4QHUB

Crystal structure of il-17a/fab6785 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
210
Chain Sequence
QVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSTISLTSGFTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQLTLDVWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab6785 light chain
publication title IL-17A Asymmetry in a Complex with a Neutralizing Antibody Fab6785 Reveals a Potential Mechanism of Receptor Differentiation
rcsb
source organism Homo sapiens
total genus 46
structure length 210
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhuB01
4JKWA 2RHEA 2XTJB 3BE1L 4FQCH 5HHPA 2QSCL 4LCIH 2P49B 2AXGB 4MAYC 3RBSA 4OZIF 1T83C 3MV7B 3NACL 3L95B 4PLKC 4M7LL 4HK3J 3BZEB 3MLYH 2YD3A 4MD5B 1XGQB 2IH3A 3ZKXC 3MUZ1 1DANU 4M43H 3QUYB 1P2CB 2AGJH 1WBXB 4YHZH 4W4OC 1MAJA 3VDAA 1N7ML 2X4UB 4NQCB 3LCYA 2Z93B 3E2HC 1WFOA 5D1XC 3KHQA 4X9IA 1NBVL 4LSQL 2MPAH 5ID1B 3NFNB 4MXWH 5ALCH 4ERSH 4CUCA 3VFOB 4IRSA 4KXZI 4S0TD 5D1QA 5C0EB 4Y19E 3NBNA 4OD2A 1MI5D 1IZJA 4J3VA 1WAAF 1ZTXH 5J7CC 5D2NA 3H9SB 1AGEB 1TETH 1FNGB 1JNNL 5FA4A 4R96B 1L6ZA 3HC0B 3SGEI 4BQBA 1BF8A 1NCAL 2EDKA 4JFQA 4ACPA 3DROB 3WFHA 5I1KH 4QY8A 2DJSA 2C4XA 3GNMH 3VMOA 1KT2B 4OJFL 2DM7A 2Y06L 3O0RH 4P3DA 2H2SC 3I6KB 2AABL 5EN2B 4FFZL 3WHXB 4ZTOH 3WN5B 3IAPA 4RMWA 3V6FA 1BD2E 5KG9B 5GGSY 2QHRH 4X98B 4ODUB 1SM3H 2GI7A 4HV8A 3GRWH 1G9ML 3MNZA 1Q72L 4JHWH 3MJ7B 1F6LL 3EYUH 1J8KA 1AXSB 4GMTL 5IHLB 2NW3B 1FFRA 2G2RA 3NCJL 1FL6B 4AMKH 4DOHE 3VG0L 1E28A 1EIBA 2R56L 2YD1A 1WEJL 3QA3B 4NYLB 4HT1L 3SCMA 2YK1H 2MQ0A 4JFFD 1UWXH 3MGAA 1UM6L 4KHXH 1KJMB 3G6JE 4YGVA 5GS2D 5FYKH 3RUGF 5GISL 4CDGC 4BK4A 2GSGA 4S1RH 1YN6B 4IDJL 3IS0X 4M61B 4ZNEE 1P53A 2XZQH 1OAQH 4JO4H 3BFOA 3IDMB 3BOVA 1EEZB 2P42B 3DIFA 3CFEB 2XG4A 4LCWD 1S7SB 1FVDA 2GTZA 1I7UB 5DF0A 4Z78A 5JHLH 5FO7B 4GBXC 4PYGA 2BDNL 2HWZH 5I73B 3HAEB 1HK6A 1IKNA 1KXVC 3TH3T 1YC7A 1DQJB 1ZOXA 4ODHL 5DURB 3KVQA 4M5ZH 1YNLL 4K8RH 4M02A 2AK4E 2WW8A 3MC0A 2DLIA 5DJDA 1FPTL 2DYPB 2X4NB 1DLHA 4F7PB 2ZCLH 3OV6A 1FFPB 2E7HA 3WJLA 3MV7A 5TPWL 2NY2C 3MREB 4YDKL 4GKNA 1CDBA 2FH8A 1CXHA 4DFHA 1TZIB 1P2CA 4APQC 4DKDC 3ARDD 4ZO6A 4FXKB 5T1DL 1UXSB 4NHCL 3S37L 1MAKA 1RIHL 1UA6H 5IEKB 3O3UN 1F2XK 4BFEA 4PJEF 3IFOB 2Z93A 3ARRA 4ZFGH 3M8OH 2E9IA 2Q3ZA 4YC2B 1MRFH 2WUCH 2FGWL 43CAB 3MV9B 3U36A 4JN2A 1NGWB 1QRNB 1XGPB 3NFSL 5EORL 5C0EA 3U1SL 1MWAL 4DQOH 3R0MA 2BSSB 3FQUA 3F7VA 1OAZH 4GUPB 5DJXB 4G6KH 1KN2L 3IKCA 5L0QB 1IGFL 5TQ0H 1I1YB 1OSPL 1VFMA 1NGPH 5CHNB 3VFTB 3HUJF 2ATKB 1AGEA 2FO1A 5EC2B 1BPVA 2GITA 4LK4A 1ZHKA 4TPRL 3RGVC 3B9KC 3D5OF 4OGXL 1S7VB 3TJEH 2AQ3A 3HC0A 3HPJA 4KK8C 3C60D 5DUMH 1GZQA 5DQ9B 1VB9A 4HCRA 1BBDH 2O93L 1KT2A 2KQMA 4YHNA 3FO0L 2PTTA 3KDMB 4M6OL 4O51B 5IBTH 5LGKA 3FCTB 4WTWA 3WHXA 4XPFH 5BMFH 3VXNB 4QGTA 3FMGH 3REWA 4H88L 4JFFA 1KFAH 2CPCA 2GKIA 4ORGB 1YDPB 2ARJQ 4R0LA 4X98A 3VFWA 4WJ5B 4KK6D 2DQTH 2FBJL 4Z7VB 3DNKA 3L7EB 3CFCH 1B0GB 2P8LB 4DCQB 5T5FH 4GXVH 5JORA 2PXYB 2EXYD 1CFQB 4L8SA 4WCYL 3V4PL 2W0FA 1NGQH 3STLB 1KN4H 5JW4M 5GS0D 3CH1B 3A6CL 1RZGB 3UDWA 1DQLH 4QHKI 2R0LH 4A2MA 4HG4J 3FOMA 3RVTC 3DMMD 4U1NB 5FUOL 1D7FA 4DVRL 1IZKA 2LVEA 1ZHNA 2FCBA 5I15L 4F7MB 4JN1H 1CDGA 3IYLW 2OJZL 2AXJA 1NCCH 3D85A 3OXRB 5CEZH 3W5NA 3WO3B 2VXSL 3IFPA 2PW2B 3BPLC 3R0NA 5FAAA 4JQVA 1XIWC 5J12C 5CZXC 4PJXA 3HZMA 4X4MA 1TJIH 5IB4A 1C16B 3CMGA 3S37X 3VA2C 5ABDE 3LD8C 4HHAA 3N1PC 3IRZA 4XBGA 4PRID 4WUUB 4HWEL 4LPVA 4PJFA 1FVCB 2D7OA 5EU6E 1AO7E 4YO0B 5HDQL 3HC3L 2HKHH 4P4KC 5JXEC 4TULH 4PV9B 3WXVH 4XCYA 4RIRB 1Z5LA 3JWDC 4Y4FC 2C3WA 3CDCA 4TNVF 3ARDA 3LS4L 2ZG1A 4M8QB 4X6EB 4M1CD 3A67L 3BQUC 2VNCA 5SX4H 5BCAA 1QBLL 1FFPA 4Z7QF 2YZ8A 2JELL 2DQGL 2IFGA 4QWWD 3V0AC 1HKLL 4L8CB 1TQCC 1C5BH 4WW2B 2EDJA 5AEAA 2RIKA 4NO2B 4I13B 5T1KD 3BGFC 2XKUA 4HS3B 1YEJL 1ZGLP 4HPYH 4LEXH 1B88A 1U3HC 5TE4L 3MX0A 1KEGH 5EBGA 3LKOB 4PJDA 3KJ4B 4OV5B 3KS0H 1ZA3A 3QFJE 5AD0B 1ZANL 1EGJL 1FJ1B 3C60A 3JTSA 2HT2D 2VDOH 3UTSD 1HHJA 2Y9RT 2XICA 2DQFA 4MLIA 4MVBD 3KYNB 4YUEH 3L1OH 3QQ4B 4GUPA 1MJ7H 2AJUH 1FZOA 3ULUH 4ODVH 3RWEA 5CHNA 5F6IC 1LWRA 3TBWB 1LILA 4YBLC 4MHHI 4Y4HD 1MPAL 1HYSD 1S7VA 4YDIH 2WAHA 1U8NB 4LU5L 3UJTL 1MCLA 1PEZA 4PJ5B 5DQ9A 1J05A 5IB3A 3MLWL 4OCWL 4G43B 4ODXA 2A6KA 4TSAL 4LLAA 5ACLA 4U6VL 1CE1H 3HC4L 4XX1G 3MNVB 4G9DA 3VXNA 3DMMA 3O45A 3VFRB 1TPXC 2ZNWA 3FONB 5FGBA 1N5AA 1XF4A 2J5LC 3OAYK 4J12A 4MA1C 3LAFA 1YDPA 3QEGH 4WJ5A 5GSVB 1RY7B 3KYOB 3QG7L 4X5WB 3NCBB 1JRHH 3U83A 1MNUH 2P8LA 4DCQA 1OGAD 2R9HD 1I7TA 3B43A 3EZ8A 5D7LB 2J1KA 2NXYC 4KPHL 5EU5B 4H20L 4GAJL 4RFEB 1TVBB 2OL3B 3GSXA 3MRPA 5E2TL 3IDYB 4PGJA 1BX2B 3QFDB 1RFDL 1JE6A 1MEXH 4U1NA 1B2WH 3GSNB 1CTOA 1UWXK 2V17H 4Z7UF 5HI3D 1FO0B 3MLTA 2GJ6B 4PYHA 4M9PA 1OAUL 3GMQB 5FUZL 3WL9A 1ZT4B 5L88H 4LLUA 2AJ3B 3RU8H 4HWBA 4F9PC 3VXTB 3QAZC 5GJSH 1FSKC 3RJDA 4YHIA 2BNUA 2RBLA 4PGBB 1J0HA 1X5YA 4C56D 2YS4A 3U9UA 4YWGL 4L5FL 5GGRY 1A7BA 5JHDD 3KWWB 4WUUA 5JW3L 1MJ8L 2DJ4A 3PG2A 3RVXC 3KPMA 4ELMA 5EZLB 5JXAH 5MEND 4HXAH 2D4DA 3UPCA 3THMH 1S78C 5BVPH 5B3JF 5KZCB 1TZGH 4Y1AA 3PQYD 1OHQA 1UCTA 3ULVE 4P9HH 4NQEB 2NY6B 4U1HB 3F5WB 3MCKB 2XN9D 4TTDD 4M8QA 5T1KA 3L3HB 5DJ6B 2LQRA 5F9WB 4GH7B 4H26B 2BFVL 2VKXA 4NKMB 4NQVA 5IVXE 4AJ0A 2AEQH 4B5EA 1GC1H 1SEBB 5LWYL 5HYIA 5GRUL 4HX1A 2Z92A 3K8KA 5DGQA 1CE6A 5CJQL 4FQXD 2L7UA 4MDJA 4HMCA 2ZJSH 3QIUB 2J2ZA 1ACZA 2VDNH 3KPOB 1RUMH 1UB5A 4XH2B 1K6QH 2FB4H 1MFDL 3G9AB 1U8MB 4W70A 2Z31D 5T33H 3B9EA 4Y5YC 1OB1A 4MSWA 3WDJA 3U7YH 3MXWL 1P4IH 4DUXA 4L8DA 3QHZH 2HN7A 2MFNA 2VMFA 3VWJA 2X44D 4EDXB 4RZCA 1MWAB 2NY3C 2X4TA 1BJMA 1FJ1A 3B3IA 4PJAF 4NJAL 5C9KA 1AKJD 2GTWB 5GS1A 1FNSH 3RX5A 2UWEF 3DUUB 3OB0K 5J3HD 5JLZB 1RIUH 3V6OE 4X5XB 3HG1B 3IF1A 4XC3L 1BQUA 1E4WL 4K9EL 4KRPC 3TBWA 5DHVB 1IGCL 4R8WH 4Q6IB 4QRUA 1SBSL 2F58H 3UO1H 3T0VA 3TF7C 1YEFH 1EFXB 3TEUA 3BWAB 3WNKA 4MCZA 1U8NA 2DQHL 5B8CC 2O5YL 5JDSB 1BIHA 2GW5A 2VL5B 1BFSA 4I9WE 1K4CB 2GK0A 2WIIB 3JWOL 3BVNA 1JGDB 4P23C 1FN4B 3BD5A 4L9DA 4UOW0 2HJFA 2OBGA 4JM2A 1J1PH 1EJOH 4UUJA 2M1KA 4UILL 4Z0BH 5GS2H 3FONA 1CL7I 2VLKB 4AENA 1X4XA 4L9LC 3SHSA 1M7IA 5I75B 2QR0B 1KBGL 1KB5A 1NUFA 5HI5D 5GSVA 4R97C 5F8RC 5EPMA 1ORSB 3KYOA 4LRNH 1YJDH 2M2DA 2IJ0C 4LSTH 2EDDA 3QIBC 4QF1B 2CMRL 5GGQL 1O7VA 3GZKA 5EDXA 3JSSA 4KY1H 1T0MA 1T22A 3AFLA 5CP3H 5D4QA 3WNLA 4JRXA 4ZG1A 2OP4H 1D9KA 4I3SL 5EIIB 3SJVB 3LKNB 1U3JA 5FOJA 3WE6A 3ZLQC 2J6EH 4F2MA 3KXFA 3MRDA 3N0PB 3GMQA 3V9FA 1CQYA 3NZHH 3D25B 1DEEA 3STZB 1JNHA 2X6MA 1T1WA 3ECBB 1RZ8A 1QBBA 4F7CB 2A83A 2J12B 4PGEB 3WFDH 5DJYB 1HZHL 2YPLA 4PGCB 3FRUA 1RZIA 3PHSA 3CC5A 1C5CH 4FQXA 4ENED 3S4SG 5A2LH 2Y36H 3SKJH 1UG9A 3NZ8B 4ZS7H 5EH1A 3T4AB 4ZAKD 1H3PL 3NTCH 1IC1A 1M6OB 1ZGLM 3MJ6A 3IDNB 1QO3B 2ZP0T 4M1DH 4LCUB 1ZVSB 4R7NB 4U1HA 3RY5A 4PRHB 5ACZB 2Z31A 2VISB 2OR7A 1A3LL 3B2UC 1I1AB 1OAXH 4G42A 5D2NE 1MRDH 5MERB 1A1MA 3C5ZB 3D1MC 5ALBH 3GIVB 5IHZA 2ZCHL 4LVNB 4PY7B 3I50L 1AKJA 25C8H 1MCRA 2I25N 4IRZL 5DK2A 1T21B 2AJVH 4CMMA 4GAGH 3GIZL 4XP9H 4G6JL 2G5BA 3VWKB 5JQ6H 1RK1B 4HWZB 4OBRA 3AAZA 1UYWH 3FFCB 1JNLL 3PWUB 1CDHA 3SDAD 1S9XA 1I3RA 2OLDA 4JY4B 5LGJA 3EOBA 1CZ8L 2FX7H 4RFOH 5E9DD 3BHBB 4NWUH 3F7PC 2R1WA 2DI8A 4JZOB 3MRGB 3VXQA 4JPWL 2UVFA 1I8IA 1A7PL 1MCJA 4MMXC 5DMJB 2AJYL 3OB8A 3IGAB 5E4IA 4AM0A 3V4UL 1RJLB 1YYML 2DIBA 1S7WB 3BZ4A 5DHVA 4ZXBB 4XWGL 4JFED 4Z6AT 3FQWA 4PRNB 2IAMD 4XXCC 3V2AR 4OFYD 5CIPB 5DD0H 3RWFB 4K3GA 2F53B 3MRNA 1MH5B 1JGDA 3ULVC 2QADC 4FQHA 1QKZL 4WI6A 4OLXH 3SGKC 4MDIA 4MB4A 1T2QL 3RQ3A 1T2XA 5DD5L 5EOTB 3RZWA 4ZS6D 4NRZB 3F65A 3PF2A 3LS5L 3S98A 3V6BR 1KLFA 1MCWM 1ORSA 3WIHH 2HG5B 4AYFA 2ITDB 2AQ2A 5IK3B 1ZHBB 2X4OA 3MNWB 2MQ3A 2ADIA 4EN3D 4XP4L 2WQ8A 3EO9L 4RGMB 1F3JA 2CGRL 2AP2A 5EU3B 1DQMH 1RIVL 2V2XB 3SEPA 5FYJU 4TSBL 2XTJE 4YHPB 5KS9A 1I1CA 3SOBL 2AI0L 1AE6L 1H5BA 5HY9B 4G8GB 2W0KA 3MV7E 3SBWA 1HSBB 4P3WA 2F8VA 3PABA 1U6AH 3ARXA 1HYRC 4XVUD 4ZAKA 3V6OC 3OF6D 1GCFA 1XMWA 1QSFD 3AMKA 1KB9J 1MOEA 3LQAC 5ESAA 2IADB 5IBLC 2V7HB 1H3WM 32C2B 4WFGE 4WO4C 5D6CB 2ZNXA 3I85A 5I18H 5HJ3B 5SX5K 4XVSL 1QEWA 3OG4B 1Q9LA 3QIWA 4K71C 1A6AA 4ORZC 1S3KH 5F3HA 1U93A 1GZPA 4NKQB 4UDTA 3UYRL 4ZUTB 1X4YA 3DX9A 1R3JA 2EICA 2B1AH 3O2DH 3BPCB 3U46A 4LCUA 3LPFA 4HCRL 5ACZA 1OTUD 1A6VH 2B7DT 3PV7A 4OCNC 4WFFE 1LEIB 2GY7B 5E8NA 1CD1B 3MLRL 1DN0A 5MERA 2WMPA 3QG6B 4K3EH 4MQ7B 5HYJD 1IFHH 5KVFH 2KPNA 1AIFB 3K8LA 1AGBB 4S1DC 1KPVB 2PCPA 4OF8A 1OARL 5CP7B 2J4WL 1S7XB 4V1DB 1MLBB 1MCDA 3D6GA 4H25A 4OSUH 4KROC 1RK1A 4D8PB 4WWID 1JHKL 5JUEL 1IEAB 3FQXA 2R2CA 4KMTL 2Z4QA 3LEXB 1KCLA 3P11H 5IF0B 4PJHA 1LDPH 3VFPA 4LKXA 4F9LA 3GJEB 4JFFE 1ITBB 4RSVA 3T0BA 4XBPB 3BHBA 2BY2A 5CBAB 4Y2DB 3HI5H 3CVIH 4KXZH 2LFGA 4NNXB 4C55A 4PJ8B 5KSAD 1PZ5B 2YPVH 3QR2A 2CIIB 4Y5XA 1S5HB 4MJ4A 2AJXH 3V8CA 2DLFH 3LKQA 3VW3L 5FYJD 3EUUA 4LVEA 4S1QH 3SDXF 5JOFB 1DP0A 3L5WA 4XMKH 4U49A 4Q2ZB 4PJBF 1S7WA 3QI9D 4ZXBA 1F02I 4X5LA 1A4JB 2OSLA 5IJVB 1XAUA 3QCVH 2DKUA 3C8KB 4NZJA 1REIA 4KKCD 5MHSE 3DV4B 3SGEH 3BMVA 1CXKA 3TIDB 4P46B 4OD3H 4OQTL 3RWFA 1CICC 2Y4SA 4XMLL 4EN3A 1R3KA 5IOPA 1YY9C 4UQ3A 3AS0A 1F4YL 5IR1A 4AL8H 4HKJB 4TVPD 4ZTPL 4X4ME 1H9VA 4XPAH 1A1NB 1NFIA 2HH0H 4NRZA 3V5DB 5D2NC 1BM3H 2GK2A 5FV1L 4AEEA 2A6JB 1CT8A 3EJYD 2FJFA 1IC7L 2F54D 4PJFE 1R3LB 4N0FB 4L1HA 5L8KB 4XVTH 4WEBH 1ZHBA 3BMWA 2VITA 1ZLVK 4D2NA 4NQDA 5DS8A 3ZE1F 3FFDB 4JVPA 5J1TC 4I2XB 1D5MB 5EU3A 2K7PA 2WIMA 3OX8A 3QUXD 3DRQB 3HE6D 2XA8L 3WD5L 2NY1D 1NQBA 4QXTA 1IILE 2OQJB 3VFVB 5T5NG 5IJKA 3BD3A 3DV6B 3UTTD 1KPUB 4G8GA 1HSBA 3B9AA 3IDUA 2QHLA 1KACB 3BKJH 1UZ6E 3G5XB 4J8RB 2R2EB 4JANB 4PG9A 4S1SL 1RHHB 1QFUH 2AVGA 4RRPG 5DQJA 5HPMB 3U0WH 32C2A 4ZFZA 5HJ3A 5L8LB 2C1PB 4D0BB 3M17B 4HF5L 5IFJB 1X44A 4PJDE 3HFML 3BUYB 1I7RA 3LH2L 2B2XL 4ZUTA 5I1IH 3O11B 1T89A 2FSEA 5FUCC 1UWEH 2VXTH 1U8IB 5ELIA 1LK3L 3QUMH 5D1ZD 4FQIH 4TNVK 3MPCA 5GS0L 5ISZB 4Z76B 4LSPH 4LSSL 4A6YA 1I9IL 2VLMD 1H15A 4N9GA 3ARGB 2DAVA 1NCDL 3KPLB 4KHTH 5HHNB 3HNTH 4UV4L 2X1OA 5KSBB 2DQDL 3WUWB 1AP2B 1QLRB 4Y4KC 5KSAA 1IKNC 4PFEA 1J7VR 1TITA 4JFPB 4OZGF 4V1DA 3ZDYE 1WT5A 3QNXB 4H1LA 4PJ9A 5ICYA 5AAMA 4FZEL 5GZND 3D39D 4X9GA 5FYLD 2DDQH 2ZSWB 3QI9A 3VG9B 2DS4A 2NY5C 1DVFA 5IF0A 2H45A 5TF1L 3DO3A 4O00A 1J1XL 5J89A 2XTJC 3GHEL 2C1OA 5C0FA 3MFFB 4LIQE 5HHXH 3RWCB 1MFCL 3WJLC 1Z2KA 4ISVA 5A3ID 4X6DF 5C07D 4KI5C 5B38A 2D0HA 4KC3B 4MMZC 1G7HA 1S9WB 4HWBL 5C09D 4EQ3A 4UTBH 3QUYC 1TQBB 2YUVA 3LZFL 5D7KE 4Q2ZA 1IQWL 2NTFB 2NZ9C 3W2DL 5HHMD 2Z9TA 3QPXH 4M1GL 4X6BB 2R69L 3MLUL 1T1ZB 5HHOB 3NVQA 4ONOA 4MB3A 3AS1A 4N90D 1GGIH 3HKFA 4PTUB 5E8OB 2PR4H 1CXEA 2UZIH 3TYFA 3RA7L 5FOBB 1H8OA 3VFMA 3H42H 1V3KA 1U8KA 4JGMA 3L9RA 4DZ8A 2XNAB 3FB7B 3V5DA 3DETC 2IPKB 4LEOA 4ZUWB 1NSNH 4Z9KB 1FG9C 1FYTA 2FEEL 5GJTH 4WUUE 1PX3A 3O3AB 1FLRL 4ELME 5FDYA 5IVZA 3K1DA 4KJPD 4XMPL 5GZOC 4OZIA 3EYVA 4PLJC 2YMXH 4HIIA 4Y1AE 4IHOA 3G6AB 1TTUA 4K7PL 4I2XA 3ARWA 5IB2B 3TIEB 3MGOA 1JPTH 2KQNA 1PVHA 4FRWA 4PREB 2CRYA 5C2UB 3LV3B 1HHHB 3OAZH 1V7MH 5CEXA 3ZKNC 3WN5C 1PY4A 2ZSVB 4TYUA 3BEVB 4ODBD 5E7BA 1BAFH 4DZBB 4MAUH 4QRSA 4YX2L 1ZWIB 4OCRH 1N0LA 1W72L 4FG6D 3BSZL 2G75B 3B6SA 4MS8C 5BJTB 4P5MA 4HKZB 4JDTH 2UUDK 3O8XD 3S4SB 4C59B 1AGFA 3GSUB 1G0XA 1QYGL 1O0VA 2XWTA 3CMOL 5E6IB 4JKKA 3QEUA 3CDYA 3E8UL 3MUHL 3EO0A 3UC0L 3SGJA 2C1PA 2Q7YA 3AM8A 3CLEH 1QHOA 4N8VB 1NGZB 3HB3C 3M17A 4JO2L 5IFJA 3TV3L 2VR4A 1DJSA 1H3GA 5DZNA 3WIIH 1JZ7A 4HEME 4EI6A 4OD1L 4MGXA 4P2YA 4JQVC 3WCYA 1AFVH 1KLGB 4OT1L 1EPFA 4M00A 1WICA 3BX7C 1K5NB 1AQDB 5I2IB 3P4MB 1J0ZA 2WWMD 4ZD3H 2EEAA 4JPIA 2HFFB 4XPTH 2EDWA 1KB5L 5EOCH 5I73C 1AP2A 5D71H 5C07A 3T3ME 3LKPB 4M7KH 1XH3A 3QNXA 4GG8A 5C09A 1PEWA 1IQDB 2IPUK 1SEQH 3N50A 3VD9A 4DN3H 3UZQA 5I8CB 3EZJB 2XTLA 1BJ8A 4U6TA 4W6WB 3L3IA 5F7DB 3W5MA 1FAIL 4YBQD 1DUYB 3LPGA 1J0JA 2FYYA 1NEZG 1EJ6A 3FB8A 4PRBA 1FP5A 3RZCA 3EFFB 3OJ2C 5CLTA 5E8EB 3QCUL 4Q9BA 2R0KH 3LB6D 1H0DB 2JE8A 1XT5A 3QUZB 1ITCA 4JRXE 2EKSB 1A7OH 2J8HA 3E6FB 1DQQA 3OKKB 5DVNA 1JFQH 4M7ZC 3RHWK 4AIXA 1IGTB 4DKEH 1UH4A 5GIRA 2R0ZL 3EGSA 4X6BA 5DUPH 3GMLB 2Z35B 1AGDB 2A1WH 1NLDL 2DKMA 3KXFE 3KLHD 4JRWA 3HLAA 2PNDA 1A8JH 3IXTB 3TH4T 4ONFH 5HD8C 2G9HB 5J1SC 1MRCL 2VDMH 1PSKL 2GFBB 4RA0C 5L0QC 3PGCB 2F5BH 1I7ZB 2I9LB 3FB7A 4ZQKB 1HSAB 1RZJH 1T4KB 1U8QB 4HFWA 3NA4A 1M71B 2YPLE 2VABB 2OTPA 3KGRA 2JIXD 3QCTH 1LO5B 4UDUA 5H8DA 4I0PD 4HUUB 4NCC1 2WLYA 5DD1H 3MRKB 3O81A 2EE9A 4QHNA 3GFUA 1MAML 1A3QA 5I16B 4JFYB 3OTTA 2IEPA 3ILQD 3BN9C 3NABL 2ZSVA 4PJEA 2R4RL 3H7BB 4J3TA 4OUUA 1E27A 1OGTA 3VCLB 1ZWIA 5DRWB 3CLFL 3G5ZB 3NIDE 3FTGB 5BJTA 4S2SA 4LQ1A 5F1NB 2GAZB 3ALXA 4CAGA 2PXYC 4JZJB 4UMGA 3GSUA 5KVGH 1RSFA 2V2WB 1YEHL 2YKLH 5D70H 1LK2B 5E6IA 2LTQB 3QHTC 1IGJA 2BSED 2WBJA 4OCLC 1PGRB 3DSFL 3IJSB 2HLFD 1Q38A 3QDMB 4UTAH 4N8VA 3UYOD 4K3DH 2BC4B 3SY0B 3MOBL 4I5BB 4LKCA 1OW0A 1QSED 1RV6X 1U8HB 1DBAL 4N8CH 1OPGH 1G7JB 1FH5H 4KKAC 1EX0A 5AAWA 4NJ9L 2H1PL 4I48B 5GRWA 1INDL 3PJSB 3EO1B 2UYLA 3D0VA 5J1AA 4MD0B 1DE4B 3ALPA 4QRPB 3QULB 3FO1A 4U6HB 5C70A 1WK0A 2HFFA 1GHFL 3CGTA 2H26A 3NCFB 4F3FB 1CD0A 3FT2B 4QTIH 1CDIA 1Q9OB 2ZPKH 1TTFA 4PB9H 1H3VA 1RZKC 2VE6B 2W07A 2IALB 1XGTB 2HLAB 1CD9B 4KZDH 1CD8A 1XR9B 5CP3A 4Z7NE 5ADOH 4P99A 2VKWA 4XWOC 1K8IB 5E99H 5C0JB 4YPJA 4DVBB 1G6RH 2BSRB 4G6ML 3FO2B 3L3GB 1J5OH 1A9EB 4KQ3H 1A6ZB 4URTB 4WW2C 3EFFA 4YXKH 1JPST 2D7TL 5ADPH 4CW1A 3C9NB 3FRPG 5EOCJ 5KS9E 5I76B 4L3CA 5IV2B 3VWJC 1TETL 3IJYB 4KJWD 3BGMB 1TCRB 2RFXA 3KJ4C 2VDKH 1HE7A 1IT9H 3I9GH 1RMFL 3V0VB 5MEQA 3FQRA 1CGSL 1S7TB 3MRQA 1W0VA 3MLXL 3NIGE 4QHMA 2FWOB 3MV11 3SDCD 5I1KL 1GAFH 1KJVB 4C83B 1MLCB 2ZCKH 2D7PA 5DFVD 1IAKB 5BZDB 2HP4A 1CL7H 3O0RL 1HSAA 2JTDA 1T4KA 5I1GH 4EJ1C 3PP3H 4RAUA 1HILB 2Q6WB 1MJUL 1TJGL 5E0QA 5GGVL 3WNMA 2VABA 4X7DC 1CBVL 5FO9B 1HEZB 1WZ1L 2EC8A 5E00A 4XAWH 1OWWA 4M8VA 1SYSB 3MRHA 5E5RB 3T3PE 2NW2A 3BH9A 4KVNH 3O6ML 4JHWL 2J88L 1BREA 4I8DA 2XG5A 1S9YB 4JFYA 4Y4HB 3F6IA 4JM2C 4NQUA 1GOFA 4AMKL 3U30B 4ETYA 3OAZK 3ZDZE 2JCCB 5BOPA 4LCCA 4H1LG 3DBXB 2YK1L 3PWLA 4U1IA 3RL1A 3MOAL 4QT5B 3L3JA 3MACH 1A3RH 2FR4B 2GAZA 3VJ6B 3MTRA 5D7JB 4UQ2A 1FFNB 1YY8B 4M6ML 4HDIA 1VACB 4NQTA 2ZUSA 1GGTA 2XZQL 3IDYC 2BHZA 4Z77A 4NO5B 4QRQB 3VXSA 3T0XA 2YEZA 4JPVH 3U4EB 1Q9KB 3IJSA 4ONHB 3GJFH 4PJHE 3WS6C 4ZUSA 3MLZL 5HHQA 2LU4A 4PG2A 5B38G 5ITBL 3FQNB 2FEDD 1U8OB 2BC4A 1FDLH 4LGPB 4U1JB 5FYKE 1RUPL 1DBKL 1LEKA 4YLQT 3CX5J 1NDGA 4RGND 1OL0A 3EYFA 5T1MB 3MRJB 2VLJB 3FB6A 4L4TB 4U0QB 5I1HH 4M5ZL 1Z9MA 1HH6B 4Q7DA 3T2OA 4LLDA 2EE6A 4RWYH 4MD0A 5A43C 1T04B 1JUFA 2IGFL 4QRPA 4J4PD 1ZSDA 4X4ZA 3O6LH 3SE4C 3W9EA 4F3FA 2FJHB 3VXUB 3FT2A 3B4NA 4M6NH 5CCKL 3L5JA 4XZUA 4J3XA 4LSRL 5EZOH 4C56B 3PV6B 3PL6D 2VQ1B 3U0TB 4JPKH 1ZGLA 3JV6A 5E6ZA 2IALA 2NY6C 4O5LL 5JHDB 1ONQB 5CJOH 5F9WC 5MENB 2MJWA 1BLNB 3ULVF 3CFJB 3ES6B 1UA6L 4MQXD 4OAWB 5C6WH 5T3ZD 4JFZL 2WBWB 3BIKB 5JA9A 3FO2A 3IS1X 3M8OL 3L3GA 3PQYB 1U58B 3KR3L 5LAXA 4AT6B 1J86A 3D3VB 3QIUC 5IVXF 5J0BA 5J6GB 4BZYA 3R06B 4NQDE 2EC9U 2XZAH 3ZTNH 4HS8H 2F8OA 1IM9B 2JJUA 3TT3L 7FABL 4MB5A 1BEYH 1M7DB 4XPGL 3ULSA 3GGWA 5IFHL 4G6KL 4HJGA 4HIJB 5K9JH 5TQ0L 1NGPL 5C0IB 3IDGB 5E6YA 1H8NA 5I76A 3K4DA 1GOHA 2HKFH 3BP7A 2QQKL 2NY4B 2VDRH 1JPGA 2P5WB 2P7TA 2WANA 4G8GE 1CLYH 3P4OB 1A14H 4X4XA 4NO0D 4F37F 3WKMH 1N5YH 1JMZA 1YC8A 2E7LC 3TJEL 1VDGA 3ARVA 1S7TA 2CUMA 3QUMB 1ZLUH 3IVKA 4ETQB 2EE2A 3EDFA 3RDTD 3REVA 2R15A 1F5WA 5E56A 1T1YB 5M7QA 1Y18B 8FABB 3RTQD 1KIQA 1HILA 4A6YL 1YEGH 3ZKMC 3V79C 4LQFH 1XZ0B 2RCSH 1KJ3H 3OGCA 4PJIB 1X5LA 5FGSA 4WDIB 3PNWB 1KULA 3WJJA 2DQTL 1YPZA 4J23A 5GGVY 1G7PA 2EDRA 4LAQH 3CX5K 4NDMB 3NIFE 2QBWA 2VN7A 1KOAA 1B0WA 4NZTL 5FYJL 1NGQL 1CVRA 3QO1A 4OLWH 1DQLL 1T7ZA 1OF2A 3ME0A 4UB0L 4HH8A 4NZRH 5EIQA 1XR8B 1NAMA 4NM4L 4JB9H 4XCEB 3RAJH 5I75C 1CF8H 4WHDA 3MFGB 5ESVB 2FX9L 3W9DB 1QBAA 4AEIH 3HZYA 2FR4A 4PGDB 4V1DE 3QZWA 3VJ6A 4OKVA 5E5MA 4UT6L 4JFDB 1ZEAL 2NMSA 3KPQB 4XP5L 3KPPA 4XNYH 1NGYB 1PQZA 1WBYB 4RISH 1AGCA 1Q9KA 1FZKA 2MHAB 1T5XB 4BQ9A 4HPOH 3FQNA 4F8QA 2RR3A 4YIQA 3ZO0A 3A6BL 5DC0A 3H9HB 4XC1H 2YBRB 4EXKA 5T1MA 4IBLT 1DQDL 4A2LA 4FS0A 2I24N 4HJ0C 3VXPA 4X80L 4QOKB 4YXLH 4L3ED 3K2UL 3S96A 4JFOB 1DZBA 4FQ2H 2DWDB 2QSTA 4MA8H 2BOBB 1Z0MA 2VR9A 4GMSH 1L6XA 3I2CL 1LE5A 4PGZA 1HCVA 4PTTB 5EO9B 3BP4A 5D9SA 4ODTH 2VIRA 4KTDH 1VFAA 3QIWC 3VXUA 1D5ZA 4HXBH 3L5XL 3TGXA 4OFKA 3W0WD 1F8TH 2W65B 2G60L 4HMEA 4GKSA 4U1MA 4CJ0A 1KTLB 2YC1A 5E2JA 2UZXB 4PRPD 1YNTB 1NBZA 3FAWA 5D7IB 1I1AC 3E6HB 4G3YH 4Z95H 5ILTH 3CFJA 3ES6A 1FYTE 4OAWA 1RUAL 3IFLL 1VEMA 5ID0A 1KEGL 1FVEB 2CLVB 4NO0A 5C0AA 4OZIE 4WFED 5IW6A 3D3VA 4LVNC 5BZWB 1IKFL 5GRXG 5EFIA 3SDDD 3Q5YA 3MV8B 3R06A 1ND0A 1FNLA 4OM1L 2ICES 1AI1H 1EO7A 4I2XE 2XWJB 1IM9A 3VWKC 3L1OL 4GSDH 2HJLA 4G8EB 4YBHA 2AJUL 4BM7A 3ULUL 5T3XH 3PHQA 4HBQA 1T0NA 4KTEL 3MRCB 4YR6A 3WIFB 3UROR 4EBQL 4JO3L 4KQ4H 4NSKA 2GEEA 3EDKA 1RZ7H 1F11B 3MOQA 3P0VH 2VLRA 4IIQB 2VC2L 2XZCH 4U3HA 5F7HA 3QXAA 3HMWH 4EUPA 2I9TA 2BVOB 4DW2H 4ZOBA 3ULUE 4K2UH 2HVJA 1B6UA 1QFHA 4PLKD 1MFAH 4EI5B 3L3OB 4ZXBC 5E9DB 3ROOB 2Y72A 1W8OA 3AU1B 1RJYA 1ACYH 4Q58C 1KIPA 4WY7H 5EC1B 4R4BA 2NZIA 3L3KA 2E9JA 5IESL 3T0EA 4F58H 1MNUL 1DLFH 5D1XD 4NDMA 1F42A 2VXVH 2N7AA 3LN5A 3C08H 4K8RC 1Q1JH 1I3GH 4JFEB 4CU7A 5TE7L 5ICZB 3BDXA 1X5JA 1KYOJ 1XEDA 4NBYB 1NGXB 4HIHB 4GG6B 1NMBH 1RD6A 4YHOL 5J57B 2Q86A 4E5XB 5ESVA 2R1XA 1EEQA 1MCCA 4FABH 5IMLB 3I3BA 5C08D 3GMPA 4KI1A 4U1LB 1BGXL 4LNRA 5KSUA 4OFDA 5C09E 4JFDA 1YEIH 4HH9A 5L7XL 4RGMC 4Z7WF 3V7AG 5I8EA 1QQDB 2UV3A 3C6LB 3T4YB 3ROLA 4IS6A 2VOTA 4B41A 2KUTA 2YPKB 3CSPA 2D31B 3GJFK 3JV4B 4OKDA 5GHWL 1EHXA 4PJ7B 5I6XB 5IFAH 2WM0A 2H2SD 4TUKL 1T03H 4TUOB 4HXAL 3MCLH 1FORH 4DKFL 4U6YB 4XBEH 3WS3A 4ELKB 1MJJB 5BVPL 1L9MA 4UOW1 3H3KA 4XCCH 4RQQB 3FB5A 4EQ2A 1AHWA 5TH2B 2XXCB 1XCQB 4M03A 4NNYA 3P9LA 5EBMB 1MUJB 1YMHA 4NRXB 2C4FT 4KUZL 5C6TL 5DK0B 3OHXA 1WBZA 5H35A 5L2JA 5AUMB 2H32H 4OFIA 3PWNB 4PTTA 1IEBA 2LU3A 4LHUB 3RWJB 3DYPA 3VXRA 2QQLH 3SDDA 5DR5H 1QSFB 4LRIA 2AW2A 3HR5A 3NN8A 2VDPH 5F7WC 4HWNA 3DUSB 1KTLA 5AYUL 4KZEH 4BK5A 1WWWX 2O61A 2EH8H 2AV1B 5MI0B 3QXDB 4QYOA 4GAYB 1R24B 3QWQB 5BVJB 5E2VL 3ZT6A 5FECA 3GMNA 4TVSa 3EDEA 4OM0L 1DDHB 1FVEA 1M05A 5BRZB 1EA9C 1CFNA 2DBLH 3BRGC 5CMAA 5JW4R 3BDYH 4Y16A 3MV8A 1AR1C 4N1EA 4DGVL 1WT5C 4GBXD 4MAYA 2X7LB 1S5IH 4D9LL 1PBYA 3KYKL 1S7RB 1T83A 3SQOL 5E8PB 5LGHH 5HYJB 3BKCL 3SO5A 1DVFC 1RK0B 2CSPA 4JGJA 3B5TA 3LMJL 4PJEE 3SKOB 4R8WL 4QRRD 1RUKH 4IEFB 2OMBA 3T1FA 1KYOK 4NZDA 1YEFL 4YHLL 4G8FB 3WXWH 1JCKA 1UEMA 3X13A 4PJ8C 2BP3A 1A0QH 1OCWL 5D1XA 1BIIA 3FT3B 4K23L 1RUQL 5IROC 1P5UA 5CEYA 5B39B 3LKRA 2NY2D 3GMOA 2FD6H 3NOIA 3PP4L 4EI5A 3L3OA 3UZEA 4NQXA 4YQXL 1EJOL 3T2PA 3AU1A 1F3RB 1LO2L 1KCSH 3G04B 4APQD 5DMIL 3LQAH 1WSST 5DI8A 1UQSA 4P46C 4XVJL 1YQVH 4UNTA 5C08A 4P2QB 4OGYH 1IC5H 5JR1H 5DRXB 1R6VA 1UM4H 4XNZB 1RU9H 3H9ZA 4XNUL 1Q0XL 2X1XR 5DO2C 4KY1L 2OR8A 1YNKL 3F6LA 3V6ZB 1S9VB 1NGXA 4HIHA 4D9QD 1A7NH 2R4SH 1A22B 3K8MA 4BSWB 3OR6B 5I1EH 1C12A 3KJ6L 1NMAH 5MEPA 4U6XA 5J11B 3EOTL 1YEEH 5IMLA 2BVQB 1FG2B 2EYSB 5D72L 1DBJL 2HMID 2EO1A 5F7NC 4MA3A 5DWUL 1CU4H 3K46A 2XQBH 2W92A 1KJ2L 3RGVD 3B9KD 5F70A 1VKXB 4HIEA 2F54B 4F15B 3V5KB 2XT1B 1VSCA 3MA7A 3ZTJH 1UGNA 4U6YA 2GT9A 3GUTA 4L4VD 3EYQC 2CKBA 4MJID 3QUXB 3MLSL 1SYVB 4ZS7L 4JR9H 4R7DA 3Q5TA 3AS2A 5LBSH 4OV6F 3TBSA 5CJBA 3ULUC 3S34L 1ZHLB 4NRXA 5T3ZH 3U4AA 5KVMC 4Q97A 4UU9B 1UZ6F 2O5XH 1RZFL 4NKDB 3UTTB 2VDLH 1JZ5A 1R5IB 3TNMA 5I17A 3AM8C 2X40A 4LHUA 4NC0B 5AG8A 2CRMA 5F7UA 4I3GA 4GW1A 4UV7L 5ALBL 1HIML 4NRYB 3WSQL 3RVTD 4O2EA 3OJVC 3ZE0E 1S7UA 4GBXA 1CXLA 3TN0D 4PJDF 3DUSA 3HR6A 2DRUA 3MJ9A 3BAEH 3GSWA 4FQLL 4NBXB 3QXDA 1UYWL 3ARUA 4OF5A 1Q0YH 4HLZG 4F7TA 4Y19D 1VHPA 3ARGC 1XIWD 5CZXD 1GOGA 5BRZA 5D1ZB 1T66C 1EO8L 3T65A 1ED3B 2SEBB 1F6AB 4KJYB 1BP3B 4DKAA 1JWSB 1U91A 4WFHD 3H2WA 1QVOA 2X7LA 2XFXB 3X14A 4N8PA 5C0BA 5EUOB 1S7RA 1WGOA 2EIZA 5E8PA 3VG9C 5BS0A 3ET9F 4P4KD 5JXED 4CU8A 3ZDYF 2OTUB 1P84J 1UZ8A 4YFDB 5FHAL 3C8HA 4TTGA 4Y4FD 5DMGD 5DMYA 1AD0B 1IM3A 3MMEB 4APQA 3OWEA 1N3NB 4UI2A 2XZZA 1JGLH 3H0TB 3TBVB 4I77L 5DD0L 3OKMB 3D39B 1FBIL 4IJ3B 3P0YH 4ZPVB 1BD2D 4NGHH 4OF0A 1KGCE 3RZCC 1I75A 1UEYA 3HS0A 4HEPG 4NN7B 4LP4A 3NA9H 3VXSE 3RNQB 5I8KH 1JK8A 2XRAH 3U79A 2CKNA 4XRCB 1HHGA 1ZS8B 4LSVL 5F9OH 1X5KA 3MBED 4DK6A 4HC1H 5GPRA 4P9MH 5HYFA 2ZZUT 4LSUH 4RMVA 5KVDH 3ARBB 2OK0H 1U3HD 4P9HC 4P4RB 3HNSH 2R2HA 5HHMB 4ZO7A 2GQHA 3V4VL 3UX9B 4QXGH 2BOCB 5TE6L 3UJJH 5JA8B 3DURA 4QRPE 1WIPA 4WI4A 5I8OL 1G6RA 43C9B 3IU4H 1GC1C 1UADC 3ARTA 4TUJB 5F97E 4S0SD 1FG2A 2Q76B 2ZUYA 4L4VA 1ADQH 1QBMH 1CLZH 3DPBA 4MJIA 4GKZB 1G7IB 2OZ4H 5C0DA 4ELMF 3MCG1 3LQZA 3OJDA 4XNQA 4BKLA 4QCIA 4BZ2H 5DVOA 4RMUA 1WWAX 1HDMB 1WCBA 4RX4D 5EO1A 5LXGH 4LGSB 4LDLB 3G08B 1HWHB 1UJ3B 1UKQA 1NCBL 4P2OB 4QHLA 2OR9L 2BCKB 1W0WA 5DJCB 2HT4C 2AK4D 3MODL 4E0RB 5EA0L 2YD6A 3NH7H 4DGYL 1PG7L 2Y25A 1WZLA 3UBXA 3ZZ1A 4LLVA 2DTML 2BVUA 5E6IC 4NP4H 4PR5A 1IAIL 1A6VL 3K4ZA 5T5NF 2IANA 2NXYD 4U0RB 2Q7NA 3K74B 5M95B 1XIWA 5F1IB 5IHUH 4EUPG 3CDFA 1P84K 1OW0C 5H2BB 4ZUVB 1J10A 2AEPH 2WNGA 2J8UA 3MRBA 4IDLA 1NCWL 2FZ3B 3FQTA 3SN6N 2QTEA 2OS7A 4ZUUA 5D6DA 4P4KA 4K3JL 5JXEA 5DVMA 1DBBH 4KU1A 5C0GA 4OCYH 4K94H 1ROWA 2DM3A 5BOZG 4Y4FA 2AXFB 2H3NB 2N56A 4BH8B 5DSCB 5E70A 3W39B 1NAML 2YOCA 4IRJB 2DIJA 3B2VH 2ARJB 5KOMC 4D9RD 1TFHA 1YJDC 2PO6D 1YPZE 1K2DB 5MP6L 3BQUA 5L6YH 1CIDA 3O3DA 4F57L 1JWSA 1BD2A 3RVXD 1QNZH 2YPVL 4YHKL 3U6RB 3O6KH 5EUOA 1T20B 3HUJB 2FATH 4S1QL 1S78D 5CZVL 3S6CA 3T3MF 4RMSA 1G7LB 3GJFA 3D2UA 3HCVB 3VRJB 2O26U 5IBUG 2AJZA 2ERJB 1AD0A 3QCVL 4OCXL 2ATPA 3QJHA 3LN4A 3I02B 4JY6B 4JM2F 4JLRB 2FHCA 4F33A 3TBVA 3QDJA 1WJ3A 5HGAB 2C5DC 2B1HL 5KJRH 4PY8J 5F1OB 1U3HA 3VGBA 1LGVA 1LMKA 4ZPVA 3GB7A 1JYXA 2VSCA 5KW9H 1F90H 2GIYA 5TGBB 1BQLL 4CL7A 1QSVA 2E27H 2EEDA 3QUZC 1MCPL 3O6FA 1CFSA 3GMRA 3GSVA 3H8NA 4FTVD 5CSZB 4LVOB 2PYFB 2DQIL 1NC4D 3L7FA 4X9FA 3VRIA 2LVCA 2R8SH 2X9XA 5EU7C 4OCSH 2VLJE 1NMCC 5DVKA 1SJEA 5E2WH 5I30L 2NY3D 6FABL 1S9KC 4WWKD 1PG7X 2YRLA 1JF1B 1U8PA 2BJMH 4YAQB 5AWNL 3TBYB 1L7TH 2HT3C 1WUNT 2D3VA 4PB0H 3N9GL 5CGYD 4KRPD 3VXUE 2I5YH 3H3PH 3EYSL 1VGKB 1MFBH 4X6FB 3BH8B 4OTXH 1K4DA 4FMFA 4KDVA 5CD5D 2H9GA 5EU6D 3QO0B 3SE9H 3HAEH 3TYGH 1FIGH 4X9HA 1CLCA 2JIXB 4P23D 5D96B 3C6SA 2IQ9H 2XKSA 1UJ3A 5FDWB 2F5AH 4L29A 4P49A 2DI9A 3QDGA 5C0AE 4YZFE 12E8L 3E0GA 3D3VE 4G80A 2ITCB 5IW1A 4FA8A 4WW1A 4OZHA 5I1IL 4JZJC 3KPSA 1FNEB 1G9NL 3NIDF 2FIKB 2LTQC 3QIBD 5FM8A 1IGML 4XXDB 4KK6C 4OB5L 4NZUL 3Q6FA 1BF2A 3VFNB 3T2NH 4JG1L 1BWMA 5HGHA 1E0OB 2W38A 3OAUL 5ENWB 3ZHKA 5CD3B 3D0LA 2VLRE 3AREB 2R29H 5D7SL 4LPCA 1Z3GL 1F45A 5GRJH 4WHYG 1R5WA 1C08B 3DSNA 1OP5K 3QFJD 3P77A 2DQEL 2GJZA 2P1YA 5I1CL 2P8PB 4I4WB 3WFEL 3OPZL 4G5ZL 1QSEB 2H3NA 4HUNB 5FGCB 5HHXL 1K2DA 3ZKSD 1JGUL 4U1GC 4XCFH 3T0EE 4YPGB 2P8MB 5F7EH 2A9MH 4C4KT 3UPAA 1LO3L 2V7NA 4M4RA 2FX8L 4XPBL 4ZMAT 5L2KB 2YD5A 1N4XH 3HCVA 4FTVA 3I6GB 2PTVA 4OLZL 3RWGA 3QPXL 1JHTA 1I8KA 4NWTH 1P4LA 2AQ1A 3SGDI 1F4HA 1GSMA 4JLRA 4Z7NF 1LO4H 2A77L 5DD6B 4JRYA 1PD6A 3KLSA 3UJIL 1FZMA 3CSYB 1Z9LA 3BO8B 1VPOH 4JFDE 2Q20A 4FQQA 5HPOA 5FHBH 4M1CC 4YXHH 1IBGH 1NAKL 1U92B 4YDJB 1MREH 3O4LA 4FZ8H 1A2YB 1A1OB 1HXYA 2IWGA 1R0AH 3S5LB 2V2TB 2JB6A 3MXVL 1NSNL 2H32B 1AH1A 3HTLX 1ZXQA 2DMBA 4CVXB 4E9LA 3LVEA 4MWFB 2BNRA 4NC1E 1BVLA 5J6HA 5KS9F 3TPUA 4CU6A 2EE3A 2MCPL 5F3BA 2F19L 2EECA 1VERA 4ODWB 4PRDB 4OI8A 2B4CL 1AXIB 1JYWA 2VZ3A 3BKMH 3C8DA 3GHBL 4R4FH 2X4RB 1TTGA 5BV7H 4NPYB 5I66B 3BWUC 4P23A 5F9JA 4OIIL 1F6FB 3DGCR 3PWVB 2HT2C 4JHAH 2ADFH 3ILPA 5TFSH 5HXMA 3DO7B 4WFEE 3VXRE 1I8MB 4G9FB 3WJJC 2BMKA 3SDCB 1UACL 3O41A 5DQDL 4XP1L 5JW5B 4L9LA 4MQSB 4NKIH 2VB5A 2X70A 1KLUA 3RWIB 2DQJH 1XF5A 1A7RL 3QJFB 3QO0A 1I1FB 2NX5A 4Y4HC 5D7IE 2KH2B 4F7EB 3V0WH 3U30C 1S7QB 4ONGL 4WU7A 3ULVD 2ICEB 2QADD 3PGFL 1YZZA 3DVFA 3KNBB 1WITA 3CLEL 2XYCA 1M7XA 2QSCH 5C0CD 5D5MA 1DSFL 3ZYZA 2PUQT 3GKWL 5IMMB 5C8JA 4NHUA 4P5KA 3NACH 3MV8E 3ZDZF 1GGBL 4GW5A 1D5IL 4M7LH 3ARFA 5D7JC 1KPRB 3CDGB 3T09A 3DRTB 1B90A 1ERNA 3HA0A 1UM5L 2H6PB 1AFVL 3OKNB 3LKSB 2LAGB 4IM8A 1V3LA 4HKBB 4CVZA 1LO0L 4ZD3L 3WFBH 1JN6B 4JQIL 2R9HC 1J18A 3DGGA 4LSQH 2JKXA 5DDHA 2A6IB 2QQNH 3K81A 4WGWB 2CUIA 3MROA 2YA2A 5D71L 1PYWB 1XCTA 5ANMB 4OGZA 3TO4A 3PWJB 1PKQA 3RFZC 5K9KA 3BD4A 4JY5L 3CSGA 4JKLA 5HI3C 1QLFB 2X89A 2YD8A 2RB8A 2IMMA 3EDDA 1JNNH 1JTTA 4PJAB 1HHKB 1BZ9B 2WUBH 5FO8B 1V3MA 2UWEB 5IBLD 5DVLA 4RAVA 5GSRA 4WO4D 5C08E 1FE8L 2ICWB 1NCAH 2V9RA 4JFXB 2Y5TB 4CNIA 3RL2B 3C5JA 5AZ2H 1T1XB 1KUMA 2Y06H 4OJFH 4LLMB 1A6WL 1XGRA 3KPRB 4FFZH 5HHVH 4Q9RL 4I9WD 1RULH 5DLML 5DRNA 1CG9B 1ODAA 3DVNA 1BZ7A 5B21A 5KOVC 2NNAA 1G9MH 1Q72H 4TTDC 4R3SB 2P5EA 4B7LA 4GMTH 1BQHB 2YHGA 2CKBL 3NCJH 2VDML 1U92A 1ZT1B 4YDJA 4PV8B 1A2YA 3VG0H 1XFPA 2EDFA 3UYPA 4RBPH 2F5BL 1WEJH 1FV1A 4E41D 4X7EC 3GMMB 4HT1H 4KROD 4AIZB 2NY4C 3EHBC 1UM6H 15C8H 3UBXG 3HE7A 4KKLC 5JPMA 1AY1L 4L3AA 5GISH 1WWCA 1A5FL 3GSNH 4IDJH 2V5MA 1A4KB 4LGRB 5DJ8B 4P0DA 4XXCA 5DD1L 5IKCA 3S88L 5SWZB 3IJHA 4MNGB 4MNHB 3MJ9L 5DHYA 4NPYA 5DD3L 1KCUL 3BEWB 1E4KC 1D5XA 5C0CA 2UY6A 5J3HC 2BDNH 1LQSR 4MJ5A 5DA4A 1I9JL 4JG0L 3RDTB 5HVFB 2B39A 1JGVL 1BBJA 2K1MA 4MZ3A 3VGGA 5IQ9A 4ODHH 1JBJA 1JTOA 1IC4L 2L0DA 1RJCA 4X7TB 5EUKB 2YKLL 5D70L 1CICD 4IRSD 3MRIB 4F7EA 5HGBA 1GXEA 3D69B 4M48L 1LD9A 3C2SA 3NIFF 2XY2A 1HI6A 1IJ9A 3KNBA 1FPTH 5SWQA 4UTAL 5GRVK 5KANG 4OGAC 1RJZA 5ETUA 5BRZE 1PDKA 4MNQA 5IMMA 1MCOL 4UINL 5DEGA 5TPWH 2NY7L 3GK8L 4YDKH 1UH2A 4B50A 1X3DA 3GSRB 3NCYP 3TLRA 3BYYA 4HGWB 5C0BE 3UTZB 5CGMA 2DD8L 4QEGA 3D9AL 1II4E 5FF6A 4OZFA 2DLEA 5F7FA 3KG5A 5BS0E 3X11A 3S37H 5T1DH 4NHCH 3DX7A 4HKBA 5FK9B 1RIHH 3V6OA 5E94A 5CBEB 3PDGA 2VXUL 1QR1A 3VXMB 4JAMA 2FGWH 4ZNCD 2A6IA 4WO4A 1EDQA 3QEHB 3EFDL 4JZNA 1PYWA 4BH7A 5TDOB 5EORH 3NFSH 2ZPKL 3DXAD 3AB0B 3CVHL 4EKXA 4W68A 3U1SH 4ZYKA 1MWAH 1UXWA 1AHWC 4PB9L 1I4FA 3X3FL 3R1GL 1KN2H 4QGYA 1IGFH 4KZDL 1OSPH 5ADOL 2F74B 4MJ6B 1HHKA 3OKOA 1G6RL 4FQ1L 4PJCA 4TPRH 1T3FA 2OJEB 4L3EB 3FJTA 3BUTA 4OGXH 1J5OL 1CDCA 2Y5TA 1MF2L 1KTRL 3RL2A 2MNUA 3Q3GB 2RGSA 3QNYA 2VRAA 3S36L 4JDZB 2YRZA 3OKLB 3FO0H 3MJ8B 3VH8B 1VADB 4E41A 2XWBA 4Q6YA 5E2UL 4H88H 2HTLC 4L8BB 1BVKB 3W0WB 4U1SB 4JO1H 2FEEI 3BKYL 1IAOB 2CIKA 5I1AA 4WIQA 2FBJH 4L4VE 2VDKL 1CYGA 2DWEB 3C09B 3N85H 4MJIE 4PRPB 4Y16C 3GI8H 2Z0BA 4NUJB 4KDWA 4WCYH 5DUBB 3V4PH 1K9TA 2ESVD 5INCA 5E08L 1IGIL 2DQUL 3C2AL 1GAFL 2NY0B 4Y4KD 3MR9A 4O02L 3T8XB 5TDPB 3RVWC 3QT2A 1FAKT 5FUOH 5I71B 2RQ8A 2F15A 2ZOKB 4ZFOA 3MRFB 4AIZA 4DVRH 1NC2D 5ESQB 2GSIB 1MIEL 3QRFM 1JV5B 1YN7B 4YHYB 1Y6NR 3MZTA 1JGEA 1G7MA 2XTJD 1A4KA 1LP9B 5DJ8A 3WHE0 4OLUL 5H94A 2VXSH 1MCFA 4MLSA 3MV7D 4DUVA 5C9JB 1CICA 4EI5C 3OBAA 1HHIB 3BP6B 2IANE 3BT2L 3UEZA 3WDHA 3TPKA 4GLRI 1B0RA 4YDVB 5B22A 3QUYD 4ZOAA 3ULUF 3JWDL 3MRLA 2XQYK 4HWEH 2GCYB 1K3ZA 2NZ9D 2VDQL 3MRMA 3LOWA 4WFGD 5LQBL 1JP5A 3HC3H 4WFHE 2J8UE 1NJ9A 3KYMB 1KIRA 3G6DL 4BSVB 5HGDA 3KPNA 3LS4H 4HUWB 3SKMA 1WZMA 3D69A 5JTWA 2ADGB 4U1KB 3A67H 4HK0A 3ZHLA 4J3UA 1CWVA 1FDLL 1QBLH 4K7FB 4WFFD 2JELH 3DETD 2DQGH 1OQXA 3IAGC 3DXAA 1HKLH 2QKIB 3UTZA 3IXAB 1YYLL 5EUOE 1JVKA 5GZOD 4GRMA 4PLJD 2GUOB 5I1HL 1OOAA 4X99B 3C6LC 2EZ0C 4UNUA 3S36X 1MCBA 5TDNB 5LCVL 1YEJH 5FK9A 1ES0B 3R8QA 1A9BA 2C7UB 3SE8L 4NUGL 4GQ9L 1K8DB 4H5SB 1OD9A 5TE4H 5I6XC 1HXMB 4HC1A 3JTTA 3W11D 3QDJE 4O2CA 1ZA6B 3ZKND 1ZANH 1EGJH 4HBCL 1IGYA 5JMRA 5TDOA 1XGUA 3BZFA 3U9PH 5JPNA 3O9WB 4XCNA 1QRKA 4MS8D 3JVGA 1UKTA 1WCQA 4FP8H 1FL5A 1RZJC 3ZT7A 4J7RA 1MPAH 4NN6B 5HVHB 4WENB 1FRGL 2C3VB 4YNYA 3UJTH 3SDXB 5IEHB 5CILL 2OZ4A 3MRRA 3HB3D 4PJBB 5DEZA 4GFTB 3U2SA 3MLWH 4OCWH 5MHSD 2ESVA 4TSAH 4Z7WA 3ZTNL 5CIPH 1WC7B 5HDOA 1UB6B 4Y4KA 3NCYS 3OKLA 1BEYL 4U6VH 3MJ8A 5MI0C 1UVQA 3VH8A 1VADA 3HC4H 3ZSSA 1TVDA 3D85D 3GEWB 1YEDB 3TO2A 1B4RA 3A6OA 2W60B 1BVKA 4HFUL 3DWTA 1W0YT 1AD9B 1NC2A 3DLQR 4U1SA 5A2JH 5J8OA 4LLYB 2VDRL 2XKNB 1NFDB 1YMMB 3QG7H 2DWEA 3HRPA 5FB8B 4NUJA 2A6DB 1QFWL 2EDBA 2AXGA 1Q9WB 3MV01 4H20H 1U8LB 3PHOB 4GAJH 5J9PB 3L95A 5E2TH 1JZ2A 3BZEA 4MD5A 1FZJB 1RFDH 1XGQA 2XOTA 3TCLB 1ZV5A 5DURD 3DVIA 3QUYA 1KEML 1WBXA 3QDGE 1NLBH 4O58L 1V8HA 3QXVA 1QD0A 2X4UA 1V7NL 4NQCA 1VGEL 1OAUH 1CK0L 3DTXB 4OZHE 1EMTH 3KPSE 5GGTL 3PIQB 1DFBL 3NFNA 2W91A 5ID1A 4P2RB 3VFOA 4QRRB 5CGTA 4XNXL 1G6VK 1HHIA 4YWGH 4L5FH 4J2XA 3MLVL 4NZRL 3QEQB 4AG4L 5SWSB 2CUHA 1EXUB 3RAJL 4D9RE 3JUYA 3VDCA 4FXGB 3H9SA 1UENA 1FNGA 4R96A 1FCGA 3DX6B 5DJAB 4ZDHB 4XNZC 3BP5B 1OQOA 4BSVA 1B4JH 4XNMB 1QLEL 1QRND 2Z91B 5GGSB 2K3TA 5F96L 3DROA 2BFVH 4N0UB 5HD8D 4U1KA 3CFDB 1IEHA 3RKPA 3I6KA 5KVEH 5E1AB 5EN2A 5J11C 5LWYH 4PD4J 5GRUH 2BX5A 3WN5A 3MUGB 5CJQH 4ZPTB 1WFNA 5KG9A 3MBXL 4S10A 3DI3B 3SE3C 3IXAA 3SDYL 4ODUA 4YXLL 4OF6A 4CN6A 3FN0L 1MFDH 3MJ7A 4BFIB 1AXSA 1QPPA 4FQ2L 4FTVE 2EH7L 3MXWH 2NW3A 4MA8L 4F15C 1FL6A 3C5SB 1RURL 2O5ZL 4LOUC 4OZGB 1AQKL 3BN9D 3QA3A 4JRYE 1V3JA 2R23B 4NYLA 2IH1B 4OBSA 4NJAH 4MD4B 3QXWA 1N2RB 3QUXC 4CADB 1KJMA 3CD4A 1JNJA 1VENA 1SY6L 2BY1A 1CFTB 2JLLA 3LEYH 4HKXB 3OR7B 5LVEA 1P1ZB 4XC3H 1YN6A 3O4LE 4K9EH 2WINB 5BV7B 3PGDB 2PXYD 4M61A 5INDB 2VLLB 5F1KC 1IGCH 5ILTL 1I9RL 4M6AA 4X6DB 4AEHL 1SBSH 3OKEB 2BK8A 5D7KD 3IDMA 2D03L 1EEZA 3CFEA 4AEFA 3AMLA 1S7SA 4KK9C 2BNRE 3U7WL 2AV7B 5IMOB 1I7UA 2O5YH 3QHFL 5FO7A 1Q8MA 5DJ2B 4Q74A 3HAEA 2YXMA 1DQJA 5D6DC 4GJTB 4KKAD 3ZE0F 1YEDA 1T7VA 3K0WA 4NQSB 1AD9A 3K4AA 2CJUL 4DGIL 3IETB 3VD4A 3AC0A 1NFDA 1YMMA 5D1ZC 3TN0B 5HVWA 2DYPA 2X4NA 3UTPE 4JEGB 4F7PA 2XV6B 1T5WB 4WUUD 1NH6A 5IVNA 1Q9WA 5GGQH 5D8JL 2ILLA 1U8LA 3HRZB 4DW2L 2NX5E 3MREA 3G5VB 4Y19B 2CR3A 5T3XE 2E6PA 5FV2A 3LY6A 4Y1AD 1MFAL 1MFNA 1YEKL 2DICA 4UIMB 3MSPA 1TZIA 4I3SH 5FKPB 4FXKA 1UXSA 4P3CL 5D5ME 3MYJB 5DJZB 4QRTB 4XWOD 2LAAA 4OZFG 5IEKA 4FFWC 2FLRT 3IFOA 5GRYA 3Q1SL 1ORQB 4IJ3C 1NEUA 5D2LB 3GSOB 4PD4K 1CXIA 1CN4A 43CAA 1G0DA 3PIQA 3MV9A 1NGWA 4P2RA 3CU1A 4NN7C 1QRNA 1XGPA 3F62A 3O6FC 5H37G 4HUXB 3LEVH 2BSSA 5DJXA 5FKAB 3DHMA 4R4NC 1HZHH 3QEQA 3VXOB 1KXTB 1I1YA 5ACMA 1QHPA 3VFTA 5BW7C 3TA3B 2ATKA 1ZLWH 3VI3E 3RX7A 4FABL 5EC2A 5IB5B 4NKOB 3ARBC 3VWJD 1PKQE 4HG4K 2VH5L 1H3PH 3O3EB 2WLZA 3BP5A 1YEIL 4M3KB 2Z91A 3P73B 1OSZB 4Y5VB 1A3LH 3EJJX 3O3BB 4N0UA 1RI8A 4JM4L 3MBEB 3CCHB 5EIVA 2MOVA 1KF9B 1P5VA 1EEYB 3KDMA 4O51A 5FGCE 5E1AA 3FCTA 2ZCHH 2Y07L 3S97C 3MUGA 3G6JB 4NT6B 3VE0B 3I50H 4NIKB 4ORGA 4AH2B 4LMQI 3GIZH 3NCEB 4Z7VA 4G6JH 3L7EA 1B0GA 4LBEB 3TT1H 2PXYA 1CFQA 2ZUWA 5F6IB 4HWUA 4KJPC 3STLA 5IHBA 3CH1A 1RZGA 1UJ3C 4P2OC 4JM2D 2CLRB 4PLNC 1CZ8H 3B8SA 2X09A 3S3PA 3GI9L 2VZOA 3EYOB 1G1YA 2P5EE 1N2RA 4JPWH 4F7MA 1TJHL 1CFTA 5M94B 2AJYH 2ZUXA 3V52L 3V4UH 1YYMH 3DECA 4W6XB 3OXRA 5D7LD 4QTHB 4U0RC 2PW2A 1GYAA 4FG6C 3ULVL 1ZMYA 2AK4B 35C8L 1V5JA 4HS6B 1NPUA 1C16A 4JRXD 4M62L 1GPOL 1D6VL 1E4XL 2DBLL 1CGUA 1D9KD 4HUVB 5HYSB 1MVFA 1FVCA 5DJ2A 4MCYB 1QKZH 4FXLA 4YO0A 3WNPA 1CR9L 2W9EL 5GGUB 3KXFD 1T2QH 4PBXA 5DD5H 2H2PC 4PV9A 5LGHL 4BQCA 4RIRA 1P7QB 3SGDH 5I74B 3LS5H 3X12B 4Y7MA 5C0CE 4IRJC 2I07B 3IETA 4N0CC 2WV3A 4X6EA 5CLWA 4DFIA 3WXWL 4XI5C 3U0PB 4G6AC 1UCBL 1T5WA 2YD9A 1A0QL 2HJKB 2YPLD 5AZEL 2QV2A 1PY9A 3EO9H 3SPVB 1YPZF 3QP3A 4L8CA 5FM5M 5KZCD 4WW2A 1RIVH 1MFEL 1C5DB 5EZJB 3FHQA 4NO2A 4NQED 2LV4A 1IL1B 4TSBH 2CDEB 2ERJC 2PO6B 2NY6D 3IDXH 4YHML 3SOBH 2AI0H 1AE6H 1KCSL 2VZUA 4YK4B 3HMXA 4R9HA 4HS3A 3LQAL 4MNQE 4PUBL 4JQXC 3QUKB 2E6QA 2JCCF 4D0DB 3OG6B 1EAPB 4N0YL 4BSJA 3DVGB 3K2MC 3LKOA 2E9WA 4G6FB 5A2FA 1IC5L 1VFBB 4OV5A 5AD0A 5KAQF 3KLAB 1RU9L 3QIUD 2DL2A 3KYNA 4HUXA 3QQ4A 4KKBC 3WNOA 2CQVA 2LU7A 4GAFB 5A2KH 4XVSH 1BFOB 5CJXA 3P9MB 5I1EL 1NMAL 1H3UA 4LASH 3TA3A 1N6QL 1J0IA 4LCYB 4UT9L 1YEEL 3RHWF 2FO4B 3LB6C 5CUSH 2OTWB 5KN5B 2XQBL 2BY3A 2R2BB 2VAAB 1TCMA 1NC4B 4PJ5A 4Y5VA 5DC4B 3FHAA 2EDHA 3MLRH 4G43A 4HGKC 4C4KO 4LP5A 1EEYA 2VZVA 3VGEA 4PJCE 2XPGB 3MNVA 5BQ7B 2W59A 3VFRA 3VGFA 3KS0J 4MZ2A 1OARH 4WWKB 3ZKMD 2J4WH 3TCXA 4RNRB 4K55A 3N1MC 4X5WA 1JHKH 5JUEH 4KMTH 4E41E 5D7LA 5EU5A 1X7QB 2O5XL 4RFEA 5D96C 1TVBA 2OL3A 1R5VB 1BX2A 3QFDA 3RNKB 4ZFOL 3UCRA 1ZT7B 2CLRA 3WS6A 3GSNA 5EU6B 5EOQL 1AO7B 3ARFC 5B8CB 2NXZD 1KIUA 5GGRB 3VW3H 1FO0A 5IT2L 1I3VA 2GJ6A 4YZFF 4XB8A 5EZIH 3DX8B 1ZLSH 3VFSB 1ZT4A 2BHYA 1K3IA 2AJ3A 1FGNL 2ADJB 5IM7B 4HD9A 5I19L 5FYKU 3VXTA 1JHLL 1DUZB 4PGBA 2PF6A 1R3HB 3B5GA 4LVHB 3F12B 4GRLB 1INQB 3AREC 1GL4B 5T1LB 1MVUB 3EJZC 3KWWA 4OQTH 1U95B 3CAFA 4TQEL 3SE4A 5C86A 4XMLH 3SJVD 5EZLA 3TO4C 5IB1B 3QIBB 2J7LA 3CXDL 5SWZE 3LHPL 3QRGL 1LNUB 4ZTPH 4EOWL 4HJ0D 4NQEA 1P7QA 3F5WA 3LSOB 3MCKA 4OIAA 3L3HA 4D3CL 5DJ6A 4H26A 1IC7H 3Q48A 4NKMA 1LE9B 3UPRB 3U0PA 1SHMA 5DYOB 2CO7B 3QFJB 5JIKA 2C4FU 1SEBA 4OLEA 3P0YL 4PS4L 4OQ1A 3QIWD 3SPVA 5C2BL 3QIUA 5JIHA 3KPOA 2XA8H 3WD5H 5I8KL 2YD2A 4WNQB 4XH2A 2CXGA 3HI6H 2EO9A 1U8MA 1I1AD 2QJDA 5ITFB 1OP3H 4POZD 3EOAB 1KCVL 4NOBA 3DXAE 1EAPA 4EDXA 1ETZB 4CVUA 1MWAA 2FL5B 2L4OA 4S1SH 5BXFB 3PWPB 2E7LA 4DAGL 2GTWA 5K59E 2BSTB 3PDOB 3DUUA 4P59L 1S8DB 5JLZA 4X5XA 3HG1A 3RI5F 5ECJE 4PP2B 1BFOA 3VXME 4HF5H 5DEFB 1EZVX 2Y6SC 3HE7C 3FFCD 4WI8A 1JJUA 2EDEA 2XIDA 4EEEA 5F21B 2FO4A 2X9YA 2B2XH 2CDFB 1UWGL 4Q6IA 4ZFFB 3HPLB 1LK3H 1EFXA 2OZ4L 5FYKD 3BWAA 4MX7B 4P57B 4G8IB 5GS0H 1A6UL 5JDSA 5FUCE 3ZL4L 2VL5A 3ZHDA 4XHQA 5F8QC 1K4CA 2WIIA 4LSSH 4IOIB 1DL7L 1FN4A 4RWHA 1NCDH 3ZMRA 5E7FA 2CLZB 3HAEG 4ZXBD 2NY5L 3SDCC 2DQDH 1DBMH 2VLKA 4G7VL 1OTSC 2QR0A 3HZKB 1P7KB 4WHTB 4NO3B 1AR2A 4HIXL 3TZVB 3NH7L 3OQ3B 3RWHB 2ESVE 4Z7WE 4FZEH 2A73B 4QF1A 1GH7A 5HVGB 4EVNB 3G5YB 5TF1H 3IFNH 1J1XH 1L0XA 3ELAT 3GHEH 4K8RD 3BW9B 5D7IF 4FFVD 5DMKB 1MFCH 4WTZA 1F4AA 1EZVY 3LRGA 3G9VA 1BZQK 5EIIA 3SJVA 3LKNA 4GT7A 1YUHB 1PLGL 2HRPL 1J8HB 4HWBH 2EEBA 3LZFH 4KI5E 2EKJA 3D25A 1IQWH 3NMEA 2AJSL 3W2DH 4NQDD 3STZA 1F97A 3CX2A 5F6HJ 4M1GH 2Q8BL 3P4NB 1L7IH 1X5AA 2QLVB 4Z5RB 5IVXB 2R69H 1IAMA 3ECBA 3MLUH 1BOGB 1FL3B 4NQCE 5T1LA 3UAJC 4F7CA 4PGEA 5DJYA 1U95A 1MSPA 4PGCA 5IB1A 2AAVA 1D5BB 3RRQA 3GO1H 3RA7H 2APXA 4G8GD 3WFZA 1N8ZB 3O6KL 5I1DB 2FEDC 3NZ8A 3T4AA 3FOLB 1M6OA 3IDNA 1QO3A 3NFPB 1ZVSA 4R7NA 4PRHA 2EXWD 2VISA 1JWUB 3QWOB 5SV4A 1UKSA 1I1AA 3WFCL 4QXUL 3ZDXE 3QQ9C 4XMPH 3H9SE 1D6EB 3AUVA 4W81A 2K7QA 3C5ZA 1KTDB 4XB7A 3GIVA 3CSBA 4K7PH 1NDMB 2H8PB 1AJ7L 3GRWA 3T77B 2P48B 5IMKB 4PY7A 4NFBA 3RPIB 2HRLA 1T21A 3D48R 3ARYA 1QZ1A 3BPNB 1H8SA 2NR6C 3TJHC 4FQJL 4OFPA 3CK0L 2IFFH 3VWKA 3LRSB 1WIOA 1BFVL 2W9DH 3WEXB 4HWZA 4J6RL 2BRRL 3FFCA 3Q6GL 1EHNA 2VR5A 4YX2H 3PWUA 1EGJA 1W72H 2R8SL 3BSZH 3TBTB 1CFBA 4FFYL 3V5HB 4JY4A 2E9BA 4OCSL 2VZTA 2JJSA 3CNKA 3Q0HA 4GQPH 3PWPA 1J1OL 4JZOA 1QYGH 2YWYA 3MRGA 4MQXC 4BYHA 3CMOH 1KCRL 4HZLB 3RY6C 4V1DD 1AR1D 4GLRH 1S8DA 3UC0H 4PJ9D 2V5TA 3IGAA 4YJZL 1RJLA 5DEFA 4JO2H 4U33A 4B53A 2MKWA 1DVFD 4X7SL 2I5YL 3L3DB 2VXQL 3HPLA 4PRNA 2A2QT 4OTXL 4MX7A 5CIPA 3CUPB 1HH9B 1IVLA 5C3TA 4PJ8D 1CDYA 1F3DH 3HN3A 4JJ5B 4OT1H 2F53A 5CEZD 1MH5A 4BZ1L 2IQ9L 1P4BH 1CDUA 5GRVL 1FNFA 5EOTA 5HHPB 2F5AL 1OT2A 3S8WA 2BNQB 3RDTC 3WV0A 1KB9K 3TWCL 2Z8RA 2PYEB 3VFGL 1J9CT 5K9QG 1INEH 4XPHL 3OKYA 2D0GA 2IH3B 2HG5A 1HINH 4R2GB 2ITDA 3FZUC 1G7QB 4ALAL 5IK3A 4Q9QL 3MNWA 5K33A 2B0SL 3RVVC 3EIFA 2GY5A 2V2XA 5DMKA 5DO2D 1QFPA 1NFDE 1YMME 4CBPA 1A02N 4Q0XL 1JPFB 4YHPA 4IOFC 1FAIH 5MEOB 1FYTD 3SKUD 4EDWL 5HY9A 2DQCL 4IRSB 1VEOA 5D1QB 2X05A 3QCUH 5AYQA 4OD2B 4M9OA 3LIZL 4P5TB 4RFNB 1XF1A 2FLBT 3VA6A 2W1NA 3PE9A 4LNVA 2R0ZH 3MQIA 1N6VA 2IADA 4KH2A 1BOGA 4OLYL 5C3LD 5FA4B 2V7HA 5D6CA 5F72S 1NLDH 1G9EA 5F44A 2IPTL 3AB0C 4GRWH 4JFQB 3MV9E 2ZKHL 1MRCH 3WFHB 1PSKH 3TVMB 4P2RE 5I1DA 4NNPL 3JVGC 1QRNE 1EO5A 1GGYA 4LLQB 3EYQD 4P3DB 3BPCA 1EHLL 3O2VL 3QEQE 3ULUD 1JWUA 3QWOA 1LEIA 3V6FB 4XP6L 1CD1A 3QG6A 4MQ7A 4HV8B 1KTDA 4WUKL 3MNZB 4IOSD 3N06B 1ZE3C 1AIFA 1MAMH 5FCSH 1AGBA 3T77A 4M5YL 4LIQL 1KPVA 2MQCA 4U4BA 2G2RB 5CP7A 2D9QB 1S7XA 1MLBA 3VI4F 1NUDA 4N0UE 3R8BB 4PJGB 3NABH 1E28B 4D8PA 2R4RH 3WEXA 1IEAA 1XGYL 3SCMB 5CJ5A 1TVHB 1F13A 3LEXA 5ISZD 3CLFH 2B5IB 1J0KA 4YGVB 3GJEA 2DIAA 3C09C 3GDBA 3GBLA 1EK3A 4XBPA 3EDJA 5CBAA 4Y2DA 4Z7VE 4YE4L 1T66D 4NNXA 1YEHH 4PJ8A 2NY0C 1PZ5A 3CZJA 2CIIA 1S5HA 4N5ED 4R4FL 3DSFH 5IROA 3DIFB 5JOFA 5I71C 1FVDB 2X2YA 2GTZB 1FGVH 1JPSL 4WTXA 1GIGL 4Z78B 1J88A 1A4JA 5IJVA 1DBAH 4KRNA 4YHYC 3C8KA 3DV4A 2VWEE 2H1PH 3X17A 3TIDA 4P46A 5IWLC 3HZVB 1INDH 2MMXA 5IQ7L 4K94C 1IAII 3STBA 3RZCD 3QQ3B 4HKJA 1RZKL 5DJDB 1OM3L 1GGCL 1DLHB 4UBDD 1GHFH 1R3IL 1A1NA 4X4YB 2BNQA 2A6JA 2PYEA 2MTPA 4GKNB 1OTTC 5F1SA 1R3LA 3BGAA 4N0FA 5HHOD 1MI5B 1G7QA 5KTEL 1M4KA 1KC5H 4OF3A 5DFWH 2WBKA 3FFDA 2J8UF 4G7YH 4OIBA 2BHUA 1D5MA 3ETBF 4KWUA 4G6MH 3DRQA 1AC0A 3WFBL 1JPFA 3HMXL 4CMHB 5MEOA 2OQJA 2QQNL 3U36B 2ORBL 4JN2B 3VFVA 1IRAY 1F3DJ 3DV6A 4HJJL 1KPUA 5B3NA 3SQBA 3V7MA 2A38A 1EUTA 1YECL 4WI5A 3FQUB 5BO1L 3F7VB 2Q3AA 4P5TA 2D7TH 3G5XA 4J8RA 2R2EA 4JANA 3IKCB 1RHFA 1RHHA 2ICWI 1JZ3A 5EUOF 5TQ2L 2E6JA 5JMOC 7CGTA 5HPMA 1VEPA 2GITB 2WUBL 1ZHKB 1IARB 1M1SA 4U31A 4DTGL 1RMFH 4D0BA 2AS5M 5D2LE 3HPJB 1GZQB 1CGSH 2P46B 3MLXH 3BUYA 5DT1L 3O9WC 3TVMA 2QSVA 5DFTA 2HT4D 2IG2H 3O11A 4LLQA 5AZ2L 3NAAL 1U8IA 3F7RA 4YHNB 3NCCB 2PTTB 5HHVL 4Z0XB 1MJUH 1TJGH 4F80A 5GGVH 1RULL 3REWB 1BJ1H 1CBVH 5E6ID 4NN6C 3OAYH 4JFFB 5HVHC 5ISZA 1WZ1H 1O7SA 4Z76A 2WBJD 2DB8A 4R0LB 3VFWB 4JKPL 4OLVL 4Z7OE 3ARGA 3INUL 1SVCP 3K1KC 3KPLA 3O6MH 2AK1H 2J88H 5HHNA 3X3GL 5JORB 5KSBA 4L8SB 2W0FB 1KTKE 3WUWA 1QLRA 4PJ5E 4JFPA 1I85C 5I1LB 1JWMB 4PJGA 4M7JH 3GBMH 2ZUUA 4LCWB 4CVWA 3FOMB 3JUZA 2Y23A 2ZSWA 4RDQF 2OL3L 1TVHA 4WI9A 3MOAH 15C8L 1ZHNB 2B8OT 4HQQL 4KK5D 1FC1A 3GSNL 3MFFA 2DF3A 3RWCA 3UTQB 4M6MH 3D85B 1FO0L 3IFPB 3RVUC 5JZ7C 2ED9A 4WTZG 5D7LE 4PJXB 3HZMB 2A9NL 1S9WA 3MLZH 5IB4B 5ITBH 5A1AA 5CFHA 2MSPA 4HHAB 2NTFA 4XBGB 1RUPH 1DBKH 5F7YC 4NM8L 4Y2OA 3K7UA 4PJFB 1T1ZA 1OLLA 1OAKH 2VSDA 4YC2C 5HHOA 4RGOH 1TLKA 2GJ6E 3HZVA 4XCYB 4PTUA 1Z5LB 5E8OA 3AY4C 3ARDB 4OZHF 2IGFH 2X4SB 3HNVL 4TOYL 5FOBA 4FOMA 4JDVB 3QQ3A 1UC6A 1OAYL 4UT7H 3QUZD 2XNAA 4X4YA 5A16B 4KVCH 2IPKA 3GBNH 4ZUWA 5CCKH 1HN1A 4R26L 4LSRH 3O3AA 1L0QA 2WP3T 4TSCH 4HULB 2EDQA 4O5LH 1MI5A 3TFKD 1ZAGA 3G6AA 4NQEE 2GJJA 5IB2A 1C1EL 3TIEA 4RA3A 4M7ZB 4JFZH 4PREA 1P6FA 3LV3A 2HFGL 1HHHA 3KR3H 4GKOA 3RJQB 5J13B 2DMCA 3WHE1 4PJDB 4TRPL 2HT3D 5EULV 5JOPE 3BEVA 1ZA3B 1RVFH 3C60B 3JTSB 5CSGA 5HI4C 4DZBA 1HHJB 3K80A 3OB0H 2DQFB 4KTYA 3TT3H 7FABH 2G75A 4HKZA 4XPGH 3PUCA 5IFHH 1FZOB 1WZKA 3FT4B 4R6UA 3S4SA 3RWEB 1I1RA 5EU4B 2FIRT 1A47A 4X8XA 2EDLA 2HMIC 3S35H 2QQKH 4XTRC 3QXUA 4UIKH 4CN4A 1BHGA 1NGZA 4XAKE 2VWEC 1J05B 5IB3B 5LG1A 2R0WL 3ABZA 4ODXB 2A6KB 1OP9A 5BV7C 5L9DH 4QHKJ 4X6CB 2L7JA 3F7YB 4KAQL 3HG1E 4Z0XA 1KGCD 2PKDA 4G9DB 4A6YH 3DMMB 3O45B 1KLGA 1N5AB 1XF4B 1K5NA 2Q8AL 1CLOL 2PETA 1AQDA 3VXSD 5I2IA 2FBOJ 3P4MA 4JO1L 5EWIL 1NL0L 3QDMD 3N85L 3GI8L 2IBBA 4FQCL 1PZUB 4LCIL 4PIRF 1I7TB 4NZTH 4H1LH 5FYJH 5E8DH 4AIOA 4JREB 3LKPA 3GSXB 3MRPB 5I1LA 1JWMA 3MLYL 4UB0H 5HYSG 9CGTA 2X41A 4LCWA 1IQDA 3WLWC 1SBBA 4M43L 4NM4H 4POYA 2AGJL 4PRIB 2FX9H 4YHZL 2X1WL 3TN0C 2YSSB 2VLKE 4QRPD 5I8CA 1KG0B 1SVZA 3MLTB 4JHBA 4V2CB 2J8OA 1AC6A 2J6EA 3WL9B 4UT6H 4LLUB 3UTQA 1ZEAH 5F7DA 2MPAL 4XP5H 1DUYA 4YHIB 2BNUB 4MXWL 5ALCL 4ERSL 4TVPH 1BJ1J 4I1NB 3U9UB 4KV5E 3LN9A 4MXQD 5E8EA 3RI5K 1H0DA 3QUZA 2EKSA 3OKKA 3E6FA 3QISA 1ZTXL 3KPMB 3A6BH 4ELMB 4OQTA 1YA5A 1G84A 1IGTA 3SJVE 1DQDH 1U9KA 2BVPB 3GMLA 2Z35A 1AGDA 4X80H 1L0YA 4Y1AB 5D5MF 2NLJB 4BA8A 3IXTA 5DMGC 3K2UH 4NFCA 2X4SA 4MA7H 5T1KB 2JJTC 2G9HA 5JNYB 4JDVA 2GFBA 3I2CH 4NQVB 2EDXA 3GNML 5CJXC 3PGCA 1I7ZA 2I9LA 2N4IA 4EIGB 4ZQKA 5A16A 3TA3C 4NN5B 1U8QA 2Z92B 4HX1B 4ZTOL 1M71A 1NUGA 3L5XH 1CE6B 4MDJB 2G60H 4M7LT 3UTSB 1LO5A 2X10A 2QHRL 3SO3B 1UB5B 1SM3L 3VI3F 3GRWL 4HUUA 4Y5VC 3MRKA 2HA1A 3EYUL 3MBEC 1OB1B 4MSWB 4O9HH 4PRHE 5I16A 4L8DB 1RUAH 3IFLH 2HN7B 3VWJB 4PPTA 4R90H 4DK3A 4RZCB 1G9MC 1W72B 2X4TB 1IKFH 3H7BA 3B3IB 4OM1H 3VCLA 5GS1B 1CGVA 4KHXL 5DRWA 3U9PL 3G5ZA 3FTGA 5FYKL 3IF1B 5HDLA 4S1RL 1NKRA 3FT4A 4ZOEA 5F1NA 4JZJA 3M45A 5EU4A 4FP8L 4KTEH 4U3CA 2QL1A 2V2WA 1TXKA 1OAQL 5IG7B 1LK2A 4EBQH 4YEEA 4JO4L 4JO3H 3FFCE 4QRUB 4XGZB 4KMLB 3QDMA 2PTUA 2VC2H 4YDLB 4MCZB 3SY0A 3DOSA 4I5BA 1OGAB 5JHLL 3PWPE 1U8HA 2GK0B 2HWZL 3BVNB 1G7JA 4JVUA 5FYLH 2HJFB 4X6CA 3F7YA 1NBQA 4JM2B 2VTFA 1X4ZA 4HW6A 4I48A 5D7JD 4UUJB 3JBG7 3PJSA 3EO1A 2E8YA 4AENB 4K8RL 3UMTA 1EBPA 1DE4A 1P7HL 1M7IB 1KB5B 2N7BA 5B4MD 3QULA 5IESH 5EPMB 4U6HA 5GS3A 2ZCLL 3WIHA 1MY5A 2Z8SA 3WKNA 4KFZC 1Q9OA 5GXBB 5TE7H 2VLJD 2F53E 3RP1A 1T0MB 1T22B 4L4TD 1JZ4A 2VE6A 4JRXB 3J7HA 1XGTA 2FHBA 5I74C 4L1DA 2HLAA 2VJXA 1XR9A 4YHOH 4PRIA 1D9KB 2CDGB 2YN5A 2ARWA 2YSSA 1NLBL 2X1PA 2QSQA 3WE6B 1K8IA 4F2MB 5C0JA 1KG0A 4DVBA 2BSRA 3OJMB 3KXFB 3MRDB 4KJQD 4ZFGL 1BGXH 1EMTL 2NYYC 1MRFL 2WUCL 1A9EA 3U4BH 3VXUD 5L7XH 1DEEB 3OZ9H 1JNHB 1A6ZA 2XN9B 1T1WB 1RZ8B 1CDJA 2PO6C 5GHWH 2COQA 4DQOL 2C3XA 1OAZL 5SX5H 2A83B 4YK4C 2YPLB 4EXPX 4TUKH 3C9NA 3FRUB 1RZIB 3CC5B 4DKFH 5LKNA 4FQXB 5IV2A 3IJYA 2BVPA 1W8NA 1TCRA 3BGMA 4GRWB 3B9VA 3I6LE 1J8HE 1VA9A 4CKVX 2NLJA 4LHQB 5C0AD 1YQ2A 1LVEA