4QHYA

The structure of aif2gamma subunit h20f/d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDFGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
molecule tags Translation
source organism Sulfolobus solfataricus
publication title Binding mRNA on the archaeal translation initiation factor 2 gamma-subunit
rcsb
total genus 97
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qhyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qhyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qhyA01
1X8JA 1ZIOA 2HF9A 2IUSA 4QGFA 1JR3E 4LJAA 3KJGA 4U5XA 1E1RD 2JLUA 3P20A 1ODFA 2HCBA 2ZSAA 1AGPA 3GLFE 1IY2A 1MABA 1F2UB 1UBGA 2IS6A 4Y9UA 2JATA 1N6KA 3GLIA 1IY0A 1KK1A 3C14C 1D9ZA 5JCZA 3ICEA 1ESMA 1NG1A 2REXB 2QG6A 4I4LA 4MGYR 1DAEA 1Z29A 3PJRA 2YYZA 2GJSA 3K70B 2YJTD 4GZMA 3W90A 2NZJA 3RAPR 3NDPA 1K5GA 2GHIA 1NLYA 3CZPA 5JWOA 2P6UA 3LDAA 1E2QA 2J0VA 4Q21A 4QBIA 2FU5C 4P4UA 4QM7A 2PEYA 3FOZA 1HQCA 4TZ0A 1N5JA 1GNRA 1W0KD 4F7WA 2QM7A 3GD7A 3GLIB 5D3MB 1OV4A 1XCGB 1WBBA 3RS3A 2OLKA 5J4HA 3ND8A 1NJFA 4ZI2A 1JR3D 1XD8A 4IDHA 1XJ0A 3A4NA 4FMDB 4PHTA 2OFWA 3EZFA 5KSOA 1WBDA 3CX8A 1IB0A 2QAGA 3DHWC 4P3YA 1E63A 1E62A 3EWAA 2BGIA 2A78A 1HT2E 1EP3B 1KTVA 3LO8A 2BC9A 4G0NA 4EAQA 3K0FA 2H8KA 1YIJB 5GV7A 1E2EA 2XOKD 3B1YA 2ZE6A 4KYIB 4FMCF 3OJWA 2FOLA 2WJYA 4TSFD 2OCBA 5GJWC 1W36D 1IXSB 2BJWA 1TQDA 2ZJAA 2XSZA 3QEJA 1IBRA 2OZEA 1XEXA 4JLJA 1PLLA 4A2QA 3R9WA 1VTKA 4K81B 2RH5A 5ELXA 4M9ZA 1DOAA 1XRJA 2GPJA 1NN1A 2IXEA 4H1VA 2CEAA 1U8ZA 4P31A 3VMFA 1GIAA 2AL7A 1K8AD 2KBEA 3X1YA 1NP6A 2BDTA 2VP6A 3Q7PA 4Q4JB 4TYYA 2GWHA 4P0TA 3J81k 1KO1A 2IYRA 3SJCA 3UK6A 1QFJA 2H18A 3CRZA 1KK2A 1MV5A 4HZUA 1MO6A 4EPTA 3AGPA 1DO2A 3HDTA 4PZYA 4IW3B 1GNPA 3QG1A 3CNNA 4A6PA 5JRZA 3D31A 2V7QD 3BC1A 1G8HA 1CR4A 3I3SR 4C2TA 4K8OA 1JXOA 2CK3A 3CB4A 3C16C 4DWJA 1QVRA 4BLSA 1OHHA 3SI7A 1M7HA 1XPOA 2VF7A 1G16A 2QP3A 1BOFA 3O47A 4ITRC 4NKRA 1QGYA 3ZVMA 1PVOA 2WM9B 3AP1A 2OFOA 3CH4B 5DSZA 1XTRA 3WXMA 1KI1A 1YE8A 1Z83A 5JSZB 2FH5B 2B7BA 1QHIA 3KFVA 5CIWA 2IWRA 1OFHA 3T12A 5B64A 4XVRA 1Z6TA 3SR0A 3UATA 3ADCA 121PA 5EQTA 1DAGA 5JHHB 2WHXA 3WMEA 2IYZA 2AD1A 5C4MA 1JPJA 1XTQA 5J40A 1TLLA 4BECA 1GKUB 4Z8YA 1OXUA 2A3RA 4MDEA 4QGGA 5JWHA 3SQXA 2CL0X 3NXSA 1M34E 1NVWQ 1QG4A 5DNYB 3D8BA 4LJ9A 4ZV4A 3FTQA 4LYHA 5B2ZA 1SKYB 4Q1BA 4PPFA 3B1XA 2DWQA 4II7A 3NWJA 2D62A 3OEED 2GCOB 1CRQA 2XB4A 4PTLA 5JS8A 2FJUA 1VCNA 2WPDD 2ZTSA 4KAXA 1E0JA 1E2IA 3K9GA 1A1VA 2OK7A 1X86B 4M1YA 4UXHA 4HLUC 4JLPA 2DWPA 1W35A 1U0HC 1XFAA 4M9SA 3G5UA 3AF4A 4DEYA 4RY2A 4LPKA 4TMTA 1US8B 3PITA 4Q00A 1P9RA 3PUVA 3KJEA 4B3XA 2C78A 4AKHA 1KK3A 4OL0A 1GFIA 1X8LA 1F60A 2J46A 5IK2A 1B23P 2PX3A 3LBNA 1G20E 1PV4A 4EH1A 2VQSA 2FEMA 2QPAA 3ZC3A 1QF9A 3B1ZA 2WMNB 5J4KA 2NIPA 3U7HB 3GLGB 5H1YA 1ELOA 3BAFA 2F3TA 2WJHA 5DYIA 2C8VA 5LBIA 2FA9A 4PC2A 4TT3A 1S72B 1XX6A 3IBYA 4TLCA 3TSWA 2A5DA 3ZYCA 3Q3JB 3K0EA 4PC6A 4A8JC 2BBSA 3RS0A 1H85A 2ZRDA 3PR1A 5E7MA 4HEJA 3X1XA 1VIAA 2QAJA 3VKGA 1O87A 4LJ7A 5FPKA 5L3RA 1ZNWA 4ACAA 4PO8A 5FBWB 4TN1A 1T91A 2ZAMA 2YVUA 1LNZA 2CE2X 2OT3B 1IN6A 4ESVA 2FFQA 1NN0A 2I3BA 1HQYE 1KDRA 1NIJA 2W00A 2ZQ5A 4XVQA 5LB4A 4YC7A 4AF6A 4WXRA 1DDGA 3MG9A 4EQ6A 1E2LA 4YMTA 4PPGA 1GL7A 3VR5A 3NBYC 4A1FA 4Z51A 2C2HA 1DAKA 5JHGB 2NPIA 2RGNC 4F4JA 4N0EA 4ZIRB 3QF4B 3A8TA 3CCSB 4JKIA 1ZU4A 1WF3A 3U60B 4HE5A 1T5LA 2JGNA 1BO6A 1G3UA 5TDHA 1OH7A 2N46A 1DBSA 3CC2B 5IDVA 4WBSA 4YXWA 2IYYA 2GA8A 2G0TA 4BFXA 3DDCA 1ZCBA 3H86A 4QBFA 3A37A 1YI2B 4UNQA 1I4LD 4GMDA 1G41A 1JPNA 3IPYA 4FMCB 4L9WA 1E4VA 1YU9A 2ZJBA 2REOA 1S3GA 1DDIA 1GRNA 4XTCS 1NG9A 1SVOA 4KXFB 1I4DD 1GAWA 1FL9A 1Q1QA 4RFSB 1E9BA 2KJQA 3GEHA 4V0KA 1Q20A 3M0EA 3DPUA 4A9AA 1OB2A 2JJ8A 1UM8A 3T06B 1BYIA 4H9GA 2GAOA 1YITB 2X19A 2WKRA 5KSZA 1YR6A 1QHNA 4ZCMA 3G6EB 4UNRA 3T15A 3B9QA 1WXQA 3TE6A 1CNFA 1UJ2A 3CNLA 1OYWA 1SVIA 3OAAA 4AF7A 3MWYW 1U81A 1W0KA 4MRNA 2HMAA 3OIUA 4XOIA 4O25A 1XD2B 3DM5A 3IEUA 4TMKA 3T61A 1NL3A 5KUTA 4BEJA 1M7BA 2PLRA 4BE7B 2ZJ5A 3RANA 2BKEA 1ZUIA 5UKDA 1AQYA 4LRWA 1F20A 2GXQA 4F93B 1KO5A 4EJSA 5AN9A 3VNUA 1J7KA 3U3RA 2YC2C 3DEFA 5G41A 5BN5A 1KY2A 4ZCIA 1NKSA 2JLYA 1XWIA 4Q7KA 3R9XA 2ZSDA 3D3QA 1BYUA 3W3ZB 2E87A 1TEXA 1R5OA 3EASA 3I4LA 1V43A 1AZTA 2I4IA 4B75A 3IQWA 3LY5A 4C30A 221PA 3CONA 2FSGA 4TYNA 1TF5A 2FPMA 1ZYUA 1GJRA 3QSYA 4B3BA 2GXAA 2ZU0C 3EWSA 2QSYA 2ZRBA 3GLIE 3TAHA 2QBYA 4M1TA 1WQ1R 1Q1BA 1MABB 4S2EA 4XWKA 4KVGA 3DOFA 1FFHA 3B9PA 1TX4B 2JLRA 3IQXA 2GCPA 3FMOB 1NMYA 2NZ8A 1G6HA 3W2IA 2GXUA 1U0JA 2HJGA 4RD1A 2V1UA 3NTUA 2XGJA 5SZIA 3EC2A 1N8RD 4JL6A 4LGMA 4B48A 4ILEA 3W5VA 2IS4A 1XCPA 2GAAA 3NG1A 2A5FA 4ZDKA 3EC1A 4AC9A 1NY6A 3UG7A 1JBKA 1MKYA 3UWKA 4EFLA 1NMZA 1JA1A 2MMCA 2VNKA 1TVCA 1VCMA 3IO5A 4Q66C 3CMAB 5LD2C 4FCWA 5KNCA 1DE0A 1UBCA 2Q3HA 1XMJA 1FNDA 3LVQE 4YONB 3TH5A 4GOKA 2WSMA 3V9PA 4MYHA 2RGDA 3AVYA 4V02A 1K5DA 4V0ME 5LPNA 3W5HA 4V0OA 2C5LA 5FPSA 3ADDA 2X3UA 2RC5A 4OI2A 4OQLA 2F43A 3LW8A 1CEEA 4B3DA 3REFA 4DLXA 2OCAA 3AKCA 1HUQA 3HU1A 1QGAA 3CH5A 4U00A 2RGBA 3TK1A 4OQMA 2QPTA 5AUOB 3NBZC 4FCVA 5DI3B 4LJ4A 2QU8A 4OKSA 3LH5A 2QRNA 3R7WA 4OJQA 2QORA 4D0GA 1F5NA 3CR7A 5FOSA 1JXMA 2QN6A 4NMMA 5TMPA 2WVJA 4HDQB 1E4YA 4URWR 2BHRA 3ICQB 1EESA 3KB2A 2FPLA 4YXWD 1U99A 2IYSA 1Q7YD 1R8SA 2VP0A 2F43B 1EGAA 3EZ7A 3KXLA 4EUNA 3BERA 4OQNA 4AG5A 1VQOB 4WXPA 4JL8A 3LQRA 2GXSA 3K8YA 5FFMA 1NRJB 3HYTA 1YZGA 3DO6A 1YZNA 3EIEA 1F2TA 4NZYA 3FWYA 2GK6A 1A4RA 3I92A 2H17A 3O8CA 2QT1A 4IXMA 1FX0B 1XEFA 4W5HA 2H16A 3UWOA 3CXCB 3HPQA 1Z0AA 2JLWA 1KSFX 1R0YA 2QGNA 1N6PA 4AWXA 2QM8A 2Z5FA 3GEIA 1L8QA 2DCUA 2C95A 2IF2A 1R5NA 4ZGNB 5DE3A 3WYGA 3AB3A 4KITB 1NBMD 1XTJA 3C4JA 2AK2A 3EZ2A 4RKFA 1UKVY 3ZDQA 4KVAA 1OIVA 3QVUA 1P72A 5FBRB 3VU9B 2HV8A 4FW9A 4PSVA 1SKYE 4U9UA 1R5BA 4CEHB 5CK5A 3UMFA 3K70D 3MUFA 4HAWA 4M22A 1KMHB 2G6BA 1E9CA 2Z4RA 2ZRPA 3HJNA 3TMKA 1P2VA 1G8FA 4RCZA 3CC7B 1S96A 2V3CC 1NVVQ 3K0FB 3AVOA 4GP7A 5TR9A 3SFVA 2ECKA 4BLTA 2QPOA 1QFYA 1CBUA 2EYQA 4FWTA 4M1WA 4U02A 1YZUA 5DO9A 4AKGA 4RKEA 3WNBA 3EAQA 2BBTA 2QENA 4B2PA 2PZFA 1EX6A 2OLJA 3R8CA 2EVWX 5EMNA 3BB3A 4GSYA 3P4XA 2XNCA 1GAJA 1Q81D 4Q9KA 3I5XA 2C03A 2EW1A 5AJWA 2OTJB 1GO2A 4RCYA 3GFOA 3EPJA 3EPLA 3CRVA 3CPJB 1ZM9A 1Z22A 3N5CA 2X8AA 1UAAA 1GP2A 3HWSA 3QKUA 3CCMB 2GJ8A 3G82C 1COWA 4KSCA 2EWWA 2QY9A 2QAGB 1Z6XA 1W36B 5BN4A 3SNHA 3SOPA 2F1RA 3PIRA 4EKDA 1NVUQ 3KKNA 3FMIA 4DDUA 1L4UA 5EE5B 2ZR0A 2GILA 4Q9HA 1R0WA 5H59A 2DHRA 1W0JA 3VKWA 4O2RA 2ZSBA 3KUCA 2F1HA 1XDBA 1Z0JA 3KFXA 2C77A 2PZGA 3CZQA 4V0NA 1G21E 4F4CA 3ZS8A 2F55A 1KRHA 2GETA 2ANBA 3BRWD 2JCSA 4DDTA 1E98A 1IN8A 4G5SA 5JMTA 2MSDB 3TVTA 1IN4A 5CDFE 2WAXA 1E1RA 2QMOA 2BM0A 3K0CA 4CT5A 5HE8A 4B71A 5F3WB 3PFIA 3QJYA 4WIAA 3TJZA 2IA5A 3FVQA 3BK7A 1MOZA 3PXGA 1U90A 3O8DA 1KDOA 1RRPA 5JSZA 3TNFA 4ZI3A 3GJ6A 3IIMA 1Q1ZA 3U3OA 4LYAA 2NTYC 5HKKD 2FV8A 4C4PA 2I1QA 3AUXA 4W9MC 4YDSA 4CT4B 4D80A 2XNJA 4PO1A 5FOXA 4XWOA 1N6RA 2RHMA 2WMOB 2DFTA 3EARA 2HXYA 3PVSA 1U98A 2O8DA 1G3QA 4DRZA 1R0XA 1UBEA 4DCUA 2PLFA 2OTLB 2ZE5A 1JAHA 2FSIA 1S1CA 1BKDR 4Z1MD 4CEHA 1E0SA 1II9A 4MYCA 1A5TA 4XTRA 1KDPA 4JLDA 4ASUA 1X8KA 3RS5A 4GDFA 5JJKA 4YAFA 1Z63A 3UANA 4D0NA 3K0AA 4FINA 2QDXA 4C2UA 3TUZC 3THWA 4KODA 3K0SA 3F0TA 4UJ3A 4Y9RA 2XJ4A 1CP2A 2PJZA 4NYMQ 1GRRA 3WP1B 3EIQA 4D26A 1WCV1 3ASZA 4RD2A 1ZD9A 1LW7A 3B1WA 4OK5A 4DEXA 1NSFA 1VYVA 3WNCA 2JLVA 2OV2A 3WY9A 1HA3A 2VEDA 2WKPA 2AHOA 4Q5IA 4DDWA 5KPJA 1KSJA 5CJPA 3KL4A 5EXTA 621PA 3OF5A 1OIWA 4ESHA 3OE7A 3AP2A 4BLPA 1AKEA 1T5IA 2ASEA 2ZS9A 1VHTA 5K8LA 4QJ3A 1DTSA 1T4GA 5K8IA 5FTMA 4B44A 3GLGA 4MUBA 4ZO4A 1QVAA 2EQBA 3MWLA 4I1SA 5ANRB 3BGWA 2ORIA 1IHUA 3A1UA 4BZXA 1DG1G 4MRPA 2J1LA 2QEQA 4HB3A 1V5WA 1H8HD 1E96A 1G3RA 1I7PA 1P75A 2J9RA 2QTHA 3A1TA 1ZINA 5FR1A 4TMWA 2ONJA 1DEKA 1Z0DA 2AWOA 1IJFA 4RD4A 1NN5A 1LS6A 3ZZTA 3F3YA 1FDRA 4JYCA 4EJSC 1RC8A 2C9CA 1H42A 4JVMA 4NHOA 2VNHA 2MMGA 4H1UA 2QTZA 1N6HA 2VHJA 4AK9A 2QE7D 4DIDA 2OAQ1 2ZI5A 5F9FA 2OK8A 4RZ3A 1SKQA 1QGZA 3MWJA 4IEIA 5JJIA 1M8PA 1FZQA 4X8HA 2ZJ2A 5D3MA 2A7QA 1VG8A 5BQ5A 1CJKC 4CEIA 3LX8A 3L0IB 4RFVA 4JLKA 1NBMA 3W9YA 3AUYA 1G18A 3THYA 1J9ZA 3CD6B 1JEDA 1R8QA 4FMBB 1CS4C 3FKQA 1BS1A 1VYTA 1YJ5A 4GP6A 4LHWA 3CO5A 4EFNA 3BBPA 1KO4A 4DLVA 5KSYA 2VH5R 4A0RA 1CF4A 3TGPA 2G3YA 3AF1A 2J45A 3M6AA 1G8YA 3ECCA 4P6VF 3QG5A 1XMIA 2FNAA 5H68A 2X1VA 5G3ZA 4OHWA 2EU8A 4MKHA 4ARZA 3EPKA 1ZD1A 2VBCA 3U3KA 5KO2A 2V9PA 2QQ0A 4NH0A 1LB1B 721PA 3ES9A 3OJXA 1LF0A 3RC3A 3IHLA 4JVNA 2IWHA 1OW3B 4OHXA 2J41A 1KAGA 3GJ4A 4Q4HA 1GKYA 2RHDA 2ZI7A 4BLQA 1XEWX 5FPHA 1JALA 3MJHA 1DARA 3P27A 2YOHA 4QKQA 1ZM3A 4HLCA 3X1WA 3IPXA 1VHLA 3L82B 3TR5A 1DAMA 1YJ9B 4GOXA 1ZCAA 3KQHA 1CXZA 3WRXC 4EQ6B 1D2EA 1SGWA 4JVLA 2XEXA 1SVWA 2UKDA 5CB6A 4X8LA 1G1MA 3GPLA 1E1QA 2GTPA 1JB9A 1RRFA 3REGA 1GAQA 4Q03A 5IHPA 2WWFA 3B82A 4A0GA 1F2TB 5HXBA 1XEXB 5L3SB 1FMLA 3PCRB 5G53C 4D4KA 2ZS8A 1E9SA 2WIBA 5BW8A 3VKHA 1T3HA 2RGEA 3H1TA 1P73A 3WYAA 2JAQA 4OHYA 1T0HB 2ZSFA 4C0QC 1OT3A 2OBLA 2CLSA 2IXFA 3AVQA 4HAXA 2Q9CA 2JDIA 4C43A 2HT6A 2F3RA 5CK4A 2OEPA 2ZI3A 3LQQA 2LWIA 5EP4A 3WHLA 4YMUA 1QUEA 3IBGA 4ZKEA 2DEUA 2TMKA 4PAOA 4A8JB 2R65A 4DCSA 5KSWB 4LUCA 2BVNA 2BEJA 2FFBA 2FX3A 4PZLA 5AUQA 5B30A 2IYWA 4ZGQB 2PCLA 1JQJC 6Q21A 4UKDA 3B60A 4WA7A 2OSBA 2CDNA 1NVVR 4V03A 4HAVA 2J7KA 4NL4H 3LLMA 1S2MA 2GESA 1JA0A 4DQLA 5IF9A 2BMEA 2HYIC 1RRGA 4BQSA 1E9EA 1Z8FA 4IOJA 2GVZC 3L0SA 4DSOA 1LVGA 1E9DA 1XXHA 2VYFA 1AK2A 4TQ9A 1FNMA 2DERA 1SQ5A 3SJBA 4EPRA 3EIHA 4PHFA 3I56B 3MAAC 1W1WA 2D74A 4M9XA 2E1RA 1KHTA 1RRCA 1VYUA 4EJSB 3A6PC 2DWOA 4BLOA 5GJCA 1P3JA 4B73A 1E64A 2KWIA 1VCOA 4BZPA 3WBJA 2JIZD 4XD7A 2VYQA 1WB9A 1EP2B 1RJ9A 1QVGB 4OHVA 2X2EA 4Q9IA 1OPXA 1J8YF 3FKSD 1AZSC 4K1XA 4GI7A 3BJIC 1LV7A 3FE2A 3NHBA 3ZBTA 4PAMA 3RWMB 1XTIA 5KDLA 3B13B 4Y0VA 2ANCA 2R6AA 2VNIA 1W44A 2GF0A 2EYUA 2O8CB 2YINC 1ZUHA 3RRNA 4BZQA 2B8TA 1SHKA 2Q9BA 2QMUA 4HSEA 4JVSB 3VO1A 1U8YA 2VLIA 2F9MA 1VG9B 1VQLB 5FUWA 3GJ5A 1F3OA 5HE9A 1KD1D 1D2MA 1DADA 2ZIAA 2QTFA 3MGCA 1RFLA 1Z08A 5JI3E 3H2YA 1QHSA 1OJLA 2CL6X 2IYTA 2KBFA 1AS0A 3U6BA 2ONKA 2F1JA 2FN4A 2FFHA 2NO0A 3ZVLA 2RB4A 5CB8A 3ADBA 1MT0A 1NJGA 2FPKA 2YWFA 2ZRGA 2VA8A 4QGHA 4JLAA 3DOEA 1KJZA 3D7MA 4G1BA 1I4TD 5EP3A 2O8BB 2OCPA 4MRRA 2BBWA 1PLJA 5FTJA 1C1YA 3RLFA 1LY1A 2CNWA 3W6PA 5EP2A 2DB3A 3RHFA 2P6NA 2R44A 3FFBA 2D06A 2QGZA 5BXQC 1G5TA 4OJKA 5E7IA 4MYTA 4N0DA 5FUYA 3GQBA 4EFMA 4ZDJA 2EFCB 1ETUA 2ZR7A 5J4YA 2R6GA 2VIIA 4LBZA 2AFIE 3HYRA 4IXNA 5GJBA 2JLXA 2BPOA 5DI9A 2XXAB 1ZNXA 1M90D 3LBHA 1P2UA 1Z6YA 4Q7JB 2R6CA 3K09C 3P1JA 4HUTA 1JR6A 4QHYA 1Z6AA 3CRRA 5CM8B 3A4LA 2XOKA 2ZSEA 1BMFA 1RYHA 5HCIA 3OW2B 3QEOA 2EFEB 4KHZA 1IJEA 1KO8A 4KBGA 1N0WA 2W2VA 3NBXX 5IT5A 2WWGA 3O8RA 2R6DA 3EZ6A 2ZVPX 4TTPA 4ASUD 3OZVA 4B3CA 4B4DA 3GLHB 3LVBA 2JJ2A 3CX6A 2N1BA 1GWNA 5AUPB 4HE6A 5TXGA 4BFTA 3LV8A 4RFSA 5JI2E 1ESNA 1OXVA 4QJ5A 3PEVA 2VP2A 3HPRA 1CLUA 2REBA 2DFLA 1NJID 4IDNA 1X1RA 5EXXA 4CF7A 3PG5A 3A4MA 5GV8A 2AD5A 2CHVA 1G4AE 5LD2B 1R10A 2HJVA 5L8VA 2GZDA 4NCJA 4W5WA 2PT7A 2VPPA 2YHSA 4DB2A 2OHFA 5JBQA 4G01B 1GUAA 2IX3A 1VQ8B 4DJTA 2LKCA 1P9NA 1E0KA 2HYDA 1GILA 2PL3A 4DCTA 1W87A 3BOSA 1ZU5A 1N6OA 5EE0A 3U5ZB 4ACBA 3LD9A 4R2IA 5K8TA 2ZYUX 2GK7A 2W0MA 1G64A 1COWD 3JQPA 1YRAA 1T8UA 1Z0IA 2JIZA 1NLFA 3VR4A 1KMHA 1S8FA 4Z1MA 3ZJYA 3F5FA 2W6JD 2G1KA 1VPLA 3SU8A 1PUIA 3K53A 1D2NA 1N6LA 4TLAA 2BIFA 3I32A 2PJRA 1H8EA 2ZYTX 4DCVA 3THYB 4G3XA 1JJ2B 5DLQC 1EG7A 1E79D 4BFZA 1Z06A 2BMFA 1ZW6A 2ZPTX 3UMSA 2RGCA 1EK0A 1W5TA 3QE0A 5DN6A 1JQLB 3ZLJA 1U2RA 3TRFA 3ZBUA 5L3QB 4LBVA 1T3LA 1CQXA 1VQ5B 1JEEA 2DFKB 3ZGXA 3MRSA 3E2IA 2JEOA 3CIOA 3OE7D 1MRSA 2AKAB 3BH0A 4A92A 3W34A 4PPNA 4A4DA 4HB4A 4DSNA 1KI7A 2ZRLA 2GVDC 4HI0E 3U6KA 1WMSA 3Q8XB 4Q1EA 3RABA 1GL6A 1DPFA 3NC1C 5D3QA 5FUXA 3THOA 4L16A 5J4VA 3OEHD 3QXHA 4C0AC 1W34A 3TSOA 3VQTA 3VX4A 3W6NA 2RCNA 2WKQA 2O8FB 1HURA 1NY5A 5KDOA 4LSGA 4PQFA 4KV9A 2HDNB 1U0LA 4B74A 1CJUC 5KTYA 4NCKA 3T5DA 3VX3A 3ZIAD 4AURA 4NYIQ 3K0CC 1KZGB 2E9SA 1IXRC 1VG1A 2B7CA 1NF3A 2CHGA 3I55B 3JZAA 1XMVA 3OIVA 4US2R 1G291 3BIFA 5AWFC 2RKOA 4QXAA 1OE0A 4B32A 5FL7D 4M21A 2IYLD 2ZJ8A 4RZUA 4BASA 2BMJA 1AMOA 2P3SA 1E2GA 1CKEA 2IS2A 1QHXA 2WWWA 4POAA 3LVRE 2F7SA 2QTVB 4AYXA 4RD6A 1L4YA 4JL5A 4M9QA 2J0SA 1XP8A 1FNBA 3CRQA 3R7WB 2Z4SA 1B2RA 4BPBA 1TTTA 4F4IA 4ZKDA 2J0UB 3UPUA 3QXJA 4L15A 1ZM7A 5HR5A 3RC8A 4A0FA 4I81A 1UKZA 4IDOA 5CDFA 1GZSA 3U7FB 1YR8A 5TV2A 4L5BA 4F92B 3CNOA 1ZAKA 2JDID 1P7CA 4EIWA 3G4SB 5SZJA 3RSLA 3LBIA 4NTZA 3C5CA 4JKYA 4PFSA 4DBLC 2ZRNA 3AP3A 3THXA 4RD3A 1QG0A 2CCJA 5FA6A 4MKGA 1E79A 1BIFA 1R0ZA 1MR3F 5THXA 1DO0A 1NI3A 4L4UA 3RRMA 2BSAA 3AH8A 3ETLA 2KB0A 1OKKA 4WW0A 3IHWA 4KO8A 1N0UA 2J7PA 3BH7A 2ORVA 1BX0A 4P4SB 1ANKA 1OF1A 4JBWA 1BX1A 4HDOB 3FHOA 1CU1A 4AKEA 4HUQA 3CCVB 1DAIA 3PUWA 3AKYA 2W2TA 3QI2A 2JJ1D 3SEAA 4HATA 3RVBA 4IKEA 3X1DA 2WAYA 1F48A 1GOTA 4LOAA 2G83A 1W36C 4PAQA 3I5YA 2WJIA 4TL8A 3DKVA 3WMFA 1G5PA 1E2KA 3UG6A 2P2LA 1W4RA 4QRHA 1SXJA 1S9DA 3D6TB 4NE2A 2ZE8A 2ZR9A 3S1AA 4MUAA 2PH1A 4TTRA 1KI2A 3AVTA 3LXRA 4QNMA 1QDEA 5CITA 2OESA 1VECA 4RD0A 3KUDA 2QSZA 2QUZA 3LWNA 4G5RA 1UEJA 1JAIA 1GL9B 2FGJA 4EDHA 4URXR 4C9BA 1N0VC 2YZ2A 1KQSB 2NO6A 4XJXA 4BFYA 2VHTA 1M6NA 4XSGA 3UMRA 3RYTC 3ZIAA 1RPZA 1OH8A 1K8RA 3MJRA 2UZ3A 5EUMA 1K73D 3E5HA 2R2AA 4LDJA 4TLEA 4DSUA 2A2ZA 3W5IA 3Q5DA 3H0KA 4OQFA 2QEXB 3FDIA 3ZZ0A 3EG5A 4X8MA 4B2LA 1L7VC 2GEVA 4KYUA 4DZZA 4TZ6A 1N3BA 1VG0B 2ATXA 2WJGA 2C9YA 3T1OA 1S4QA 1T9HA 1IOZA 2O0JA 3M1IA 4CDGA 3GLFA 4JLNA 2BCGY 1NKTA 3CCUB 2CCKA 1OGJA 4TWZA 1XJQA 4MKIA 3CF2A 3ZVRA 1XMSA 2LCFA 5GVSA 4MRVA 4PC3A 1ZM4A 3OIYA 4LZZA 3WBKA 4ZPXA 3SYLA 1VQNB 2C96A 3CCEB 2ZRMA 4E07A 2P0EA 2VSOA 3SBDA 1E6CA 3LA6A 2O8EA 3AGQA 3Q7QA 1Q44A 1XBTA 2HLDA 3U3JA 2VNJA 4A82A 1VIYA 1E2JA 5CIQA 1GVNB 1YZTA 3WRYC 2XNDD 2WPDA 1E2MA 2ZI6A 3FB4A 4E09A 3GJXC 4Q01A 4C7OA 2AWNA 5F9HA 1LF5A 1ZM2A 4LHZA 4TYQA 3AV0B 2XXAA 4AG6A 1H8ED 1KI4A 1NBME 2GDJA 2H57A 1N25A 3CPEA 3HU2A 3BD9A 3LO5A 3THXB 3X2SA 3IIJA 3F8TA 4ARZB 2I1VB 3WMGA 1KMQA 3PENA 1WA5A 3B8HA 4D81A 2O8EB 2VP5A 2ZRFA 3VR6A 1DAHA 4MYUA 3P26A 4V0MA 2F9LA 1OGIA 3OZUA 2JJ1A 4C7OB 2VZLA 5E3HA 2BEKA 1TUEA 4US1R 3QPVA 2BN4A 2CCGA 2O5VA 1D5CA 2FDCA 3CRMA 2KSQA 1Z07A 2Z43A 2ZREA 2RC6A 2OXRA 1W4AA 2EWVA 2C9OA 4K46A 5EE3A 3JVUA 3AF0A 4BFVA 4IHQA 5J4LA 1XCMA 3W2EA 1M7GA 1Z5ZA 2V6JA 1XZQA 2BM1A 2ODBA 3GLHE 3PEUA 3RNLA 2ZJOA 3KKMA 1FP7A 2CVHA 4HDCA 1VQ6B 3NC0C 2WIAA 4CVNA 3VU9A 4DC9A 2EIXA 4BFUA 1IAQA 4BEBA 1KC8D 1TEVA 4C3ZA 5EE9A 4DIEA 1BJKA 3SJAA 2BGJA 2V55B 2ORWA 4LC0A 2PT5A 4LHYA 1Z3IX 1KJWA 1TQ4A 3SN6A 2ZEJA 1KJYA 1XZPA 3CF6R 4CEJB 4AYWA 4HYYA 3M4YA 3VFDA 3CKLA 1EFRA 2YC4C 1S3SA 1E2PA 2CMKA 1W5SA 1ZMXA 4M1KA 3EA5A 1GITA 1G7RA 1KNXA 1T0JB 1Z0FA 3MWKA 5CYOA 5JJLA 1E69A 4B76A 1G3MA 1TF7A 3OEEA 4BGDA 2OBMA 1TNDA 1Q82D 1BMFD 4GBMA 3T1TA 1YQTA 1ZC3A 4Q7LA 4TL9A 1Z28A 2IYQA 1IY1A 4A6XA 2PIAA 1D1NA 3QENA 4AYTA 1M1YE 1J70A 3QY0A 2HLDD 2QAGC 4URUR 4D82A 4M0LA 4Q48A 1Z6GA 2IUUA 2FGKA 1ZVQA 4A15A 4EPVA 1YJNB 2ZXUA 2J5XA 1W7AA 3BFXA 4P4TA 1XPUA 1FQJA 4JJKA 2PZEA 4MGKR 2XZLA 1XE1A 1XJCA 2A5GA 3OEHA 3PUYA 3KKPA 3KX2A 3SS8A 5EJEA 2CLDX 3KZ1E 3FGNA 4QJ4A 3Q9LA 3TKLA 3KKQA 2JLSA 2HT1A 2VHCA 2W0SA 2IXGA 2J87A 5HTKA 3TW4A 2BV3A 2NG1A 4LK2A 1Q86D 2QP9X 4IJMA 4AIIA 1T8TA 3C5HA 4L8GA 4ZDWA 4O0MA 1PJRA 2Q0HA 3DVLA 2P6RA 1O3YA 3SHFA 1AN0A 1A2BA 3CCLB 1SVSA 3CPHA 1A7JA 4S35A 2QNRA 3CX7A 4URZR 4XWAA 5JFGA 1H65A 2IYUA 3AM1A 1WDTA 3W8RA 3V4RA 1FRQA 1KYIA 3NEJA 3E70C 421PA 3W2GA 1W49A 3PEYA 3QBVA 1EWYA 1G8GA 5FI1B 4DVGA 1CR0A 4F38A 2V7QA 5CLQA 3OZWA 1J99A 1UMKA 4G5QA 2IS1A 1DVRA 1UADA 2DBYA 2B6HA 5CYPA 2WSSD 2XNDA 4IFBA 2R6HA 3K9HA 2ZYVX 1JJ7A 1QUFA 1MO3A 2IC5A 2Y8EA 1YZKA 2ZAOA 3NVAA 4FD2A 4RSGA 1G7CA 2FSHA 2O8BA 4MKFA 1D6JA 2VF8A 3JQQA 1WE2A 2A5JA 2H5EA 2W83A 3R20A 4Q1CA 2H1LA 2GEUA 3RDPA 4A2WA 3KQNA 4B35A 3RSOA 3K9NA 4B2IA 2V8OA 4R7ZA 1IQPA 5EZ5A 5F2EA 5KDDA 4Q02A 3IGFA 3TIFA 2J59A 3BWDD 2RGNA 4F7DA 2Q3MA 4NU0A 2DETA 2OILA 2NO9A 3ZQJA 1PLKA 2QT0A 1VDZA 3BORA 3JZMA 4DT1A 3FPKA 4ERNA 5JLJA 1C9KA 2X2FA 2GBLA 4V0LA 5EUQB 4PO9A 3W2FA 1L2TA 1ZBDA 4PANA 1GSIA 1AS2A 2YOFA 2IHYA 5GJVC 5C18A 3IDQA 1D8TA 1FMJA 3QF7A 2ZRJA 1LTQA 1KI6B 5E7JA 4YAUA 4YAOA 1EWQA 1G9XA 2B5OA 1FNNA 1U9IA 3LRPA 4PSKA 4Y0AA 1CRPA 4YAWA 2PCJA 1KI3A 4NYIR 4RZ2A 4P4SA 1R7RA 1OXXK 1M2OB 4HLDA 4Q4HB 4KU4A 1II0A 1XTKA 1Z47A 3IILA 5KPDA 4KI0A 3W5JA 2OO7A 3BB1A 2ZE7A 1X6VA 5DISB 2A5YB 5EXSA 4B3GA 2BOVA 1GNQA 1ZD8A 1T6NA 5C1BA 5GADl 4PZZA 3VR2A 1OFTA 2W6IA 1SXJB 2UZIR 2GKSA 4ZDIA 4HUQB 5FR2A 3Q5EA 1D9XA 4JIMA 2JASA 1TAGA 5P21A 2ZI4A 3BB4A 3PUXA 3LFUA 3QXSA 1EX7A 4GNKA 1ZNZA 4I99A 4D25A 2PMKA 3HU3A 2VP4A 2FZLA 2D7CA 4TQUS 1QBKC 1OXTA 2QROA 1P5ZB 5KSPA 3MD0A 3MLEA 4KCGA 2CLCX 1Q21A 4FIDA 3LAWA 3R8FA 4B33A 1N5LA 2ZUBA 3N2IA 3OIWA 4Q4JA 4YLGA 4DUGA 1OIXA 2ZUCA 4D6PA 3EXAA 2ZRIA 1QZXA 4N3NA 1FRNA 3B7GA 5DHAA 4PXAA 4A8JA 2IT1A 2CXXA 4DXAA 3RRYA 3FPAA 5DH9A 3CMEB 1RJ9B 1OFUX 4JT2A 1KKLA 3B1VA 2V4ZA 4QFMA 1KNQA 3ZS9A 4DLWA 2WOOA 1KI8A 2NQ2C 3SFZA 3TQCA 3OHMA 4I1VA 4AKIA 5LDDC 4NCHA 3CUEF 4OK6A 5KHOC 2W58A 3V76A 1SVKA 5G40A 1KO7A 1DAFA 3S1AB 3CW2A 1NMXA 1YHQB 1EFRD 1CJMA 2R9VA 2ODEA 2OCYC 3OFNA 2OE2A 3GLFB 2WJJA 4LY6A 4US0R 2A9KA 3BH6A 1NDHA 2ZYWX 2XZPA 4Q1FA 5FTNA 1HTWA 2G88A 2F1IA 1QX4A 2CL7X 4MRSA 4NP6A 5FTKA 4DLUA 5DYGA 3U4QA 2ZROA 4Q1AA 3DMNA 4IRUB 4LJ8A 4QBHA 4URYR 2VTKA 5SZHB 1UEIA 4AD8A 3T35A 1BQEA 1AS3A 4PC7A 2RGXA 2FSFA 4BWYA 4GT1A 1P60A 2QTLA 4CIDA 3CF0A 4PC1A 1MH1A 1XEWY 3QOFA 5JECA 3I8XA 2NOAA 1XXHE 4YALA 1N2CE 4CEIB 2AX4A 2ODWA 4X8OA 2KE5A 4WZAE 4QOSA 4JSYA 4QL3A 1RVDA 1B0UA 3GJ8A 2AXNA 4N1AA 1E1QD 4XIGS 3CBQA 3AKEA 3GCGA 4D4JA 3I73A 1VQKB 2CJWA 1W2HA 3UXMA 4C0LA 3OAAD 2Q9AA 4PGOA 2GEDA 4KFSA 4TTQA 1KAOA 2NO1A 1E32A 2XTMA 3KKOA 3V4FA 1FW6A 4IOKA 4R2HA 3EW9A 4D0LB 3NHAA 2AR7A 4JSTA 2FG5A 5FBLB 2PEZA 2XZOA 4C0HA 1DS6A 2C98A 1HE8B 1HT1E 3E1YE 2G9NA 5JWRA 1HYQA 1JI0A 1VCIA 2P65A 3Q72A 3VNVA 3GJ3A 3VAAA 3VHXA 2QA4B 5FPYA 3U7EB 1W47A 2BCJQ 4M4SA 2GJ9A 3QXXA 1BH2A 4JJZA 1ZRHA 2CBZA 1SVMA 1TMKA 1W0JD 3FFAA 3LW7A 3QIAA 3IEVA 5C46F 4WZ6A 2EFHB 2YOGA 5EE1A 4IVPA 3WYFA 3B6EA 4BPRA 2SHKA 4JMPA 2QZ4A 5K8UA 3T34A 2Q6TA 5JEDA 4HB2A 4MQBA 4HAUA 3KDSE 3TR0A 5TY0A 3I62A 1P61B 5SZKB 3C15C 5FBVB 2CRVA 3KJHA 5L3SA 1P6XA 4LHXA 3A1WA 1JB1A 3T5GA 2O52A 1FNCA 2QQEA 3FYHA 3OFND 2VO1A 1NLZA 5JEEA 1Z0KA 5AJVB 2Q3FA 1AJEA 4NCIA 1KKMA 4MA4A 3A1SA 2VSXA 1Z2CA 4NDZA 1G7TA 2VL7A 1QG2A 5M04A 2O0KA 2AFHE 3ONWA 3QBTA 2OUKA 1P62B 4DKXA 1N5IA 1A2KC 4B34A 5HKKA 4JT4A 3TQFA 2AK3A 2CVFA 2ODNA 2ZM5A 1G4UR 2D7DA 1N6NA 5FOUA 1UPTA 2ZU6A 2VHQA 3TSZA 3NBFA 4DHEA 2P5SA 1WP9A 4JBXA 4Q7MB 1GKIA 3L43A 4DLZA 5J47A 3SDZA 2VRWA 2DPXA 1E9RA 4L9SA 1Q1EA 3ZZUA 3LX5A 2FZ4A 3K9LA 1YJWB 5FL7A 3C41J 2VHUA 3SJZA 3W8NA 1N6IA 4O3MA 1N5KA 2IW3A 5JCPA 1A8PA 2B92A 2YV5A 3CM0A 2XAUA 1QH0A 3AEZA 5BN3A 3ZH9B 2OM2A 4AY2A 3QFCA 1E0AA 2J0QA 1KOFA 1W48A 3GFPA 2IUTA 2J3EA 4PHHA 1TQ2A 3SYNA 4E5UA 2RGGA 4DLTA 4PPQA 4N3GA 4TT3D 5IRCD 1QVFB 4LX0A 5H70A 1AQUA 2G0NA 2EFGA 4MH0R 3PQCA 1Q12A 4UJ5A 4B6FA 4M8NE 1FTSA 2XJ9A 4D4LA 5FH9A 1KY3A 2YWGA 2Z0MA 1JNYA 4Y7CA 1RE0A 1FP6A 3JQRA 3W2HA 3KB1A 1KSGA 5KU1A 1CULC 2WWHA 1OKKD 1TPZA 2GJKA 4A2PA 4TYWA 4OI1A 3A1VA 1IONA 4XD7D 2NGRA 4W5JA 2ZS7A 1XF9A 2YNMA 1IM2A 2K5UA 5EP1A 1JJVA 4KFTA 1JR3A 1FPMA 4YDHB 3ND9A 1E9FA 5DIFA 3K1JA 1A82A 2D4HA 2WWIA 4C0BA 5E4FA 2R6FA 3EZ9A 1Q3HA 3L0PA 4IDPA 4OI0A 2V54A 3ZQ6A 3KQKA 2YWHA 3HP1A 1OB5A 1UDWA 3VO2A 1TF2A 5JS7A 2CJWB 3A36A 4CZ2A 4WOPA 2BJVA 1AKYA 4CYMA 4KFRA 1GM5A 4KBFA 2OFXA 3VR3A 1FUUA 4E22A 4DT1B 2CNDA 5HZKA 3GJ7A 4JLBA 3UIEA 2R62A 1UKYA 4PSAA 3DL0A 1YHNA 1VQPB 2NPFA 4HAZA 4JS0A 1QHHA 1ZC4A 1GTVA 2X77A 4TLDA 3FJOA 3NH9A 2H7VA 4M1MA 2CE7A 4QHTA 1Y63A 3TW8B 4WQMA 4I1UA 2O8FA 4OBEA 1I2DA 2J0UA 1CIPA 4YMVA 3QPUA 2Z83A 2ERYA 2GNOA 3FKSA 2QBYB 2WV9A 1M74A 4CW7A 1ZIPA 2IEYA 1OH5A 1RZ3A 4HAYA 4J0QA 2QE7A 2L0XA 3IUYA 5BWMA 2AKYA 4KLZA 2BMWA 4M1SA 1AIPA 1SXJC 2QA5A 3QFRA 2W6ID 3RWOA 4FK8A 2CNWD 3TUIC 4U7DA 2J7PD 3R9IA 3VTKA 1XPRA 1T3SA 3FHCB 1NN3A 4PQYA 5IK2D 1GR1A 1SXJE 2ZVQX 3CC4B 2RAPA 2CK3D 1E2DA 2WICA 4OK3A 4NCNA 3RRZA 4BRUA 2ZITA 1HH4A 4GZLA 4R98A 4GOJA 2Z6VA 2DR3A 3KTAB 3AVWA 3H84A 4OQXA 521PA 1FUKA 2IHBA 3GLHA 5H5JA 2ERXA 1EXMA 4EPWA 3MSXA 3KQUA 4JLOA 1GG2A 1CJTC 1TADA 1X3SA 4NYJR 2GZHA 2DFNA 1RIFA 2ZRKA 2BWJA 3AF2A 3I72A 2O0HA 4LI0A 5L3QA 1VKJA 3K0AB 4G5GA 5TVKA 3BXZA 2OXCA 3CPWB 1ZP6A 4OHZA 1PUJA 1U8AA 1IXZA 1F2UA 2HF8A 4LV5B 3SYKA 4P32A 1OYYA 1VMAA 5C2JB 1AA9A 4HZUB 3QKSB 2IK8A 5CJ2A 3ZVNA 4JLVA 4LWZA 1E94E 4C0SA 3KQLA 1FOEB 3PEWA 1UBFA 1K9MD 5LB2A 1MRNA 2XTNA 3I8SA 1YR7A 2JLQA 4XH9B 4DB4A 2B21A 1RYFA 2AN9A 4WAUA 5B57C 4DSTA 4D4MA 1R6BX 4G1VA 2PBRA 3FHTA 2C99A 1QFZA 1DG3A 3QNUA 1XD9A 3MCAA 1W4BA 2Q21A 2ZJYA 1OSNA 3SZRA 1PZNA 4Q47A 2ZANA 1OFIA 1G7SA 1X1SA 4DLSA 4UXIA 4RZXA 5A5GA 3TBKA 5L3VA 1VQ4B 3EPHA 2FEOA 3O8BA 4IDQA 4QBGB 1KDTA 1MO4A 5FTLA 1P9WA 2EFDB 3OZXA 2W6JA 4UAJA 1UF9A 1YVDA 3SQWA 1E2NA 4TMVA 4XSHA 1YZQA 4KSBA 5J5CA 2ZRHA 1FQKA 3U7GA 3L8YA 3GP8A 3ADKA 1XXHB 1HV8A 2OG2A 1ONBA 5AJZA 4YQFA 2DYKA 2XNSA 3H4MA 2JA1A 1KZ7B 4PHGA 2F6RA 1HY3A 1QRAA 4TL6A 2QI9C 5C4GB 3GFTA 4KLNA 4XVUA 2BKUA 2B8WA 4F91B 3WNDA 2ZJZA 4HLUA 4YMSA 4UNNA 4FCTA 3U4QB 1EFCA 1YR9A 3ZD6A 2IYXA 3AKDA 3B78A 4M1OA 3CCJB 2GCOA 2XTZA 1Q0UA 4PX9A 4RJLA 4MITA 2BF4A 2IYVA 1QHHB 4TQAA 1R4AA 1G3IA 4KJZA 3QPWA 1II8B 2GZAA 3B85A 5AUNB 1G19A 3GJ0A 5CM9C 4QM6A 4EPXA 4BLRA 4HZIA 2GCNA 2HEIA 1KSHA 4IVRA 2GBLC 2WBLC 4DDVA 4MGIR 1G6OA 4R71A 3W6OA 4Q19A 5BYKA 1LFDB 1EFTA 4NYMR 3RS7A 1QHYA 2R8RA 1H8HA 3K09A 4LPSA 4CGZA 1U9IC 4Q18A 4C0KA 1W4CA 1ZJ6A 2G77B 1E99A 1SXJD 1U94A 3VR1A 4GRAA 3AVPA 3ASYA 1II8A 1K6MA 5DGXA 1ZNYA 1G17A 3MHPA 2ZRAA 3CRW1 1SULA 1TU3A 2MSEB 4QNRA 5FBQB 2PX0A 3B5JA 4BRWA 3NH6A 1EWRA 3DKPA 4DLRA 3BFVA 4R9UC 4HB0A 3NDBB 5TARA 2XB2A 3MMPA 4UNPA 4GL2A 1C4OA 1OH6A 3DM9B 3NKVA 1GDDA 2V6IA 3U44A 4MDFA 4A36A 2NMVA 4EPYA 1LS1A 3W5UA 2WZQA 4Q9LA 3QFTA 1JECA 2BMDA 3P4YA 3PV0A 1HEIA 4QC2A 4W7SA 2IBMA 1RKBA 1M1KD 1J8MF 1G8PA 1ZUNB 4CRWB 4DCNA 2GJAA 2ZUDA 4C0JA 1UKEA 4GPTA 3CCRB 4UNSA 1F6BA 3VHLB 4DUGD 3FMFA 3N2EA 4IEEA 3U2QA 4WZBE 3DMDA 1GRQA 1XTSA 2AXPA 4TMZA 1P2SA 4ABYA 4B43A 1OXSC 3TVDA 3CLVA 2IL1A 3SC3A 3CCQB 2JJ2D 4LC1A 4A0HA 3TUJC 1CR2A 3AVVA 5FOTA 2OAP1 3U44B 4D2IA 5KYKA 2FFAA 3V00A 4IOMA 4Q1DA 5FPTA 4M2LA 1NNEA 5DHFA 2O8DB 5TB5A 3QKSA 3T1VA 3BFKA 8OHMA 4RVCA 4PQRA 5HZHA 5AJXA 2WWYA 1US8A 3E20A 3L0OA 3A58B 2IF0A 2RMKA 4Z8XA 4P33A 1W2BB 1S0UA 1OHHD 1P4SA 3GEEA 1MO5A 4Q4LA 4Q4AB 1Q3TA 4LJ5A 3K70C 1DELA 1XD2A 4OYHA 5FOVA 1KGDA 1E2HA 1EP1B 4FN5A 2D3WA 4LYFA 3QQ5A 1GVHA 4GFDA 2YWEA 4LBYA 3BS4A 2XITA 3AQ4A 3RS2A 1E2FA 2FMXA 5JZVA 2HCJB 1YKSA 3KXKA 3TLXA 1VQ9B 4LJ6A 5FL3A 3QUSA 3C8UA 3HR7A 5EXPA 1KK0A 3MFYA 4LYJA 2H92A 2ZRCA 4JLMA 4LJYA 2QL6A 3ZD7A 1Y3AA 1AM4D 3L8ZA 1UDXA 4O2LA 4E03A 3QKTA 2VP9A 3PUZA 1SVLA 2O8CA 2QMEA 2GF9A 4OI4A 2D2EA 4ZCLA 2QMHA 4PR0A 5JRJA 3B2EA 2WTUA 2YKGA 2FWRA 2FF7A 4YHBA 4BUJA 4HLQB 2G1JA 3TAUA 3GLGE 1I2MA 5AK0A 4DQKA 4LCBA 1W46A 3KXIA 1S9HA 2ZETA 5AJYA 3SBEA 5F98A 3FMPB 3NEYA 1NIPA 3IO3A 4B6EA 1J90A 3CWZA 1G5RA 1P2TA 3X1ZA 4NBSA 3AF3A 4JBYA 4WVFA 1TQ6A 4UQOA 4UXJA 4TYPA 1HE1C 4JYBA 2ATVA 3W3AA 2P67A 3DZ8A 4IOLA 2QRZA 4G5OA 4TLBA 4CEJA 4GMXA 5BYJA 4FWIB 1SZPA 1VQMB 3RS4A 5HCNA 3HR8A 5E95A 4KFUA 4QGAA 3EX7C 5FI0B 3N70A 3T1QA 2XSZD 3I1FA 5EZ6B 1TUIA 5KOYA 1NVXQ 5B58C 5FUVA 2UVQA 1EFUA 1KIMA 1YZLA 4IVQA 4ON9A 2WWXA 3QE2A 2XX3A 4LBWA 4JZKA 1W2GA 3DZDA 1KI9A 4LHVA 1IN7A 1TL7C 3L2OB 2RGAA 4FMDF 4B47A 2MSCB 4FXPA 4QG7A 1VQ7B 4G1UC 1CJVC 2FE4A 3QVVA 1SM4A 4BFWA 3THWB 4MGZR 1SHZA 5CLLA 1UFQA 2CHQA 3SE0A 4ZIRA 3LNCA 2C04A 1RW4A 1S1MA 1EFHA 3AVUA 4LV6A 2N42A 1IN5A 4M53A 1TU4A 2GRJA 3AVXA 2QP4A 3E1SA 1KI6A 2VSFA 821PA 1FTNA 4TMXA 3IKJA 2P5TB 3CR8A 1XB2A 3G0HA 4Z54A 1YRBA 5GVRA 3WHKA 3GMTA 1Z2AA 3SHWA 4TSFA 2BBOA 3KJIA 4Q4AA 3U61B 3UKDA 2NO7A 3QF4A 4FI3C 5A0FA 4NPHA 2LKDA 4DLYA 2JLZA 3LXXA 1CTQA 3IIKA 1Q22A 3NIBA 1FX0A 3QKRA 1R2QA 5G3YA 1E3MA 3Q85A 3I61A 4YMWA 3QFSA 2WOJA 3JVVA 3QXCA 3WP0A 5KNDA 1WRBA 2ZI9A 1Q57A 2A30A 4LV8B 3EA0A 3BE4A 2PMDA 2KI5A 2WJVA 1AGRA 2DY1A 2WSSA 5DN6D 2V1XA 5H8WA 4QHSA 5KNBA 1CR1A 3CWQA 2GQFA 3KTAA 3P32A 4AI6A 5DI3A 4BFSA 4IFEA 1XU4A 2IEZA 4NONA 3U3MA 2D2FA 1CNEA 4TL7A 2HXSA 1QHGA 1E9AA 3LLUA 2W2XA 1J2JA 4B3FX 3OESA 3QKRB 5A4JA 2OBNA 3G71B 5FOWA 4I1OA 5HPYB 1XNJA 2HUPA 4URVR 4Q9JA 1NSTA 3C7KA 4NYJQ 5AR1A 1OLOA
chains in the Genus database with same CATH superfamily
4CG2A 1TKCA 1UOOA 2Q2VA 2WHEA 1JR3E 3E03A 3SZOA 2J31A 2EL7A 3KJGA 4GYWA 4IRXA 4CZ2A 4WEOA 3QYAA 1XRPA 4PV7A 5BOSB 3ESCA 2L18A 4Q37A 3P20A 2NUAA 3TRJA 2O0MA 4D9HA 2H4XA 4YI3A 2AZXA 4ZT4A 1Z18A 1F2UB 2FFJA 3PYLA 4CTOA 5KTKA 1ODSA 2IS6A 4Y9UA 4PWZA 1L7AA 4F97A 1KERA 1T0PA 4IWYA 4BNDA 1D9ZA 5IFKA 1F5SA 2YJ6A 3AFMA 4TKVA 2REXB 4P7KA 1XNGA 4HMQA 3FF4A 5F2NA 4U7HA 3UY4A 3QW4B 1U7DA 3QU4A 3ONYA 2YYZA 2J3JA 3WB9A 5GTDA 3DXFA 4H15A 3IODA 2C9DA 4MVXA 4P4NA 1FJXA 3GL9A 3NDPA 1CVLA 4DWVA 3LY9A 3USES 5DM1A 4D8XA 5IG2A 5JDCC 2OQRA 2P6UA 1PDVA 3CN7A 1E2QA 2J0VA 2QD3A 3ZZ1A 4P4UA 2BFDA 1HQCA 2I3DA 3DDOA 1N5JA 4TZ0A 1GZ3A 3NPAA 1Y34E 1W0KD 3KQOA 3SDSA 2H4WA 3GD7A 3OSZA 4NE9A 5D3MB 1OV4A 5LC1A 2JJQA 1QNFA 2P1ZA 4TRJA 1HBJA 3TBHA 1O6FA 2B5VA 2LTAA 2VKQA 4KAJA 2R79A 2OA0A 4R3NA 3DLAA 4CMBA 3UMVA 2MHCA 1UQRA 1WV0A 3BWYA 1QC5B 3CX8A 1IB0A 2H4HA 3GLGE 3WYNA 3E4DA 1R4MB 4F1JA 3PNVA 4Y30A 2F00A 1HXHA 2EZ9A 4LF9B 4G0NA 4FXOA 4XLLA 4ZVUA 3UJBA 3EDOA 3ENVA 3AOGA 5DM0A 3ZWOA 2IXBA 3IUSA 3OJWA 4PGAA 2BGMA 1XTBA 5FQNA 4Y6SA 4AMYA 5IUNC 4KH1A 4P5EA 2AUTA 4F60A 1ABBA 2I2CA 4P7BA 2ORYA 2XSZA 1E1NA 3DMYA 3JYLA 4TKZA 1XEXA 5K0EA 1IUKA 2ET6A 1PLLA 1XU7A 2GARA 3CCFA 2X9VA 5IUKC 3LMKA 4P7FA 2RH5A 5HZBA 1R74A 3ZWYA 4E7PA 4BOYA 2VAXA 3DCNA 1YHYA 1V1MA 2UUCB 4PF1A 1DOAA 4Y6RA 1KEKA 2GPJA 1T2AA 4ZTUB 1H1LB 3P9CA 4H1VA 5AVKA 1VI6A 1NVBA 2CEAA 1U8ZA 3D6NB 3A4YA 1PEDA 3VMFA 3K5HA 2AL7A 4HDNA 3X1YA 4JJGA 5D5HA 3KZOA 3UXEA 1C0PA 3GJYA 1TYDE 4MX8A 4B0PA 1VBMA 1KO1A 1ZSVA 3UK6A 3C3EA 1VA4A 2R1VA 4G5YA 4K9SA 5IC6A 1KK2A 2QR2A 2WA1A 3HE3A 1MV5A 4OYLA 3DNMA 3A7EA 3T38A 4AY5A 2Z6QA 1TKBA 4WHMA 3WQBA 3NE5B 3I8OA 4PZYA 3W4KA 4KKSA 3CNNA 4I7EA 3BC1A 1SD1A 3S29A 2WT8A 5A4FS 2FQQA 1DDOA 3EXEA 4E88A 3BHIA 2CK3A 1DBPA 1GRVA 1BCRB 2P2ZA 3K35A 3ND7A 4CM1A 3D6UA 3KJZA 4INOA 2AQHA 4DWJA 2MTBA 3NETA 4BLSA 1TZJA 3R5SA 1HYGA 2QP3A 1BOFA 1X87A 3P45A 5AOAA 2O8NA 4NKRA 3K2IA 4RBNA 2ZBFA 5CD9A 1Y48E 4EVRA 1DOZA 1TM5E 4IDDA 1R8YA 4RHTA 4JXXA 1HF3A 1M1ZA 3DWEX 4TVKA 4A16A 5AI0A 1TC1A 4QVJA 5EPUA 5BNFA 1XTRA 3RUIA 1J1UA 2FR0A 1Z83A 1RZRD 2DR2A 2RSLA 1A04A 1KGSA 2QX4A 2HLHA 2B7BA 1FDIA 3LHSA 3RFCA 2IWRA 3RHTA 3I0ZA 2UVDA 3L46A 1Z6TA 3SR0A 1A5BB 4DF3A 1E58A 4TS1A 4TKLA 3OU2A 3UATA 5EQTA 2ZYRA 2XGSA 3FDFA 2VCYA 1DAGA 1O77A 5JHHB 1CY0A 5IT4A 2CLHB 1HEUA 1U3FA 1RBMA 3WMEA 2IYZA 1KOGA 3RCBA 5C4MA 1Q6YA 1XTQA 1PJ5A 1UD6A 3TQIA 1T9KA 4OO3A 1TLLA 3PA1A 5J47A 2LXNA 2A3RA 4MDEA 2CL0X 3EUEA 1QTRA 3BSSA 3NXSA 4UNIA 2JI9A 3UF0A 3DFFA 4IIDA 1QG4A 3I01M 2PUEA 5DNYB 5DVZA 3WO0A 4CDMA 2QTAA 3UMMA 1SKYB 4D5EA 2XDWA 4MINA 2CFTA 2QZ9A 1GTRA 2I54A 3H8WA 3OEED 3VGJA 1C2TA 1N92A 1XK6A 2G1UA 2X0NA 3MJFA 3NHMA 4DARA 4A73A 1VCNA 3EMBA 1X7HA 4EENA 1YULA 3FFXA 1JFRA 4TYMA 4F2WA 3BCFA 1V11A 5J2UA 3P0FA 2RHWA 3R0VA 1I3NA 1MB3A 1U0HC 1OWLA 1ZI8A 2G71A 4WWHA 1UPUA 3WOHA 3KK0A 3UXYA 4GPEA 4IDEA 1G2IA 1XA4A 1DBQA 4X5OA 4C3OB 3AFHA 3ILVA 1KK3A 3LBYA 4OL0A 1GFIA 3QVKA 2LGJA 1X8LA 4O4JA 3K9FC 3ELYA 4XWYA 1O4WA 1B23P 3LBNA 1BU8A 1WW8A 3WTBA 4DZTA 3CJQA 3TEMA 2QPAA 3B1ZA 2HK8A 5J4KA 3SJUA 4RTJA 4G56A 2GK3A 5A71A 1T5SA 4J91A 3WFZA 4L5CA 4QXOA 2WJHA 3O2JA 1IJKA 2C8VA 3WE7A 5C1OA 2UYYA 2Z5VA 5TF0A 2DQYA 3FX2A 2CXNA 3GVLA 2AN5A 1JILA 2MCFA 1ZJWA 5BV7A 4YCAA 1Z4JA 1USVA 3GQBB 1WHSB 3I45A 3ZYCA 1GNSA 1WJGA 4PC6A 1JJAA 3EEBA 4JJ8A 4JH0A 5DFAA 4ZT3A 4JI3B 1H85A 2OB2A 1EFPA 2ZRDA 4RIGA 4RX1A 5E7MA 3L7NA 3NBKA 5A6VA 5IVDA 4NBKA 2OYSA 5LDHA 2IHNA 4U6SA 5FPKA 1BGXT 2C3YA 3SVTA 5F7XA 1IZ8A 2YVUA 1O89A 1U63A 1WUYA 5AVJA 4PNPA 5BNWA 1T9GS 3K16A 2WT9A 5F1YA 2ZTLA 2FFQA 2IYEA 3O6VA 1NIJA 2BLNA 2WIFA 3DEKA 4OKNA 1M2JA 2Y0BA 3V3KA 1TFUA 4AF6A 3MGKA 2WB4A 4HJXA 4HNAA 4JDPA 1CC1S 1J20A 1GZ4A 4IV5A 3DEIA 4HC4A 1CEYA 1GL7A 4GAEA 1W19A 5CLHA 4A1FA 2C2HA 3RGGA 3GBPA 5JHGB 2NPIA 4L51A 4XEHA 4F4JA 5EFOA 3VSCA 1NTRA 3G8DA 3QF4B 2CXQA 3GBVA 1ZAYA 1ZU4A 4BMYA 4NICA 1KYZA 3ROEA 2YZKA 4HE5A 4RF2A 3CVUA 4FILA 2YFYA 4BB9A 2BRUC 1PK9A 1CY4A 1CUGA 1L8LA 1U1DA 3RTBA 3WGHA 1J2EA 1DQRA 4FCCA 4ZEXA 4YXWA 3IHTA 4V2UA 3GGGA 3WIUA 4BFXA 3UUWA 2WZDA 3DDCA 2RKWA 1XDSA 3O8QB 2ECOA 1YI2B 5FXMA 4CG1A 4QFBA 2JGKA 5DK4A 1DB3A 5EVJA 3ZJ5A 2D8AA 3S55A 3KXDA 2BONA 2XMSA 2H52A 1YU9A 2QL9A 3QLTA 3O31A 2SKEA 4YV7A 4TVSA 1DDIA 3OETA 3EIWA 5CPFA 4QE3A 1ST3A 2W2KA 1H66A 3G8BA 1RI3A 4F3NA 5CH3A 4XYBA 3I6IA 1WL8A 3OUTA 4YROA 3M0EA 4H3VA 4KQ9A 3H3FA 3MYRA 4R1TA 1L1FA 4H9GA 4XEUA 3TL3A 2X0IA 1U2SA 1XYGA 1YNSA 4I5FA 2X19A 3QUBA 4MR9A 4PZ9A 5FYQA 1VDMA 4PN7A 5BR4A 1CYEA 1NZJA 1QHNA 1XLTC 3CXRA 3PJGA 1DX4A 1N8TA 4UNRA 4NAVA 2YXPX 3T15A 5KVVA 3B9QA 1MB2A 4WKCA 3BK1A 2W9XA 3D4IA 1UJ2A 4IGEA 1SOUA 3NORA 2YHBA 5JVDF 4KRXA 1PGJA 2AFRA 3HJUA 1E3DA 1Y82A 3WLRA 4FGJA 4TRNA 1JKMA 1F8GA 2P9YA 4TXJA 1GV1A 2LCQA 1W0KA 1D7OA 2HMAA 3DT8A 3KDAA 3OIUA 3DM5A 4MRNA 5TPZD 3MPUA 5KUTA 2PLRA 3MYYA 2ZJ5A 3OQ1A 3FLAA 4BX8A 1VSBA 1KP2A 1F20A 3ZV3A 4B4OA 4DYDA 2O3QA 4F93B 3WLIA 2Y0CA 1KO5A 4LFBB 1R4NA 4EHLA 3W6ZA 1J7KA 1NRWA 1XQXA 3ABQB 1RQRA 2FN3A 1DCMA 2YC2C 2BFDB 3JQAB 1H69A 3OM9A 3PIDA 4NWIA 5G41A 3WLMA 1I2BA 1SKAA 3IRUA 4K05A 5BN5A 3NQ41 1LC3A 2JLYA 2PH3A 2PSEA 4G63A 5ITWA 2VZ0A 1Z16A 2HJSA 1RKXA 1W85B 2WPNA 1V8BA 2WZBA 2ZSDA 5TT0A 1WVIA 1Y9EA 3LIPA 1Z6ZA 3IB3A 4M55A 5IXSA 2H4JA 3E7FA 3EASA 3I4LA 1M6HA 1J8VA 3NJRA 4GVLA 1TLTA 1UC5B 4Y2YA 4C30A 4AY4A 1MC5A 2FPMA 3P0HA 4B46A 4EX7A 4P54A 4B3BA 4GGMX 3H19A 3PC3A 5BSRA 3VZCA 4EHAA 1MOSA 2C57A 1SR8A 2EKDA 2WSIA 2QSYA 3DFMA 3ICPA 3KOWA 1PW5A 2A86A 3AZOA 2RAFA 4Y2PA 4M1TA 1O8CA 1Q1BA 1WQ1R 2X42A 5KVQA 5U4XA 4OF4A 4XWKA 1P2FA 2QJFA 4RK1A 3DZBA 3OSUA 1TW2A 4N39A 3FMOB 1XZHA 3EXHA 1G6HA 2Q9UA 4YH1A 4IFTA 1LH0A 4CR6A 2VRCA 1V6CA 3LC2O 4I8DA 4EMTA 3BXHA 4UMEA 3ECSA 5BQOA 3RFXA 4BVFA 2HFKA 5CVTA 3W5VA 2IS4A 2B0CA 1P5RA 3H5NA 2R5NA 5E6RB 4L4RA 2E37A 4BZWA 2MMCA 3GUZA 3I5MA 3LPCA 3ACBA 3PPXA 2QSJA 1T9CA 4OM7A 5L51A 1OOEA 1VCHA 4FCWA 4FYKA 4BB5A 2QHXA 4YCMA 3FOEC 4KV7A 1S6YA 5L7WA 5K7SA 4EGAA 2J09A 4GOKA 1PCXA 1RRKA 2P77A 2ZB2A 4IIGA 4IV0A 4OOVA 2IY8A 2X15A 3FWKA 3AVYA 4ZQEA 1G59A 3CUWA 2FUEA 3TD6A 1CEXA 1WVMA 4UHDA 5LPNA 1FW8A 4CF6A 2GPNA 2V9CA 1LRLA 2TMYA 2Y2VA 3ESYA 2FFRA 2M98A 3A3OA 1GUDA 2AVDA 4I3GA 4UUQA 5FPSA 4X62B 1S89A 1YB5A 4G9BA 2X3UA 3T9DA 4ER6A 3H7IA 3UVEA 4R2JA 4E5PA 1M2GA 3MOIA 4RKRA 3NVDA 2AI3A 1VKRA 5BN4B 4DLXA 1UAAA 1HUQA 3OF2A 1QGAA 2RGBA 3TK1A 2WIJA 3FLEA 4OQMA 1EGHA 2QU8A 4GMFA 5J4YA 2INGX 2QRNA 4EKNB 2OECA 3QEKA 2F3QA 4OJQA 2QORA 2G5PA 3EFEA 3N7TA 4RF4A 1L4FA 1F5NA 5LMZA 5FOSA 1RI2A 2WP8J 3UA4A 1C3OB 3ZI7A 4MW0A 4H7HA 1COZA 1CT9A 3OA0A 4ENWA 1PDOA 2BHRA 1KH2A 4HQOA 5EWJB 4YACA 1ATZA 3KXLA 2IX9A 1Z88A 3BERA 3WQZA 4OQNA 5I7UA 1C7QA 2VK2A 4JR2A 4FHZA 4JL8A 4E94A 1J56A 2FG7C 2GXSA 5FFMA 1L7EA 1YZGA 3DO6A 4MWGA 4HG2A 2JN9A 3I83A 3EIEA 4W1RA 2JD0A 1A8IA 3FWYA 1A4RA 2HGZA 3DLHA 1VMKA 4DUPA 2OQVA 3VOTA 1XCJA 4H6WA 1Z0AA 4S1NA 3WIEA 3ZE7A 3VHXB 4E1BA 3KQYA 3ZNPA 1JHAA 1KSFX 2VPQA 4UPEA 5JSFA 2JLWA 3SHQA 2Z5FA 5JAZA 4P3PA 1DQPA 1T3TA 3ZUGA 3SEQA 2DCUA 4MIYA 1R5NA 3KT6A 4KE6A 4GX0A 2XCLA 3T8YA 3WYGA 2VZ8A 1Y8RA 1EFKA 4FE4A 4IG4A 4RKFA 2PJDA 4BV2A 6YASA 2AOVA 1BW9B 2BFEB 1OIVA 2NUPB 3E9CA 1P72A 1JL3A 4S1WA 4UVHA 4I2NA 5E8JA 5ICSA 4I0WB 1Y4UA 3CZCA 3GNLA 1PZHA 4R0MA 3IMCA 5IJZA 3AI2A 5A02A 3UJ9A 4RSRA 1R5BA 4OYRA 3LP6A 4OU4A 4KR2A 4CEHB 3OT1B 3IBFA 1RHQA 2Y0PA 4V2IA 2DU8A 2O7SA 3HJNA 5AI6A 1P2VA 2E4XA 3TMKA 4FB4A 5JYBA 1W0CA 4RVDA 2DZDA 5HBGA 3S0JA 3OJOA 2HX1A 3HZRA 3SAJA 2WHYA 3PE3A 5AOBA 3PT9A 1GNVA 1TQ8A 3AVOA 3ZU4A 4DNPA 5F73A 4OBWA 3TCXB 1QFYA 2ES4A 2UYHA 1LRJA 2EYQA 1I3MA 4H0CA 4IXWA 1PWHA 4AKGA 2OD7A 4FHGA 2H1FA 4O33A 5F51A 2OLJA 2VHXA 1Y89A 3HXTA 1KIFA 2XNCA 1Q81D 4LXQA 4D3SA 2C03A 1ZA1A 3H1AA 3B3AA 5DT2A 2PGLA 4AN0A 3O83A 3DLBA 4YJFA 3CPJB 4CQNA 2HFJA 1Z7YA 2NU6A 1EZ4A 1GP2A 3FPCA 4U63A 4YP9A 2G72A 2GHTA 3CCMB 5BORA 5ILOA 3ZKWB 1EVEA 2O2GA 1Z6XA 1B7GO 3SNHA 2FW6A 4QTYA 3FGOA 1WD5A 5CVCA 1OFUA 2GLXA 1U7ZA 2C4NA 1VPVA 1T5TA 1X7ZA 2F1RA 4R9SA 5B4VA 4D98A 4X90A 5EE5B 5B55A 2GILA 2VQFB 1YE3A 5B6IA 1H2BA 2XMDA 1W0JA 3B48A 2XTJA 4U7FA 1IL0A 4GIBA 2FJ0A 1DT5A 3MS7A 2PRZA 3DP9A 4QPCA 2NSYA 1Z0JA 2HCRA 5EJAA 4A03A 2C77A 3ITNA 5HQ3B 5I4KA 4X85A 1BDBA 5HILA 3EDQA 4FLFA 5F1KA 4E0BA 4F4CA 4WVLA 4EA6A 2G7ZA 2G63A 2YVKA 4FX2A 1NFRA 1IN8A 4G5SA 4J6EA 4MDHA 5AKKA 5HIMA 1NT2A 2WAXA 2YJNA 2H48A 5BRJA 3PFHA 5L6LB 3K0CA 5I5GA 1ZUNA 4KP7A 4RLQA 4B71A 1PR2A 5F3WB 3CZ4A 1SUSA 4HDNB 4KW7A 4M1QA 1LPAB 2Z8XA 2IA5A 3A70A 3BK7A 4GUDA 4DNQA 5BOVA 3S1SA 5IDYA 4EQZA 1U90A 3O8DA 3L6CA 1SC9A 1HT0A 4ERXA 4O4LF 4RYDA 3IIMA 4H3SA 3MW8A 3U3OA 2DUWA 3HKDB 3KKLA 4CIBA 5HKKD 5ALFA 5TGTA 2PTHA 3DO5A 3RTAA 2AJDA 4BKPA 3L4BA 2D0PB 4CT4B 4D80A 3ET5A 4XWOA 2F64A 1XDUA 4YPFA 1PNTA 3RSQA 1I80A 1U98A 2B20A 4UBOA 2H07A 3NYRA 1R0XA 1DAPA 4N01A 1PGPA 4PR3A 4Q82A 1ESEA 4DCUA 4H6XA 3COYA 1CJCA 3MJCA 3N0VA 5EWMA 5FI3A 1CVRA 2VYVD 4D8TA 1BKDR 1I51A 2GYUA 1II9A 2I55A 4ZCSA 2WB2A 1BAPA 3AHHA 4D97A 1LI4A 1E8MA 1A5TA 1I1OA 1KVSA 3TX6A 2BI7A 3RRBA 1KDPA 4JLDA 4DNOA 2A59A 1E43A 1GFSA 5FAKA 2C54A 4FD3A 3RS5A 5KVCA 3ASQA 4CCYB 1WY7A 4FINA 4C2UA 1X77A 3THWA 2A35A 1M83A 5F12A 1U9CA 1DBIA 4Y9RA 1ZGCA 1CP2A 3MRVA 5DP1A 2WYRA 2B82A 2C88A 4OLFA 2HRZA 2QD2A 1H9AA 3TZCA 1ZD9A 2YJ5A 1EXNA 3S6JA 3T5AA 2BGTA 2C2OA 1HA3A 2VEDA 2VTBA 2RAVA 4MR7A 1KSJA 3KL4A 3ZXSA 1LJUA 4DJJA 2XMBA 2WKWA 5CVDA 1OIWA 1P3Y1 3KIPA 4DMHA 1FRVA 2B0JA 1DX6A 2B78A 4IO0A 2ENUA 1F4LA 3HO6A 4JB0A 4MICA 3HA2A 3IVCA 4QOHA 4BLPA 4Z49A 1JFTA 1SBCA 1T5IA 3C6KA 3O4FA 2ZS9A 3OLYA 3JU3A 4Q93A 5KNBH 4OB6A 4I9NA 1PT5A 2P6OA 1Z4NA 5K8IA 4L57A 1PT8A 2EQBA 4JCOA 3KLBA 4ROSA 5ANRB 4EGJA 2GD0A 3BDVA 3F49S 1MO2A 1VSUA 4OTZA 5KCZA 1LW6E 2RKBA 2B3DA 3B53X 2K2WA 4I5GA 2C31A 2QEQA 1IIBA 3ELWA 2IZ6A 3C24A 4HB3A 4MRPA 4DC1A 3R0JA 1XHEA 2W71A 3GVKA 1E96A 1H8HD 2DPLA 4C4ZA 3GRZA 4NABA 1T3ZA 1XZJA 3S28A 1IXYA 1N7GA 1IJFA 4RD4A 5HDBB 2WT4A 5CNJA 4EJSC 1NR7A 3Q9NA 4KGVA 1EVIA 4HR7A 4E2WA 3SEZA 1J06A 4AK9A 1FVXA 4FX5A 4INPA 4IHJB 3ZWNA 1ZXBA 4YJ2B 1UKCA 2XADA 2XUPA 4DIDA 4E6PA 4HQRA 3WWCA 4CDRA 1QP4A 1BQ3A 3MWJA 4IEIA 5JJIA 1BS2A 1D3AA 5GZ3A 5BQ5A 5B6PA 3WGIA 1USIA 4DV6B 3LX8A 2VQDA 3L0IB 3GAFA 4JLKA 2ZUSA 3AUYA 3LX4A 4KYTA 4QULA 4CFSA 1IHMA 4FMBB 3ONEA 1VGRA 1BS1A 1VYTA 5TQ2B 3CO5A 3NAQA 2R4QA 3BBPA 4IX9A 3V6MA 4A0RA 4B79A 4C5BA 2IH5A 1CF4A 2SBTA 3CZRA 3EHDA 3M6AA 3ECCA 2J3KA 3QG5A 4CKWB 5J1TB 1GTJ1 5I7VA 1RRVA 3DJYA 4DXDA 1CG6A 3RYCA 4GOLD 3VU8A 3SFTA 4OHWA 3E8XA 4CUKA 1HMPA 1ZD1A 2VBCA 2WF5A 1YCFA 1C3VA 5FNZA 2NN3C 2XD4A 2PUFA 1C4XA 2HHCA 4JVNA 4G8DA 4P84A 3JX9A 1T6YA 3O0TA 4L08A 4Q4HA 2RHDA 2X8BA 3D54D 3O3NB 3G0BA 4HO1X 4K9MA 2V3VA 4OMFG 4BNJA 4CMEA 1J09A 3EB9A 5BSHA 4G1EB 1M76A 3P27A 1Z2PX 3EUWA 2AIRA 4MS3A 4MVJD 4BV3A 3FDXA 3VC1A 3L82B 1DAMA 2G36A 3GEPA 1NMSA 3KQHA 4RCVA 3WRXC 1F38A 5BSMA 4EQ6B 2XEXA 1BVRA 1X2EA 4N0PA 2HV9A 5CB6A 3A2LA 4X8LA 3BZWA 1EXWA 3G59A 2C5GA 4N7JA 4R41A 1JB9A 4EA8A 2IP4A 1AC5A 3REGA 1DHRA 2NW6A 1MQ9A 4Q03A 3ZX5A 2R6R1 3R3WA 1EFLA 1R16A 5F64A 2C3PA 2HK6A 4JUAA 4A0GA 5LOVF 5HXBA 4WLOA 1MW8X 3RQIA 3HWRA 3PCRB 1HLDA 5ALMA 3SQNA 2JHGA 2WIBA 3NOXA 4ZO6A 5HJ7A 1J25A 3VKHA 4G81A 3FOFC 3PBKA 3KE9A 5IVKA 5JSQA 1UWLA 4X6LA 1UKAA 3AUAA 4TXHA 4OHYA 2GBGA 4UOEA 1WS6A 3HYNA 1SZJG 1ORVA 1DINA 3OEYA 3TOXA 3LDGA 1P5HA 4JD5A 4C0QC 1VBKA 2JANA 4GW3A 2FPPA 1Q6ZA 3D8RA 4P3NA 1V48A 4ZQGA 4NFLA 5JDCA 2Q4TA 1WMDA 5ES4B 2ZI3A 3LQQA 2QZSA 3QNWA 3T99A 3UYKA 3WHLA 4CLDA 4YMUA 4A8JB 4PAOA 2PS9A 1USWA 3HBMA 3AHDA 3OOWA 2BVNA 1WEHA 1YK1A 2FFBA 4FQ5A 4MEBA 3GUHA 3I6YA 4ZGQB 5LIPA 3QIVA 1LX7A 2K4MA 1JQJC 2IZ7A 2BKAA 3G0OA 4UKDA 2H5JA 2OMKA 3IDSA 2OSBA 3WGYA 5J2UF 4LRTB 2WP0A 3TIXB 2FPWA 3KHKA 4YK7A 5AM1A 2FPIA 1JA0A 4AJ4A 5KYVA 4C5AA 2C4WA 1Z33A 4XQCA 1RRGA 1Z8FA 1XXHA 4L7QA 1O7JA 3PIIA 1AK2A 4JIGA 1FNMA 1PK7A 3SJBA 4EPRA 1GZ6A 4EYGA 3I56B 4YT4A 2QD4A 2D00A 2HGSA 4W7IA 1NZFA 2E1RA 1JFSA 1IG3A 1RQNA 1R4NB 3EOZA 3M1AA 1JAYA 4FDUA 4MW6A 4PG6A 3A6PC 2HF7A 3JQAA 4B09A 1ZI6A 1GUYA 3M1LA 4BZPA 1O5TA 1SHUX 2JVJA 2PX5A 3WBJA 1MB4A 4ZDKA 2VYQA 2DC1A 2Q50A 3OM0A 5CA0A 3P5SA 4K9KA 4S05A 5CB4B 1YDWA 2WUGA 4C76A 1QVGB 2JFZA 4G84A 4BNXA 3N3AC 5IU6A 1OPXA 1J8YF 4B3RB 5C8ZA 1PDWA 4GI7A 1K7EB 3NHBA 1K4YA 3V32A 3ZCQA 3BT7A 4M9UA 4WT7A 3RWMB 3C8HA 1KFBB 1EX1A 4EO4A 3TF5A 3QU7A 5I4CA 1RBQA 3LHDA 3BGIA 4FZRA 4YWHA 4JP5A 2Q6VA 2VNIA 1T6ZA 4I5DA 3WDKA 2H0RA 2O8CB 1N2JA 1QYRA 3RRNA 4G5HA 3D43A 4Y6PA 3AMVA 1LXCA 2XKAA 3HEMA 4PRYA 1H0KA 5DYWA 1Z7WA 1MVLA 4W8HA 4HSEA 3TTTA 1ECPA 1JS1X 1SRRA 2NWQA 3PQFA 4M54A 4AS2A 1BXGA 2XCUA 4DIUA 3N0RA 3PQ2A 5CVVA 1Z56C 3F7MA 4WFQA 3E22A 1F8YA 1V9SA 1GNLA 1M54A 3GJ5A 3E23A 4P93A 4FBMA 5AM0A 1L8OA 1UPCA 3TNLA 1KZHA 3VHQA 5DNUA 3MGCA 3BE6A 3AQIA 1C41A 4EZIA 4Z53A 1QHSA 1OJLA 1NYQA 1V5GA 2WYIA 2FN4A 2Z6UA 2XZTA 1C7FA 3GOHA 1MT0A 4XR6A 4Y67A 2B94A 5DASA 1SIUA 2VA8A 4IIHA 1I7DA 1HOTA 4PVDA 1N1GA 4JLAA 3ZHQA 3S81A 1KJZA 1XVUA 4C7MA 1IZ7A 1EVQA 5CCXA 4ALIA 4F3TA 1NXPA 3HKDA 2JGFA 3BREA 3LT4A 1XNHA 2IZOA 3NMUF 1MVNA 2LZ0A 3ANSA 4D44A 1C1YA 3MTGA 5EKXA 1A1SA 2XRFA 2P9QA 5ITZA 3AF5A 3FFBA 4DDHA 2FCRA 2HPAA 1RQ7A 3QBJA 1G5HA 1R6VA 1YLOA 2FPGB 3FOCA 4BMDA 2G8NA 2NP7A 4RVOA 2ZR7A 2PHZA 4OP7A 2IGBA 2VIIA 4BQFA 1X38A 3N2YA 3A2KA 3IVRA 3LBHA 4HUTA 4AAYA 4X20B 3P1JA 4MIOA 2J6HA 3PGXA 3CRRA 4X65B 3A4LA 1T5OA 1MCZA 1V16A 1BMFA 4U2EA 1RYHA 4R7GA 5JEDA 3N39C 3QEOA 2EFEB 3I37X 4KX5A 1XN1A 5AK6A 4I6JA 5EGSA 4UDNA 4BFLA 2W2VA 3NBXX 3T7TA 2WWGA 2XNKA 4HN4B 4ETWA 3V97A 4G36A 1QPBA 3EZ6A 2JAXA 5KQMA 4TTPA 2D3NA 4TS4A 4C4TA 1A9RA 3ER6A 4HH3C 3KYBA 2JEZA 3C7AA 5CGZA 2P5UA 3GA7A 5HZAA 4MKRA 4O4LA 2HWUA 3HNRA 2DJIA 4TVOA 1TO1E 2JIPA 3WC4A 3NANA 2ZBGA 3ORQA 4KQFA 1MQAA 1VMIA 1KETA 3I3OA 1FDTA 4LE0A 3UC9A 5IS2A 1W88B 1ISSA 4AECA 1EK6A 1XYYA 3PTAA 3HCAA 4MUKA 3HPRA 5BV8A 2NP6A 1CLUA 2E4AA 3EQ7A 1NJID 3MCWA 3OTWA 1X1RA 5K8CA 1I36A 4CF7A 3JWPA 3PZBA 4GBGA 1VL5A 3A4MA 5IKPA 4AIRA 3H9GA 3FZNA 4CV1A 2VTBB 1U5BA 2GZSA 3Q10A 4L27A 3EG9A 5LD2B 2GZDA 1RQGA 2PT7A 2YHSA 4HQLA 4N3BA 1PS0A 3NV7A 2OHFA 5JBQA 4G01B 4NHEA 5DHTA 1RLIA 4Q12A 3VKFA 3RJMA 2E3JA 1VSVA 3R4CA 3PWZA 5E2BA 3HJHA 4S1PA 3AHCA 4DDKA 5KTRA 3BOSA 3U5ZB 2HRBA 4ACBA 1TK9A 2VATA 3IERA 1NR5A 2WE7A 4X07A 2PUHA 1X19A 3DLCA 3PPWA 4R2IA 5JD3A 5JTTA 5K3BA 2V6FA 1U8FO 5BVHA 1A77A 1QP7A 4XORA 2D1QA 1F0YA 4LNHA 3JQPA 1YRAA 1RWXA 2EHJA 5CT6A 1Z0IA 2M2IA 1D7AA 2CN1A 2I7CA 1S8FA 4NECA 4Z1MA 2WFLA 4QWWA 3BWMA 2W6JD 5DN9A 3T7DA 3GZNA 3T7AA 1C1DB 3RBXA 1D2NA 1N6LA 1O9HA 1YV9A 3B9RA 4TLAA 2WD9A 1I5RA 3K0BA 4R5HA 2BIFA 4UTRA 5KYUB 1WLYA 3OOSA 1MIOB 1O54A 1QQ6A 3I32A 1H8EA 1DXOA 2AG8A 3IMKA 3LGXA 3ASPA 1FFAA 5CFZA 1TYCA 2I6QA 4G9GA 1XMQB 4C88A 1NU8A 4ZCPA 5GAJA 1I2ZA 3E05A 1M1NB 4PSCA 5A4AA 3D02A 4ZCTA 1FVOA 4HX5A 4YJ2A 2PJRA 1QMPA 4P08A 3E3NA 3UCFA 1FFYA 5L3QB 1T3LA 5LA6B 4B9EA 4EUSA 1G8AA 1VQ5B 1JEEA 3FETA 3MRSA 4C08A 2JEOA 3PNSA 1QYXA 1Q9SA 3C3CA 4GMHA 2FSVC 3KQMA 2KVOA 2G40A 4NK5A 4DSNA 4X1OA 1QVZA 1FSPA 3G2JA 1D6NA 1GYPA 1SIBE 5AM3A 3M5PA 3EISA 3OMXA 4FOSA 3RVOA 1PQYA 3HDJA 4QO8A 4G4IA 1YDMA 3HN2A 3IP3A 3OEHD 3R3HA 4NNOA 2I7TA 3GI1A 3IP8A 1XAIA 4C0AC 4DA4A 1H0HA 2CLIB 3CT6A 3BRCA 4DLNA 3ZDRA 1Z5VA 3W6NA 4KO4S 1C9DB 1AUOA 5AK5A 4CDNA 2O1SA 2F1LA 3KVYA 2IPNA 1ZFNA 4ZRDA 4ZVKA 1CRWG 1UFVA 4MW7A 4RTLA 4BO5A 4S04A 3WLLA 1KWGA 1HYHA 1U0LA 4NCKA 2ZAGA 3VM6A 1Y3HA 1QIKA 2Q4OA 2O3RA 3VPFA 2VDJA 5A89A 4EABA 4UM9B 4U2FA 1VG1A 2B7CA 1AK1A 3I55B 3F1KA 4ZO8A 4JB3A 5DS0A 1L4BA 1Z17A 3I28A 1GPJA 1E3SA 3HY4A 4Z1OA 1J23A 1PTJC 1VHJA 4XLHA 2A84A 4MB6A 3S44A 3B6JA 4M21A 3D1VA 3VC3A 4DPMA 5CDTA 2ZWAA 3NIFB 4UOZA 4POAA 1S2DA 2G9ZA 4NOKA 2Z09A 3UO8B 5BSWA 3FTEA 2LP4Y 4RD6A 3EQ8A 1RABA 4JL5A 4RGVA 5ECYA 1E3WB 3DVAB 3JYNA 3EWIA 2AXEA 2VK1A 1KAEA 2Z4SA 3R7WB 1NVKA 1B2RA 4RWEA 1TTTA 3ACCA 1XQYA 3WZLA 2HU8A 4IMPA 1PJTA 2ZZEA 4C3VA 2A0XA 4RQBA 3UMCA 1GZSA 4ZVQA 1W1IA 1SJ9A 3DL4A 1Z68A 3LHFA 4NNPA 4EIWA 4MI3A 1EX9A 3PEFA 4ZQHA 1A98A 1PS8A 2IZZA 3GFSA 3HLYA 4G37A 4JKYA 4NTZA 4UBIA 5ALZA 3RSLA 4DBLC 5F2KA 1E5QA 1E79A 2ZBQA 3IVXA 1NI3A 5LDGA 3RJ5A 3WMRA 3AH8A 4WW0A 3GLVA 3IHWA 3D6FA 3B6IA 2IHJA 2EV9A 2R1TA 3AHFA 7ADHA 4ZT2A 1DUSA 2H1CA 2ORVA 4ZANA 4P4SB 1YS9A 3UJNA 1BX1A 2B83A 2EDAA 3SOZA 2ZUVA 2MR6A 1ITZA 1TMOA 2VT2A 3Q41A 1DAIA 4HUQA 5IJAA