0B 3G9AB 3ZDYE 4K3EH 3B2UC 2EEBA 5AZ2H 4IMKA 3FN9A 3X11B 4LARL 4OT1L 2GJ6A 4ALAL 4KDTC 4OLUH 1AGBA 4PJHA 5C0GA 5I8EA 1A6ZA 3AUVA 5FGRA 3HZMA 1ZA6B 5IG7B 3NCJL 1ODAA 1F3JB 5GGRA 3UJTL 2QQKL 4XPFL 4OI9A 2V2XB 4LGSB 5DC4B 1NGQL 4JY4A 1UWEL 4UAOB 1CI5A 4IIQC 4XPBH 4JFQA 5DD3L 4E41E 2FB4H 1G6RB 2VWEE 2EIZA 3MUGA 3ZL4H 2CMRL 3NZ8A 4PBXA 5C6TL 2ITCB 2FEDD 3H8NA 1RUML 3SGJC 1RK0B 2HA1A 1QSFD 3VGFA 1W72H 2GIYA 3RA7L 2AERT 1T7VA 2D4DA 3RKDD 4X0KA 3QZWB 3S37L 3GSNA 1KJ2L 1OTSD 3VCLA 4E42B 3IETA 4LHJB 4Y4HA 3N1PC 2XG4A 2R23A 3Q6GL 4K23H 5JOFB 4PYGA 3I9GH 2CKBB 3CDGA 5F6HI 4I0PC 3R06B 3TA3B 3O2DH 2HRLA 4DZBA 1IC4H 3ARBC 4EKXA 3BMWA 1C5BL 2NXZB 2YPVH 1F00I 4J3SA 2CLVB 5BXFB 1FGNL 4I0KA 2HJLA 5DURD 2A77L 1KCLA 4PB0H 4OD1L 3FJTA 4HD9A 5BS0B 1ZHLA 1D5ZA 5C0DA 3ALPA 2ADGB 2VNCA 4ZOCA 2UYLB 4M7LL 3OKLA 1J7VR 3O3AB 3T0EA 2VLKE 3QDMA 5DJ6B 3VFTB 3LZFL 1T66C 4X6BB 3IFLL 4U1JA 4LLUA 3P4NA 3D9AL 3RWCB 3VFGH 2H3NA 2GAZA 3V2AR 1EFQA 3CH1A 4K7FA 3BWUC 1LD9A 1MLCA 2B4CH 4IRJC 1IZJA 2HG5A 2OP4H 3QEUA 3MOQA 4P2QA 4D0DA 5EU7C 4EOWL 1A6PA 5DI8A 1FDLH 2MJWA 5H37H 12E8L 1Q9WA 2QL1A 4HEME 3ULUL 3MJ7A 3VD4A 1V3JA 3HNTL 4QXGL 3L3JB 5DRNA 5AYUH 2OSLA 3EW3B 4YBHA 3RTQA 3OB0H 5JA9A 4HV8A 2VDNL 4ZFOB 5ILTH 1O7SA 3WS3B 2D7NA 4WWKD 3VXPA 2Z31B 4IM8A 2A83B 4JRWA 1U8OA 5C07A 1OOAA 4YDJA 3VWKA 4L4VD 4LCWB 5I18H 5IJKA 4JVUA 4LLMA 4MZ3A 1HH6B 43C9A 4DGIL 4F9LC 4X7EC 3H9SB 2G2RB 4Y4FC 2D9CA 2PKDA 1S78D 2YBRB 2VABA 1WFTA 3UDWC 1R6VA 5ITFB 3VE0A 3ILPB 4MHHI 3CSYA 3CSGA 1Y0LA 2F54D 2OL3A 5TQ0H 1AFVH 2GHWB 3GDBA 1LO2H 3O3DA 5DJCB 3L3DB 4JHAH 3BRGC 3GBLA 1BBDH 4JDTH 3U36B 5HGBA 5ESAB 2V2WB 3P4MA 32C2A 4D8PB 5I30H 4GSDH 4K9EL 3TM6A 1C5DB 5GS0L 2GITB 5E03A 3PXHA 3DNKA 5DJ0A 5TH2B 4F58H 4APQD 3MOAL 2FGWL 5DR5L 2VZTA 1X5ZA 5HHNA 3NN8A 1YNKL 1FGVH 2H8PB 1AKJA 3TJEL 3UO1H 8CGTA 5JA8B 1JPSL 2P5WB 4HK0B 4KHXH 2AEPH 4KMTH 2GFBB 2FX9L 4JFHE 1CD1A 3RVWC 3V0VB 2EYSA 3GI9H 4XHJC 1VFAB 3UBXB 1MF2L 3QUZD 1KF9B 3EOTL 3IJSA 3RY6C 4S0SD 4Z0BL 3RWDB 2PTTA 1UB5B 2PO6B 2XICA 3CUPA 2NY4B 4GUPB 4WJ5A 4OCWH 4Z7UA 4OD2A 3OB0K 3DX6B 2IPKB 5ACZB 4O4YL 4OCRH 3X17A 3DVGB 3C08H 4QOKD 2E9WA 2AKRB 3OG4B 1VKXB 3EO0B 3HC3L 3FT3B 8FABA 3DRQA 1P69B 4NC1C 4QEGA 3MUJA 1T20A 3BW9A 4JVPA 1HNGA 3L5XH 1FNEB 3LKQB 3QWRA 4NQSB 5EO1B 1E4XL 2YSSB 3RUGB 4L8CA 4KVCH 2Y5TA 4GKSA 4NN6C 1IILE 4X4YB 4NO0B 1NAMA 1TMCB 4UOJA 4OCLC 2R2BA 2CLRA 2B5IB 4WI7A 4Z7UF 4FQCH 4FXGA 1IRAY 4IDJH 3X3GL 1CFQA 3DX9B 3EAKA 4JRXE 1KCRH 4OSUL 4RISL 1RIVL 4X9BA 4I18C 3T65A 1KCVL 5HTSA 1JTOA 3AMKA 3FB7A 4UQ2B 1AE6H 3KPSB 1SEQL 3MV8B 5TF1H 2BVYA 1UWGH 1JGVH 4TPRH 3BQUD 3IXAA 3QDHA 2X1XR 4BELD 2E7BA 3EZJB 1RFDH 1KTKE 1MFEL 1SY6H 2EDYA 3LRGA 5F1IB 4U1HA 2ZUXA 1JN6A 4JHWL 4NWUL 2IG2L 1A3RL 4Z7QF 2BNQE 2BZDA 4LMQI 4BSJA 5F6HJ 5JTWA 2CR6A 1G7JB 1GHFL 2XACC 2X4TA 4FQPA 1KXTB 2ITDB 4LEXL 3KYMB 4ZFGH 2V6HA 5D7LE 4PV9A 3J8F7 2FX8L 5EC2A 2LQRA 3VWKC 3MLRL 3KPQB 1NEZA 3OXSB 5GZNC 1GOGA 4HUVB 3VXME 1T7ZA 3GHBL 4ZTPL 2NY6D 1JUFB 1KIUA 4YAQB 4NO5B 3SDYH 2EKSA 4ZAKC 1MELA 4NGHL 3G08A 4N0FB 2FX7H 4LKCB 2DQIH 4B0MM 4JFOB 2WIIB 4XGZB 4YNYA 2IFFH 3TLRA 4EDWL 4PGCA 1A7OH 4AL8L 1YC7A 3VI4F 2O61A 5FO9B 3MACH 5D7SH 3T0XA 3D0LA 3FQXA 3CFDB 1NC4B 3X14A 5IKCB 3HA0A 3QXDB 1GCFA 2OI9C 1WLHA 3ECBA 4KAQL 3RX5A 3QDGD 3QAZC 4P49A 4ZO7A 2X4PB 4XNYH 5EU7E 4YFLF 1X6LA 4OFVA 3IXTA 5D93C 5DO2C 4OLXH 1N2RB 4CL7A 5EU5A 2HTKC 1NFDE 1I1YB 2ZKHH 3T04D 1UXSB 4AQ1B 3MV7A 4M61B 4NWTH 3CXDL 4DKEH 5D1XD 3H3KA 4IIQB 2N4IA 2N56A 5SWZB 1J88A 1W8OA 1FVDA 4M7ZB 4CUCA 3DO3A 2VDQL 1U0QA 5GSRA 1P6FA 1PSKH 4X6EB 5HYJB 4MZ2A 4RZCB 2ZSVA 3CVHB 4L8BA 1UZ8A 4PUBL 1CDUA 1MFDH 2EC9T 4WU7A 5ISZD 3IFNH 3PWUB 1QQDB 1IGML 2VXVL 2EXWD 5GZOC 4HUXB 3K4AA 3QEQA 3VW3H 1EGJL 5TFSL 3GK8L 1CE6A 1AJ7H 1BEYH 5CLWA 1XR9A 4YH6A 3QEGH 1X3DA 3NACH 5E2UL 3UP1A 5IVNA 5I1AB 3AAZB 4I3SH 4PRAB 4R0LC 4Y5XA 1KBGL 2IANA 1B4JL 3AM8A 4TUKL 4XVTH 4LPCA 1NCCL 1UACH 2K1MA 5E1AB 5CCKH 5IK3B 3WHXB 4RNRA 1YQ2A 4PGEA 2ZUWA 1S7UB 5HVHB 2GEEA 1CGYA 3OJDA 3QHZL 4F7CB 5CAYB 4JGMA 4ODUB 4GAJH 2YK1H 5DFVC 3MV11 5KJRH 2J3SA 1FZMA 4N8PA 4FZEL 2HN7A 3L3OB 3QNZB 4XMPL 1P4IH 1U93B 2VLJE 4PY8I 4KQ3H 3G5ZB 5DJXA 3T8XB 4GAGH 5D7KD 3PWPA 2ICWB 3WFCH 2PYEE 1BJ1J 2LFGA 1CGSL 2I9LB 3IS0X 4PJDF 1Q1JL 2GJZB 1HHGB 1XCQA 3T3PE 4MLIA 2FYYB 2EDTA 1SJVA 1MCOH 4FQXA 3EDFA 2DB8A 1ZXQA 2BXZA 2EYTB 5H37G 2BNRE 5HI5D 1KJ2A 4O51A 2Y06L 2JJUA 1TPXC 1D3CA 3BP5A 3JSSA 1PQZA 3GMNB 3PWLB 1YN6A 4YFDB 2AK4B 3DX8A 1UH3A 5BMFL 1WZMA 3QFJE 4JY6B 3PXJA 2BSTA 3BD5A 1P7QD 3QQ4A 4YHKL 2HT3D 5FF6B 4DW2H 4XMKH 4NKQB 2CJUL 4HIIA 1KLGA 1OGAE 3WIIL 4P2OB 4YBLB 1W0WA 5CMAA 5EZIL 1KTLA 4WEUD 4PJ8C 1XGYH 3B3IB 1INDL 5AZ2L 2RFXB 3PGCB 3GMRB 4NC1E 5GS1B 1MHEA 1HHKB 4J4PA 3WD5L 1G0YR 4D9RE 4LP4A 2YEZA 4PLNC 5I8KL 4RCAA 3L3HB 2F19L 3KDMB 1FV1B 5F71A 1A8JH 1NAKL 1HKFA 4RGMC 4PJCE 2AXHA 4XPBL 5KN5A 1T0MB 4W68A 2YA2A 2VMFA 5F7YC 2FB4L 4PG2C 2FL5A 2OS7A 3FL7A 3MO1B 4QXTA 1BFTA 5L88H 5I8OH 2W60A 1C8PA 2GJ6B 5HHOE 1BJMA 4PJHB 1AGBB 5C0GB 1CD8A 5I8EB 3IFPA 1A6ZB 2GQHA 3HZMB 4UQ3A 5GGRB 2AEWA 4NM4L 1E6OH 4Q6IA 4U1GB 1ZGLP 2PN5A 3QUKA 4JY4B 5DGRA 3ROOA 4KUCF 2IAMA 3GKZA 4JFQB 4K23L 1URLA 3I9GL 4PGBA 4WI6A 3LEVH 4PJGE 4X7TA 4N0UE 3PWNB 3ULUF 2EIZB 1IC4L 3MUGB 1TNMA 2VUYA 1NMBH 3BP6B 5IJVA 2FD6H 5DQ9A 1MFCL 3NZ8B 5KZCB 4YHLH 2V17H 4X83A 1H3UA 3S36L 4UOW0 5B21A 1J05A 1FBIH 2P5EA 4OGAC 2FBOJ 4P9HH 3DRTA 4YK4C 5JOEA 3WFDH 4NFBA 3ULVD 3VCLB 2V9RA 2BOBA 3IETB 4Y4HB 5GGVY 3TVMA 2R23B 1XGPA 1LMKA 1ZWIA 2I5YH 3VFGL 4FFWC 1CK0H 3CDGB 3O81A 4G6JH 2J8OA 3EO9H 5JHDA 4DZBB 2OP4L 2CK0L 2Z8WC 4AIZB 4LCYA 5T5NG 3WMSA 1I1AD 1UQSA 1QNZL 1ZHLB 1D5ZB 5C0DB 1YEJH 2BJMH 2VDOH 3OKLB 5AYUL 5C0ND 3VXUB 3CVIH 2DLIA 1PG7X 3LB6D 3T0EB 3QDMB 4J3XA 1MRFH 5F7DA 4BFBD 2Z8RA 2IQAA 1AO7A