4QHYA

The structure of aif2gamma subunit h20f/d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDFGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Binding mRNA on the archaeal translation initiation factor 2 gamma-subunit
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 97
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qhyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qhyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qhyA01
1KI1A 3FFBA 4ON9A 2WBLC 2ZUCA 3GLHE 4R98A 3L8YA 3KKNA 1WDTA 2WZQA 2FZLA 2VNKA 2BBTA 2R6DA 2ZU6A 1TUIA 4M0LA 2QQ0A 1F6BA 3EA0A 3NG1A 3QF7A 3ND8A 2BV3A 4C43A 2FNAA 4CEIA 4IEIA 3CNLA 1ANKA 3KUDA 2WWYA 4BEJA 121PA 4OHXA 1NN1A 2QTFA 2GKSA 3EXAA 4Q5IA 4B47A 5K8IA 4K46A 4JMPA 2JLZA 3MD0A 3RS7A 2ODWA 1N6KA 1TQ2A 2ZUBA 3VR1A 3WMEA 2MMCA 4DLWA 4G5QA 4UNPA 1LB1B 4BECA 3BJIC 5FTLA 1RKBA 3PUVA 2JLWA 3DM9B 4AYXA 3V76A 3ADKA 3SS8A 4ARZA 3EPKA 2D74A 1VMAA 3NBFA 2IYXA 3AVTA 5CLLA 1JB1A 1YQTA 4Q01A 4DT1B 1KMHB 1YU9A 3NEJA 4MQBA 3GLFE 2ZJBA 1E1RA 3KQLA 3CCEB 2PZEA 1G7CA 4TLDA 4QOSA 2BCGY 4B2IA 3I32A 3EIQA 2GXSA 2XZPA 1KI4A 4ASUA 3BXZA 3L0PA 2GILA 2FPLA 1ZC3A 3HR8A 3LX8A 4M53A 2KI5A 3H1TA 3REGA 3EG5A 4FWIB 5LD2B 1EX6A 5CIQA 1UEJA 3VU9A 4PQFA 4MRNA 2W6IA 5SZHB 1E32A 3GMTA 3ZZ0A 1W5SA 2G0TA 2XB4A 3TUJC 3U3JA 3VFDA 5L3QA 3GJ6A 4Q21A 3X1YA 4CF7A 2WJIA 4ERNA 2NO6A 1BYUA 1YITB 3KKQA 1KSGA 3ZIAD 1Z6XA 2Z83A 4EH1A 2WSSD 4HAZA 4PTLA 2F1HA 1QHIA 2GESA 1F60A 1B2RA 4XOIA 3VAAA 4Q4JA 3NXSA 3BH6A 1OLOA 4Q9IA 1M2OB 3GQBA 1Q3TA 2GK6A 4L4UA 2BMEA 3T1TA 2ASEA 4UQOA 1AIPA 4Q9LA 1ZCAA 3L0IB 2PMDA 4JIMA 1TLLA 2BPOA 3VR4A 1AGPA 3VR3A 4DDWA 3IHWA 2DR3A 2ONJA 2G1JA 4EPVA 1XTIA 5DGXA 4EQ6B 4KFSA 4HAVA 1P7CA 1G64A 1NIJA 2GCNA 4DCTA 5L3VA 1WE2A 1Z06A 4BE7B 2R65A 4PAQA 3VQTA 1R0ZA 4JBWA 4D80A 4ZKDA 2C96A 3C8UA 4TWZA 1OH6A 3Q9LA 3WHLA 2PEZA 3ZQ6A 3NHAA 4P4UA 3R8CA 3THOA 2HYDA 4TTRA 1FL9A 1U8YA 2ZROA 2WMOB 4M9XA 3B5JA 2GPJA 3W3ZB 4POAA 4PC7A 3GEEA 3CXCB 4URWR 5AJZA 1CLUA 1VYVA 1FDRA 4X8LA 4NYMR 2OLKA 3L82B 3TAHA 1UDWA 4EJSB 4HUTA 1FMLA 4KFRA 3KFVA 1E62A 2F1IA 1NNEA 1SM4A 3PENA 2R6GA 3ZD7A 2Z0MA 4JL6A 2BC9A 4B32A 1KI3A 1E9CA 4QNMA 5GADl 3QXHA 1LTQA 1JJ7A 1M74A 4RD0A 2QM7A 5KSYA 3HU3A 2QSZA 1IY0A 3U44A 1PLKA 1W48A 4EFLA 3ZVNA 1BYIA 4JLMA 1SVIA 2J46A 5LB2A 3MG9A 1Z22A 3VR2A 2FGJA 4DSUA 4DZZA 2Z5FA 1OIWA 2ZI7A 2ZRAA 2AWOA 4NH0A 3MRSA 5JSZB 4NYIQ 4Z51A 4KCGA 2BEJA 1Q3HA 2YOHA 1E2NA 1OXTA 1G19A 1XTJA 2QU8A 4LZZA 4LSGA 5CM9C 2QTZA 2PCJA 3IIJA 1M90D 1K5GA 3AB3A 1AA9A 5J5CA 2XTZA 1FTNA 4OQNA 4NONA 1FP7A 2KB0A 3TNFA 5HCNA 2P5SA 2OK7A 2UZIR 1Z08A 3IQXA 4XVQA 1HE8B 3W6NA 5JCZA 4U7DA 2VNIA 2OG2A 1QVAA 4V0KA 3C4JA 4ACAA 3CO5A 4IDQA 1XU4A 4PSKA 3SEAA 5JMTA 1FZQA 4DT1A 1IN8A 4Q1BA 1H65A 1YIJB 1LNZA 4ZCIA 2VHQA 3CC7B 2ZYUX 2ZPTX 1G5PA 1NBMD 4M8NE 2W2VA 3T35A 2X8AA 1YJNB 2HJVA 2IXEA 1E63A 3SJZA 3AVUA 3CRQA 4P4TA 1OPXA 3BERA 4AKEA 2B5OA 3C5CA 4LJ9A 1NDHA 4ZDKA 2ZIAA 1QHSA 1MH1A 3R9IA 1JEEA 2HLDD 1J7KA 4G01B 4JLJA 4TL9A 2D3WA 4MRPA 1LF0A 1VYUA 1ZD8A 3HP1A 4BLTA 1A1VA 4ASUD 2ZRDA 3K0EA 1FNCA 2J41A 1ZW6A 4RZXA 2PMKA 3QEOA 3CCRB 1D9ZA 3OFNA 3SDZA 2W00A 3KJGA 5FOTA 4ZDWA 5SZJA 1YE8A 4JYBA 4MYCA 4Q1CA 4C2TA 1RW4A 5FFMA 5C4GB 2VYQA 3W5HA 2W83A 3CM0A 2W6ID 3AP3A 4JKYA 1KNXA 2DWQA 1RE0A 2IF0A 4US0R 4Z8YA 5C2JB 1U98A 2A7QA 3ZD6A 4Q7LA 3QFCA 1D2NA 1JAIA 1ZP6A 2VL7A 4IRUB 2ZYTX 1G41A 1NL3A 2O0KA 5FOSA 1U9IA 3Q5DA 2YZ2A 1N3BA 5JHGB 1G9XA 2F43B 1EFRA 4IVRA 4DIEA 4C7OB 1TF5A 4QHTA 2IXGA 1UBFA 2JLSA 4EQ6A 1R7RA 1G3MA 5DHAA 1PJRA 4DSNA 1GAQA 2F3RA 3HDTA 2JJ2D 1G291 2WSMA 2YINC 3MWLA 3SFZA 3VO1A 4BFSA 1RZ3A 4DQLA 2QP3A 3NBXX 3WYFA 4TYYA 2ODNA 4LJ4A 5FPTA 2PLRA 5CM8B 1MOZA 5EQTA 2IWRA 3T34A 1HQCA 1TEXA 2G0NA 5EUMA 3PJRA 3H2YA 4JLNA 2QN6A 3S1AB 3HJNA 2B6HA 1GTVA 4PHTA 4DLVA 2GBLC 5IK2A 5KSZA 4YMSA 3K09C 4Y0AA 5H5JA 2EQBA 1FX0A 3E70C 5G41A 2WAYA 3UKDA 5JS8A 5BW8A 2H18A 5F2EA 2VYFA 4NCNA 2EYUA 2VF8A 4PPQA 2G77B 2QP9X 2RGBA 2ZRLA 4PO8A 1MABA 1K9MD 4WXPA 2P5TB 4Q02A 1JXMA 1XRJA 4CT4B 4A36A 2GAOA 4EDHA 3BS4A 2GA8A 5DO9A 2QBYB 1TU3A 4NZYA 1R8SA 1YR6A 4A92A 1UFQA 1BS1A 4HDQB 4TN1A 2HT6A 3I61A 5J47A 1TVCA 1KO4A 3A4MA 3W6OA 1MR3F 2NIPA 4JLPA 4KSCA 4CIDA 4EFNA 1S1CA 1U8AA 3TVDA 1G16A 2F55A 1KZ7B 2J3EA 1XTSA 1IB0A 1ZM7A 2GJKA 4LPSA 2FEMA 3I73A 4V0MA 3CCUB 4URVR 3BBPA 4P3YA 1H8HA 3LDAA 2JLVA 4MDEA 4IOMA 3I56B 1KKLA 3SHFA 4LJ6A 1KAGA 1FNDA 3DOEA 3OF5A 3ADBA 4G5OA 3I3SR 1YZNA 3C14C 3GP8A 1B0UA 1EG7A 1ODFA 5G40A 2ZI4A 1Z0IA 1OXVA 5HPYB 2ZRPA 3W2GA 3RS4A 4C0BA 3BB3A 3MAAC 3EARA 1Q12A 3I1FA 1UKEA 3SI7A 4OHZA 3LV8A 1YI2B 4AKGA 3VR6A 2P65A 2Y8EA 3LY5A 3M4YA 3CPJB 4TZ0A 4NHOA 1OE0A 2CL6X 5DH9A 1UF9A 4FIDA 2J7KA 5KYKA 4PC1A 2NPFA 3SYLA 2BCJQ 2RGNA 3KUCA 1UM8A 2WJYA 2GJ8A 3DZDA 1VQOB 1VCMA 1WF3A 2ZRJA 1UDXA 4F91B 2R6CA 5HE9A 3CCSB 5AUPB 3MGCA 1ZM3A 2VP4A 4Q1DA 4B3BA 1VCNA 1J8YF 5JI2E 1OKKD 1VCIA 4HI0E 3QFSA 5EXTA 3LW7A 4JLAA 3QQ5A 4OJQA 3UWOA 3KFXA 2WPDA 4TMWA 4G1VA 3IBYA 4FMCF 2O8DB 4HE6A 3FWYA 3THXB 2WIAA 5D3MB 3SQXA 3OFND 1T3LA 5EE9A 1Z0AA 4RVCA 1HA3A 1SKYE 2FV8A 4S2EA 3WP1B 1G8GA 3NBYC 4O3MA 1QF9A 5AK0A 1HURA 2IUUA 1EFTA 5KOYA 4MRSA 2BMJA 3DKVA 4FI3C 3QE2A 5DYGA 1Q1BA 3OEEA 4LJ8A 2RMKA 2PLFA 3TSOA 2XB2A 3LO5A 3PQCA 1TX4B 3QXCA 4BFVA 2OCAA 1G8YA 2ZAMA 1LF5A 3RANA 4L8GA 1J99A 1FNNA 5JZVA 3K8YA 1W35A 1NLZA 4B35A 4P4SB 2FJUA 4HDOB 3RDPA 4LJYA 1VG1A 1T8UA 3OESA 3T15A 2FDCA 4DDTA 1EFRD 1IM2A 4LOAA 4US2R 5L3SB 5CJPA 1E2MA 3Q7QA 5DI3A 4YMWA 3JVVA 1YZQA 2FE4A 4ACBA 4Q4AB 1G6HA 5FOWA 2WWXA 3V4RA 1N25A 2WOJA 3JVUA 3LD9A 3I5XA 1KI9A 5HZHA 2ATXA 1NN0A 1Q21A 3AQ4A 4II7A 1UKYA 4MKIA 3SBDA 4OK5A 2EFDB 1F2UB 1W7AA 4LPKA 3VNVA 3M6AA 1NSTA 3E20A 3CPEA 1XXHB 1OYYA 4BRUA 1WBDA 4IVPA 1R10A 1ZM2A 4BLQA 8OHMA 1YJ5A 1Y3AA 1W2HA 3A4LA 3CCQB 2N1BA 2A5GA 4V0NA 5A5GA 3NTUA 2KSQA 2QBYA 4B75A 1Z0JA 2GTPA 3GLIA 1Y63A 1MO6A 3A58B 2ZRGA 3WNCA 4UJ5A 1W87A 1IAQA 2V4ZA 4TMZA 1BO6A 1KZGB 2IS4A 2RHMA 3T5DA 3LBIA 2O8CA 3AVVA 4N1AA 2GCOA 3BH0A 2Z4SA 2GDJA 1E1QD 2DWOA 2XNDA 2JJ8A 5JRJA 2OAQ1 4QJ5A 2ZE8A 1R0XA 2QM8A 4LDJA 1QVGB 4JYCA 3U7FB 4ABYA 1KSHA 4JJZA 1E79A 1YZTA 3B78A 4PQRA 2GETA 1X1RA 2DWPA 4KVGA 5CYPA 3CD6B 2QE7A 2QQEA 4JSTA 4RD3A 4BFWA 5JI3E 1N8RD 4AKIA 2OBNA 5FTJA 1G7RA 1QH0A 1VYTA 2A5DA 2GEDA 1G18A 3IHLA 4D4LA 3C41J 3Q7PA 4DSOA 2FEOA 2PT7A 5E4FA 4O2RA 4B33A 4O25A 1OSNA 4BZPA 2WTUA 1XB2A 3PIRA 4QBGB 3SZRA 4AD8A 1QHXA 1P9RA 3A37A 2QGZA 1ZUHA 3OZWA 1BMFA 3HU1A 1NP6A 2CE7A 3B82A 2ZJAA 4UNNA 4UJ3A 1GZSA 1WCV1 1HTWA 5B2ZA 4E22A 1C4OA 2YVUA 4FW9A 2AWNA 2BKEA 2NQ2C 1VG0B 2CLSA 1IN5A 3PUYA 1JJ2B 1G5TA 2ATVA 1G4AE 3QBTA 1S0UA 1GR1A 4A82A 5DN6A 2IYZA 2QA5A 4GNKA 4LHWA 1IOZA 1JQJC 4Y0VA 4I99A 3CB4A 4LC0A 1Z5ZA 3EA5A 1KDPA 3WYAA 2QMUA 1VKJA 2G83A 2H92A 2HXYA 4RFSA 5TXGA 3MJHA 1XDBA 3BGWA 1ETUA 4MGKR 1KSJA 3ZJYA 1CEEA 5B64A 4RD4A 4PHFA 4WBSA 2SHKA 2LKDA 3NC0C 3A36A 5EMNA 4U9UA 1GL6A 2RGXA 3GLIE 4GL2A 4RKEA 2PX0A 1T0HB 3KXIA 1Z6AA 4FXPA 4HZUB 3O8CA 3X1XA 1R0WA 3WYGA 1CR0A 4ZIRB 5FOVA 1W49A 1U8ZA 1GJRA 5D3MA 1IQPA 4CEJB 1OHHA 2D7CA 2ZE5A 4DWJA 1W0KD 2H7VA 3B7GA 1NG9A 1E4VA 4CYMA 2P3SA 3ZC3A 5F98A 2P0EA 2WPDD 2VHTA 1ZYUA 2OCBA 1ZD9A 3D31A 1N6LA 1H8EA 5KPDA 2HDNB 3R7WA 1OV4A 1E9DA 3MHPA 3FTQA 2BEKA 1GSIA 5AJXA 1U0JA 1W36D 4Y7CA 5THXA 1J8MF 2JCSA 4MGZR 3OAAA 4Q00A 5DE3A 4LI0A 4PHHA 4IXMA 1GFIA 4Z1MA 4NMMA 4ILEA 3QG5A 3OEED 4EAQA 4X8HA 3DO6A 2Q9AA 3ICQB 3PEUA 4HLCA 1Q81D 4P4SA 2DHRA 2ORWA 1MRSA 2ERYA 4UNSA 4GDFA 2VRWA 2OHFA 1YZLA 1K6MA 1R6BX 2FZ4A 3IDQA 3K9NA 2OV2A 5KDLA 4C0SA 5P21A 3TVTA 5KTYA 4R9UC 1UBGA 2NTYC 3X1ZA 5KNDA 2WICA 2ZJOA 1L4YA 3P4YA 1KI7A 5E7JA 3OIUA 4FCWA 5M04A 1Z2CA 5KDOA 5KDDA 1G20E 4CEHB 1P73A 1DAGA 2YWHA 1X8LA 4TT3A 1QG2A 2ZSFA 3MLEA 5FBQB 1WMSA 4YXWA 5A4JA 2AK2A 2VHUA 3D8BA 3K0FB 3VHXA 3N2IA 4OJKA 3OEHA 4IVQA 1YZUA 3LVBA 1G4UR 2J0VA 1E0AA 1DG1G 1QGYA 1HYQA 3K70B 5J4VA 2O5VA 1FRQA 4BLRA 1D1NA 1VDZA 1XTQA 4NYJQ 4NU0A 4RFVA 1XD8A 1IN4A 3W2IA 4F4CA 4C30A 4RD1A 3KXKA 3TUZC 1Q1EA 2J7PA 4PSVA 3U7EB 4PR0A 5B30A 5KUTA 1VQPB 1GIAA 1VHLA 4GOXA 1AZTA 2BM1A 1US8B 4QXAA 3TIFA 3VKGA 1AMOA 1P62B 4LC1A 3X2SA 1BOFA 4TQUS 5E7IA 3B13B 2EWWA 3HPRA 4LUCA 1C9KA 3T5GA 1HH4A 2IYUA 1FQJA 4RKFA 5GJCA 4A0HA 4W9MC 1G6OA 2VLIA 5KNCA 4PSAA 1YZGA 1CRPA 3W5IA 1U94A 3R20A 2Q3HA 2XXAB 3EPHA 1M1YE 2RH5A 2Z43A 1H42A 1QHNA 3SHWA 1Q57A 3CUEF 4PPFA 4KLZA 3CC2B 1EP2B 4A1FA 4R71A 1KGDA 2JEOA 2XNDD 4DHEA 1SVWA 1HY3A 4BZQA 4YLGA 3QXXA 1AJEA 4BPBA 2C77A 1E99A 4XD7A 1G8PA 4O0MA 1E79D 2ORIA 2OBMA 4FMBB 1GL7A 2XTMA 4BGDA 1P3JA 2NGRA 2QE7D 2ZYVX 4I1VA 4Q4LA 1SXJA 4JJKA 2CCJA 1ZNXA 4RZUA 4KAXA 3U3OA 4D81A 2RGGA 2V1XA 2YC4C 2HUPA 4V03A 2VHCA 1A82A 1FFHA 1GP2A 2IC5A 4B48A 4XSGA 2H17A 3Q8XB 4PC6A 2CNWA 1QG0A 1N6OA 2W0SA 3KDSE 3TJZA 2QAGA 2GXUA 2XNSA 4LYHA 4BWYA 1BKDR 1BMFD 1ZNYA 4A8JA 2NZJA 2P2LA 3ADCA 4PFSA 1PZNA 2ZU0C 4KLNA 3U4QB 3FGNA 1KDRA 1T0JB 2TMKA 1QGZA 1G3UA 4KFTA 5ANRB 1XJQA 3KTAB 1W47A 1OXUA 4TYPA 2RGEA 4LYFA 1SVMA 3CMAB 5FTMA 5D3QA 5DN6D 2AK3A 2XJ4A 2HMAA 3W2FA 2BOVA 3I4LA 4OQFA 2WIBA 2AD1A 4DCUA 1GWNA 5HZKA 3IPYA 3LVQE 4YAUA 4N0EA 3KJEA 4HUQB 4ZKEA 1DADA 4LYAA 5H70A 3RSOA 2O8BB 4CT5A 1KO5A 4XH9B 3QG1A 1WBBA 3RRNA 4GPTA 4G1UC 3F8TA 2VP2A 2C8VA 3P32A 1KY2A 4TSFA 1ONBA 1D2EA 4F4IA 1FUKA 3AGPA 4DLSA 1AQUA 3BWDD 3D7MA 3HPQA 4MRRA 3FOZA 1CR2A 2GHIA 5LD2C 1WXQA 2EU8A 2V9PA 2VZLA 4KFUA 1IHUA 3T1VA 1JEDA 3EC2A 4DEXA 2MSEB 1FW6A 1J9ZA 3ZQJA 1OHHD 2FSFA 3DZ8A 1KAOA 4IDHA 1GUAA 2A2ZA 1AKYA 4EPWA 1XX6A 4HB4A 4CDGA 4IW3B 2Z6VA 4B4DA 3ZVMA 4QM7A 1JA1A 1J70A 4V02A 1H8ED 1AGRA 2A3RA 2CK3D 2HXSA 1NVVQ 1RJ9B 3CW2A 1KDTA 1SXJE 2CEAA 1NJFA 2GNOA 1MO5A 2PCLA 2R44A 4LV8B 4B2PA 3ND9A 3ADDA 3OAAD 3LRPA 3BC1A 2H57A 1UAAA 4B71A 1II9A 2D06A 3A1VA 1U9IC 2IYTA 4CEHA 4LBWA 4LHYA 1S96A 2AL7A 1F5NA 2ZE6A 3PCRB 5FUYA 3B1YA 3QIAA 3VKWA 1G3IA 4JT2A 3TKLA 3LBNA 2FWRA 5TDHA 3UANA 3K9GA 3OZVA 1KO1A 1XCMA 4N3NA 5H59A 2V6IA 3DMDA 4AURA 3BOSA 4TT3D 2V6JA 3AF2A 3SFVA 2VO1A 3O8DA 2PT5A 3TLXA 3OEHD 4L9WA 4TTPA 2A78A 1TADA 4HAXA 4HLDA 1M1KD 4PQYA 3KB1A 4PZYA 2VSXA 4QHSA 1DAMA 2NO0A 4TLBA 4PC2A 2C99A 3T1OA 2J7PD 3TGPA 1MO4A 2W6JA 2ZS8A 4C9BA 3E1YE 4EPYA 2HEIA 4AF6A 4TYWA 3SYNA 4PO9A 3NKVA 4AI6A 5C4MA 2IF2A 4LJ7A 1IN6A 1E0JA 421PA 2Z4RA 1OFUX 1XCGB 2GVDC 1DO0A 1FQKA 1LY1A 2PX3A 4KI0A 3LLUA 1G17A 1XD9A 1XEWY 4P32A 1GAJA 1EWRA 1LS1A 1S3GA 1XMJA 2GXQA 2XOKD 4UNRA 5DSZA 1QVRA 3W6PA 4A15A 3CLVA 4B3DA 2P6NA 1KY3A 5FBVB 3TW4A 2JGNA 3TBKA 4QNRA 4S35A 2NO1A 2KJQA 3BORA 1SVOA 3FDIA 1E2GA 1XMSA 1YR8A 5FH9A 4B44A 3MMPA 3KQUA 4MGIR 1WB9A 1OB5A 3GJ3A 3I72A 5FUWA 3REFA 1RRFA 2P6UA 1II8B 5JS7A 3RRMA 2O8EB 2YOFA 1D8TA 4XD7D 721PA 1Z0KA 4F7DA 1TNDA 2BDTA 4LV5B 1PUIA 3UATA 2ZE7A 2BMDA 3CNOA 4G5SA 2RHDA 3FHCB 3KJHA 1KTVA 3TUIC 1E2PA 2A9KA 2VNJA 3NH9A 1SXJD 3CRRA 4RCYA 4JLKA 3W5JA 1E2KA 3U4QA 1KMHA 2OUKA 4MH0R 1MO3A 1GNPA 2CNWD 1PLLA 3P27A 2ZJ8A 3GEHA 3KTAA 5UKDA 1DDIA 2LKCA 2QT1A 1WQ1R 1IXRC 3ZBTA 3EWSA 4WIAA 4Y9RA 3FYHA 4QM6A 4TLEA 3Q3JB 1OIXA 2RGNC 2QGNA 3P20A 1E1RD 1TEVA 1Z8FA 4F92B 1VQMB 1KD1D 2EFHB 4Z54A 2CL7X 4DQKA 2O8BA 3BIFA 5TMPA 3I62A 3Q85A 2J5XA 5EP1A 3OZXA 1BX1A 4DLTA 2X3UA 3BRWD 3PEWA 1LV7A 1Z6TA 5FI0B 4NCHA 2O8FB 1Z0FA 3IILA 1OGIA 3V00A 4PHGA 4Z8XA 3BAFA 2ZI3A 4M9SA 5HKKA 4FCVA 5CK5A 1E3MA 2B7CA 5EE0A 1M7GA 2D62A 1K8RA 4BFUA 3KXLA 4LV6A 2ZVQX 1XNJA 2JAQA 3RS3A 3GCGA 3QPUA 1E4YA 1ZNZA 3B9QA 1XTKA 1WRBA 4RJLA 2CXXA 2OK8A 4IEEA 5KSOA 2IS6A 2VEDA 5IDVA 1ZNWA 3EASA 1VQ6B 1CJTC 2BJWA 4URZR 1W36C 4U5XA 2R8RA 3U7GA 2W2TA 2HCBA 2WJHA 4K1XA 1XTRA 3NVAA 1JR6A 1W2GA 4A2PA 2D4HA 5FOUA 1QFJA 1YRAA 5FR1A 2PJRA 4JLOA 1IXZA 2BWJA 3TSWA 3I55B 2MMGA 1GRQA 4IKEA 2WOOA 5KSWB 4M9QA 5H1YA 2DFNA 2JIZA 2CJWB 3TMKA 4IDPA 2DY1A 1KK3A 3NWJA 2W58A 4R2HA 3ZDQA 1NVUQ 3LQQA 4JL5A 2OILA 1LFDB 2IYWA 3K0CA 4A0RA 2KWIA 3QVVA 5E3HA 5LPNA 3PXGA 2C78A 2AHOA 1XCPA 2Q0HA 4OQMA 4DLXA 3SJCA 3G6EB 1JAHA 4EJSA 4WAUA 3UMFA 1NJGA 2FU5C 3LVRE 5BN3A 3TE6A 3G4SB 1K8AD 4NPHA 2F1JA 5GV7A 3TQCA 1N6HA 4B73A 3ZYCA 5IT5A 1RRGA 1KMQA 1JA0A 2J0UB 4FCTA 1Q20A 4M1KA 4JS0A 2AD5A 3MCAA 5DYIA 4KHZA 5K8UA 2PZGA 1NN5A 4UXHA 2ZRFA 1RPZA 5AUNB 5ELXA 1GRRA 3B1XA 1KKMA 3C5HA 2DBYA 2C04A 1YJWB 4GOKA 2XZLA 4IOKA 2W6JD 3HWSA 4KITB 2ZS7A 4AG5A 5JSZA 4UXJA 1VIYA 3B2EA 3QEJA 3KQNA 1E94E 3A4NA 1E2IA 1T4GA 3T1QA 3CCVB 1T3HA 3KKOA 1D9XA 3QXJA 1QHGA 5EZ6B 2IUTA 1W4BA 2BIFA 1Z07A 4OKSA 2YKGA 3U3MA 3U3RA 3RS0A 3EPLA 2O8EA 4B6EA 1DAHA 1P72A 5C1BA 1GM5A 4PANA 3CIOA 1SHKA 4D0LB 2VHJA 3IUYA 3FPKA 1KDOA 1MV5A 1R8QA 5SZIA 1QRAA 1E9RA 2HF8A 2ZANA 4HB2A 3K9HA 2X77A 1ZUNB 2XZOA 2XGJA 1GKIA 4NYJR 4JKIA 1NY5A 5TR9A 3GJ0A 2FA9A 5EZ5A 1B23P 2PL3A 5HR5A 1BIFA 2J59A 1CQXA 4D82A 4OL0A 2H8KA 1GO2A 2DERA 2QEXB 3CNNA 5KNBA 1TQ4A 1YRBA 4JSYA 1Q0UA 2VBCA 3G0HA 3DEFA 5HCIA 4LY6A 3K9LA 4PXAA 4M9ZA 3THYB 2VSFA 1EP1B 3SJBA 2OZEA 3A6PC 1E9AA 4D6PA 3A1WA 4TMKA 1P9NA 1UADA 2ZETA 4BUJA 1OFIA 4P0TA 2XITA 3O47A 2QI9C 2QORA 3QKRB 5GVRA 3LWNA 2YWEA 4OK3A 4HLQB 3PITA 3A1TA 5TARA 3UMRA 2C9CA 4NKRA 1TTTA 3TR0A 3IO5A 2O8FA 4MRVA 1DVRA 1L8QA 2ZR7A 3U60B 2VPPA 2G88A 3PEYA 1P2SA 1YVDA 2WWIA 1X86B 4TL7A 4I1OA 4XWAA 3OIVA 4YC7A 4C0AC 4ZGQB 1R5OA 2Q21A 2OXRA 2AR7A 4YONB 5DISB 1J90A 5FL7A 1P61B 4H1VA 3BB1A 4NCKA 4V0ME 1G1MA 5HKKD 3HYRA 3K0AB 1KJWA 1BJKA 2HJGA 2RKOA 3E2IA 4C0QC 1KSFX 2ZREA 4YALA 2F43A 3ES9A 3QF4B 4C7OA 1VQ9B 4PGOA 3QKSB 2CRVA 4L16A 4PZZA 4L5BA 4OI4A 4FK8A 5FI1B 4IFBA 3CRW1 1MT0A 3VMFA 2FMXA 1GVHA 2QG6A 3K1JA 2ZRIA 5LDDC 1OH8A 3PFIA 1N6IA 2F1RA 1I2MA 2G1KA 5KU1A 3OW2B 1AZSC 2FN4A 3SNHA 1P5ZB 4OI0A 4TYNA 3IQWA 1VQ8B 4GP7A 1GOTA 1U0HC 3GLHB 4DDUA 2CCGA 2JLQA 5C46F 4HSEA 3FKSA 5F9FA 3E5HA 3VKHA 4ZDIA 1R5BA 5FPSA 4DLRA 1E0KA 1OXXK 2OEPA 3GJ8A 3S1AA 4AG6A 3SN6A 2XTNA 1O87A 1P75A 1OFTA 3F0TA 1IJEA 3M1IA 3LQRA 4GBMA 3AP1A 1OW3B 1XEFA 4WZAE 4BFYA 5JEEA 1IBRA 1TAGA 1FNBA 2A5JA 3CF6R 2DB3A 4Q66C 4QBIA 1QG4A 2QDXA 2CVHA 5HXBA 2V54A 2WWWA 2ZI9A 2ZQ5A 2JLXA 4G3XA 1E69A 2QSYA 4GT1A 1T3SA 4PO1A 3VX4A 5IK2D 5J4HA 2IW3A 2XJ9A 2R6FA 3NBZC 3R9WA 3DOFA 3PV0A 1ZUIA 2G9NA 2BKUA 3QKUA 2IYLD 1GILA 2C03A 1W0JA 1A8PA 1H85A 4B74A 2JDIA 2ZSBA 2JATA 3H4MA 1NSFA 4H9GA 3FKQA 2EFCB 2GZDA 2DPXA 2FPMA 4FWTA 1NVVR 4X8MA 4TTQA 2ZSEA 3QSYA 1EXMA 1VHTA 2QAJA 5FOXA 2AFIE 1U81A 3GLFB 2VA8A 1KYIA 4BZXA 2FPKA 1A4RA 2AXPA 3GFPA 3CH5A 4DCVA 1SVSA 5F3WB 2UKDA 2WWGA 4Q7KA 2ANCA 5AN9A 3EWAA 4HYYA 2IK8A 1GKUB 1YZKA 4HLUA 5J4YA 2BMFA 1SULA 2ZITA 1XD2B 2OFOA 1RFLA 4B3CA 4URXR 1CTQA 2C9YA 4YAOA 2QPAA 5EP2A 1Q7YD 4DEYA 3CMEB 1E2QA 1EWQA 2CLCX 3AKEA 1H8HD 3RWOA 5J4LA 4ZPXA 2OAP1 4PZLA 3ZVLA 4LGMA 4M21A 2CBZA 1CNEA 1NG1A 2AXNA 1ZIOA 4EPXA 4A0GA 5G53C 3ASYA 1E9BA 4R2IA 1M34E 5FPHA 1A2BA 1CR1A 1P2TA 2BN4A 1ZMXA 2ZI5A 4US1R 2B8TA 3CONA 4B76A 1LVGA 2RB4A 2IT1A 3ZH9B 4XVUA 1DBSA 1GVNB 4OHYA 3TR5A 1VQNB 1KO8A 1SXJC 2F9LA 2OT3B 2QT0A 3X1WA 3THYA 3DL0A 2YWFA 2MSCB 2AN9A 5EE5B 2C5LA 3DDCA 2ZI6A 1VIAA 4ZI3A 2PBRA 2GEUA 1GAWA 2ODEA 1EWYA 1CIPA 1ZAKA 3WNDA 3WP0A 3CKLA 2IX3A 4EKDA 4DLZA 1VG8A 2QAGC 3QKRA 4A8JC 2IHYA 1KI8A 4GFDA 3WNBA 3VR5A 5L3RA 5IHPA 5JWRA 1TF2A 4JVNA 4DDVA 4M1YA 4EPRA 3FMPB 5EE3A 3TSZA 3DMNA 1GL9B 3FMFA 2O8DA 4GMXA 3AVWA 4ARZB 3THXA 1KNQA 3H86A 3IBGA 2PIAA 4NDZA 3SR0A 3LX5A 1F20A 4ITRC 4F7WA 3HYTA 1W1WA 2BJVA 3RLFA 4ZI2A 2VP9A 4MA4A 2KE5A 4D2IA 3FHOA 1G8FA 2AFHE 4YMUA 4AC9A 3G5UA 1SVLA 1QZXA 3OIWA 4KO8A 4R7ZA 3I5YA 1PUJA 2BSAA 1E2HA 1Z0DA 1JBKA 4EUNA 5FL7D 2BBWA 4OI2A 1JQLB 3QF4A 1W5TA 1KK1A 1VCOA 1NLYA 2ZTSA 4MKFA 2ZYWX 1ZJ6A 4WVFA 3DKPA 3ZIAA 3VU9B 2XNCA 1Q82D 1DELA 1Q22A 1UPTA 2BHRA 2WSSA 4I1SA 4Q9JA 1P9WA 3PR1A 3U5ZB 3SU8A 5L3QB 1E2JA 1G8HA 1PV4A 1FNMA 1RYHA 2FG5A 3NC1C 2OE2A 3W34A 1UMKA 3RWMB 1RVDA 5L3SA 3AM1A 1W4RA 1A2KC 2G3YA 4Q4AA 1TL7C 1EGAA 4DJTA 3FE2A 1GG2A 4LK2A 4IJMA 2IXFA 4UXIA 1XMVA 2H1LA 5B58C 1QX4A 4Q4JB 4FINA 1II0A 4WZBE 1MKYA 3GLGB 4B34A 1F2UA 3U7HB 4E5UA 5JFGA 2CHVA 3FKSD 5GVSA 1D5CA 4O2LA 1XXHA 3CCJB 3B85A 3UG6A 3UPUA 2J1LA 1E96A 4OBEA 5GJWC 2IYYA 1NIPA 3N70A 5IRCD 4QHYA 5JRZA 2XX3A 1TUEA 2NZ8A 1HQYE 1CJVC 3LW8A 2I3BA 1UBEA 3OE7A 1EX7A 4WOPA 5KO2A 2OTJB 5JJLA 4DC9A 1J2JA 4LJAA 4TLCA 5TB5A 3VX3A 1IY2A 5BN4A 2I1VB 1Z6YA 3F3YA 5AR1A 1U0LA 4PAMA 3CF2A 1G7SA 4AWXA 2JASA 3QI2A 2R6AA 4RY2A 1K73D 4YMVA 1HUQA 4Q1EA 1XPOA 4AKHA 5FPKA 2UZ3A 1JR3A 3EX7C 1KO7A 3TH5A 4DRZA 4LRWA 4LWZA 2FH5B 1DO2A 2GCPA 1W0JD 2L0XA 3CR8A 1PVOA 1E9EA 2K5UA 2BGJA 4M4SA 1GRNA 3BK7A 3LXRA 1QHHB 2LWIA 4A2WA 4IDOA 4D26A 4E09A 4M1SA 4C3ZA 1XZPA 3AUXA 3FJOA 3QXSA 2IL1A 3AF1A 1N5JA 2ZRBA 3FFAA 2H16A 5DHFA 5CITA 1SGWA 4JT4A 2FFHA 4A0FA 3EZ9A 2ZJZA 3LNCA 2A5YB 3BFKA 4PX9A 2QENA 3AVQA 2XEXA 4DLUA 4KV9A 4BRWA 3MSXA 3CCMB 1P60A 2RGAA 5J4KA 1KRHA 1ZD1A 2AKYA 4JVMA 2IYRA 5CYOA 3WRXC 5E7MA 3U44B 1X8JA 3L0OA 2OXCA 2VTKA 3QUSA 5L8VA 2QPOA 5FUXA 4NL4H 4AY2A 1ESMA 2EW1A 2ZSAA 2ZSDA 4WW0A 3RS5A 2OSBA 4P31A 2VP6A 3QBVA 4Y9UA 2X2FA 2F6RA 1NVWQ 1VPLA 4Q4HB 2O0JA 1XP8A 3AKYA 3R8FA 1T6NA 3FMOB 3CX7A 2QMOA 4XTCS 5LB4A 1XXHE 3WBJA 1FTSA 1R5NA 1VG9B 5BWMA 1OYWA 2QTHA 2NG1A 4ESVA 1IXSB 3L43A 3CX6A 2ZEJA 4M22A 2IYQA 1FOEB 3EIEA 3O8RA 2EIXA 1FPMA 3GJXC 1R2QA 2P67A 1N5LA 1OIVA 4HEJA 1IN7A 4FN5A 2ERXA 2ODBA 3UIEA 4HZUA 4D25A 1NBMA 1U2RA 3U6KA 2NO7A 4YDSA 4ZIRA 2XAUA 5BN5A 5HE8A 2PJZA 3LH5A 1JR3E 4W5JA 4A6PA 4CEJA 1VQ4B 2YNMA 3UWKA 5BXQC 3Q5EA 3JZAA 2HLDA 3JZMA 5FBLB 4OHVA 1E98A 5FR2A 4UAJA 2AKAB 2B21A 4XVRA 2WKRA 3CWQA 1KK2A 2ZAOA 4K8OA 4Q7MB 2ZRCA 2CHQA 3RRYA 3RVBA 3QVUA 1JJVA 2RAPA 3AEZA 1XPUA 2ZR0A 4CVNA 3MFYA 4Q7JB 4Q9HA 1NRJB 2JLRA 1YR9A 2W0MA 3IPXA 4UKDA 2FFBA 1W4AA 2RC6A 3FVQA 3CC4B 3SC3A 3AP2A 3JQQA 1SZPA 4AYTA 1CJMA 2PEYA 2YWGA 4MYUA 5JHHB 3IIMA 4QGHA 5TVKA 2ZRMA 1XJCA 4BQSA 4C0JA 4Z1MD 1G5RA 4TMTA 3VTKA 1IJFA 1Z83A 2Q9CA 4HAWA 1O3YA 5GV8A 3ECCA 1M7BA 3WMGA 1GNRA 4BASA 4AK9A 4JL8A 1YJ9B 3ZVRA 2FGKA 3FMIA 1S9DA 3MWJA 3GLGA 4B6FA 3K0FA 2V55B 5EXPA 4CZ2A 5AJVB 2A5FA 1R4AA 2GF0A 2JJ2A 4PPNA 4OI1A 1S1MA 2YOGA 3W8RA 4G5RA 3W2EA 4OQXA 2CDNA 5J40A 2OFXA 3KJIA 4YXWD 5GJVC 3ZLJA 1P4SA 1CKEA 4DB4A 3GFOA 3Q72A 5JWHA 221PA 1US8A 2JLYA 4M1OA 5JJIA 1NBME 5EJEA 4BLSA 3U3KA 2J0SA 3KX2A 3CRZA 2DFLA 1QBKC 3B9PA 1QUFA 3CR7A 3W5UA 3B8HA 4DXAA 1G3RA 1ZU4A 4MKGA 4DIDA 3KQHA 4J0QA 1Z29A 3K0CC 3A1UA 1OH5A 3OE7D 2VF7A 5EP3A 4NE2A 5BYKA 1OF1A 3OZUA 2AX4A 1CULC 2XXAA 4EJSC 1PLJA 2OBLA 2QNRA 4D4KA 1M8PA 1QHHA 1WP9A 2UVQA 4I1UA 1CXZA 2ZRNA 1JR3D 1NKSA 3ZS9A 1P2VA 1FX0B 1NN3A 5CDFA 3WRYC 1E9SA 1E2EA 3BB4A 4FMDF 4HDCA 3TQFA 3CWZA 5DIFA 4NCJA 3GD7A 3THWB 3OHMA 3V4FA 1DAKA 3P26A 2IS1A 1VQLB 1MABB 1OXSC 2H5EA 5EXSA 2G6BA 2OCYC 4KYUA 2FX3A 3P1JA 4DLYA 4B3GA 2X2EA 2GXAA 4Q18A 3CRMA 2WKQA 2V3CC 2ZR9A 4FMDB 3PG5A 4U02A 3EC1A 3T06B 3C7KA 4AYWA 4RZ3A 1VECA 3VNUA 4QC2A 2BVNA 3BD9A 3DVLA 4NP6A 2EFEB 4QJ4A 3RC3A 3SYKA 4CGZA 4HAYA 1NY6A 4HZIA 2EFGA 2ZM5A 5F9HA 4Q4HA 3MWKA 3AVXA 4JZKA 1SKYB 3IEUA 3GLGE 2WWHA 3CZQA 3LO8A 5EP4A 1D6JA 3IKJA 2VP5A 4ZDJA 5CB8A 2IYSA 1CP2A 2WMNB 3AGQA 2J0QA 1I4DD 2X1VA 1N0WA 4HE5A 4KBFA 4N0DA 4RSGA 4P6VF 1YHQB 2FOLA 4B43A 2WHXA 1FRNA 1RYFA 1VQ5B 4TMVA 4OYHA 3TW8B 1FMJA 3EZ6A 4HB0A 3WMFA 2IYVA 2BGIA 4DUGA 5AWFC 1N2CE 4D0NA 2ZJ2A 1X8KA 4HUQA 2E87A 2I4IA 1L2TA 2GZAA 2WVJA 4EFMA 2QRZA 5JLJA 1HEIA 1XWIA 1U90A 2Q9BA 1XPRA 3CRVA 2OFWA 4QJ3A 3N2EA 3RSLA 1KC8D 1WA5A 3O8BA 2IBMA 5TV2A 2GQFA 4TMXA 4Q1AA 3A1SA 2JA1A 2ECKA 1OKKA 4HATA 4URUR 4ZO4A 1CU1A 3OJWA 1HT1E 4QBFA 621PA 4PC3A 4M2LA 4TSFD 5FA6A 4RD6A 3TRFA 1D2MA 4QFMA 1Z6GA 5CDFE 5JCPA 4KODA 1E2FA 5BYJA 4QG7A 2CL0X 2EYQA 3OIYA 5A0FA 4GOJA 1E2DA 2GAAA 3I8XA 1IONA 1V5WA 3F5FA 3PEVA 4LBVA 1XBTA 2BF4A 2B8WA 1RJ9A 1ZCBA 3NEYA 4WQMA 4URYR 3NHBA 5AUQA 1RRPA 3MJRA 1NI3A 3WXMA 2DEUA 4MITA 4Q1FA 1HT2E 2NMVA 4IFEA 1X6VA 1U99A 5FL3A 4PAOA 2KBFA 2WJGA 3UK6A 3QE0A 4GZMA 1SQ5A 3U6BA 2RC5A 2J9RA 1AKEA 3AF4A 4LJ5A 1W36B 3AKCA 2VIIA 3IEVA 1E0SA 3E1SA 2WV9A 4H1UA 4M1MA 2CHGA 1I2DA 4BEBA 3R9XA 1AN0A 2C95A 2REBA 1S3SA 3PUWA 5DLQC 4QGGA 1E2LA 1T8TA 1C1YA 1CBUA 2HV8A 4RCZA 1TQ6A 5JEDA 1GNQA 1M7HA 4XWKA 2LCFA 6Q21A 4CW7A 2VP0A 2HT1A 1F2TB 3SE0A 2O52A 3VHLB 1Q1ZA 1CJUC 5TY0A 4DSTA 4M1WA 1HV8A 4BFTA 4YAWA 3K70D 1QVFB 1JPJA 4GI7A 1AS0A 4UNQA 3LLMA 2QROA 2V1UA 2YV5A 4C2UA 1XF9A 1E9FA 2BBSA 5DI3B 5K8TA 1S4QA 3TAUA 4F93B 2FFAA 1Q86D 521PA 4C0HA 2QY9A 3AUYA 1RIFA 3B60A 3IO3A 4W7SA 2B92A 1YKSA 3DHWC 4JVLA 2XSZA 3W9YA 3WBKA 3SQWA 5EUQB 4KU4A 4WA7A 2IEYA 1QGAA 2QMHA 3D6TB 4XWOA 821PA 3CCLB 2RCNA 1XEWX 1KJZA 2E1RA 2QEQA 1KI6B 4EIWA 2JJ1A 2QRNA 5SZKB 1NMZA 4JLBA 1Z47A 1NLFA 1EFUA 1JECA 1TMKA 3THWA 3LA6A 1E6CA 5FTNA 1VQ7B 2ZUDA 1E1QA 3B1VA 1OT3A 3GLIB 1DEKA 1II8A 2GVZC 2OESA 4A4DA 2J87A 3NIBA 1JALA 1GDDA 1FUUA 2GK7A 4QKQA 4LHZA 3AF0A 4TQAA 3V9PA 2O8CB 1A7JA 3KB2A 3GJ5A 3B1ZA 4GRAA 4OQLA 4F4JA 4MDFA 2GCOB 1N0VC 5K8LA 2R62A 4QGAA 3BH7A 4KVAA 4TL8A 4HLUC 1DE0A 1EP3B 1DAEA 3C15C 4ZCMA 1ZVQA 4GP6A 1CRQA 4KJZA 2MSDB 2PZFA 3EZ2A 3K0SA 1XZQA 3EIHA 5FPYA 4TZ6A 4IXNA 3SOPA 2ONKA 3EW9A 1S9HA 2DFKB 3LBHA 3N5CA 4XSHA 5FTKA 2F9MA 4G1BA 2EWVA 3B6EA 3T12A 1XFAA 1DS6A 2QPTA 4XIGS 1KIMA 2I1QA 1E64A 2ZXUA 2RGCA 3QOFA 1RRCA 2P6RA 4OHWA 3UG7A 2VQSA 3MWYW 3RYTC 4GZLA 3L0SA 3P4XA 4DUGD 1N6RA 5G3YA 5H68A 2EVWX 3QFTA 1BQEA 2REXB 2VNHA 2C9OA 4L9SA 3ZGXA 2WWFA 1T91A 5C18A 4QGFA 1G21E 1DAIA 4N3GA 3IIKA 1UEIA 2FSHA 1CF4A 1ESNA 1A5TA 1EFHA 4LYJA 1CR4A 4RFSB 3J81k 1NF3A 5AUOB 1T9HA 4C4PA 3PUXA 1DPFA 1EK0A 2CNDA 3AV0B 1HE1C 3CX8A 4WXRA 1KI2A 1W0KA 4Q47A 1XMIA 1W2BB 3QJYA 4W5HA 3QY0A 3ETLA 2E9SA 2ZJ5A 3CF0A 1F3OA 3GJ7A 3HU2A 1T5LA 3AKDA 4RZ2A 1NKTA 1S8FA 1YHNA 1SKQA 2ZRKA 3QKTA 2OO7A 3RHFA 2HF9A 5HTKA 4C0KA 4A9AA 2IEZA 3W2HA 2N42A 4NYMQ 4QRHA 2GRJA 5CLQA 2J45A 2D2FA 1M6NA 2D2EA 3U2QA 1K5DA 5LBIA 4XJXA 4FMCB 1XEXB 2OTLB 4Q48A 3GJ4A 1F48A 3OJXA 4GSYA 1L4UA 3R7WB 4L15A 2CJWA 3ZS8A 4LBYA 1CS4C 4Q19A 5EE1A 4FD2A 4JLVA 1OGJA 2CCKA 5JBQA 1N0UA 1AM4D 1F2TA 3RS2A 4HAUA 4D4JA 2XNJA 1JI0A 4G0NA 3QFRA 1OH7A 3L8ZA 5GJBA 1KJYA 1X3SA 2V7QA 1TF7A 2JIZD 3M0EA 1COWA 3AF3A 2BMWA 1N6PA 2C2HA 3LXXA 4IOLA 1KOFA 2YYZA 4X8OA 5DI9A 2YJTD 2GBLA 4MKHA 2NPIA 2ZJYA 4LHXA 2CVFA 3K09A 2WAXA 3BFXA 1UJ2A 2IHBA 1QUEA 2J0UA 5CJ2A 4A2QA 2R2AA 1QFZA 1V43A 2QP4A 1LW7A 1Z3IX 3CBQA 4NTZA 4YDHB 3SJAA 1DTSA 3C16C 4GMDA 4E03A 2ZS9A 4BPRA 2OM2A 3L2OB 5FBWB 3QPVA 3PUZA 1KI6A 1N6NA 1N5IA 3ONWA 4RD2A 4Q9KA 2PH1A 2XSZD 1SHZA 2BBOA 3DPUA 1MRNA 3X1DA 3CZPA 2HCJB 2A30A 3UXMA 1ZU5A 3W5VA 1OFHA 2QZ4A 3W90A 1GITA 2GF9A 2JJ1D 2QUZA 2Q6TA 3H84A 2N46A 2ZVPX 4AIIA 1UBCA 5AJYA 3G71B 2JLUA 1OB2A 2YHSA 3WY9A 3FHTA 3RC8A 2QTVB 5CIWA 2OLJA 3I92A 1I4TD 5JECA 1Z63A 3ZBUA 2IWHA 3FPAA 3LAWA 1FP6A 4OK6A 3MUFA 4BFZA 1Z28A 4U00A 1S2MA 3W3AA 4I81A 2QMEA 3AVYA 4MUAA 4PPGA 4CEIB 1JB9A 2BM0A 1W4CA 3I8SA 4EPTA 2DCUA 5KHOC 5BQ5A 1I7PA 1I4LD 1Q44A 2IS2A 5KSPA 1KK0A 1UKZA 1AQYA 1UKVY 1S72B 1P2UA 2Q3FA 3ASZA 4KBGA 4XTRA 1DOAA 2WKPA 1SXJB 2F7SA 1IY1A 2V8OA 2VSOA 4BLOA 4ESHA 3BFVA 1KHTA 3JQRA 2KBEA 1TU4A 4QBHA 4D0GA 2FSIA 3EAQA 4TL6A 1TPZA 2DETA 4DCNA 3NDPA 1XJ0A 2O0HA 4G5GA 1BH2A 4KSBA 2QAGB 4V0LA 3W8NA 2X19A 4E07A 4A8JB 1XE1A 4B2LA 1R0YA 1DG3A 1QFYA 3QPWA 5EXXA 3A8TA 4W5WA 2WJVA 3QENA 2IA5A 4A6XA 3PVSA 3RRZA 3RABA 2F3TA 2ORVA 2R9VA 3SBEA 4DKXA 5G3ZA 4LBZA 3EZFA 5CK4A 3RNLA 4DCSA 5H8WA 2ZRHA 3K0AA 4TQ9A 3AH8A 1P6XA 4P33A 3AVOA 1SVKA 3ZZTA 4NYIR 3JQPA 1AS2A 2R6HA 3QKSA 3AVPA 2D7DA 1YR7A 1ZC4A 1QHYA 1DAFA 4YAFA 1BX0A 5DNYB 1AK2A 4DBLC 2CE2X 4CRWB 3ICEA 2GZHA 4F38A 2VH5R 4YHBA 3QNUA 1X1SA 1DARA 2QL6A 3H0KA 2Q3MA 2B7BA 1OJLA 4DB2A 1Q1QA 4D4MA 2QTLA 1ZIPA 4KXFB 4MGYR 1XEXA 3GLHA 4B3FX 4LHVA 2CK3A 4YQFA 3KQKA 1NMYA 4M1TA 5CB6A 1ZRHA 4KYIB 2DYKA 3UMSA 1DDGA 4V0OA 2FF7A 1ZBDA 2GWHA 3K53A 4BLPA 1JXOA 1N5KA 4JVSB 3NDBB 4K81B 5JJKA 4TYQA 4MYTA 4IDNA 3CPHA 2OCPA 3CPWB 1QDEA 3B1WA 3T61A 3GPLA 3D3QA 4Q03A 4YMTA 2REOA 1G3QA 4B3XA 3FB4A 1KQSB 1W44A 3U61B 1CNFA 1ZM9A 1LS6A 3KKPA 2HYIC 1JNYA 4NBSA 2C98A 3KZ1E 2V7QD 4MUBA 2YC2C 3KKMA 4ZV4A 1COWD 2WM9B 3K70C 3TK1A 2FSGA 4LCBA 4JLDA 2NOAA 1ZINA 4JBYA 5FBRB 3ZZUA 2W2XA 1EESA 3KL4A 4ZGNB 1GKYA 4HB3A 3RAPR 1CJKC 4LX0A 1Z2AA 5B57C 2FFQA 4WZ6A 5JWOA 4QL3A 3IGFA 4I4LA 2WJJA 3GLFA 2GJ9A 1L7VC 5FUVA 1W34A 1NJID 2QA4B 5IF9A 4MYHA 1T5IA 2JDID 3G82C 1ELOA 4ZCLA 3HR7A 2DFTA 1RC8A 3GFTA 3LFUA 2CLDX 5AJWA 5KPJA 4JBXA 3EPJA 1G7TA 4C0LA 1EFCA 3BE4A 4NCIA 1VQKB 1XD2A 2NO9A 5E95A 3CH4B 1ZM4A 1TQDA 2GEVA 2GJAA 3GEIA 4IHQA 4IOJA 2GJSA 2ANBA 2IUSA 4AF7A 4BFXA 1VTKA 4TLAA 3VO2A 2XOKA 1NMXA 2CMKA 3NH6A 4DVGA 2RGDA 3DM5A 1JPNA 1AS3A 1W46A 1NVXQ 3EZ7A 3WHKA
chains in the Genus database with same CATH superfamily
1KI1A 4RHEA 1C1DB 2WF9A 2GOYA 6REQA 3C2QA 3FNHA 3K4QA 2WZQA 3BTVA 4G24A 2FZLA 3E15A 4I3GA 5DBGA 1TUIA 1WCWA 3BVPA 5AVKA 1EDBA 3A1DA 3EA0A 1E8NA 1GUZA 1T4CB 4QASA 1A4XA 3AZPA 2YVQA 2FRVA 4R1LA 2JCYA 4BEJA 4GC5A 1KQ3A 4UBNA 5BRJA 3SY8A 2AN5A 2CF5A 2GYUA 1ZSVA 1HTBA 3QFFA 4Y6PA 2GKSA 4BNUA 3F2IA 4F3TA 4UBOA 3I39X 1YVRA 4B47A 2TRSB 1XKTA 2ZWPA 4K46A 4KGVA 5IVIA 4YROA 4XLTA 3WIVA 4BUCA 2ODWA 5AXDA 4AS3A 3N0VA 3TFOA 1PR5A 2HUNA 4DY6A 1QZZA 3ZU5A 2WTEA 3BJIC 4W9NA 4CIXA 1PBTA 5G4LA 5FTLA 4M88A 3DM9B 4AYXA 3V76A 1WSAA 1O95C 2AQIA 3GJRA 4Y2HA 2NP6A 5C53B 4P3OA 4PTYA 1CEYA 2YJNA 2IYXA 1BG6A 1YHZA 1YQTA 4Z4SA 4Z1OA 3GQVA 3WIEA 3KHSA 4MQBA 4XXHA 4J16C 1WW3A 5BVHA 4OFWA 1E1RA 2PZEA 1G7CA 2P9TA 4B2IA 4UDNA 3I32A 4JR2A 1J20A 4ASUA 1KS9A 1RQ2A 2ZXHA 4N3CA 3TJMA 3KYCB 2VK2A 4N12A 1QH9A 4K0KB 3LX8A 4PYNA 2PBLA 4QUDA 3REGA 3EG5A 5LD2B 3P8ZA 1WY7A 4RIFA 3AESA 1H5UA 1ZJZA 1UEJA 3PT5A 2LD4A 1VKZA 4CNBA 5JAHA 1JG3A 3PVZA 3EMBA 4GPAA 4HWGA 3IOEA 3PXGA 4FBMA 1E32A 2C42A 3EQ6A 3GMTA 3JAWA 4ED9A 4PFQA 2IPLA 3VFDA 4MW4A 2QNBA 2BF7A 3UMBA 4NIMA 3ZDBA 2QUHA 1Y37A 2PE5A 2I22A 2FW6A 3IUMA 1YITB 5IJ9A 1KSGA 4EB6B 4W63A 1V11B 2ILVA 3CKKA 1NVGA 4MQEA 4DLLA 1ODIA 4PGMA 2DUUA 3DWGA 3ENZA 3CVVA 4FPXA 1WSDA 3FTDA 4KO2S 3TQSA 5EQDA 3VZDA 4Q4JA 3HNOA 4AZSA 3BH6A 2OZLA 5LP6C 2DT5A 4CKEB 1OLOA 3AEUB 3LWDA 3GQBA 1M2OB 1ZXBA 2AZ4A 3DFKA 2GK6A 1Q3TA 5H02A 4AU1A 3CZ4A 3NV7A 4KPFC 3UFBA 2H0RA 1ZCAA 1M8FA 2HXGA 3L0IB 3FNGA 4G9GA 2BUCA 2BPOA 2IYNA 1OAKA 3H2ZA 3OQ1A 4TN5A 4UQLA 2W6OA 1LVUA 3NORA 1J5XA 1V4NA 2DR3A 1L0BA 3C7CB 3IXMA 3QZUA 1KP3A 1XTIA 4EQ6B 5D85A 1E3SA 4YQEA 4HAVA 3HNPA 4MWCA 2PUEA 3TCKA 1G64A 4J07A 4BJ6A 4EO9A 5IJ0A 3GVCA 1Z06A 4BE7B 3KUXA 5KYVA 2R65A 4PAQA 4XLAA 1X19A 2QLBA 4JBWA 3F71A 3C8UA 4I4CA 1QAQA 1Q7GA 1OH6A 3Q9LA 2I91A 2GLXA 2EIHA 2LCIA 4ZZ3A 2X7XA 3NHAA 4CDRA 2BM8A 4P4UA 3FOZA 1CB7A 2HYDA 1J1IA 1HYEA 4TTRA 1FL9A 2B4TO 2WMOB 1J33A 4DJ5X 1J7JA 2JKVA 4L4SA 4Y2JA 3W3ZB 4DCCA 3CT4A 1ZIXA 1OUMA 5FLKA 3L1HA 3RQSA 4PC7A 4IKPA 5ERYA 5ALRA 5AJZA 4JN6B 1VYVA 4X8LA 3F7TA 3REQA 2VXYA 4QPDA 4XASA 3A2LA 2WYUA 2M6SA 2VQ3A 4TM8A 3RLIA 5BN3B 1QK4A 3HYSA 1KQNA 1NNEA 1SM4A 2ECQA 1JAXA 2R6GA 3BK1A 4O1MA 3UAZA 2RG7A 2W90A 5K4HA 2LW7A 1BFUA 2QM7A 3CURA 3UHJA 1PWHA 4EO7A 1O94D 1QRDA 1IY0A 2G67A 2HQ1A 3VU3A 3V8RA 1XDGA 4CMBA 4EFLA 2XB8A 4ND6A 4JLMA 4IS2A 1RPAA 1T8WA 2PA3A 2LR0A 5JCJA 3VR2A 1X42A 1ADJA 2KW5A 6GPBA 4Q3NA 4XJVA 5IUKC 4HDRB 5JSZB 4MUYA 1HI9A 4NYIQ 2FMFA 1DUIA 2WJZB 4WWHA 5DGDA 2NV4A 1Q3HA 1QKIA 3PDWA 4J3JA 3ZQKA 5B1EA 2PV0A 1V5GA 2UYOA 1E2NA 5B37A 5A04A 2VUSA 4B4KA 1A9RA 1UK7A 3Q8KA 2QU8A 4LZZA 3R5KA 2QTZA 2PCJA 1Z18A 2Z2XA 3ANNA 1TCAA 3IIJA 4OIMA 1M90D 1UD4A 3MLAA 3V6MA 1K5GA 2W6NA 2B6NA 3AB3A 3BXOA 2PUGA 5CRIA 3B2NA 1JHAA 3WQQA 4XCVA 2B35A 4NONA 3UM9A 3WB1A 1HDXA 3WKEA 3DT9A 3BK2A 4REOA 3TNFA 3TSCA 3PC4A 2LNDA 2P5SA 2EHDA 4GAEA 4KC0A 2UZIR 1JRLA 3VNRA 4BNNA 3U40A 5ICEA 2EL9A 5HGJA 4ATNA 5FLXA 2HBZA 4V0KA 4PQGA 2RAFA 3S5UA 1LA2A 3CLRC 1FZQA 3LQ6A 4DT1A 4IZIA 1MHTA 3EQ2A 1NBHA 1ODLA 1Y48E 2R86A 5ESWA 3E22B 1AKRA 1H65A 1YIJB 1LNZA 3IC5A 5KTMA 4ZCIA 1X15A 1ISMA 4DCMA 2ZPTX 5AW3A 3H1FA 1NBMD 5T4FA 5AKYA 2HJVA 4Z7OB 1RQPA 3SJZA 3IJRA 3O8NA 4P4TA 5ALZA 4JP3A 1OPXA 4H1WA 5LIPA 1X1BA 3HFJA 5SV2A 3PZRA 4LJ9A 5LBUA 1JKFA 1TUBA 4D3YA 3ESXA 4DK1A 3L01A 3U7RA 1EUZA 1QHSA 3R9IA 4WZTA 2HLDD 3OX1A 3RUEA 3EUFA 4P2NA 3CF4A 1M72A 4G01B 3VNSA 5AVQA 4D98A 4J4TA 2GAIA 1VYUA 4X0EA 4RVHA 2ZRDA 3NYIA 3WICA 4L5IA 1C7JA 4JUAA 3T3OA 5TF0A 3QEOA 3CCRB 4I3HA 3SDZA 3WOVA 3E9CA 4B4VA 5FOTA 4EYKA 1X80A 4WINA 2P9FA 4MKRA 3PFFA 5H3CA 4ZDWA 1HDEA 1YE8A 4JNKA 4JYBA 2I3DA 1RW4A 4MYCA 4Q1CA 4PVDA 1L5FA 4D44A 4ZA2A 1ID8A 2VYQA 1K89A 2VPIA 3G2OA 3VO9A 3LCUA 1L5VA 3N6XA 3ZCXA 4EY7A 4QOJA 5JS1A 5COBA 1CLEA 4HFRA 2DKOA 1U98A 2BUAA 2QF7A 5HFJA 4AZTA 2H07A 3I58A 3O1JC 2PO5A 3MYRA 4Q7LA 2AFIB 2BT4A 1F17A 1ZP6A 4MCJA 3GIRA 4D99A 4HDSA 3OQOA 1NWHA 2GN9A 2O0KA 1PR2A 1ZH8A 4EW3A 4M60A 1U9IA 5IFLA 2YZ2A 2R8OA 5MGBA 3QKWA 5BW4A 2F43B 3WLKX 4DNRB 1XEAA 4RQAA 3IX7A 4K28A 4AUNA 4C7OB 2ISCA 4ZO8A 5EWJA 1JFTA 3TQHA 2NNLD 3GCXA 5TX7A 1GARA 4KAFA 4UAGA 1G3MA 4F4UA 1CSEE 2QD5A 2A14A 2PL9A 5LLSA 4DSNA 4FFDA 5I7HA 1NOIA 5C1OA 2B9VA 1G291 1YDFA 2WSMA 5GMOA 1VZ2A 1D0VA 1QANA 5AKEA 3E61A 4DQLA 2I6UA 2P0YA 2QP3A 1VKRA 3NBXX 4UOZA 5BWNA 4TYYA 1CFZA 4X93A 1PJTA 1QCDA 4A26A 1SCKA 5FPTA 1MG5A 1T34A 1RLMA 5CM8B 5ES4B 2ZYRA 5EQTA 2IWRA 2NU8B 2CNNA 1HQCA 3I5AA 2G0NA 1TZMA 3C8ZA 3ZWDA 3H2YA 2QN6A 3PNOA 5DNVA 3HJNA 1S7GA 2B6HA 2Q4RA 1CCWA 1GTVA 2FOIA 4GYYA 4OB8A 5IK2A 4RK5A 3VBEA 5KVVA 5B1HA 3X2EA 3D8TA 2JGLA 2N3ZA 3K09C 2CDCA 4U6SA 1T2AA 4O4LB 3V4SA 1FX0A 1JR4A 5GWXA 2HA7A 5KYWB 1DCKA 1B4DA 1SU7A 4QATA 4UUMA 3O73A 3EGDB 4RF4A 2XYHA 1ZVVA 2ESRA 2VYFA 3DGEC 2VF8A 2XMCA 5FNVB 1K9MD 4WXPA 3MWDB 2RI0A 1G9TA 3E7WA 5BT9A 3BS4A 4Q7EA 1Z7WA 5DO9A 2QBYB 1JIJA 1Q50A 4FLEA 1G4HA 2HGZA 1YR6A 2CXQA 3L8GA 3RVSA 1FSGA 5CCXA 1KO4A 3BG5A 1I5RA 1MR3F 4JLPA 1KEWA 3FYCA 1G16A 3TWOA 3I9MA 2J3EA 1DBWA 1XTSA 4UCWA 1CIVA 2FEMA 2DPGA 5TPZA 2X8JB 3I73A 4HNSA 4V0MA 1BHQ1 2I2BA 4H59A 4O08A 3OSUA 2OMKA 1H8HA 3CWCA 3LDAA 4IOMA 3WS7A 6ADHA 2F3QA 2YIMA 4LJ6A 3OF5A 3A2NA 3DOEA 3RYFB 2Q45A 4OYLA 3Q3IA 3B51X 1HDRA 1R0BA 2FQYA 1B0UA 1N2SA 2O1EA 1QAMA 4A23A 2ZI4A 1Z0IA 3HJUA 5EIWA 3M3DA 3C8DA 3NNNA 3C24A 4YJ3F 2H11A 2B1QA 1DKRA 4JASB 4FLMA 4ARCA 1JJBA 1KARA 4I4TF 4D9CA 5CUQA 1J9GA 5JZBA 3PU6A 5BSEA 3FY4A 4BN0A 3BY2A 2PSFA 1SR8A 4GMGA 4HXGA 9ABPA 1VFNA 4AKGA 3CPJB 4HCJA 1QOZA 3BA1A 3EMDA 4NAHA 3INTA 2WTBA 4R41A 3KT0A 2O8NA 4PC1A 4OXNA 5KYKA 4N5DA 3JQAA 2RGNA 3OCYA 2VJIA 5EJ7A 1NW9B 1BHJA 3SEJA 1RS0A 1XKQA 4TKLA 1UFOA 3K9QO 2FLVA 5IT9A 4UFPA 2VEOA 1KYZA 1CUSA 4S1OA 2ZRJA 1SKAA 5FWXB 1GGMA 1UDXA 4HNHA 1YR3A 3B6ZA 3OUTA 1K92A 5F51A 3QX3A 1P7ZA 2R6CA 2XBLA 3UAGA 2ZWOA 2AN3A 1ZM3A 4FCCA 2IPMA 4G0ZA 5JYDA 2IEIA 3V8MA 4X95A 2OENG 4PZ0A 3V32A 5ADHA 1PAUA 1UC9A 3RSHA 4BTLA 5LNK1 1FU7A 1YVEI 2IJGX 4L73A 1P7PA 3O4VA 4HI0E 4LG1A 3GPBA 1PSZA 3LW7A 1SUSA 3WJAA 1WABA 3DXXA 3ND7A 4FYHA 3RI3A 3RSFA 2QRKA 4KQXA 2OL4A 3KFXA 3BC9A 1J0DA 3V8PA 2GM9A 3PKIA 3C74A 3IBYA 2GZ1A 3RFVA 2O8DB 4QE3A 3ROXA 3THXB 2WIAA 1HEUA 4FIZA 3SQXA 3D7SA 5KC9A 1T3LA 1HXHA 1BDHA 4RVCA 3WP1B 5DXJA 5CFMA 3TIXB 1EBFA 1ZRSA 1CY4A 5AK0A 2JFWA 3B1KA 4H31A 3U81A 1VSVA 3HCRA 4NY1A 2C7OA 3H9QA 3BN3A 1H4VB 3HCEA 1VBFA 1CHDA 4X00A 4XOUA 1ULAA 4UQPA 5G0WA 1PCXA 4I66A 1CUWA 2P9BA 3ZCVA 1ESEA 3EBPA 1IATA 3GIWA 5L9AA 3SSNA 2QKYA 4JUIA 3G5AA 3Q39A 3LBAA 3RANA 4M9RA 4OX9B 4OXXA 1T8YA 4NQZA 3C98A 3HNRA 3NUGA 2FJUA 5JADA 4LJYA 1RQRA 1VG1A 3OESA 2FDCA 1G9SA 1HPLA 4IGEA 3WDMA 4C3UA 4OYRA 5T3YA 5L3SB 3AYXB 2ZUFA 3IR5A 3A4TA 1E2MA 1SNYA 2FTKE 3NRJA 4WADA 4X6UA 1YZQA 2PX5A 1RMQA 3TLZA 1N8TA 3K9FC 5LQDA 5M34A 2BKXA 4OLBA 3WNVA 5EJAA 1N25A 3JVUA 3HXTA 3I5XA 5L3ZA 3FHJA 3GP5A 4IUCS 2WUDA 1P39A 1SHTX 3AQ4A 4FE7A 4MKIA 4OHMA 4XR6A 2WM8A 4OK5A 4LPKA 1LSOA 3VNVA 2DG2A 1NSTA 2JHGA 3UT5B 3SIRA 1EFVA 3ISXA 1WBDA 5A88A 5B1SA 5B2FA 2C8KA 5G0SA 4BO7A 2P4QA 1RCFA 2MHCA 4KKVA 1EA7A 4XRGA 1YJ5A 1ODCA 1ZWLA 1W2HA 3LHDA 3HCOA 3PQFA 4V0NA 1HC7A 2J3MA 3AHJA 1MDBA 4B75A 1Z0JA 3AUAA 4C1BA 3WNCA 1W87A 2V7VA 5FPPA 3TL6A 3C3KA 3UENA 4II2A 1KZGB 1N5DA 3T5DA 2XQJA 3QKIA 1ORWA 1LKZA 2GCOA 5FOQA 3KT8A 4D3SA 1U04A 2WFLB 1DFGA 4DR2B 1XN4A 1FVXA 2EP7A 2GDJA 3OH8A 3T0GA 5KKCA 1NW7A 2FUCA 3RJ5A 3FX2A 4QUBA 1GGVA 3D2AA 3DE2X 1EQUA 2JJYA 2ZE8A 3WGZA 1WDWB 3E03A 3IOCA 4IYRA 4LDJA 5K9ZA 3U7FB 3I2IA 1XZAA 4Z4EA 2P6MA 2ZAGA 1P5JA 3ROKA 4PQRA 3NIWA 2JD0A 1YUBA 5KAPA 2QRMA 2DWPA 4KVGA 4HDNA 2R48A 3BEDA 4EJ0A 3GROA 4FSHA 4R3UC 2A5LA 4JSTA 5E4TA 5JI3E 2G9QA 3AERB 4CGYA 1H2ZA 4AKIA 3ZWBA 1MOQA 4WI1A 2ODPA 2M32A 3N2YA 4G67A 1SC1A 5E4FA 4DSOA 4O2RA 3L7MA 5HHTA 4BZPA 1J2EA 2HIMA 1XB2A 2WTUA 2AZDA 4JQYA 4J3NA 1T4DA 1EPUA 2C82A 2QT9A 4QBGB 3R9KA 3UAWA 4AD8A 1AVTA 3A37A 3NKFA 3URMA 3CLRD 1TFRA 1NXPA 3OZWA 1XDWA 1WCIA 4R6WA 2V4MA 4UNNA 5H16A 1ZWKA 1B0ZA 4HNAB 4UJ3A 1QO9A 2QVZX 4YJKA 3WWOA 1XALA 1E6UA 4P3KA 4I4TA 2VTBA 2F1KA 5FORA 5HZMA 2R0QC 4EUSA 1IWBB 1A88A 2EEPA 3TZLA 1RHJA 1GTL1 3VR6D 4BBZA 3IDSA 3QBTA 1G4AE 3ND6A 2BE9A 4F8EA 2WHEA 2IYZA 4GNKA 1IOZA 4IM7A 2WUFA 5AKLA 1QIGA 1Z5ZA 3I3OA 1RXEA 13PKA 2G83A 3HYCA 4W9NC 5BNWA 3D1LA 5J43A 3EH1A 1ETUA 1KSJA 2WC1A 1UT5A 2OGSA 1JFRA 2VWHA 2QPLA 1RYBA 1KYQA 2LKDA 2SHKA 2QLLA 3E3AA 4MUGA 1JBQA 1GL6A 4E2WA 1YSCA 3OOYA 3GLIE 3QELB 3OZBA 3KXIA 1T0HB 4FXPA 1Z6AA 3ZE8A 3FNIA 3QWBA 4JB0A 2E5LB 1AD2A 1R0LA 2CKMA 2RJ3A 4UHKA 4C4OA 4EFDA 1OU0A 1Y5RA 1KVSA 3UJAA 4CM1A 3WK8A 5M2QA 1OHHA 1LTHR 1K8ZB 1SCUB 4CV0A 4UOEA 9MHTA 1B3BA 1SG0A 5DX8A 4CXMA 1TZCA 1X77A 3E7XA 1E4VA 1Q0TA 1MAUA 2CUTA 2P3SA 1Q0LA 4KXXA 2QVGA 5JNLA 2WPDD 3HYLA 2XT9A 3WLEA 2VYCA 3AEQA 5AOVA 1M1YA 1ZD9A 4LX8A 3H94A 1H1TA 4B82A 4QT0A 2BEKA 5AJXA 4V0QA 1QAOA 1U0JA 3BIJA 4I8DA 3X1KA 4DBVO 4ER7A 1I7LA 1J8MF 2JCSA 2HW8A 1UBOS 2FI1A 2OP1A 2QOEA 2YBEA 1VPVA 3A9CA 4ZRDA 5AT1A 5BR4A 3QG5A 4X8HA 1P80A 1N2XA 5EGSA 3DO6A 2Q9AA 4JX8A 4P4SA 1A5SB 4QXRA 2ERYA 1JG1A 3H2BA 2VRWA 4I8XA 1E7SA 2FY8A 1R6BX 4QJBA 4TV8A 3IDQA 2ZT6A 3BWXA 3RUIA 4O4HF 3TVTA 1VB5A 4S04A 5EKTA 5JPDA 3PXUA 1CDOA 1JQDA 4OO3A 3DBVO 4MWOA 3HXOA 2M2IA 3AQIA 3S55A 1GTRA 1L4YA 2PRZA 3EXFB 4FCWA 4MLDA 4XQ0A 1G20E 1JG4A 1EM6A 4CEHB 4F85A 4GC9A 1VRVA 1QG2A 2ZSFA 3HZOA 4MINA 5FBQB 2EZ8A 5M29A 5A4JA 2FN9A 2P6OA 2VHUA 4ZI7F 3D8BA 3VHXA 3N2IA 1LBQA 2Z2KA 5E3JA 1Z4LA 3LVBA 2N75A 1WSVA 3R5FA 1L6RA 4G4GA 3DC7A 1VRCA 2D3TA 4R1QA 4KUGA 2GO7A 5J4VA 1FRQA 3JPWA 1T1IA 4X8IA 3HI6A 4G65A 4V0SA 5SYMA 1IVSA 2DHDA 4RFVA 3X0DA 4FR0A 3W2IA 2WZNA 4C30A 1FMFA 1DIRA 1Q1EA 3OW7A 3R24A 4PSVA 4PR0A 5KUTA 5KTSA 6NULA 1ECCA 5KOJA 1AC5A 1T3TA 2RHLA 3JASA 5E7IA 2OYRA 1ZH2A 1XZGA 3F3KA 1K4MA 3GAMA 3D8RA 3NOOA 5GJCA 1HOTA 1VA4A 4A0HA 4AN0A 1G6OA 2QLJA 2RHRA 4QOHA 2OVBA 1CRPA 4JX9A 1Y8RB 3BILA 3GFRA 2Q3HA 4HPJB 1UEXC 2C2WA 2XHZA 3B7WA 2J3KA 3EPHA 2OY0A 1H42A 1QHNA 3HM2A 4MUMA 2ZUTA 3SHWA 1E2UA 4PPFA 3HZRA 1JQKA 1LXCA 3OQIB 5AKHA 5GAJA 1H2AS 1JMKC 1AF4A 1EP2B 4YFVA 4FGKA 1KGDA 4FHFA 3RASA 3OKFA 2NU9A 3C6KA 4UM8B 4BVBA 1KIAA 4BPBA 2C2MA 2R4TA 1CY8A 1DWUA 2H0AA 1F06A 2OBMA 3HUFA 4NULA 3EGEA 5HKAA 1GQRA 3IDFA 5EHZA 4BGDA 1P3JA 5KX5B 3Q7EA 3JQ8B 2P68A 4U8HA 1E6KA 2WMYA 1SXJA 4HGZA 2IEAA 4JJKA 5TQ0A 4D81A 2GEJA 2RGGA 2V1XA 2HUPA 3ICPA 4V03A 4ZQFA 4EOGA 4ENRA 1LCIA 2EZUA 1GP2A 2I33A 3GI1A 4OMDA 2Y6UA 2F2TA 3ULKA 1WCYA 1CQZA 1C41A 4DZTA 5IC5A 4R2XA 5BSWA 2CNWA 2H5JA 1QG0A 3P71T 1ABFA 4IUDS 2X2OA 3DLTA 3EGIA 1MT3A 3HCWA 2GXUA 3NASA 1IJBA 1MIOA 3RUDA 4A8JA 4YRQA 1S6YA 2H3HA 1VLHA 4JYPA 2C2GA 4PFSA 3DCYA 5CBPA 3FROA 1VKOA 4P3IA 1X3LA 3FGNA 1T2UA 3DFFA 3FGOA 4L28A 2WVGA 4RZQA 2B3DA 2QM0A 3PS9A 3W8EA 5IN4A 2A58A 1XJQA 2C83A 4EBBA 3HJHA 5A9SB 1PQUA 1FZTA 3BHIA 4UHJA 1RLUA 7AT1A 3JTMA 3M4ZA 4TYPA 1SVMA 3D4IA 1P0CA 4YRMA 4K6HA 4AXXA 3W2FA 1OLUB 2QY6A 4TTTS 5I48A 5KJ1A 3MAJA 1TA0A 2A9PA 2WIBA 4OQFA 3GVPA 1O9HA 3DW1X 3PPWA 4M3NA 3LVQE 5EJ2A 2XF2A 1DC7A 3LHFA 1V3UA 5H70A 2V4DA 4JFAA 4QQKA 3WIDA 5JDCC 5EKDA 4XH9B 3QG1A 1QHEA 1QR2A 3KOOA 2I2CA 1Z25A 4GPTA 2VP2A 1C7EA 3OETA 4EYGA 5HSGA 3DVAA 3PIDA 4WDRA 1D2EA 1T9KA 3GG9A 4EG3A 1AQUA 3BWDD 4MRRA 3WB2A 4OEHA 4MI6A 2BHTA 2JI6A 1W6UA 3V4PB 3USZA 3SF8B 5EFZA 2V9PA 4KFUA 4TWIA 1R4MA 3T1VA 2H9IA 4OLFA 2MSEB 1J21A 2CGEA 2MWMA 3V1LA 4GM4A 4WERA 2XYVA 1CRWG 2FSFA 2RGYA 1W30A 3NDIA 3CUTA 3NUZA 4M1QA 2QTWB 3RS8A 3RUAA 4XEHA 2X23A 5EHQA 1L5MA 2XBUA 1M2KA 3TZCA 2FEAA 4L8JA 3VVMA 2J9XB 4QM7A 4RHFA 4EGQA 3VNBA 3C6ZA 1AGRA 2O1WA 4RTPA 2A3RA 2NSDA 3ZTYA 5C81A 2HXSA 3SYNA 4EGJA 2EG5A 5DHUA 2PGXA 2PCLA 1NMQA 2BP7A 4D7AA 1ZOPA 4J1TA 4G1EB 2J30A 5F5XA 3VKUA 1FDVA 4H7DA 2Q3CA 3WYDA 1NZJA 2H57A 4JJIA 5T4EA 3DE7X 1TCBA 4B71A 5GZ1A 4WCFA 2D06A 3A1VA 1U02A 3HUTA 4IWYA 3TSAA 3EH2A 1U9IC 2X4DA 1K88A 1T6YA 2N47A 1LD3A 1PL6A 5KTPA 1Z7EA 4R2WA 2ZUVA 3B1YA 4O4HA 2O3QA 1VE9A 5T4HA 3WK7A 3IP9A 1HDYA 5T6MA 1D0IA 3JQGA 1IZZA 4D0SA 3CNHA 3H05A 1NLMA 2E4VA 2VDPB 3VO8A 4QDZA 4AURA 2WF8A 1JNXX 4E2ZA 2FSUA 1R37A 1J2TA 3ITEA 4FFMA 1W5EA 3O8DA 4WA8A 1N2BA 4OY3A 1RWNA 2EJTA 3TLXA 4ZI7A 1MQ8B 5IUNC 4ND2A 3AC0A 3OHSX 1TUGA 4TTPA 3VVCA 3ZWVA 2IU3A 1W93A 2A78A 5IS2A 1JQ5A 2Y4NA 4PQYA 5ALLA 3R5JA 2VSXA 4QHSA 4S1NA 4X0CA 1DAMA 3D0KA 2NO0A 5JSYA 4NMWA 4IIJF 3TGPA 2XMDA 2YW9A 4ML3A 4GNRA 5CVDA 5HF5A 2ZS8A 3ZPXA 1L5ZA 3E1YE 1A5AB 1N1DA 1V6CA 2O2SA 4EPYA 4LWQA 3OMWA 2ODAA 3ANYB 1IN6A 3HL4A 4LJ7A 1I4EB 4CL0A 4IZ6A 1XCGB 2GVDC 5E0OA 2X0NA 2H9YA 3DR3A 3HEAA 3TNYA 2WZBA 1I3MA 1RCUA 4C4XA 5JXJA 4QUJA 3RNOA 1UBTS 3I6YA 2IP1A 1S3GA 5HJ7A 1DJQA 2IY8A 3F9IA 4QNNA 5I9LA 4A15A 5J2TB 1GZVA 1O97D 3PXBA 4LCJA 4BNZA 1ZN9A 2N1MA 2XI4A 2XRFA 2FK8A 5DV9A 2Q62A 4S35A 2KJQA 6YASA 3ZW8A 3FDIA 4LRUA 3KQUA 5DM60 1JWLA 3MMPA 2DJIA 4MGIR 1WB9A 1OB5A 2HB6A 3OMXA 3GR6A 3I72A 3EVCA 1BJTA 3REFA 4BQIA 4X71A 2QDKA 1W581 2I8CA 4QU9A 1U3DA 4RY0A 5JS7A 2O8EB 2REQA 1D8TA 1LC0A 4LQDA 3N1UA 2NT4A 1ATIA 4WE3A 1ONNA 2BMDA 3PYMA 3OCCA 5CNKA 3OQ6A 5E6UB 2QRHA 5SYAA 3PXDA 1KTVA 2V0GA 4DPMA 3TUIC 4BCCA 4LF5B 1WUTA 1Q2XA 1QH1B 1RRVA 4BQFA 3T99A 2H1VA 2WE8A 2FMHA 1YQGA 4FHCA 1RVV1 4FC6A 4J7AA 4FC7A 3T53B 5ALKA 2A9RA 1F8FA 4JLKA 4NZ9A 1ONPA 3TYXA 1LPAB 4DIMA 3KL9A 2EGGA 3R3ZA 1E2KA 2O07A 4JJFA 4ZQBA 4AMVA 3M82A 2LP4Y 5DBHX 4LOHA 3HFSA 5H4HA 2GK3A 3ORFA 5B6PA 3ZLVA 4KQWA 1NBEA 1PLLA 1BZYA 1U4NA 3I04M 3EVGA 4CLOA 3JD2A 1E7RA 3PNMA 1JEYB 2N0SA 2Q0SA 4YP5A 4UVEA 2W2MA 4RPHA 2SICE 3L7KA 4DM3A 2QT1A 1IXRC 2R60A 3ZBTA 1DLIA 1WVGA 3FCCA 3UH1A 4DZRA 4JLUA 5CFNA 2Q2QA 1LU9A 1ULHA 4QM6A 1Y5LA 5C37A 1S3FA 2ZKIA 3P20A 2RGNC 3OZEA 3BDAA 1E1RD 1Z8FA 4QYXA 5AW0A 2ZL7A 1BWQA 3K9BA 4EKIA 4F4HA 2YX1A 3BIFA 3COVA 5HX7A 3Q85A 4KIGA 3AYZB 4JU9A 4OJNA 1ISIA 1CDDA 1YAHA 3DZJA 2GYYA 2WRZA 3BRWD 4O4JB 4DLTA 1GXSB 4DLAA 3IQZA 5CVVA 1YIDA 2PQ0A 3UT0A 4XNFA 5FT9A 4OX9Y 5TT1A 2YMMA 1IEQA 4CCWA 2J33A 3P9ZA 4PHGA 3D4BA 2QRLA 3BAFA 4L3WA 4Z8XA 4D3DA 1SBNE 4E46A 1MQSA 2B7CA 1A50B 1M7GA 3AUSA 3K1AB 2NU7A 4BFUA 2H6EA 4F11A 1XU7A 5JRDS 1EE2A 1P0MA 3KPYA 4AJ1A 1XNJA 1TRHA 4GVPA 1O08A 1SPBS 1ZNZA 3GCGA 3B9QA 3QPUA 5MGNA 2WHYA 3BTOA 4RJLA 5KJ6A 2OK8A 2OM6A 3HA7A 4FM9A 1JZTA 5KSOA 3D6AA 3NFYA 4IWNA 3G5MA 2Z8XA 3PPVA 2WY2D 4URZR 1XZHA 2Q29A 3KNZA 1AKQA 2J85A 3V2HA 4DJDC 5KWJA 1TCVA 3OQBA 2W2TA 4E13A 1N77A 3SS9X 1X14A 1L7QA 2F8LA 2RBEA 3OM1A 1SQ0A 1XTRA 2H52A 4RE5A 2VZ9A 3HKDA 1D1PA 1VKNA 1W2GA 2WHQA 4N9QA 3RRFA 1UQTA 3HFRA 1TU0A 3G79A 3M4JA 4CU2A 4A2PA 1NI4A 2D4HA 1OLSA 1PFQA 3FUXA 4FSXA 3GRPA 1BVRA 2CYBA 3IRUA 4NLLA 1YRAA 2HDWA 2R1TA 3A9UA 3NDJA 3P2YA 3D3EA 2AQKA 2BWJA 5EVJA 3TTTA 3EFOA 1E6EA 4OJTA 4M8KA 1FB5A 2O2XA 4MQMA 4CF5A 2VRCA 5K45A 1H93A 5KSWB 1PKXA 3KR9A 4M9QA 4PIPA 4R68A 1BXKA 3HBJA 2KVOA 2DH5A 2Z3WA 3G5LA 2DFNA 4UM5A 3QA9A 2BGTA 5FWYB 3GRYA 4L8VA 3H18A 3A1FA 4XN0A 2ZVDA 1KBZA 4QTXA 4R8RA 3TX6A 3BE5A 3U49A 5C8YF 3ONFA 7ABPA 4QQFA 5B6JA 5DK6A 3K0CA 3P9NA 2KWIA 2QD1A 3M34A 4EX6A 4DL9A 3OCXA 4I7EA 1XCPA 1AUPA 1UXOA 2FPRA 2OHHA 2QSUA 1NAIA 3EHDA 3FCUB 3L79A 3MK31 4OQMA 3CKYA 3G6EB 1HYGA 4UBJA 1CX9B 3DZBA 4YT2A 1YDWA 1YQDA 3O3CA 3GZNB 3SKYA 1NJGA 2FU5C 2XD4A 2M6LA 4BO2A 4EHFA 3TE6A 3G4SB 4LOLA 5A7FA 3V4LA 4NPHA 4TOIA 5FWNA 2F1JA 2XYGA 3BQMB 1TLTA 3O3NB 5IT5A 2JA2A 3ECSA 1JA0A 2D8AA 3GGOA 3NTOA 1V39A 4JS0A 1ECGA 3N5KA 5K8UA 4UXHA 2ZRFA 1M2VB 3AB7A 5AUNB 1G2QA 4ZWNA 4Z7QB 1RXVA 3K31A 4KTTE 3C5HA 5EIAA 2DBYA 5EMLA 1O4WA 2UYYA 6PFKA 2XZLA 4BO1A 2H51A 2W6JD 1EFPB 1FF9A 3BMNA 4NK4A 4REQA 4C4SA 3A9WA 3A1EA 4AG5A 3WFJA 3QEJA 3AM3A 2DQSA 4PTZA 3SIPA 4WBXC 1I1NA 4AJJA 4MHTA 1E2IA 4WCDA 3P5BA 3T1QA 1BC5A 3UJDA 3JVIA 4P38A 1N75A 4EWLA 3AI7A 1DL5A 1R9MA 5JCJD 1J9EA 1SWVA 3GEBA 1UPAA 2OB2A 5BUZA 4ZAVA 8GPBA 2E6UX 4JBNA 1AT1A 1V8ZA 3KOUA 5DTMA 1GM5A 4YIKA 3CIOA 2H1SA 5JY1A 4UASA 4D0LB 1MPTA 4EF4A 2P35A 2VHJA 3NAGA 3T3NA 1JKIA 4QXQA 1C3OA 3GLRA 3BAZA 4R8LA 4WUVA 5SZIA 1QRAA 1E9RA 2J0EA 3W9BA 2VCYA 3LCMA 1G1AA 2WUEA 3ZCUA 4CM3A 3L4EA 1ZUNB 2XZOA 2BHSA 2WJ6A 2Y27A 3BRSA 3GBSA 3WGIA 1GKIA 3UV3A 4MULA 2VF5X 2C4VA 4BP8A 5K6RA 3LQ4A 3RUFA 2FA9A 1MVLA 5IKEA 2PL3A 1HWYA 1BIFA 2X41A 2WKWA 4GZ5A 4RPGA 4QWMA 4D82A 4F3YA 4U3JB 5HMMA 2VRNA 4RS3A 3M9WA 3FVVA 3SQOA 2QEXB 4TRRA 1GNLA 3IKMB 1L5GB 1U7WA 1YRBA 2JAPA 5EZQA 3JZIA 4XGKA