4QHMA

I3.1 (unbound) from ch103 lineage
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
QVQLQESGPGLVKSSETLSLTCTVSGGSMGGYYWSWLRQSPVKGLEWIGYIFHTGHTNYNPSLESRVTVSVDTSENQFSLRLRSVTAADTAVYYCASLPRGQLVNAFFDNWGQGTLVTVASASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords I3 heavy chain
total genus 37
structure length 217
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhmA01
2R69L 2PNDA 3FFCD 3SDYL 2B2XL 5E2VL 2DYPB 2C3VA 5T1DH 3T2NL 1A2YB 1X6LA 2J8UA 2YD6A 3D3VD 3RJQB 1ZVSB 3GMQA 3BKJH 4Y4KB 1BVZA 3K2UL 2AJ3B 4M5YL 4Y4HB 4AZ8A 4I0KA 5CGYC 4XBPA 3HZKB 3QEQB 3U0PA 2A6IA 4JY4A 5H35A 4N0UB 5F9WB 2YPKB 4O58L 1A7PH 3RBGA 2R9HD 1MHPH 4WEMB 1R3JB 3RL2B 1HEZB 4TTGA 2E7LC 1MLBB 2XKUA 1BZ9B 3SDAA 5BXFA 3S5LG 4MXQC 4X7TB 2AK1L 2CIKA 4XPTL 3DPBA 3BD4A 2X4UB 2XNAB 5DHXB 4L4TD 2PO6A 4H25A 3BESR 3HR6A 2NY0B 3RWDB 5H94A 4NNXB 3GMMB 3VXMA 8FABB 3HMWH 5GGVY 4RIRB 4PJGB 4J3TA 4MLSA 2HKHH 1S7QA 1G9NC 2AABH 3QUMB 4MYWB 1DSFL 3KHQA 1PJ9A 1HWGB 1WWWX 1I3VA 1KTDB 1PX4A 2Y1VA 1RURL 3FB5B 3BVNA 3I02A 3BQUD 4UIMA 1IAII 2BMKA 4JM2C 5FKAB 4PV9B 1A1MA 4Y5XB 5DK0B 1YMME 3BGFC 5ICZB 1DQJB 2NY1B 2HH0L 4BH7A 4YHZL 1P7QD 1JVKA 1Z0MA 1S7SA 1L9NA 1CFNB 1T22A 3GHEH 1B6DA 1CDGA 1NMBH 4V2BA 3PHSA 3ALWA 3TBVA 2V7NB 4JPKH 1SJEA 5E94B 4OIAA 1F02I 1MH5B 4IIQA 3QAZB 5L7XH 5I9QB 1JNLH 1CK0L 4MJID 1QBBA 3RWIA 5EC2B 1RHHA 2ADIB 4I0PD 1W72H 2OX5A 3G08B 2Z93B 4U0RC 1FV1A 4K8RH 3H7BB 4Z7VB 1GCFA 2XPGA 4Y5YC 3OX8B 4MJIA 3P0VH 1IGYB 4OF6A 2DD8H 4FZ8H 4X4ZA 2HFFA 1N0XH 1QLEL 4PJAA 3JWDH 2ZNWA 2QQLH 1FH5H 5C0NC 4OZHF 1MRCH 1X5KA 4GQ9L 4ZPVA 2LTQB 2FGWL 4EIZC 1OGTB 2KDGA 3ARDB 4P46C 1J1PH 2HAZA 4IRSA 1J5OL 2MQCA 1QSFE 5BQ7A 4B7LA 1X9QA 4KWUA 2YN3A 3FOMA 2HTLD 4M62H 4U1JB 1UA6H 5GHWL 1F8TL 4XI5D 4K3EL 1LDPL 5HHXL 4PJEB 4NC1E 1KIQA 1RPQA 1JFQL 2FSEB 4KHTH 4PG9A 5KANG 3PHOB 4YBQD 1AE6H 3S37L 1RUMH 2DRUA 5HDQL 5I1CH 4Y1AD 3L9RA 4XMPL 2A74A 5BVJB 3I9GL 4X8JB 5FGBC 4YC2B 3QQ3A 4FQJH 3QDJB 4OUOA 1MJ7L 3OL2A 5KJRH 5HYQB 4KQ3H 3CVHB 5CP3A 5FOBB 3SGKA 5E24E 3LIZL 2FX7H 1AIFB 4E41A 1MREL 2RR3A 4I3GA 3V4UL 3WFDH 4HV8B 2FO1A 2ICES 2EIZB 3DV4B 4PJDF 1RHFA 5GISH 4P23A 1Y6KR 3BI9X 5K59F 4XVTH 3IKKA 4NQED 5HVGB 5DJYA 1CK0H 4MNGE 4UT6H 2YPLD 4JFPB 3VRLE 4MQ7B 2A6JB 3S36H 4ODXB 2OI9C 5D6DA 2AKRB 3MUGB 5FKAA 3NACH 1QFUL 3CXHJ 4FABL 3X3FL 1SJHB 2X4QA 4LSSH 3MYJB 4DGVH 3PWUA 1GZPB 1KIRA 5I66B 4OZGA 1FH5L 5J4MA 4MXQD 3VXPB 2Q76A 3MGOB 5EA0H 4X4YB 4Z76A 2V5SA 5ADOL 4NWTL 1KEGL 5E56A 3OQ3B 1IBGL 1JMXA 1WFTA 1VFAB 4ZD3H 1IQWL 3IF1B 1FE8H 1P4BL 1MRFH 1QPXA 4RGOL 2NTFB 3KPLA 3LEVL 4ZO8A 4L3ED 1MFCH 4AT6B 1ONQA 2VLJA 4WI7A 5D2NC 3QSKB 3DX8B 3INUH 5LGHL 3LPGA 4LHUB 5DUBA 2PYED 3D69B 5EU3A 5DJ8A 1TTGA 3C60C 4Z6AT 4YZFF 1OAXL 2V5RA 1DUZA 5GZOC 1MF2L 2NY4D 3VWJA 2Y07H 1MCOL 1I3UA 1IFHL 1LGVA 1A7OH 4POZD 4O58H 3VFVA 2R1XA 2W38A 5FO9A 3TO4C 3U1SH 1N4XL 4KFZC 2HMIC 5E2TL 3UYPA 1FZMA 1BD2B 1XGPA 2XQYG 5HY9A 5CMAB 5B8CA 2R56L 2LFGA 4YXKH 3WIFB 5LGHH 1OGAA 4TRPH 3RX7A 5CSZA 4CJ0A 3PWPE 5E6ID 4XNQA 4JG0L 4G80A 1X44A 2AJSL 3DRQA 1QYGH 1IGCL 4TNVF 5D2LF 4HV8A 2WINA 4OF7A 4P3CL 3QI9D 4OV5A 1KC5L 4R7NA 5F9DC 5TFSL 5ILTL 1FLRL 2XZCH 4KRPD 3FT2A 3OKNA 4K94C 3LCYA 1VB9A 1OPGH 3BAEH 3RPIB 1NKOA 1WC7B 5GGVH 4P2OA 3KPMB 2OP4L 2VRAA 4XCFH 5F6IC 1BFOB 1MI5A 4BJLA 3VI4E 4S1QL 5B38G 4Z7VE 2QHRL 4PB0L 4YR6B 4ORZC 3DUSB 4KKAC 1BX2A 3MV7A 3QUKA 4JJ5B 3IDNB 2XRAL 1JWUA 4MCYB 3DX9B 2WWKO 4MNGA 5HVWA 1D9KA 1W72B 4OJFH 2V17H 4GXVH 1FN4A 2VOTA 2XZZA 4NRYA 5IP4A 4U1JA 2ESVD 5IB3B 4NQSA 1FFOA 1IGFL 5ISZB 3DUSA 5L2KA 3SKUD 4FTVA 3O9WA 4M7JL 1RVFL 4GS7B 4P5TB 4QHKJ 5CCKL 4TTDC 4OZIE 1YC7A 5AZEH 2IBBA 4H26A 1CVSC 4TSAL 5ERWA 2QKIA 1WZ1H 4XBGA 4TVPE 3S5LA 2EDXA 3KXFE 3U30C 1NMCC 1QLEH 4PJBE 1S78D 2A2QT 5D70H 3WUWB 4BKLA 4JO3L 3WKML 1VFMA 1PFCA 3EO1B 3M17A 1CFVH 1TZGL 2J6EH 1B2WL 1RVFH 3PXHA 4PLJD 4DK3A 3RL1B 1KLGB 5CJ8A 4Q6IB 2HMID 5T5NG 5F8QC 3QO0A 4YPGB 3CH1B 4NKMA 1V3MA 3X11A 5EO0B 4HWUA 1VESA 5DRWB 1UC6A 4MQTB 5HHXH 5K9OB 1MFEH 1FJ1A 1T7WA 3UBXG 2ZSWB 1KG0A 5BW7A 1CFNA 4M43H 4QXUH 4U1LB 2IMMA 5E4IA 3CLEL 3QEUB 2UY7A 1OAQL 2PW2B 4WDIB 4HUVB 1CLYH 3PQYE 1TVBA 3OHXB 1EH9A 2D03L 4F2MA 3GBMH 4GMTL 3G6JE 5FYJH 5IVZA 4Z0BH 4OD3H 5C86A 3H7BA 4UU9A 3WFHB 1ORQB 3TVMC 2HLFD 2G75B 2Y6SD 2Z93A 1HHGB 4FQ2L 3WDIA 2QR0B 3DRQB 5GSVB 2ARWA 1I1RA 1EO8L 2Q8AL 3LRGA 5C0JB 3D85A 3OAYH 25C8L 3CFJB 1RUPL 3EFDL 1F4XH 3QI9A 3IDIA 3BH8A 3HE6B 1RIHL 3NTCL 4HUUA 4K7FB 3MUY1 1SEQH 1CL7I 4I3RH 5DK2B 4JDVB 1INDH 2G9HA 1MUJB 2Z35A 3IAQA 1ZT1B 3U0PB 4XX1E 1MIEL 1NBQA 1UGNA 2X4RB 1KLUA 3FOLA 4KVNL 5JQ6H 3MCKB 1Y0LA 1JRHH 3IU4H 3GIVB 1CLZL 5FHAL 1WSST 4ODUB 2V9QA 2IG2H 1CFVL 2IBGA 5CD5C 3DV6A 3TIDA 4XB7A 35C8L 4UB0L 2G2RA 2P5WA 3LB6C 1QSEB 4RIRA 3OMZA 3QDJA 5CEYB 1RK1B 4KTDH 3IU3A 4ODUA 4G8GB 5C0FB 4PJ8A 3P4OB 4Y4FA 3S88L 4HT1L 4N8PA 1KENH 5LXGL 4OZIB 4KUZH 1UYWH 5JHLL 2JIXA 2ICCA 1EFXA 1NC2A 1JK8A 3BOVA 3QPQD 1ZHBB 1XH3A 3FO1B 4V1DA 1X4XA 2EKSB 4MJIE 5HYSB 5GSRA 1DLHA 3EOTL 1QFWL 1T0MA 1PDKA 2EDRA 1WEJL 4MQ7A 1F3DH 1NAKH 1C1EL 3GNML 1ZTXL 3U7YL 2XKNA 3H3BC 4K55A 4N8CH 4U0QB 4UMGA 2I9LA 4QHUA 2XN9E 5E2UH 5J3HD 5I18H 1FORH 1HHIA 2VXUH 5C07B 4DZBB 3DYMA 3MOAH 1OTTC 3MLZH 2B4CH 3QRGH 4PGBB 2MCPL 3TNNB 2B39A 3MLRL 4WWKB 2R23B 1P7HL 1T1ZA 4MMZC 4WUKL 4OLVL 1LEKB 4LVOC 2X09A 3QHZH 1B0RB 1L7TH 5DD1H 5DJ2A 3TN0B 4WDIA 1CN4A 2MPAL 2LU7A 3IFNH 3ZT5A 2AJXH 4KI5F 2AJZA 2PTUA 3IXAB 4XCNB 4S1QH 4XP5H 2E7BA 5I73B 1UB6B 1KN4L 5F70A 4TPRL 3D69A 4XNUL 1A3QA 2CXGA 4NZUH 5F6HI 3CFKA 4FFZL 5EZLA 4YPGA 2D7MA 3I6LE 5JW4Q 4HJ0D 2XWBA 4R90L 4WTWA 3RDTB 3SEPA 3FT4B 4WWKD 2AW2A 4F3FA 2D7TL 2XZQL 5ICZA 4HWBH 1ZA3A 3VXNA 4EXPX 3R06A 4UBDD 4Y5XA 3FQNA 1BIHA 3SGEH 1IJ9A 2FLRT 4F7MB 3CD4A 3BZEA 5GRZA 2P1YA 5JOPE 3OKKB 4M1CC 4D9RD 3QYCA 4DGVL 4DW2H 3DX6B 2UWEA 4F7TB 3MRJA 3V2AR 2P5WE 3FQNB 2HG5A 4C56A 4HQQL 1DBBH 3L1OL 4JO2H 5KN5B 4JR9L 4WVRA 4HXBH 2NR6C 4EIGB 3F12B 3RUGE 1D5IL 4FQXC 3QIWD 3B9KC 4L9LA 1NCAL 3QDGD 5L0QB 4PRDA 1H5BB 4HIEA 4RFNC 4YR6A 1A7NL 4K94H 3DMMD 5DK3A 2I60L 1JWUB 1C08B 4JQIH 2VLJE 1D6EB 1FZJB 3KPSE 5J1SC 1OAXH 5MENE 3GUTA 2D31A 1VGEH 2JELL 3BYTA 1P69B 3RBSA 3P30H 1FRGL 5T3ZE 2FX8H 1OAUL 1SYSA 3GSXA 4ZFOL 3KPNB 1KNOB 2W9DL 1JZ5A 1H5BC 1ACZA 4M1GL 2OL3A 4OZGE 3L95B 5FYJL 2E6JA 3BPOC 1L7IL 4F15B 3CPLB 1K4CA 5C07E 4G7VL 2AS5M 4UTBH 4H20H 4LLDB 3WNMA 1JTOA 4FFZH 1A9EA 3CGTA 4MAYC 1HHIB 1KCRH 3LEYL 3G5VB 4LSRH 4XBEH 1P1ZB 3IVKA 5I76A 2BNRA 1ZLVH 3DECA 2QTEA 4MJ2A 5EZJB 2XNAA 1A6WH 5INDA 2NYYC 4WUUA 3RVTD 1EZVX 2I26N 1INDL 2JK5B 4Q6IA 1PLGL 4J1UA 4V1DB 2GQHA 2ICEB 4RGNB 3UTTB 4LRIA 2ZUWA 4X6DA 4M61A 3EYUH 2ZOLB 4H8WH 5JA8B 3NCMA 5IVOA 5D71H 5IF0B 2GYSA 3H3PH 1MAJA 4NM8L 2H8PB 1QFWM 3HNSL 3QG7L 5L2KD 2FATH 3F8UB 1RZIB 5HYJD 3ARED 2D9QB 3T0AA 3MRPA 1EAPA 3I6KA 2GK2A 1CDBA 4CMHB 4EOWH 1HSBA 5ESQA 4NKOB 1JBJA 5T1DL 1T1WB 5L9DH 3GIZH 4K71B 3OHXA 1KYOJ 4QHKI 4PJ5A 1GZQB 3ARSA 3SPVA 4KKNA 4TULL 3HFML 5I1DA 3WFBL 4NBXB 3ILQD 2I9TA 4PGJA 1N6UA 5IWLC 2XWTA 5GZND 4N5ED 2VLKE 4DUXA 4UTAH 4PR5A 1GH7A 1J0JA 3IXAA 4LARL 1FNGA 2BY1A 4AMKL 2HT3D 3KYOA 1LMKA 5JW3H 4QT5A 1T3FA 3WN5A 3HE7D 1NGPH 1ZEAH 1DQLH 2R8SH 5HHPA 1U3HC 2OTPA 4M7KH 1ZOXA 1WFNA 5GRXG 3SDXE 4XX1G 4HUUB 4L8CA 4HMEA 5EBWA 1LK2A 2WMPA 2R9HC 5DD5H 4OCYL 1J10A 3QP3A 2F8VA 1Q0YH 3L95A 4ISVA 4OFYD 3V8CA 4DK6A 2R0LH 2IQ9H 5BS0B 4CDHA 3ALXA 4PY8J 3CX2A 4FZ8L 4D8PB 1O0VA 1XEDA 1ZA3B 1A6VH 5CGMA 5F7EL 3BP5A 3IT8D 3JTTB 1NGQH 2HFEB 1U2HA 4L9LC 4K3GA 1AGDB 5DJAB 2X4OA 4PJHA 4XPAL 1N6VA 3B9KD 4Y5VA 4EJ1C 1OW0C 1YMMD 3GI9L 4HJGB 5IMMB 6FABH 3WV0A 3VJ6B 5BS0A 1RY7B 1TVHB 2ILLA 4AL8L 2BVOA 5FXCH 3OF6A 4YWGL 2A9ML 2HG5B 1HXYA 4WEUD 4OD2B 1YECL 3C5SA 4X0KA 3H3PL 4KDVA 1Q9OA 1FYTD 3LY6A 1KN4H 4XMKH 1JV5B 3QUZC 1I3GL 4WRLA 4RFOH 4G8GA 5GGQL 1JGDB 4QWWC 3UJTH 4L4VA 1NGWA 1CQKA 2C7UB 3ARYA 4ALAH 4OGYH 1T20A 2HKFL 5T3XH 1LO5A 2NW2A 2NY2D 3WS6C 5J0BA 3ZKXC 4R90H 1I9JL 1JGEB 3HA0A 1P53A 4WWKC 4ELKB 1LO0L 4OIIH 2OP4H 5D1QD 3UTQB 1NANI 3QEQE 3H7LA 4KZEL 3KPMA 4LP5A 5IW6A 1MCHA 2DD8L 2ITDA 1F00I 2XKNB 3CU7A 1O7SA 4M3KB 1NFDA 2OL3B 1EFQA 5I8KH 2D7PA 2IPKA 3TZVC 2PYFB 1I9RL 3KAAA 3O41B 1BIIB 5CKGA 3MLPA 1OLLA 2WQ8A 2YUWA 5JOEA 3MODH 5DD0L 3RGVD 3EHBC 1TZHB 3ARVA 3MYJA 3EOAB 2O5YH 4UI2A 3RDTC 5CZXD 2F8XC 3BEVA 4AEFA 1GAFH 3VMNA 3NACL 3QZWA 2XYCA 1UEYA 2G75A 3VD5A 1E27B 2CLZB 2R39A 4C55A 3TZVB 1QR1A 1IAOA 3BPLC 4GH7B 4NHCH 3THMH 5SX4I 1XGRA 2YD1A 3MJ7B 4M6NL 1F11B 1AC6A 1FL5A 3D1MC 3BO8B 3CZFA 3OJDA 1AO7D 1WZ1L 4LSQH 1P4IH 2VITB 4E41E 3KPOB 5T1KB 2E7LA 4LHUA 1DQQB 1QP1A 1I1AC 3RIAK 2XZAL 1YEFH 4Q74A 3SKOB 4O2FB 1AO7E 3OR6A 2Z8SA 4WTZG 4Y2DC 5HHOD 4LLQB 5FUOL 4HIXH 3H9ZA 5J12B 3VXQB 1ZTXH 2MKWA 4NWUL 5EU4B 3V5KB 1F2QA 4LL9A 1X4ZA 2ZSWA 3QO0B 4JRYD 2NY6B 4OM1L 4ZUUB 2MSPA 3O2VH 1FBIH 1KF9B 4OZIF 2EE9A 2WIMA 2NNAA 3VFRA 3BWAA 3B8SA 4ONHA 2FEEL 3WEXB 4P5KB 4WENB 2F8OA 4YDLC 2KZ1B 4ONFH 4PRHB 2X89A 3UPCA 4OIIL 3CSBA 3C09C 5CJXA 2CGRH 4XHQA 5CSZB 4Z7OF 1W8OA 2P5ED 2I07A 3PGFH 1WV7T 1U58A 3D2UA 5C0IB 2NNAB 4M3JA 3SCMD 1YC8A 3GMOB 4G6FB 4HIEB 1ZHLB 5C2BH 1CFSB 2FYYB 4J6RH 5DMGC 1EK3A 2OSLB 2GJ6D 4FQ1H 4M7LL 1MAKA 1KYOK 1NC4B 1REIA 2W9EH 4XP5L 3B9DA 1EXUB 5IQ9A 1DVFC 3H9SE 4OD3L 2OR8A 4KMQA 4P23D 4K3DL 2EXYD 1HI6B 2J4WL 3AU1A 1IGJB 1ZVSA 3GMQB 4GUPA 4I3SL 4L29B 1N64L 1HDMB 5CZVH 3ROLA 5L88L 1RUAH 4NO5B 1ERNA 1VGKA 3WBDA 3C5ZB 1A7PL 3LRHA 5EPMA 3LVEA 5EO9B 1HZHH 3INUL 3OKYA 1R0AH 4EDWL 1WJ3A 1T2QL 1F97A 2MQ0A 4WU7A 5JO5A 1HKLH 4OCMC 1A5FL 3O3AB 2ZCLH 4HUKB 1A7OL 3SKMA 4ZOAA 4OD2A 3I85A 4R4BA 2WAHA 1GZPA 2PETA 2XZAH 2DQIL 1E4XL 1DVFD 1TENA 4MA1B 2PTVA 2VABB 1IRAY 2AK4E 4JPVH 3OG6B 4IRSD 3LKQA 2DQHH 4FXGB 5MI0C 1GGTA 1U8OA 1WIOA 3QB7C 4JY5L 1TETL 2IPTH 3N1FC 2ENYA 3GSQB 2DQFA 2JJUA 1JHLL 1RK1A 4YHOH 4NZRL 1WZMA 4Y16C 3QXWA 4KPHH 4OAWA 5F96L 4YBLB 4NHUB 3GI8L 4ZQKB 1I1AD 3RL1A 1PQZB 1WFOA 2RBLA 1VKXB 2EDKA 2ORBH 4MX7A 4LVNC 1MCPL 1FZMB 4BZ1L 2W9DH 4J6RL 5JW5A 1TQCC 3PJSB 3MUHL 4N1EA 3ULUE 3TT1H 4NQDE 3DHJA 1YEGL 2VLKD 1P5VA 4FFWC 3WHXB 1HNGA 5I6XC 5GGQH 2VXVH 3FN0L 4FP8L 4HDIA 4NPYB 1F6FB 4G7VH 2VB5A 5K9QG 3BKYL 4OJFL 1QA9B 4PG9B 1R3LA 1N64H 3VMPA 5EUOB 4JRYA 4MNQA 1UACL 3F6IA 4RGMB 3PGCA 4AENB 2CRZA 2MHAA 1S7SB 4JFOA 4LLUA 3Q48A 4RSVA 3B9VA 3DO7A 1JNNH 2O5ZH 4FA8A 4PBXA 2GCYB 1T7XA 4O2EB 1M4KA 5IB2B 1QFOA 4HJJH 3RWGA 4BSVA 1FFQA 4L9LB 3EO0A 4N1CA 1IM9D 2D03H 3VXPA 5CKAA 5I2IA 4NFDA 4N90D 5DD1L 5J6GB 2Z8VC 4U6HA 1DQQA 3D25B 3O2DA 5MEQB 2JB6A 4QLRA 1E4JA 2C1OB 1MI5B 3N1PC 1ZANH 3KYMB 3TH2T 5D1XD 1H3PH 1EJOH 3JWOC 4FQIL 1B9ZA 1BFOA 3FO2B 1CQYA 1C12A 4P57B 5AZ2L 4K3EH 1OSPH 2EEAA 2FATL 3HZMA 3P0YL 3WS6A 5DURD 5KSAB 3IAPA 1EGJL 3SE9H 1NANH 3EDFA 4PJHB 1SMOA 1OP5H 2VDNL 3WSQL 3Q1SL 4WI8A 3WNOA 5CAYB 4OF0A 4CVZA 4EQ3A 3P73A 4AH2B 2I07B 5F93C 1NDGB 2FO4B 2C3HA 4X6BA 3S98A 1A6UL 1A3LL 1TZIB 1S7RB 3FB7B 4NDMB 4GAFB 1OP3K 4W4OC 2EH7H 2RCSL 2Y7QA 3FT3A 4EN3C 2AEIT 2E9JA 2DIAA 1NJ9A 1OW0A 3AS1A 2JLLA 3P11L 4JRXA 3EYFA 5TDPB 3TIEA 3VGAC 5BV7H 2JJWA 4Y4FB 5E9DD 2VDMH 1BQLL 5E1HB 3SBWC 4QRRD 4S0TD 3MCG1 4BFGA 2Z0BA 5KSBB 5MHSD 4NFBA 3KYAA 4JRXD 1RZ8A 4BSJA 3BN9C 4ODTL 5EORH 5IB4A 5BRZD 3RI5F 1DUZB 5T5NF 1RD6A 4YK4B 3BH9A 1NCCL 3W9DA 3KS0H 4JFEE 5FAAA 4U1HA 1RULH 3VGAB 4P9HC 1MLCA 4WI5A 4YQXH 1I1FB 3VW3L 1E6OH 3LSOB 5BV7L 1JCKA 4U1GC 4R26L 2M26A 5SWSE 3UAJD 3D87B 5K9KA 1T4KA 4LLUB 4XWGL 4O4YL 1FYTA 2AGJH 4PJXB 1U8QB 2EE2A 2A77L 4DVBB 5CEXB 2AV1B 2QSQA 3BEVB 4YWGH 4JRYE 1I7ZB 1II4E 1RZJC 1KELL 3C5JA 1G7MB 1EHNA 2AK1H 3RWFA 3VFMB 3F58L 3MNZA 2YMXH 4D9RE 4TNWF 3PWUB 3UYRL 2C5DC 3HE7B 4CU7A 2W0PA 1CF8H 1KUMA 2X44D 4OBSA 3CFEA 1BJ8A 4H26B 4YEFA 5MEND 3IDGA 1AHWC 1AC0A 2Z31B 4E9LA 1GPOH 1JPGA 1RIVL 3HB3D 1EA9C 5HD8D 4JN1L 3L3JB 3EOBB 1PLGH 1XAUA 2DWEA 5KAQG 3GB7B 4XNUH 3CFBA 2IGFL 1U95B 5F7LB 5IT2H 2CKBH 1F3RB 1MCFA 5FYLH 1P4LB 3T0WA 4JKWA 1GJIA 4ONGL 4QEGA 1JWSA 3AAZA 1U58B 3GSOA 1U8KB 2Z31C 5C0RH 2D7NA 2F54E 1N8ZB 2J7LA 2VXQL 2YOCA 4GBXD 2BY0A 3RGVA 2V2XB 5CZKA 3B5TA 2ZCKL 3CXHK 5CWSB 4PJ5B 5I8EA 1KIQB 2XIDA 1TDQA 3L5XL 4HCRH 3G08A 2ZOKA 2V5TA 4UOW1 3WFCL 1CD8A 2B1AH 3BZ4A 3J8F7 2RJMA 5I17A 1LD9B 3CVHH 5LJYH 3T0ED 3L7FA 4XAKE 3O2DL 1QOKA 5FDYA 5DO2D 1HDMA 1OTSD 5FYKD 3BGMB 4NYLA 4POZC 3NCYP 1TIUA 1Z9LA 3QCTL 4FHBD 1IAKB 1Q9KA 1RJYA 4DUVA 2HWZL 2XA8L 2YA2A 4QGTA 3C6LD 3MLSL 4I48A 1CGUA 4C59B 4OM1H 5KSUA 3GM8A 5F7HA 5IBTH 4LLVB 4K2UL 1CICA 4U1HB 3DSFL 4IOFD 4LMQI 3H0TB 4TSAH 4Z0XA 2HFGH 3VXRD 3WXVH 4HULB 5IB1B 2VYRE 4ONFL 1UG9A 5ETUA 5IM7B 1VADB 1YN6B 1KJ3H 4LLDA 4JFZH 4I2XE 2PN5A 3GHBL 5J7CC 4MWFB 5D5ME 1Y0LB 5GGVL 2J8UF 5GS0D 5KVDH 2R1WA 4JLRA 2BZDA 4G6MH 1EEQA 1UB6A 3LEXB 2FRGP 5KS9A 3RAJH 4Z76B 4YXLH 3W0WB 5CBAA 1G7PA 4G8FB 2BSTA 2AJZB 3CFDA 4LPCA 4P59H 3U46A 3E0GA 2FHBA 4MWFA 5HI4D 3PABA 1D7FA 3ZSTA 2ZOLA 4XVSL 3IFLH 1YNKH 2R4RL 3UMTA 3FJTA 1G1YA 3NA9H 5FYKH 4ODXA 4PJ7B 2WK2A 2NY3B 1XF5A 4PJ8C 4JG1H 1UWXK 1Q94B 3KYNA 4KY1L 4KQ4L 4MD5B 4YX2H 4C56D 4KJWC 3HC0B 2ZCLL 1LP9A 5EDXA 3UEZA 1H9VA 1K6QH 2GTWB 1L9MA 3CLFH 2FR4B 4JFOB 2VLKA 1VENA 4S10A 2MHAB 1TZHA 3MRJB 1EMTH 1I9RH 3O6ML 2QEJA 1I7RB 3FB8A 4XPGL 3QEUA 2R4RH 4LNVA 3PDOB 3HE6D 4JFFB 4DGIL 4YFLI 3RWGB 5HTSA 1IGYA 4G8EA 4PFEA 1FE8L 1P4BH 1R3IL 3IDYC 3THML 4LIQE 1T5XA 3GJFB 4NM4H 4Y4KC 1BQHA 2IH1A 4K8RL 2G9HB 2YR3A 5E6ZA 4IOFC 1J8KA 1X5ZA 1R5VA 1IGIL 1ZT7A 5DQJA 4B5EA 1JPGB 1F3JA 4JZOB 4KKCC 2D31B 3BIKA 1XF3A 4Z5RB 3VXUD 2G60H 1RFDL 1IE5A 1FVEB 1X5YA 4N8VB 4JZJA 3TBSB 4WU7B 2R1YB 5BQ7B 5J89A 1AQDB 4XPFH 2KPNA 4U6YB 1T89A 3CX5K 3V9FA 4EI5C 2NY7L 3QBTB 5JHDA 4NM4L 3OR6B 4QF1A 1L0YA 4G9FA 3RAJL 1G9NH 1IAKA 1Q9KB 4HUWB 4NQXB 4R97C 1UZ6E 5GGTA 1B4RA 5E03A 4J4PC 5D1ZA 3KR3H 1YEKH 5I1EL 5GS0L 4MQXD 3IFOA 1RZ7H 2VUYA 3D39E 2J88H 3TJEL 3TWCH 3TESA 4AG4H 1ADQL 4N0YH 4MS8C 3PL6C 4C83A 2CD0A 4XC1L 1CLCA 3BMWA 3FONA 4LHUG 1KPRB 25C8H 2MTPA 3EFDH 3GSQA 1R3HA 2V2WB 4JM2B 3K74B 4EBQL 5DZOA 1KC5H 3RNKA 3NN8A 3CCHA 3BZ4B 4KJQC 2YA0A 5IW3A 4ENED 1BQHG 4KY1H 3P77B 4XPTH 5EO0A 3QIUA 1OPGL 4U1IA 4DZ8B 1EEZA 4LVEA 3C8DA 2YN5A 1RK0A 2W60A 5IB4B 2X4UA 1BZ7A 4XP9H 1QRNE 5J6HA 5IF0A 3O6FB 5K9JH 4JFHE 4PPTA 4O9HL 5C09E 2APTA 1HK6A 5J06A 4U7KA 3UJJL 4PJ8D 1A64A 1JPFB 2UZXB 2W1NA 3MC0A 3VGGA 2P47B 2GFBA 2A9NH 3DURA 5C0AD 2ADJB 1FG2A 3MRHA 3OF6D 5D2LA 5TDNB 5C0RL 2AKRA 5I74C 3PP4L 1JE6A 3CC5B 1R3IH 3X3GL 3TH3T 4LAQH 3TT3H 4PREA 4B41A 3QHZL 2AEQL 3ZE2F 4JFFA 5D72H 4YHLL 3N1MC 1AH1A 4NRZA 4CVXB 3MGTA 1AHWB 4FN0A 4PV9A 5DK0A 4P5TA 3S4SG 4HWZB 2X9YA 3U9PH 3QCVL 3VWJC 4QXTA 4NKDB 4JPIB 5CJ5A 1QZ1A 4X9BA 5C0CE 5A2IH 1LP9B 2X05A 4WO4D 1CFBA 4ODWA 3TBYB 5DQJB 3T0XA 1MJ8L 2CUIA 5FO8A 2XICA 4HUNB 2CLVA 2LTQC 4OD1L 3SOBL 1EHLL 1E27A 3VXUB 5I0DA 2W65A 4L4VE 2AEWA 4U1MA 2NY7H 2CUHA 4PJHF 4JY5H 2EZ0C 3GBNH 3G6JB 4ZUVA 4YDKL 3MR9B 3VWJB 1XIWB 4JPVL 4MNHB 1AO7A 4WTZA 4LCYB 4L8SC 1MVUA 3V79C 1Q9LB 2A6IB 3C6LC 1FPTH 4JY4B 3ZE1F 1R5VB 3F7VA 4XNZC 5C71A 4YHIB 4ZUSA 3C8KB 4Z7WE 4ZUVB 2VZ1A 1CLOL 1RZKC 1I8LC 4PJDE 1CD0A 4M8VA 3O6KH 2EYSA 3KPRB 1P84K 3T0EC 2PXYB 2VISA 1S9WB 4PRID 5E2WL 4I4WB 4L1HA 2V5MA 3SDYH 3MLXL 4YZFE 1I3RA 1OM3H 2OJEB 1BLNB 4JRXE 3QG6B 3G5YB 4OLUL 4F7MA 3WJLA 1UM5L 4NJ9H 1NFDF 4OKVA 2Q7YB 4GJTB 2Q86A 1T5WB 4BSVB 4BFIB 1RHHB 4GT7A 3LOWA 3SKNA 4Y8AA 1U92B 2HJLB 3FQXB 1T03L 1Y18A 4H5SA 2PXYC 4MJ5B 4XMPH 4APQC 4X5XA 1FRGH 3P9MA 1CFQB 4KK8C 4WI3A 4JFXA 1X5LA 3W39A 1E6JH 2MOVA 3NTCH 3VXOA 3SQOH 4PTUA 1WWCA 3EO9L 1D5MB 5CBEA 4NKQB 4YDJA 3V4UH 1RZIA 2E7MA 4D9LH 5D7IB 4KRPC 3ZSSA 2AJ3A 4NUJB 4P5MA 4KKBD 1UM6L 4HQQH 3UO1L 4HIXL 4LDEB 2QKIB 3P0YH 4RDQG 5HI3D 4NQEB 3UZEA 5E4EB 1GGCL 1S3KL 2YBRA 4UV7H 3RWFB 2ESVA 3SDXF 1KULA 1PZ5A 5E6IC 3ZL4L 5C0AA 1S7TA 3UTZB 1G7JA 4H0HB 4Q9QH 2ZKHL 4LSSL 1K8DB 1LO4L 3F7QA 1GIGH 1MCLA 1CDHA 3P9LB 1LK3H 1XZ0A 4KRPB 3EYUL 5T5FL 3W9EB 3U83A 1TTUA 4GMSL 3MOBH 3NCCB 4H25B 1BQLH 4XZUA 3GM0A 1E4WH 3TM6A 1TJHL 4WY7H 4PS4L 5JXED 3U0WH 2VDOH 3IFPA 4NKMB 3SY0A 4I0PA 4M6OH 1FNFA 1MWAB 3MOQA 2ATKA 5J1AA 3KPPA 3QHFH 4H1LH 3C9NA 3GSNB 4OLYL 3RVUD 4OUUA 2YD4A 3QJHA 3TBWB 3VWKD 2R0WH 4DOHB 4G3YL 2BX5A 5A2FA 5LQBL 1F90H 4ODSL 5D4QA 1JWSB 1M05A 4MSWB 4UTBL 2VXTH 5T5FH 4RCAA 4XTRD 3I2CL 3PJSA 1DEDA 2F54A 4OQTH 3VDAA 3OGCB 4LSRL 1IL1B 1IEBB 1NCDL 4CU8A 1GGBL 1RULL 5EWIH 1KCUH 1DSFH 2FHCA 1E6JL 1JTTA 5FUZH 2B0SL 3I6GB 4OLVH 1YJDH 5IBUG 1U8HA 4LHUD 1I9IL 1WISA 1CFQA 2NR6D 1BQHB 3R8BB 1DN0A 5DUPL 1ZXQA 3JV4A 2XG5A 5CJBA 5E5MB 5JPMB 1M71B 1GOGA 1DL7H 3IAGC 1KTLA 2A73A 4M4PA 2FLBT 4XPHL 4NGHH 3QZWB 5JR1H 3MRKB 1I75A 3AY4C 1JNNL 4IJ3C 3OR7B 4J3SA 4X80L 4R7DA 3NPZB 3S37H 1M7IB 4GRLC 1FNEB 5JMOC 5C0GB 1DQMH 4KPHL 2DDQL 3GRWL 3O8XC 4DQOL 4JM4H 3FOMB 5DFVC 2DBJA 3P2TA 4KXZH 5GGTL 1I9EA 3VXRB 5GRUH 2H45A 1YEJL 3K4ZA 4G9DA 5FHAH 3CLFL 1OSPL 3C08L 3QNYB 3V6ZB 2FZ3B 5FYJU 5BXFB 1NLBL 4AIOA 4DW2L 2R69H 5F3HA 3P73B 1IQDB 1HXMA 2BY2A 4APQA 3SCMC 4XNMA 3DX7B 3LKSB 2BFVH 3L3HB 3OZ9H 4Q6IC 3AC0A 3BGFB 3VGEA 3ARGC 3LV3B 5MERB 3VG9C 4RZCA 1I7UB 1ZSDA 2CKNA 1FFPA 3ARDC 2JJSC 4S1DD 2M1KA 4G7YH 1BHGA 2YK1L 1T89C 3MRRA 4JRXB 5IW6B 1F4YH 2DQJL 1BFVH 3D2UB 1IGIH 1QFPA 1C5CH 4Y7MA 4YE4H 5DRNB 1NBVL 1AIFA 1RJZA 3SCMB 1KBGH 4YAQB 1JGEA 4HPYH 3KJ6H 3I3DA 3R1GL 1Z6JT 2P5EA 3NABH 4ZD3L 4PREB 4JPWH 4YDIL 3RWEA 3ARQA 3HN3A 5IOPB 3TBWA 4NKIH 3O45B 3MJGX 4XMKL 1OP3H 3WIIH 1NLDL 5JHDD 1S7WB 3NZ8B 3ZDYF 1R5WB 2VWEC 1A21A 4PRPA 5DJDA 3PDOA 1RZJH 32C2A 3C6LA 5BOPA 2J88L 3KXFA 4X80H 1JZ7A 2R4SH 1T80A 2DLIA 1DLFL 1MCDA 2Z92B 1I9JH 4XCNA 1YQVH 2VITA 1F5WA 3BW9A 3NMEA 4QHNA 4NO2B 4Z7WF 1I1YA 2X41A 3GRWH 4HBCH 4L3EA 4Z7UB 5ACLA 3U82B 1QBMH 4JJ5A 4AEHL 3ARUA 2A0LC 3MLTA 4UV4H 5A43C 3D85D 5F9OH 2GY5A 3STLB 5DHVB 4DKDC 1OSZA 1MJUL 4WGWB 1JFQH 3BQUC 3LH2L 3L3DA 4JPKL 4OCWH 5BO1L 3U4BL 2H6PB 1JGVL 2OXHA 3R06B 5I1AB 3MRGB 3BWUC 5JHDE 5K93A 4G9FE 4P3CH 3O3BB 2Y06L 3MRPB 5F7DA 2OQJA 5BV7C 3GFUA 3CFBB 4JG1L 2VNCA 3MV01 5B21A 3GDBA 1WCBB 1NGZB 1HQRA 4JKLA 5I1AA 3H9YA 4U2YA 2VZUA 3BQUB 3LN9A 2LE9A 1MIEH 3WFEL 3HFMH 5JIKA 4LQFL 2VH5H 4NN7C 2YKLH 5GS0C 2NX5D 3CX5J 4IRJD 3K7UA 4X6EB 2AQ1A 2JJTC 3FQXA 4P5KA 3MJ9L 5GRVK 4BFIA 2A6KB 4LPWA 2C1PB 3BDYL 2E8YA 4WEBH 4I8DA 3G9VA 3TPUA 1N2RA 1HHHA 2BSRA 4G42A 1G7QA 4ZDHA 4V1DD 5IIEA 4OLYH 5MERA 3HZVA 1ZE3C 3MX0A 3BZDA 2E9IA 3OAZK 3HG1E 4WFGE 4O02L 4LOUD 1C7TA 1KB5B 1GGUA 4HWNA 3V5HA 4ZFGL 4KC3B 2A1WL 2ATPB 3BUTA 5HDBE 3SKMB 4HBQA 2FX9L 4JB9L 2VZVA 4X4ME 3LSOA 4GAGH 5D7LA 3KGRA 4Y5VB 1FAIL 4P5MB 3G5XB 1YMMB 5SWSB 1KXQE 1AQDA 3O4OB 1FGVH 3VFWA 1SVCP 4MA3B 1T0MB 3C5ZA 5EPMB 1INQB 4YHNB 3W11D 3FRPA 5FYLE 3O6LH 4O00A 4OZGB 1Q38A 1RZGB 1SJEB 4RWYL 1FG9C 3Q2CA 4X9FA 3TIDB 1ITBB 4Y8DC 3V6FA 1AJ7H 2J4WH 3M07A 1J8HD 3HMXL 5FKPA 4GAGL 3GRWA 4GG8B 4PTTA 4PGCA 1AR2A 5F9WC 5CD3A 1MVFA 3BXNB 2VE6B 1L0XA 1CXKA 3VXTB 1MWAA 3PGDA 1MCCA 4M7JH 3ROOB 4B0MM 5DUBB 4QTHA 3G5ZB 3MXWL 3GMLB 3MNVA 5I0ZA 2E5EA 3BE1H 5DFWH 1IEAA 4LSDA 1AGEB 2C4XA 3HCVB 5F1KC 5K9QI 2EO9A 3WXWH 2Z91A 3C08H 3D39D 2XA3A 1D6VH 2H32B 1AY1H 1UFUA 3I6KB 4W6YB 3X3GH 1NGYA 2ADJA 2VDQH 3BKML 3ZDXF 5I1HL 5I30L 5F9JA 4EOWL 3QA3B 5HHMB 5FB8A 3VXQA 2EDQA 5JTWA 2EYTB 2GCYA 4O2EA 5HYJB 3WO4C 1QTYT 5E00A 1A6ZA 4ODVH 4A6YH 4KVCH 2R2EB 3U36B 4IOSD 1MNUH 4X7SL 3IYLW 5CIPH 5T3XE 1JYNA 1CTOA 2O26U 1J0IA 2PXYD 2DIBA 1CU4H 1FNSH 2OR9H 1G0XA 4PJXA 5FYJD 2YD3A 4GRWH 1F11A 2DMCA 3VWKB 4LLYA 1JNHB 2V9RA 1E4WL 3IJHB 4RX4D 3ZZ1A 5GIRA 1IC5H 3VXUA 3KDMA 4GG6F 1I8KB 1BP3B 5TF1H 1DBKH 4PJ9B 5FF6B 2EYRB 1SY6L 3VGDA 3TN0D 4GKZB 5I8OL 2NXZC 2CIIB 1JUFA 4X5WA 1FNSL 2OR9L 3D25A 5MEQA 2OK0H 4U6VH 5ENWB 4F80A 2PTTA 3IXTA 5EU7E 3KLAA 3MRLB 3MLUL 5FF6A 5F1IB 4XHJD 1FIGL 4GKZA 2J1KA 3DX7A 2O5ZL 3EOBA 1KB5H 1W8NA 5EOCJ 5F3HB 2EC9T 1MHEB 3WHE1 1T1YB 4QXWA 3ZMRA 4P2QE 4HXAH 1RAMA 5D2NA 1ADQA 4O2CA 3AREB 5IG7B 4N5EC 3MBXH 1J1XL 2B5IB 2NXYD 1VFUA 5C0FA 4OGYL 3IU3B 4M1CD 1MHHB 4UNTA 3BPCA 5ALCH 4XNXL 1SYVB 3QDME 4NN5B 4KJPC 3QIUD 4YHKL 3PP3K 4FXKB 3CMOH 3SCMA 1MEXH 2AXFB 2CDFB 1TNNA 4K71C 3TGXA 3ULUL 3VFSA 1XH3B 4HGWB 4NO5A 3QUMA 5E99H 3DVNA 3LPWA 3MA9L 3Q1SH 3E2HB 1U8QA 4HG4J 5H37G 2D4DA 4LGRB 5BMFL 3KYNB 2EDEA 1HSAA 5T3ZL 3B9KA 4JM4L 3EFFA 4YHZH 3ARZA 5D7IA 2P4AB 5DMGD 2A9NL 1UWEH 3MV7B 2WUBH 3UO1H 1C7SA 5IKCA 2V9TA 4N5UA 3O4LB 3B3IB 4PRIB 3RZCA 3WLWC 5JDSA 2CO7B 1MFBL 5BZWA 1ITCA 1I8IB 3LEVH 2YD8A 2UV3A 2GKIA 4NPYA 4J4PD 2Y5TB 2VQTA 5KVGH 1MELA 3OKDA 5EBMA 1W72L 3SGJC 4CJ1A 1NBYA 4X4YA 3MOBL 4HIJB 1QNZH 4U1MB 2CJUH 1T5XB 2BXZA 1A14L 4JDTH 3TNMB 3GMPB 2DI9A 4Y19D 4K7FA 4U49A 3ECBA 3DGGB 1BMGA 4FFVD 3ULUC 4MDJB 3VFTA 3W5MA 4UDUA 1TJHH 3NCJL 4JEGB 4YXKL 1MFNA 3HMXA 4FFVC 3LS5L 2X4RA 5DJ0B 5L6YL 4RWYH 4GSDL 1BWWA 3G6AB 1M7DA 3VFVB 3DMMC 4AY0A 1GHFH 3CH1A 2ZSVB 3QIBB 2R2BA 2X4NA 4XP4H 5D1ZB 1N5YL 2P7TB 1PYWA 4LK4A 4BQ6A 3QDHA 3NIGF 5TGBA 4KDTC 1QFWI 5GRJH 2HVKA 1NAKL 3TPUB 1J0HA 4JFQB 4OZIA 4WCYH 3V0WH 2A74B 1G7PB 4G8FA 3CCHB 4MCZB 3VD4A 1IKFH 3WYRA 1B4JL 3MFFB 5L8LB 1FZKB 4RMUA 2DBLL 1JZ2A 1AD9B 5GS1A 1HINL 4UU9B 1VGKB 1JPTH 1CXIA 5EUKA 3OR7A 1MCRA 4UOW0 3VXOB 1C08A 3VXMD 4JQVC 2VR4A 3UYOD 2ZP0T 4FTVB 5DDHB 1CGTA 2E9WA 1A9BA 1XCTA 4L4TA 4PJFB 4WFFE 5IM7A 1UM4L 5JNYB 4AM0B 3KLAB 3QUXB 4ODVL 4A6YL 1A6WL 1YN7A 4WO4A 3DI2B 3AVEA 4JFPA 3NVQA 3OTTA 1SM3H 1KNOA 4GLRI 1KENL 4AK1A 4Q0XL 5DJYB 4Q2ZB 5C0AE 3S6CA 1MIML 1D9KD 3BT2L 2DQUL 3NPSB 5E8EA 3DXAA 4P2RA 1NPUA 3LRSA 4RBPH 2R23A 4YHMH 1ZS8A 5ALBH 4JZNB 3TNNA 3RWCA 3BMVA 4ODHH 2A0LD 1OAKH 1ZWIA 4JKPH 4F8TA 5GPRA 1KIUA 4R3SA 3DIFB 1O7VA 3T0EA 4MVBC 2R0KH 2DQFB 1B0GB 1U8PB 2FH8A 1KPVA 3IDUA 3BDYH 3KYKH 3QO1B 3MV9B 4RGOH 2VDML 3VI4F 1VFBB 4ZO7A 5D6CB 2CIKB 4FXLA 3CFKB 1QRNB 2GTZB 5DLML 2ID5A 2UZYB 4MAUL 5HDOA 2LAGB 4WUKH 1RJZB 3UC0L 4LCWD 1N0LA 5IMMA 3W0WA 3WXVL 2L7JA 1Z9SA 4U7MA 3VWKC 4LARH 4TYUA 5E2TH 4U6XA 3N85H 1T0PB 5C08D 1J5OH 3GHBH 1MJJA 3NGBC 5K9OA 3MV8A 3TYFA 2VL5A 3H42H 3SDDD 4NQVB 1OGAB 2FNBA 1GZQA 2R4SL 3R0NA 1QEWB 5DD3L 5CILH 3UC0H 4JFYB 3TFKD 1FV1B 1AD9A 2I9LB 2CRIA 2XPGB 1A6PA 1YJDC 5IFJA 4PY7B 1CF8L 4RMRA 4PR5B 3RGHA 1MJ7H 1S9YA 3IFLL 4I3RL 5EU6E 1FL3B 1K5NA 1BZQK 4JN1H 5IHZB 1ZT1A 4OV5B 3ELAT 2FH6A 2HN7B 3RIAF 4MDIA 4NQTA 1UXWA 4W4NA 2QQNH 5HD8C 2F53B 1MJUH 3M45A 4ISVB 1OSZB 2FWOB 1CE6B 5MENB 3HZKA 5JW4M 5D7LE 2PF6A 4W70A 3ZYOA 4AEHH 3TVMB 4P5TD 3SGEI 5D7JC 1KGCE 4YGAB 4UTAL 3O8XD 3MRLA 2XACC 3O4LD 1EGJH 1LEIB 3V5KA 2P5WB 5C07D 3IDNA 4OF8A 4QRQB 2YPLA 4JJHA 4LAJH 3FONB 4ZFOB 2OZ4L 2F19H 4HKBA 4RMVA 3S35H 3GJEB 4WFHE 5HHMD 2DQGH 3HNVH 3D6GA 5CHNB 2XN9B 3FN3A 1A7BA 3O6FD 2XWJA 1HXYB 5AZEL 2EO1A 4BSWB 1Q0XL 3D9AL 4BELD 3GMMA 2HT2C 4HF5H 3VXMB 3X3FH 1JK8B 2NY1D 4UQ2B 2HTKD 5EWIL 2Q6WB 4HKBB 3T09A 4QXGL 4D3CH 2F5AL 3O11B 5I8KL 3Q5YA 1IQWH 3HAEB 2G5BA 3P11H 3QDMA 2A6KA 5E7BA 2QADC 1W0YT 4Q9CA 3FFCA 3CFCH 4HFUH 5FUCC 1YEDA 3RU8H 3OZ9L 4OIBA 3RKPA 1JNLL 2H3NB 1RJCA 1VACB 4OZFG 5I6XB 3B5HA 3FO0H 3QDGE 1HHJA 1OCWL 3WFBH 3X14B 3W0WE 5IBTL 4YAQA 4RNRB 3JUZA 4U1IB 4RAUB 4NUGH 5SWZA 5ESVA 5D1ZD 1BECA 1CFTB 1UKQA 2XA8H 4XVUD 1SJHA 2QADB 3O41A 4YQXL 4JANA 1KTKE 2DKUA 2EIEA 1VEOA 2ARJA 3EJZC 3H2WA 5GJSL 2FGWH 4ZYKB 4NBYB 3U4AA 3DROB 5LAXB 3DUUA 4LEOA 3DX6A 2EDTA 4I2XB 1MJJB 1ZMYA 1OAZH 1JHKL 3V4PL 3MLVL 4KHXH 2LQRA 3D3VB 2Y36L 4NQVA 4LEXL 4EUPB 2UWEE 1UB5B 3LD8C 1IAOB 5DI8B 4PTTB 1FPTL 1MAML 1ORQA 1CT8A 5I8CB 1IM3B 5DSCB 1QR4A 4PJBB 1H0DA 3RIFK 5FGCB 1U8MB 2BDNH 4TULH 1PY4A 2IJ0C 2P24B 3VA2C 1GAFL 3UTSD 1PVHA 2LU3A 4Z7VA 3OXRB 1LO3L 1VPOH 4PJ7E 2P5EE 4PJEA 4J1UB 3V52L 2XKSA 3LD8B 3KJ4B 3KPSA 4QXGH 2CMRH 4D3CL 2DL2A 1AGDA 3O2WL 5F7DB 2IAMD 1BREA 1P7QA 1W0WA 3DRTB 5KZCB 4UT9L 4MGXA 1QLRA 3QUXD 2BJML 4G43A 3QWRA 2CK0L 4NJ9L 3DNKA 2LVEA 1DBBL 2Q87A 3FO9B 1HILA 1OGTA 1UJ3A 1LO0H 5EG6C 2E6PA 4UT6L 4KVCL 5TJWK 4LU5L 3AROA 5FOBA 4XCYA 3CVHA 1IEBA 4FFWD 2OSLA 1LO5B 4NQCA 1T20B 4GKNB 1DP0A 5D6DC 3S97C 4E41D 1L0QA 3WUWA 4AQOA 2BNRE 3C87A 4XC3H 5ESVB 4YDJB 3DSNA 3G5YA 4KROB 3P30L 3UX9B 5F71A 2FJGB 3LDBB 4Z77A 1W0VA 1XCTB 3RVXD 2ATKB 5J1AB 5IW1B 4LU5H 4WHDA 3U79A 1MRFL 4M5ZL 4OSUL 4MJ6A 5ICXB 5KJRL 3KHOA 5I19L 4IBLT 2AERT 3W2DL 5HHNB 1NEUA 4ZSOA 3IJYB 2D7QA 2ZJSH 5FECA 3QDMD 1MREH 3EJYC 4ZPTB 3VE0A 2LVCA 3ORJA 4U6VL 1YEHL 2JCCF 5EO9A 1EAPB 1JI1A 4KRNA 3WIHH 4IRSB 1V05A 1ZLSH 2W07A 5D7SH 2P8MB 3D3VA 5CILL 2CLVB 2IF7A 4XBEL 4KI5D 1ZV5A 4O51A 3I50L 4GG6B 5KTEH 4KTEL 5DYOA 3WO3B 2XWJB 3CAFA 3GI8H 1EVUA 3TLRA 2DMKA 2ARJB 2OM5A 4PLKD 4LF3A 3CLEH 1IZKA 4K9EC 1XIWA 3SKJH 2HFFB 2QQQA 1Z5LA 5DURB 1T0NA 5KSAD 4GRMA 5D96C 5DTFA 4BZ1H 5IQ7L 4EDWH 1RUQL 1IARB 4IRSC 4BYHA 4PJGA 3V8OA 1D9KC 5H94B 1KCVL 1MHHA 2XY2A 4LF3B 5F1NA 1J12A 4LFHG 3RVVC 3UYRH 4BZ2L 3C09B 4M6MH 4F33A 1F58H 1F4XL 1S7UA 4LHQB 4OAWB 5B3JF 2O5XH 4R8WH 1AR1C 2C9AA 3QI9B 5E99L 3UJJH 3IDJB 4OQTL 4Z78A 4MHHG 3WUWG 1ONQB 1G6VK 2F53E 4MA1C 3HAEH 5EU4A 4X6CB 3QIUC 4HWBL 2W59A 5EFIB 1NMAH 4NHCL 1Y6NR 3V6OA 3T2QA 1A22B 4AQ1B 3QIBD 4S1RL 4DN3L 5BMFH 3QWQB 1KPUB 2DQCL 2P5EB 4LSVH 4OZFB 5E7FA 3U0TB 3SO3B 4H0GA 2Y23A 1V7MH 2KL6A 5I66A 2ZPKH 5D7JB 1JRHI 3E8UL 3U48A 1KJ2B 43C9A 3LN4A 5GGRY 3VXUE 1C16B 1C5DA 1LHZA 4XHJC 1D5IH 3HG1B 1N2RB 2BSRB 3BP7B 4CMHC 2DF3A 3EO0B 3VXME 1LP9F 2C1PA 4MZ2A 4HIHB 2XFXA 4L5FH 5E6YA 2YS4A 4L29A 3SO3C 2Y25A 2R1YA 5T3XD 4KTEH 4OLWH 4ERSL 1S8DB 4N8VA 5MP6L 3ZDYE 1A6UH 4FS0A 1ND0A 2G60L 5DQ9A 2DQIH 5LVEA 1U36A 2VJXA 3ULUD 4EI5D 4HUWA 1WWAX 3X17A 4PJBF 4B53A 3RNQA 5GXBB 4PJCB 3QEGL 5JO5B 1U3HB 4Q7DA 1S5HB 1EUTA 3OPZL 5HHNA 2IPTL 1CGXA 2YUXA 1WEJH 5F7KC 1EPFA 3UBXI 1CXLA 3S7GA 5H8DA 1D3CA 3FCTA 3RVXC 3BP6A 3X12A 1XGQB 3LKPA 4JN2B 3PHOA 4CMMA 4ZXBC 1CG9A 1DFBH 5EORL 1MHCB 1AP2A 3RGVB 1Z0NA 4K2UH 1T03H 4LLVA 3HAEG 5E2UL 3FFCB 1I8LA 4QHNB 3GIVA 3HAEA 1WBZA 4HWBA 5HYQA 3SE9L 2E7CA 4MJ5A 3WE6A 4POYA 2W0KA 4CGTA 3JTSA 4J8RB 1A6TA 2F58L 5KVMC 4L4VB 1CU4L 2C4FT 1KTDA 5T1KA 3TP4A 3MACH 5J11C 3DV4A 3SGDH 4Y1AA 3RGVC 3FB5A 1OTUD 4HS3B 3V4VH 2BVEA 4YXLL 1IKFL 3K3QA 3VH8G 5GS1B 3VXSB 4H1LB 4GKOA 4PRPB 3H9HB 5IMOA 5DMJB 2H2PC 3MRMA 4Q9BA 4JANB 2E6QA 2KQMA 5FDWB 1JF6A 4M1DH 4JO1H 5HGHA 3JSSA 1SJVA 5I71B 3QQ9C 4DCQB 1DLFH 4LBEA 4KJPD 5FYKL 3VXSA 3IB4A 5J11B 2X1QA 1CE1L 2F74B 5E94A 5AG8A 2H26B 2FDBP 4OV6F 4Q2ZA 3V7MA 3MRCA 3U9UB 5DHVH 5JLZA 3WIHA 1R5WA 4GQPH 2IFFH 3B8YA 3ZTNH 2CR6A 4PS4H 1S8DA 3BSZH 1UZ8A 4JDZA 4OCRL 4OD1H 3B2UC 3VW3H 3MR9A 2KUTA 1N6QH 1G7HB 5K59E 5JW3L 3KYKL 4LIQL 1TCRA 2OMNA 3BYYA 3TA3B 4QT5B 1UENA 5E70A 1EIBA 1HQ4B 4TSBL 3BDXA 4FOMA 4R97B 1D5XA 3U7WH 5KOMC 2C3VB 4EVNA 5DXWA 1EEUA 4KTDL 2J2ZA 2NY4C 2B2XH 3DGGA 2VLRB 2WBWB 3NIGE 1FBIL 1QNZL 2K3TA 3QXVA 4E5XA 1UYWL 3V6ZA 4RGNE 3UTTE 3PL6B 4QOKE 3KPRA 3ZYJA 4HW6A 4MLIA 1B6UA 1P2CA 2FD6L 2EDDA 3HE7C 5I75C 1FNHA 1NCNA 5HHOE 3LDBC 3S5LB 5HVHC 3VFOB 3NCJH 4ZTOH 4PGEA 1I1AB 3U7WL 3O3BA 1NDGA 3MACL 3M8OH 4MB4A 3X13A 4YLQT 4F9LC 1V3KA 2R2BB 2X4NB 4GSDH 3DUHA 5J12C 1BWMA 5IEHA 1Q8MA 1T21A 3FMGH 4DZ8A 5F9OL 2DQTL 2HYMA 5I75B 2HTKC 2HJLA 3RPKA 2JJTA 3WNNA 4OQ1A 3WDJA 4UB0H 1PZUB 3TEUA 4ZNCD 1F4AA 1JGDA 1CL7H 1J1OL 2RFXA 5DHYB 4EBQH 3ABZA 1F13A 1KPRA 2ARJQ 4F7EA 2ZUQC 3JWDC 3AGVA 2UZIH 5DVOA 3G5ZA 5F7FA 1YEIH 1ZK9A 2CQVA 2PO6D 3AU1B 4QY8B 3S37X 4X7CC 3NCFB 3CMGA 3QJFA 5D96B 5CEZE 5DQDL 3KLSA 5J6GA 4NRZB 2DDQH 5FM5M 3QUXA 3D48R 3MJ6A 5K33A 4UT9H 4R4NC 4AM0A 3WCYA 2F5BH 2P8MA 3DBXB 3ZE1E 2BP3A 2ITDB 2AXJA 5FKPB 3B3IA 3MODL 3OAUL 3QEQD 2PCPB 2ZZUT 3MGOA 2N56A 4AENA 3O4LA 4FRWA 2Q76B 3C5ZC 2BRQA 5BVPH 3SGKC 3D85B 5FCSH 2DM7A 1XZ0B 4MA3A 2JIXD 2WBJA 4WU5B 5BRZE 1BAFL 3CFEB 4MQXC 2QL1A 4NC2B 1A4KA 2FD6H 3DI3B 4YGVB 4DEPC 2G5BB 2YK1H 3QDMB 4W6WB 1ZEAL 4MAYD 1U93A 1FZOA 3O3DB 4YE4L 1GXEA 5CJQH 4XT1C 5E8NA 5F8RC 1EBAA 4S2SA 3SDXA 4HLZG 4G6AC 1JZ8A 1JF5A 2J6EA 4WFEE 1KBGL 2BVPB 2OJZL 1FQ9C 4XPGH 5I1IL 5DWUH 2DI7A 1PW3A 4GKSA 4MA8H 1AGCB 3MLYL 1AFVH 4V2CB 1WUNT 2NY6D 4M7ZB 4MXWL 3V0AC 2P8LB 4LBEB 1NDMA 1XF5B 3BGAA 1NFIB 5D93B 1OF2A 5IB5A 1AE6L 2VQUA 4MD5A 5FA4B 2B7DT 1CXHA 3LPFA 3RY4A 1OGAD 4KJYA 3BN9D 5TE7H 2CRMA 1KJ2A 4X7DC 1MHEA 2IQAB 2EZ0D 1ROWA 4K23L 4U2ZA 4PRHA 4WIQA 5E8DH 3SJVE 1UKSA 3STZB 4BK4A 1N8ZA 1RUML 1YNKL 2P44B 2DI8A 4LLWA 2ZUTA 4LRIC 5C9JA 2V2XA 1IVLA 3LIZH 2RHEA 3OKOB 3VGBA 4FFYL 1AFVL 2JCCE 3LAFA 1D5BA 3MRKA 1TTFA 4LKCB 3KPTA 4FQIH 2JJVA 3QFDA 5DI8A 1NUGA 4NO0B 4P4KD 1ND0B 1QQDA 1U91B 3QFJD 3QNXA 4P48A 3WJLC 5JR1L 1X5XA 4RA3A 2R0KL 4OT1H 3RKDC 1U8IB 1OHQA 3FTGA 2DQEH 4YHPA 1IGFH 1WAAE 1JP5A 4PRDB 5I16B 5DHYA 4GUPB 4FABH 1FIGH 5MEPA 1YN7B 4WO4B 3S4SB 2NQCA 5KSUB 1HSAB 2ZCHH 3SGJA 1KXVC 1J8HA 2N1KA 3RKDD 3N1QC 5IHLB 1GGIL 1RI8A 3U6RA 1VGEL 4U1NB 1HXMB 1IQDA 3EOYG 4PJIB 4XXDB 4LHJB 1G7LA 5E8PB 3VFUA 3PHQB 3GHEL 4P23C 3WFEH 3MZTA 3HUJB 3AY4A 1RFDH 4XNMB 3MNZB 1E4XH 4M1GH 4ZFZA 3GSRA 2ADFH 1BZ9A 3SDAB 4DTGH 1MFCL 2GHWB 4MNHA 5F1OB 2HJKA 4PJ8B 1P84J 2ZSVA 1YA5A 5E08H 3OKDB 3C6SA 5EBMB 2H2SC 1YY9C 5B8CC 5CEYA 1L6ZA 4ELMF 5IHUH 2BSSB 4I9WD 3CDGB 1BOGB 2MKLC 5CEZH 5IG7A 5HGBB 2COQA 5F97E 3EUUA 1NCCH 3T65B 1YNTB 3AMKA 4ZOEA 3KPQA 1GIGL 1SQ2N 2E9BA 2CR3A 3FQRB 3V5HB 4LDLB 3TJEH 1I85A 3TWCL 5AUMA 3UTPD 4W81A 4L3CB 1KJ3L 1R5IB 2VTFA 4NQUA 1YPZB 4JKMA 3LQAC 3SDDA 3OKKA 1PG7X 3NH7H 3MV11 5D2LB 5TDNA 1RZ8B 3U0WL 5B8CB 4N9GB 2FBJL 3MRHB 1FG2B 2Y5EA 4IDLA 1BD2A 1XGPB 3IRPX 2YPVL 1Q94A 4LSTH 1KT2B 5T3ZD 3MROB 4IDJL 1RV6X 1NH6A 3QG7H 1A9BB 4R2GD 5C6TH 3MRCB 4O9HH 1RZJL 1UACH 4PYGA 3ZHLA 3HPJA 1T04B 2XXCB 4QXTB 5JLZB 1TPXC 2H2SD 2ADGB 4OZ4B 2F54B 5IFHL 1GGBH 1F45A 4P2OD 3GI9H 1ZGLM 5IKCB 4NKOA 3LS4L 4J3OC 5DRXA 3RTQB 2NLJA 1CL7L 2DTMH 4PBWD 3W39B 4PJCF 4KMTH 3RA7L 1F42A 2CDGA 2JCCB 4JAMB 4FQLH 1FL3A 1K5NB 3O8XB 1K4DB 4PY7A 3RDTD 5ITBH 4O5LH 1RJLA 1WLHA 1KB9K 3MA9H 1OAZL 1UCBL 1JL8A 2B1HH 5IMLA 2GJ6A 2AEPH 2QSVA 1DQDH 4LCCC 3UP1A 4HHAB 2D0FA 3SY0B 2F5AH 5GS0H 4NP4H 2EXWD 2P46B 5E6IA 4E5XB 3QHTC 3MLXH 4BH8B 3KPPB 4HAFA 3CFCL 4NGHL 3NCBB 2J3SA 2P42B 3OXSA 1U8KA 1UM5H 3T77B 3GMNA 2B4CL 2MCPH 1FN4B 5I9QC 1LO2L 1IKNC 5JHDB 3S34L 3ULVE 5C6PB 1G7JB 3WSQH 4X99A 5I76B 4R0LB 3GB7A 4KI1A 2EC9U 3IFNL 4Y5YB 4MA7L 3FO9A 1AP2B 1X5IA 5HJ3B 3RJDA 5DS8B 3QXDA 5HGBA 3MBEA 3I6GA 2I25N 3ULSB 1S9VB 4XXCA 5TE4H 2DBLH 3MRFB 4XNZB 3QXAA 3SDCC 1BBDL 2D0GA 3QUZD 1XF1A 2GSIB 2AK4A 4X6CF 5EIIB 3EOTH 5D6CA 2DLTA 5EBGA 2W0FB 2WUCL 3FQWA 4X6FA 5C0IA 5IR1A 1C1EH 3BRFA 1H3GA 3GO1L 3VRLF 1HHJB 3QXAB 1B2WH 4ZOCA 4BUGA 5DF0A 4YHOL 2HFGL 3IXTB 2LV4A 1NBVH 5GGUA 2OK0L 4K3JH 4L9DA 5GS2H 1XF2A 2J8UE 5JZ7D 1W72A 1RIUL 3DBXA 4LSUL 4KGJA 1A3RL 4OGAC 4QHLB 1QKZH 1WTLA 3GBML 4GMTH 5DEZA 1VPOL 5JXAL 4OCSH 5KOVC 3VGFA 3SDCD 1W2KT 3TO2A 4GG6A 5TDOB 1TJGL 3C2AL 4ZFFB 2C3WA 3DROA 2V7HB 1OD9A 4NQDB 3CPLA 4NP4L 4U31A 2BSTB 1MY5A 3CFDB 1LP9E 4Z7VF 4U6TA 4PRBA 1YEGH 1XGRB 3GMPA 4QRQA 1NAMB 1CGSL 3O45A 1ZVHA 4CMMB 4YO0B 4XRCB 2BSSA 3STBA 4F9PC 5TFSH 3O0RH 2APWA 4MZ3A 1NUNB 4CADA 4ESKA 3T0EB 4CU6A 3WLBA 4YDVB 3VRIB 1AXTL 1R3HB 2V2WA 2F53A 4JM2A 3C2AH 5CJXC 1GPOL 5L8JB 1CE6A 5MENA 3UTQA 3V4VL 1N7ML 4IMLB 4OFPA 2BK8A 2DLFH 3GSWA 4OTXH 3IDJA 4N0CD 3VG0H 4UV4L 3WUZA 3EYVA 2VXSL 5D1XC 4EKXA 5TPWH 1X5GA 1KLUB 3FOLB 4JFDB 4IM8A 4XWOC 5FA3B 4LSPL 4APQB 5DD3H 4AJ0A 5KANI 3BPNB 1KCRL 2K7QA 5L88H 3NAAL 4JHAH 1PQZA 5I1DB 1ZHLA 4DGIH 2UWEB 1UCTA 2VXQH 4CNIA 3SE8H 3WNLA 4R0LA 3C60B 3MV8B 1U8NA 5D7SL 2AXGB 5KSBF 5SX4H 1D5BB 5IGXH 3HUJE 4FQQB 3MRNB 3QFDB 3PP3H 3O4LE 4M8QA 4K3JL 4M5YH 3QXTA 4WFED 1N6QL 1JNHA 3UZQA 4RFEA 1HHGA 5GRUL 3QFJE 3EYFB 3TIEB 2ZOKB 3SDDC 4NWTH 1I1CA 3GJFK 4I5BA 2QV2A 1ZGLB 4HUMB 3CXDL 1D6EA 1FZJA 15C8L 3SDAC 3CZJA 2BVUA 1Q72L 5AAMA 4N0FA 1S5IH 3AM8C 4TSBH 4ODBD 4PJXF 3SE4A 4QRRA 3GZKA 4HLZH 3GSUB 2CKBB 3SJVD 1SJXA 1PEWA 4F8QA 1IC7H 2V2TA 5FEBA 1E6OL 5C6WH 1X7QB 2QSCH 2A1WH 3ARPA 1YMHB 2FEEI 4UDTB 2PR4L 1B0GA 4QO1A 2OTWB 2YD2A 4GG6E 1HZHL 1T6WA 3PV6B 3CVIL 4BZYA 5ICYB 3L3KA 3BP6B 4OZFH 2WWMD 4F37F 3FCTB 2IAND 5ISZD 5E8EB 3B2UD 5HGAA 3CSGA 1BM3L 4EN3D 4HS6A 5EULV 4GRLB 4JZNA 4IS6A 3HI6H 1KJ2H 4M48H 3MYZA 5KVDL 2VE6A 2DQTH 4M9OA 1QSEE 4ZS6C 3RQ3A 1BF2A 4NM8H 2HT2D 3WE6B 4UINL 1NC4A 2AJSH 4QNPF 3EYVB 3T4AB 4L3CA 4XMLL 3K1KC 3V7AE 2DM3A 4DGYH 1JN6B 1MWAH 2E3VA 1ZHBA 1DBAH 5IK3A 3FQUA 1JZ4A 3UZVB 4ZUWA 4DN4H 4LDOB 3UPRA 4UILH 2H3NA 2OZ4H 3GIZL 1OARL 3QA3A 4KTYA 1OB1A 1ZLVK 2NX5E 1PKOA 3GGWA 4GW1B 1AR1D 3EFFB 3R0MA 1QHOA 5D9SB 3ARGB 3VG9B 2Z8WC 5LKNA 3ZKMD 4KQ4H 4P3DA 1OAKL 4U0RB 3MLVH 4LCCB 3NCYS 4UIMB 4IJ3B 4PJFF 5DQDH 4EXKA 3W9DB 4PD4J 1FCGA 2NW3B 4HXBL 2FJFA 5EB9A 2I5YH 2FR4A 4PJDA 4JKPL 3MTRA 4YBQC 3D18A 4UNVA 4P2OC 1T1ZB 3R1GH 5IBUB 5IJVA 4OZHE 4DZBA 1K4DA 3HC4L 3A6BH 4WHYG 4LEOB 2IAMA 3PIQB 5ACMA 3L5XH 4HCRL 4LCWB 3W0WD 3TV3L 3O8XA 4HIHA 2X1XR 4JY6A 1FL5B 1U8OB 4WFFD 4OM0H 3QFJB 5J1TC 4GO6B 2CJUL 4KZEH 1J86A 1QRND 4OFIA 2VZOA 3DTXA 1QD0A 4M6AA 3KPSB 3HNTL 2VC2H 2X70B 3IDIB 4NCC2 3L6FA 3GUTB 3QAZC 3WFCH 1XF3B 2BNQE 3SBWA 3SDCB 1BPVA 4UQ3B 1BFTA 2FBJH 1QACA 4PJIA 1OOAA 5HSFA 4ELMB 3FL7A 3QNZB 4HS6B 4MA8L 1BD2E 1T1XA 4NQEE 5I1JH 4NN5C 3O11A 1S9VA 3G5VA 4G6JL 2MCG1 1AKJA 4H8WC 5DT1H 3JWDL 1A9EB 4QOKD 3HE6C 3MLUH 5FOJA 2K9UA 1WBZB 1S7QB 2BRRL 4P46B 5CZXC 5HHVH 1FZKA 4GAJL 3QCUH 4ZS7H 3LV3A 1FAIH 3T1WA 3CDGA 1EXUA 2DMBA 5IQ9B 4G6ML 4MCZA 4PP1D 5BV7B 5DGQA 4HXAL 1YDPB 4DKEH 3W81A 5F88A 4FQHA 3RP1A 4HK3J 4H88L 2AEPL 3GGWB 3LN5B 3RFZC 1A8JH 2QQKH 3ARBB 4HWEL 2VERN 4GRLD 3KYMA 2JIXB 2H8PA 2BC4A 2DWDB 1KACB 2X4QB 2NXYB 1SYVA 5TQ0L 5C3LD 1BGXL 5IJKC 3L7FB 3MRMB 1K2DB 1FLRH 3QEQA 5FDWA 3TT3L 4WFHD 1J8HB 5D7LB 5MEPB 4GXUM 4XH2B 2X40A 2EXYC 4PRBB 1Z9OA 3S35L 3DIFA 3ARFB 2YC1B 3EW3B 1AHWA 3OB0H 4C56E 3GSNH 4R26H 2NXYC 1GL4B 3MRBA 4TUJB 3BE1L 4PD4K 5C07A 1FFOB 5D1XB 1T66D 2W9LA 1C5DB 4G5ZH 1GRWA 4OGXL 5IB1A 5IEKB 4M6OL 4LCWE 5DJ2B 3TN0A 4PLKC 1UZ8B 4JDZB 1DEEA 2YZ8A 1A47A 1NGPL 1BFSA 1A4KB 4JHWL 4BQBA 1MPAH 3LQAL 1EBPA 4YHYC 5E4EC 3K1DA 1CR9L 3OB8A 1DANU 5E6IB 1M6OA 1IC4L 2JB5H 4D0DA 5D1ZC 2VLRE 1CT8B 5SWZE 1S9XA 2BNQA 1Q9WA 4X6DE 4N90E 3CVHL 4I0PB 5EO1B 1KCUL 3WN5C 4NT6A 1VEPA 1A6AA 4HBCL 3P4NA 1QSFA 1NDMB 2FIRT 1WCBA 1EO7A 5D2NB 4HUXB 1T6VN 5I1IH 3P0GB 4IOIB 1OAYL 2R2HA 5I8EB 3QPQC 4HWEH 2BOBA 3EZ8A 1LNUB 4PGEB 5TE6H 3C60A 4JFYA 3C5JB 2FJHB 1GHFL 3LN5A 1FORL 1CFSA 2FYYA 4U4BA 1YEKL 4Y4HC 5CP3H 4PIRF 3WXWL 4M6ML 4GBXC 1BVKB 5J9PA 4KKBC 3B9EA 1N4XH 2HKFH 5T3XL 3S36L 5D7JA 2VZTA 1U6AH 1GOHA 3EDDA 5C8JB 3HHRB 1WAAA 1MLCB 5DDHA 1AXTH 2RAMA 3FFDB 1EEYA 4N0CC 5DRZB 3KLHD 2DLFL 5EC1B 1QBLH 4GS7C 4P5TC 4PRAA 2EE6A 4HD9A 5ID1B 4G9DB 1OQXA 3FN9A 3OKNB 4NQDD 3EYQD 4WV1C 3ILPB 3LKPB 1XGQA 4JN2A 2NY0C 1XF4A 2P8PA 5H35B 4YNYB 2Y9RT 4QRUA 4KK5C 1NBZA 1NMCB 2CPCA 4LSPH 1I8IA 2VSCA 3WKMH 2A38A 5C1MB 5DK2A 4CVWA 3PUCA 4P2CG 2VDLL 5FGRA 2FO4A 4X6BB 3PL6A 5IVXE 3GMRA 2NY2C 4RMWA 5C70A 1DBKL 2P7TA 3OJVC 2JB5L 4PGBA 4HK3N 5EZOH 5C0CA 4LPUA 3H0TA 5F96H 4JB9H 3VA6A 2EDHA 2NXZB 2Y6SC 3CZFB 1H8SA 3LRSB 4PJEF 5BRZB 4D94A 4PV8B 4NNXA 5MEOB 3MJ7A 3LHPL 4M43L 4Z7OE 3VGHA 5INDB 2BNRB 4H1LA 4IRZL 3HC3H 3PXJA 3KJ6L 5J8OA 3PWNB 2R1XB 5IUSA 3QDAA 3HTLX 2BHYA 1CBVL 2NY2B 4MQSB 3CK0H 1N59A 4HIIA 1CIDA 1HH6B 5DD5L 3GSWB 5TE6L 2YUZA 3EIFA 4HGWA 1YNLH 2A6DA 2NX5A 3NZHH 4IRJA 5EU3B 1VSCA 5DLMH 1C8PA 3U0TA 3ISWA 5JIHA 3ZDZE 1NC2B 1IC7L 1J1XH 3PWVA 1GOFA 2NXZD 3I2CH 1J8HE 3HRZB 1KJMB 4HC1L 1JPFA 2NMSA 1QEWA 2JE8A 3X11B 4RISL 4TSCH 4TUKL 3PWPB 1R3LB 3MZGB 2AXGA 4OCRH 3ESVF 4FQXD 4HGKC 4PJ9C 5FUZL 2IALA 3RHWK 4PJ5E 4PRIA 3FB6A 5C8JA 2HT3C 5FM8A 3CUPB 5T33H 5IESL 4OF3A 2Q1EA 1BF8A 5TDOA 1D5XB 2P48B 4Y16A 2DS4A 4OCSL 3QFJA 4ZOBA 1ZGLP 3MGTB 4DJMA 3MA7A 3MFGB 1D6VL 5F1NB 5GS2D 3H6JA 3LQZB 5BO1H 2Q86B 1RJYB 2DQDL 1MUJA 1PSKL 2OYPA 1Z9MA 4PJAE 5J9PB 3RHWF 3MOAL 1KB5A 1XIWD 1CXFA 1CLYL 1MNUL 4UDUB 3P4MA 1W0WB 3DRTA 4MDJA 4QF1B 1ETZA 5BZDA 3STLA 1U93B 1WGOA 4YC2C 5GRJL 4F7CB 3DLQR 2EYSB 2XI9A 2B5IC 3G9AB 3CFJA 1P7QB 2OTWA 1DVFA 2GJZA 5TPWL 3T77A 1E4XI 4HUXA 5IMKB 5BOZG 4PJGF 4MCYA 1UWGH 3MRQA 3FMGL 2X10A 3BSZL 5IVXA 3L5JA 5DD0H 3SE8L 2J6EL 4N0UE 4UV7L 5M94B 2BVOB 4O2CB 4HKJA 1EEZB 1NGYB 1DUYB 3VFOA 4BFBD 1F6AB 2OI9B 4GKNA 5IVXB 4L1DA 2BVQB 4WGVB 5EU5B 4GMSH 3I3BA 1RIVH 1XGTA 4RGND 2FGZA 3UTTD 5J57B 1F4YL 4L5FL 4M8QB 3ARFC 3QG6A 3LS4H 4LSQL 5GRYA 4NZTL 4ERSH 2UWEF 4I9WE 5C0BA 3GKZA 5EUOF 35C8H 3EKCA 4QHUB 3EO1A 3M17B 1UXSB 4S1SL 1WTGT 4JRWA 2R56H 1HH9A 4UUJA 4KZDH 4KV5E 4FZEH 5H2BB 5HHME 1M05B 4OGZA 3QH3B 1UVQB 5KW9H 3KNBB 3Q0HA 1RSFA 9CGTA 3NIDE 4YIQA 3MREB 5INCA 2B8OT 4IIQB 4NN6C 4K9EH 5CEXA 5EUOE 5EZIH 1I85C 3BKYH 2MFNA 3VRJA 4WW1A 1MH5A 1EZVY 5F6HJ 1V7NH 3TYGL 5C0JA 5B22A 3BAEL 3O6KL 1KIPA 2GAZB 2ICWA 1VFAA 2VKWA 2CDEA 3H9SA 3MQIA 1IKNA 4KJWD 3KJ4C 3NCEB 3OJ2C 1T7VA 4LCIL 4Z7UA 1I9IH 4GKSB 4IRJC 1ED3A 5E95B 4NN6B 4ZFZB 1KCVH 4PUBL 4NO2A 1MJ8H 3IVKB 3FO2A 4OLXL 3MSPA 2AABL 4XP4L 1N5YH 1MCBA 4Y2OA 3VFPB 1FZOB 1FHGA 4CVUA 4ZAKB 2PXYA 2VISB 5FUCE 4KAQL 2JK5A 2JJSA 1YNTA 5JUEH 1T1XB 4JFFD 1S9WA 5KSVA 4GW1A 3G6AA 5I73C 3QNZA 4KK9D 4M93B 3WD5L 4FQXB 3VXSE 1N7MH 3QQNA 1U8LA 1HCFX 5C92A 3TC9A 4HC1A 1OARH 2IFFL 5DZLA 1U8HB 2GSGB 4YHIA 4ZUSB 1V3JA 4QOKB 5KZCD 4TUOA 4LQFH 4RRPA 1FO0A 4DKFL 1XR9B 1NGZA 5GGTH 1QA9A 5F7NC 2Q3ZA 3OAZH 4ZAKC 4NO0A 4QRPA 3T0VA 5D5MA 4X9HA 1Y18B 4H5SB 3QDJE 2R2EA 3PIQA 2XZQH 2IH1B 3AMLA 5BJTA 1ZA6A 4A2LA 5I1KH 5TF1L 3RY5A 4JHWH 1UXSA 3QJFB 4RZCB 2Q8BH 2NY6C 3EGSB 1M7IA 4LCWA 1PD6A 3NZHL 2OJEA 5EC1A 3S4SA 5ALBL 4U6HB 4ZUTA 2VC2L 4YDLB 4ELKA 3MLRH 5ID1A 4PRAB 5DJCA 4DFIA 3U30B 1BVLA 3LKNA 5TE7L 4I48B 3QNXB 2VDOL 1TLKA 3JVGA 3O3EB 5EIVA 1VDGA 3ARRA 1NAML 4NOFA 1LILA 5I19H 2ERJC 1MHCA 1LEIA 5IESH 5T33L 4MJ6B 1WBYB 1JMZA 1S7TB 4WU5A 5EN2A 5GHWH 2IBZY 3NFPB 4NNPL 5LCVH 1DQTA 1FVDB 1HINH 4LCUB 4G6AD 1HEZA 4KKLC 4XNYL 4HKJB 4RGNC 1OCWH 3UTSE 5GZNC 3D0VB 3C5ZD 3M1BB 2X4SB 4LASH 3KNBA 4Y88A 3Q6GH 2ZUYA 5F1SA 3WIIL 2BHUA 2ZG1A 3L3OB 4NUJA 3T4YA 4PJBA 4XXDA 3JUYA 2HA1A 2FX8L 3MV9A 2D7TH 1IAIL 1XMWA 5CBAB 1EAJA 2E7HA 1NC4D 5IWLA 3FT4A 5IGXL 4W6XB 2FECL 4GAJH 3U7AA 2AI0L 3F5WA 4HS3A 2XTJE 2A9MH 4DKFH 1U8LB 1NEZA 1LE9B 5DHVA 1IEHA 3IU4L 4BZ2H 4WY7L 2HKHL 3VCLA 4JFDA 4JO2L 3MV8D 4U6XB 5FV2A 2J5LB 3SGDI 4RA0C 4JVWA 4ALAL 1IAIH 3MV7E 3DARA 2HRLA 3I75A 1MAMH 2J8OA 2XWTB 3K8KA 3K4DA 2E8ZA 3QXUA 2D7OA 4P4RB 2K7PA 4P9MH 5B3JE 3HZYA 4G3YH 2Z92A 2IALB 4IMKA 2H26A 2AI0H 3FO0L 3KPRD 3FB6B 1QPPA 4PB9L 1SEBB 5EIQA 3TBVB 3F7YB 1QFUH 4MNQE 1YEJH 4DN3H 2AV1A 1NCDH 1DQDL 4HK0A 1WC7A 4Y0GA 3GJFA 4XPBL 5IB2A 5B39B 3ZKSD 4WEBL 3UAJC 3WJJA 4Y19E 3T0BA 3I84A 3AB0B 7FABH 1ZLWK 4P3WA 3MJ9H 3F12A 3P4MB 1IAMA 2DJ4A 1H3TA 1BBJA 1ZHNA 1WBYA 4UINH 4N8CL 3JZ7A 1G7LB 1MPAL 5E8PA 5ACZA 1ZLUH 1VERA 5DC4B 4HCRA 3RTQD 3IDXL 1HYSD 3IJSA 4TVPH 4FTVE 3MCKA 5FO9B 1JTPA 4KGLA 3O3UN 2OL3L 4IMLA 4PRNA 1KCLA 1K3IA 2FX9H 5DMIL 5F7WC 2G2RB 2MPAH 5H37H 5D7LD 1G7IB 1HYRC 5E8DL 4I4WA 1JGLL 4PRPD 4H8WL 5D5MB 5KVFL 4EDXA 3AXLA 1S78C 1TVDA 3T65A 1QVOB 1K4CB 5I1JL 5FCUL 1F4HA 4OFVA 2WQRA 3IKCB 2L0DA 5BJTB 4OT1L 3QNYA 4LKCA 5EOCH 4OI7A 4OLXH 2Q6WA 2VLME 4W68A 1ORSA 2IWGA 1H8NA 4HH9A 5I71C 3MLWH 1W0VB 4D9QE 1QVOA 3BUYA 1X5HA 3H9HA 4HJJL 5E9DE 4TNVK 4R7DB 4Z77B 2VAAA 3O9WC 4HJ0C 4KK5D 4OQTA 3QUZB 4G7YL 2XN9D 1Z3GL 2QLVB 1MIMH 3BT2H 1U42A 2Y36H 4JFDE 5HYFA 2QSTA 3ARWA 1UWXH 1GGYA 1RUQH 4JFEA 4HFWB 2CH8A 4MX7B 4M7LH 1HN1A 4M6NH 2YUVA 3BPLB 1GGIH 5I1GL 2CK2A 2VN7A 1DN0B 3VCLB 3TF7C 3T3ME 3PQYB 5C0EA 4NQEA 4Y2DA 4Z7NE 5D2LE 2IG2L 4JQVA 4JPIA 4JZJC 1V3LA 2X2YA 3UTSB 1FGNL 2DM2A 2YC1A 3R4DA 5BS0D 4XGZB 5DJXB 3K81A 4YDIH 5DZNA 3QUML 3D18B 3J7HA 4NSKB 1TFHA 4QTIL 4PJIF 1OTTD 4N0UA 3ES6B 4YK4C 4PLOB 1NKRA 5J3HC 4XBGB 4MAUH 4YGVA 1HNFA 3DO7B 4P49A 4K7PY 3LHPH 3DHMA 3A6CH 2V6HA 3SO5A 2CUMA 1G0DA 4S0SD 4NQCD 2EH8H 4A2MA 4OFYA 1JPSL 5D8JL 4WWID 2JELH 1U8PA 4R2GC 4JZJB 3TBSA 1KEGH 1CBVH 3I9GH 1BJ1H 5KS9E 1N26A 1VKXA 1CTNA 3BIKB 4RX4A 2YXFA 4ZXBA 2IH3A 1S7UB 5E8OA 2XWBB 4K7PX 3S9DB 1INEH 1YECH 4NZDA 1OP5K 1QBAA 4DFHA 1OT1A 1I4FB 1XGYH 3QUMH 4L8CB 1QUNA 3UCRA 4IDJH 1ZT4B 3GSVB 1HQ4A 4WW2A 3KR3L 1BOYA 1PY9A 4KRMB 3T2PA 5C08E 5IQ7H 2VR9A 5L0QC 2CIIA 2GW5A 4HMCA 5DJZA 1Q9OB 3PDGA 2O61B 5KW9L 1ZLUK 3OWEA 2AAVA 3NFNB 3FRUB 4RQQB 4U1SA 2L7UA 1KTRL 1JGVH 5IFHH 1IFHH 2BMKB 3A67L 1DUYA 1G1CA 3BEWA 3QIWC 5FM5O 4I3SH 1G6RH 2VLKB 3S96B 1ADQH 4MVBD 1LNUA 4N0YL 1HWHB 2BOBB 4QXUL 5LGKA 1RUAL 4I5BB 2AGJL 3FRUA 3N06B 4G8GE 2B1HL 3IJHA 3IETB 3MPCA 1AXSB 1CCZA 3UDWC 1C16A 2RFXB 3RWDA 4XP6L 4XB8A 2CMRL 3HI5L 1QO3B 4IHOB 4LCIH 4Y19B 5DGRA 3EO9H 4FQQA 2BERA 1J11A 2WBJD 5ADOH 5IEHB 2VDRL 5DD6A 7CGTA 1N3NB 1AI1H 5ADPH 2AVGA 2HN7A 4TQEL 2VSDA 2XTJB 2KKQA 1HI6A 1CR9H 3ILPA 4YIQB 4NJAH 1ZGLA 5C2BL 2P5WD 3FQTA 3GEWB 5JNYA 3PNWA 5T3ZH 4Z9KB 3WD5H 3HI5H 3NOIA 1LVEA 2XY1A 3G6JF 2C4FU 3EZJB 4DEPB 1MCNA 2Y07L 4MB3A 4M03A 4U6YA 4QY8A 4YHML 2E27L 2WBKA 1BBDH 3DYPA 1IILE 1JUFB 1YUHA 2YPLB 3P3YA 5CD3B 1INEL 3CNKA 3BO8A 1EJ6A 43CAB 3WLBB