4QHYA

The structure of aif2gamma subunit h20f/d152a from archaeon sulfolobus solfataricus complexed with gdpcp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
414
structure length
414
Chain Sequence
b'AWPKVQPEVNIGVVGHVDFGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVAVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title Binding mRNA on the archaeal translation initiation factor 2 gamma-subunit
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 97
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qhyA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4qhyA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qhyA01
1U8ZA 5C2JB 4B34A 2BGJA 2FFAA 4V0LA 1HT1E 5D3QA 3QOFA 1ZAKA 4G5OA 2BDTA 3W6PA 3L8YA 2WMNB 3Q72A 5SZJA 3ZVLA 2Q9AA 4B4DA 1E2HA 5AR1A 4DB4A 5E4FA 4JIMA 2GJAA 5JMTA 2R6DA 2ZVQX 3PVSA 2CL7X 2NIPA 2WWFA 4A1FA 2O8FA 1AQYA 3CCJB 3EARA 1JPJA 2GCOB 2ZRNA 3CIOA 3OFND 2FF7A 5DNYB 4PC3A 3AUYA 1E9AA 4M1YA 1D9XA 4DEYA 1G3RA 4GBMA 2ECKA 3Q9LA 3BGWA 3AF0A 4W7SA 5B2ZA 3VR5A 1LS6A 2YC2C 4NCJA 2CJWB 1G3UA 3IBGA 5DLQC 2A5JA 4D4KA 1AGPA 2J7PD 4PSKA 1YE8A 4PHHA 1ZC3A 4RZ3A 1W4AA 4TWZA 5JSZA 4GRAA 3OE7A 2IS4A 1UM8A 2ZJYA 3PCRB 1F3OA 3WNDA 2VP4A 1HH4A 3OZVA 1TEVA 2XITA 2PLFA 3BWDD 3GQBA 4U5XA 4A2PA 2GXQA 2IYTA 3TK1A 3GJ6A 3JQPA 5G41A 2GZHA 5AUNB 1UDXA 3WRXC 3GJ8A 1RYHA 2FZLA 5ANRB 5CJ2A 4UXJA 3SHWA 1IXSB 3K70D 3AKCA 4Q9KA 4AF7A 1AMOA 3NH9A 2J0SA 4F7WA 2D4HA 3CX8A 1IJEA 3QKSB 5DYGA 3WYGA 5KNCA 1Q3HA 3REFA 2ZRLA 2O8DB 2ANCA 2OESA 3U61B 1U0JA 3SS8A 3OZWA 1N25A 2IW3A 2OEPA 1T5LA 3EPJA 4Q1BA 4CEHA 5FOSA 1U0HC 1VG9B 3D31A 2GZAA 4BGDA 4GMDA 4HUTA 4UNPA 3P20A 1NF3A 2CNDA 3TAHA 4BZQA 1NMZA 1TF2A 3ZD6A 1FNMA 3A1WA 3B1VA 5DI3A 2R6FA 1JJVA 2Z83A 3IIJA 2NZJA 1NG1A 8OHMA 1N6RA 3KJIA 1DEKA 3R7WA 3I92A 3SI7A 3RSLA 5FH9A 4LJAA 5HZHA 1BKDR 2BCJQ 1SGWA 1N6LA 1NKTA 2RGNA 1PUIA 2BJWA 2ZUCA 4IFEA 2JIZA 4ZKEA 2OCYC 2ZYVX 4CEIB 2DFLA 2B7BA 4M9SA 4QRHA 4GDFA 1E1QD 1MV5A 4RJLA 2QGZA 3R8FA 4PXAA 2B5OA 2QU8A 3LO8A 2RKOA 5TVKA 2YWGA 3TE6A 2AR7A 2Q9CA 4NYIR 4Q1DA 4KBFA 2QQ0A 1XRJA 3MJHA 1LB1B 1ZU4A 4OI0A 2XB2A 1W35A 2VP5A 2ZAOA 1N6KA 2FDCA 1XZQA 1Z29A 2B6HA 3LX8A 4DSNA 3HU2A 1WA5A 3VX3A 4C30A 3P1JA 3WNCA 4DSOA 1HTWA 1KI6A 1R2QA 4PZZA 3TW4A 1RVDA 3CMAB 1Y3AA 3NWJA 5FTNA 3VX4A 2RGEA 3LVQE 2W2TA 4QJ3A 2AFHE 4GT1A 4FK8A 3THXB 5FI1B 1QVGB 3E1YE 2I1VB 4X8LA 5J5CA 4ZI2A 2CNWA 3RSOA 2RGAA 2JLZA 2BM0A 2W6IA 2Z5FA 1EX6A 1JB1A 4D4JA 3MFYA 2IS2A 1TQ4A 1NSTA 3OEHD 1UKEA 2AD5A 4NHOA 3EPKA 2RCNA 2GETA 2C03A 4Y7CA 4M1TA 3GLIB 3QKTA 5K8IA 3QXSA 2QAGC 1SVKA 1DDIA 1Z2CA 1YR8A 4C0BA 4TQAA 3UPUA 2IWRA 3ZS9A 1ZVQA 3GJ3A 4B6FA 1E2FA 2Q3FA 2REOA 4JVNA 2QTZA 1AS2A 2QMOA 1E2MA 2NQ2C 5DN6A 5LB2A 2IC5A 3I61A 2EWWA 4ESHA 2HDNB 1NY6A 5EP4A 4LBZA 1HEIA 5EXTA 3V4FA 4C2UA 1IY2A 1U0LA 2BBSA 4XWKA 3IIMA 1SQ5A 4JBYA 4QFMA 4UJ5A 3KDSE 1L2TA 2D2FA 5JJKA 1Z3IX 2IXFA 1GNQA 4DRZA 2MMGA 5KSOA 3CF2A 1F48A 3IEUA 1V5WA 5HPYB 3UKDA 2QA5A 1WB9A 1CIPA 3EIQA 1XZPA 2YV5A 3K0AB 1XJ0A 1FNDA 3C5HA 4JYBA 4NYJQ 1WDTA 4YAWA 3GJ4A 4YMSA 3RS5A 4BQSA 3AH8A 4QHTA 4XWOA 4TSFA 1G9XA 4BLRA 2Z43A 3OIVA 1FX0A 1KMQA 2K5UA 2R44A 3CZPA 3FKQA 2ZJ5A 1XPOA 1PUJA 2HLDD 4KFTA 1VQ7B 1Q3TA 2NTYC 3PUZA 4URZR 2D74A 3K09C 5K8LA 4FINA 2V7QD 2J45A 1NN1A 1EFHA 4NCIA 2P3SA 4Q4JB 4D6PA 1JNYA 2PCLA 4GSYA 4JT2A 2XXAB 2IA5A 3OHMA 2DFKB 2WSSA 4W5HA 3N5CA 1G21E 1XMSA 3OESA 5TMPA 4OJKA 1NMYA 2VP0A 3GFTA 4XSGA 2XB4A 2PT7A 4RD3A 1NVVR 3PG5A 2O52A 1E99A 4LYFA 2Y8EA 4DCSA 5IRCD 4HZIA 1IXZA 2Q3MA 3IHWA 1GTVA 4FCWA 2FA9A 3VO1A 1OE0A 4Q1CA 3R20A 1S96A 3ZIAA 3LAWA 4TN1A 1U9IC 4R7ZA 5KOYA 3LH5A 3THWA 3M0EA 2QPOA 5LD2C 2J0UA 4PO9A 4YMVA 1E79D 1NIJA 2ZU0C 3NKVA 4AG5A 3W2FA 1KNQA 4LJ5A 2AHOA 4NKRA 1XWIA 4B74A 1Z6AA 4HLDA 1XTQA 1KKLA 2FU5C 4TT3A 4LV5B 4XIGS 4BLSA 2HMAA 1UADA 2WAXA 1VG0B 4N1AA 4C43A 1DAKA 1MRNA 1TL7C 1YZKA 3EXAA 5CIQA 1I7PA 1XJQA 3ND9A 4I1UA 4DDTA 4ZKDA 2WWIA 5FPYA 4Z8XA 2KWIA 1TNDA 3GLHE 4D2IA 1MABA 3OW2B 1OFUX 1OJLA 3LVBA 4FIDA 3A8TA 1GRRA 5KSWB 1QVAA 3CNLA 1NRJB 1O3YA 1YZQA 1NMXA 1N2CE 3P4XA 1E6CA 1AA9A 1T0HB 4JLVA 5J40A 4C0JA 1WBDA 4OQMA 2V3CC 1ZM3A 1LFDB 3AVXA 2IUTA 1ZBDA 3B7GA 1KQSB 1KZ7B 2QORA 3O8RA 1HE8B 3PFIA 1GKUB 3TQFA 1W49A 3M1IA 1BJKA 3BH0A 3K0CA 3PR1A 2W2VA 4PZYA 1JB9A 1PV4A 2DY1A 1W48A 1ZD1A 2OAQ1 1D5CA 1ZP6A 4JBWA 1VCIA 1AZSC 1UF9A 1OH6A 2ZYTX 5KPJA 3OJWA 2WVJA 4U02A 1JAHA 5JFGA 1W44A 2EW1A 3AP3A 1XMVA 2CXXA 1P9WA 2BVNA 2JJ2A 5FL7A 1GKYA 2D7CA 2P2LA 3E70C 3K9LA 4AYTA 1SKYE 2ZSDA 1XEFA 3CF6R 1G20E 3P26A 3VAAA 4G01B 2XSZD 4F4IA 1ELOA 2W6JD 2H7VA 2YOGA 1K5GA 1QFYA 4EUNA 3A4LA 4OQLA 1BO6A 3PEYA 1YR9A 1CTQA 3CC7B 4FN5A 1RPZA 4ZCIA 3KKPA 4CRWB 5JCZA 1YRBA 1OSNA 2QMEA 4YMWA 1KI4A 4HAXA 4C0QC 1IQPA 3MWKA 3ZLJA 4F4JA 1Z22A 3VU9A 4LJYA 3U3KA 5EMNA 1XEWY 3AP1A 4ZDIA 3I1FA 5EXPA 1DELA 3CZQA 1VHLA 3NHBA 3NEYA 1HURA 3CD6B 2XOKA 2WPDA 3L0SA 1ZRHA 2IEYA 5EZ5A 1T6NA 3T5GA 2N1BA 1QHGA 4PAMA 3WNBA 2O8DA 4Q4HB 5EXXA 3I5XA 2A30A 4MDFA 2ZRBA 3B5JA 4EPRA 4M9XA 1US8A 2W58A 2DEUA 1H42A 3CRVA 1E1RA 4OBEA 3QF7A 5HCNA 2HXYA 3T35A 1N3BA 1EFTA 4C7OB 2VLIA 4FWTA 1VQLB 3EAQA 5FPHA 5C4GB 1SXJA 4RD0A 2EQBA 1EXMA 2NGRA 3KQUA 1FQJA 2F3RA 4JLJA 1W36D 3PUWA 4TL9A 4YAUA 3A1SA 1U8YA 1JECA 3IQXA 3AKDA 3PQCA 1VCOA 1QHHA 1T0JB 3GEIA 3MG9A 4CDGA 5H68A 4HI0E 2P0EA 1DAMA 3K9HA 4KU4A 5KNDA 1IOZA 3FMIA 5F3WB 4I1OA 1EG7A 3QBTA 2GBLA 2ZI4A 3QPVA 2DHRA 3TSZA 4R71A 3RS0A 4PC6A 2QEQA 2QL6A 2QAGB 4PHTA 3AP2A 4WAUA 4IOJA 1N8RD 2OLJA 3FKSA 4B2LA 3U7FB 1JI0A 1TEXA 2QRNA 1LS1A 3FYHA 3KXKA 5SZHB 5LPNA 4PZLA 4LJ7A 2B8TA 4GNKA 1EP1B 5J4HA 2VHTA 4BPBA 2XTNA 2ZRFA 2REBA 2RC6A 2OZEA 4HSEA 1QDEA 4RSGA 1AS0A 4ZDKA 2IYUA 4IVPA 4CVNA 4M22A 2ZJBA 2BPOA 3A1VA 5FFMA 1JQJC 3FHTA 1T5IA 1YZTA 3TH5A 3TR0A 2BSAA 1IN6A 4G0NA 3SE0A 1GNPA 3SC3A 1G7TA 4B3CA 2ZE7A 3VKHA 2CL6X 4Q21A 3IPXA 3THXA 3DM9B 3CNOA 4ZO4A 2YYZA 1YIJB 1WQ1R 3RAPR 3QXJA 3AGPA 3VO2A 1DO2A 1I4TD 3R9IA 2X8AA 2QGNA 2J0VA 4IVQA 1CNEA 1XU4A 1VHTA 5FA6A 1PLJA 2CCKA 3GJ7A 1NG9A 1E2GA 3O8CA 3LBHA 1L4YA 1VQ8B 4S35A 3UMSA 4KAXA 3GLIA 1MR3F 4EFMA 1UEJA 3CPEA 2ZJAA 1U90A 5FOWA 4DB2A 4TMZA 1X8JA 1G5RA 3MJRA 4BFZA 2PL3A 2WWXA 2PZFA 3KTAA 4U9UA 1B0UA 2JASA 3B13B 4P6VF 1FRNA 1OKKA 1XP8A 2OCAA 2QPTA 2CLDX 4O2LA 4Q9JA 1GRNA 2XZLA 1PZNA 2FJUA 2I3BA 2OM2A 2J9RA 1A82A 4URYR 2ZRCA 3RS3A 3CC4B 2QP9X 1KAGA 1OXVA 4HB0A 5AUOB 2VL7A 4P3YA 1J8YF 3CCQB 1E9BA 2F1IA 2C9OA 1T91A 1NJID 2W83A 5LD2B 1NVWQ 5KDOA 2DWPA 4CGZA 1VQOB 5CLLA 1H8ED 1XFAA 1T8UA 3U7GA 1GNRA 2TMKA 1RE0A 3LW8A 4FMBB 2EVWX 2HCBA 2ZYWX 3H84A 1IN5A 3KUDA 2FSFA 4GI7A 4US0R 1KSJA 2GJ8A 3CBQA 3T61A 2ZI3A 2OSBA 1DAEA 1G8YA 1M6NA 1TPZA 2IYSA 2VRWA 3BIFA 3RABA 2JLWA 1SZPA 4WVFA 3EZ9A 4LRWA 1VECA 3W5VA 4NU0A 1G8PA 1O87A 3RS4A 1D2EA 3KX2A 1SULA 2FFQA 1L8QA 1GAWA 4Q4JA 3UIEA 4JVMA 5CK4A 2XXAA 3AV0B 2GF0A 4D4LA 5IK2D 4RY2A 4DLWA 3OZUA 1U94A 1CR2A 1TU4A 3IIKA 3QI2A 4MRVA 3UWKA 3VR6A 3SYKA 1AIPA 5GJBA 4EH1A 4A0GA 3QIAA 1Q7YD 2JIZD 1E2PA 3B9PA 4JSYA 3WBKA 1G5PA 3SHFA 1QX4A 4XTRA 4PSVA 2ZTSA 1G291 4BRWA 3QE2A 1UBFA 1FZQA 5KSZA 1X1SA 4OI2A 3MCAA 1GUAA 3KJGA 521PA 4BLOA 5BWMA 1RYFA 2FFBA 2VF7A 2CLSA 2C9YA 1Q21A 4TZ6A 3F8TA 3HPRA 4JSTA 3U2QA 3AF1A 3PIRA 1PLKA 3CF0A 3SJAA 1GM5A 4XD7A 1SVSA 2H17A 4Q19A 4R98A 2PZEA 4H1VA 4D81A 3EZ6A 3E20A 3GEEA 5CLQA 2BC9A 1OIWA 4HZUB 5GVRA 1XD8A 4A9AA 4ZCMA 4M9ZA 4L16A 3SQXA 3T1OA 1H8HA 2ERYA 5TY0A 1II8B 2W6ID 3THYB 1W46A 3FHCB 4NE2A 4I99A 5JZVA 4IRUB 1S0UA 1W2HA 5HE9A 4FMDB 4YXWA 1OYWA 3K8YA 5BYKA 3LRPA 4XH9B 3SYLA 3U44B 1GZSA 3ICEA 3B78A 3W90A 4KO8A 2PMDA 1XXHA 4DUGA 1FMJA 4Q7LA 1D1NA 4US2R 221PA 4LI0A 2YOFA 3RHFA 3KXIA 1N5IA 3T1VA 2OCPA 1JEEA 1GIAA 3U3MA 1E3MA 2CHQA 2X19A 4XJXA 3T1QA 1ESNA 2DCUA 2REXB 5G40A 3A37A 4OHVA 1IY0A 3DOEA 2BM1A 4PC1A 3CCSB 4URVR 4LV6A 4A2QA 1KK1A 1FW6A 5CYOA 4B76A 4LYAA 1KGDA 1CJTC 1QG4A 1T4GA 2IYQA 3BXZA 4QHYA 1ZUHA 3AVOA 2X3UA 2JJ8A 1LV7A 2UKDA 2ZVPX 1ZIPA 2OO7A 3RRMA 3SFZA 1OFTA 5TARA 4WIAA 4M9QA 1ZNYA 1VKJA 2JLQA 1KI8A 3W5IA 2CHVA 1G41A 1XPUA 1AN0A 2V4ZA 4DCNA 2LKCA 4N0EA 4BPRA 1BS1A 1CEEA 2O0KA 1Q1QA 1R8QA 2GZDA 3B60A 4KVAA 1IBRA 3VNVA 4LHZA 4P0TA 1CLUA 4BRUA 4BLQA 1YHNA 1IJFA 2XNDA 3A58B 5A4JA 1JEDA 5CITA 2WSSD 4LYJA 4P4UA 3OAAA 3I8SA 4LK2A 1XEXB 1R6BX 4Q4HA 2A5YB 1XCPA 2ZPTX 3CR8A 1GL9B 4LY6A 3NC1C 4B3DA 2OBLA 3D3QA 5DI9A 4GL2A 4BFUA 1UBCA 1AM4D 2ZROA 3ECCA 2PJZA 4QNRA 4K1XA 5THXA 2AN9A 1GL6A 4BECA 2PIAA 3I8XA 4A2WA 1Q44A 1UJ2A 1L7VC 1W0KD 3ZIAD 4B3FX 4YHBA 5IDVA 3QKRB 4M1KA 4JLPA 3JQQA 2OBMA 2MMCA 4XOIA 1S72B 4JLDA 2P65A 3MRSA 2QAGA 5CDFA 3UWOA 1EWRA 3AF4A 2IHBA 3BD9A 2H8KA 4KODA 3CNNA 5KUTA 2G0TA 4RKEA 2HXSA 4BE7B 4MGKR 2PEZA 4DXAA 2VBCA 2VPPA 1Z6YA 3U6KA 3ADDA 4WOPA 4FMDF 2VNJA 3THOA 1LNZA 2VHCA 3TVDA 2FPMA 2ZITA 1VDZA 2DPXA 4P32A 5H8WA 2ORVA 2V6IA 1Z08A 2CK3D 4HAVA 2H18A 1OH5A 1KJWA 1FNNA 1N5LA 3ASYA 2F43B 1BOFA 2F3TA 2WKPA 3S1AB 2VH5R 1G7SA 2O5VA 4PHGA 4XVRA 3OIYA 5CYPA 5E95A 5BW8A 2YWFA 1JA1A 3EWSA 3ND8A 4LDJA 2G0NA 5EP2A 2F1RA 2VZLA 3KZ1E 3U3OA 4E09A 3N70A 2WICA 5H1YA 3Q3JB 4LX0A 3M4YA 4Q00A 4XWAA 3PXGA 3VHLB 3LD9A 3CRZA 1E62A 1X3SA 2RH5A 4TYWA 2JJ2D 3I72A 3K09A 5FL7D 3VR4A 1FOEB 3DPUA 4TL8A 3I4LA 4MRSA 5FOXA 1F2UB 2QI9C 3QEOA 4AD8A 2C77A 4DSTA 1U8AA 2ZE5A 2YVUA 4H9GA 1EFRD 5F2EA 1YR6A 1NI3A 2OHFA 2QAJA 5BN5A 1TUEA 1G4AE 3BB3A 3EIEA 3T15A 5J47A 3NXSA 2IWHA 4PPNA 5KO2A 3CCUB 4A36A 5LB4A 1Z0KA 4MGYR 3K0FB 1CKEA 121PA 1VQNB 1VYTA 2OXCA 1G8GA 4R2HA 1E2KA 1FL9A 3CCRB 3LWNA 4KFUA 3K70B 1D2NA 4QKQA 4RCYA 1WXQA 2ANBA 1E2LA 5FBLB 1XD2B 4Z1MA 1EWQA 2V1XA 3TGPA 1KY2A 2XOKD 2ZJOA 4O0MA 1KYIA 4QJ5A 1CJKC 3CM0A 3QXHA 4ARZB 2IL1A 3KB1A 1KIMA 2GCNA 1K73D 4DKXA 3N2IA 4EJSC 4MYCA 2BWJA 2ZI5A 1HT2E 4DDUA 3AVVA 1QVFB 1Z0AA 2W2XA 1VYUA 2ZM5A 1RRPA 2F1JA 1E1RD 1Q12A 3DKVA 1FUKA 4BZXA 2FMXA 1G8HA 3EG5A 2DFNA 2NPFA 4HEJA 1SXJD 1U98A 1FNCA 3UANA 2D7DA 1JR6A 4ERNA 4EAQA 4DEXA 3AB3A 3RVBA 1KO8A 2GILA 1DPFA 3G6EB 3NH6A 2HJGA 2UZ3A 3CPJB 2QY9A 621PA 1FRQA 3WY9A 1GFIA 3AM1A 5JS8A 5JHGB 3GMTA 4DVGA 4H1UA 1WF3A 1YJ5A 3C16C 3FKSD 3IHLA 4D80A 4DDWA 1JAIA 4JS0A 1DVRA 4Z51A 1G7RA 2YWEA 1U99A 2IYLD 3RWOA 1F60A 2DBYA 3K0SA 4TMWA 4Y9RA 1KRHA 4DIDA 4LJ6A 1P2UA 4G5SA 2JAQA 3N2EA 4UXHA 1W5SA 3GCGA 4IXMA 1UKVY 2GKSA 3CCMB 1NL3A 3W6NA 1M74A 1F2TA 3LNCA 2BMWA 4RCZA 1JJ7A 3GJ5A 2VP6A 1VCNA 5UKDA 3FE2A 2FH5B 2OCBA 1DG3A 2QZ4A 2WJVA 4L15A 3X2SA 4LV8B 1W36C 2C8VA 3ZVNA 3LBNA 2FPKA 2IHYA 2ODNA 2VHJA 3BRWD 1YZNA 4LYHA 4ESVA 2IBMA 1CRPA 2XEXA 4TLCA 4BWYA 3THYA 3I32A 2G3YA 4KFRA 4OI1A 4ZDJA 4OK5A 1HQCA 4EPTA 4TLEA 3T5DA 2A2ZA 4AIIA 3DDCA 4CT4B 1XTSA 5AK0A 1W4RA 1U2RA 1FP6A 1SXJE 2FZ4A 2D2EA 3RWMB 4ZI3A 4B47A 5KPDA 1TX4B 3QE0A 4EPYA 5G3ZA 1IAQA 1W7AA 3C41J 3PV0A 2QT1A 2VA8A 3NEJA 1G7CA 3W2GA 4GOXA 4BFYA 1ESMA 5SZIA 4DCUA 2VP9A 4LHXA 1Q0UA 1E98A 3HJNA 1UKYA 3IQWA 1OKKD 1NN5A 2J3EA 2N46A 1M34E 3I3SR 2PX0A 1WP9A 2WZQA 3HU1A 3CLVA 3Q8XB 4OI4A 2B92A 2A78A 3NVAA 3GFOA 4NYIQ 3OJXA 2NO0A 3GLHB 3LX5A 4LOAA 2O8BA 1YJNB 2BMDA 4B2IA 4D82A 1II0A 3ZBUA 4QL3A 5L3QA 2ZJ2A 4BFVA 4Q9IA 1Z5ZA 4HLUC 1KOFA 2V54A 2ZIAA 3SZRA 3PEUA 1G3MA 3D7MA 3QXXA 1RRGA 2QENA 3Q7QA 3QJYA 4EFLA 1QGYA 1ZMXA 1E96A 4M4SA 1DAFA 2CEAA 2WTUA 1Q1ZA 3TSOA 2CE7A 3R9WA 3SYNA 1ZCBA 5CM9C 3CCLB 3AVTA 4B75A 1XF9A 3SBEA 3WBJA 3U4QB 3T34A 1KI2A 4OHYA 2A7QA 2JA1A 4A6PA 1H85A 4TYNA 1ZIOA 3OEED 4KVGA 2PCJA 4R2IA 1KSFX 1NVXQ 3BOSA 5FTJA 3DZDA 1SKYB 3FDIA 4ZPXA 3LVRE 1E32A 1GVNB 2JLVA 3BAFA 3OIUA 4UNNA 4AG6A 5EE5B 2HCJB 4M21A 3ZYCA 2DR3A 4NP6A 4DLZA 3GLIE 2OTLB 1Z28A 3KJHA 4F92B 2C9CA 3MHPA 2PBRA 4NONA 2VHQA 4M0LA 1ONBA 1EWYA 1OH7A 5AN9A 4W5JA 1XCMA 3QKRA 2VNIA 3U5ZB 1BYUA 5CDFE 2O0HA 2IXEA 1DADA 4IDHA 4ASUA 2OG2A 3TLXA 1NN3A 3AEZA 4IHQA 3EA0A 1LTQA 1KK3A 1M8PA 1N0WA 2QNRA 4JLKA 1CNFA 1J70A 4V0NA 4C2TA 3JZMA 1K8RA 1S9DA 2OE2A 3QXCA 2DB3A 5E3HA 1PVOA 3CWZA 3W5UA 4PHFA 1IONA 1W0JA 5L3SB 4UXIA 1QGAA 2R2AA 4ZIRB 4HB4A 4LBYA 4CZ2A 3L8ZA 5H59A 2HF9A 4WW0A 421PA 2O8EB 2IXGA 2OT3B 5TV2A 1FUUA 1H8HD 1GITA 3B1XA 1HYQA 1G3QA 2RGNC 3KKMA 2XNJA 3BS4A 4IOMA 4P31A 1IN4A 1EX7A 3RDPA 5E7MA 4DLVA 5BN4A 3P27A 1VIAA 4YXWD 1CS4C 2GCOA 2F43A 2ZS8A 1P3JA 3MLEA 4B35A 1Z06A 5GVSA 1GRQA 4DUGD 4ACAA 1MKYA 5FOTA 1OB5A 5J4VA 4DLUA 4FMCB 1AGRA 1Z47A 4EJSB 1L4UA 2CJWA 1NVVQ 3BFKA 1GO2A 1NBMA 3LQRA 3MSXA 3ZS8A 5HKKA 3RLFA 5HXBA 4V0MA 1KNXA 3HR8A 4RD1A 4MKFA 1J2JA 4WZ6A 3W3ZB 4V02A 5A0FA 4MQBA 2UVQA 4Z8YA 4C0LA 3TJZA 3RYTC 2C95A 5DYIA 1CBUA 4QM6A 4IVRA 3FFBA 3D8BA 4HAUA 2NO1A 3QF4B 4A15A 4R9UC 2QP4A 5CB6A 3CRRA 4JBXA 1W34A 1CXZA 4HB3A 4MUAA 3TSWA 4B6EA 1P60A 4BEJA 1WE2A 1DO0A 4L5BA 1KK0A 1QFJA 2WAYA 3NG1A 4NTZA 5KDLA 1QHIA 1Q1BA 4HYYA 3K0FA 1P61B 1MH1A 1YZLA 4Q9LA 1B23P 1AS3A 3QKSA 2ZR9A 2GEUA 1NKSA 1I4LD 2XZPA 5FUVA 3TVTA 3CW2A 5AUPB 3P32A 5FR1A 2FEMA 2ZREA 1LW7A 3A4NA 1NLFA 2Z6VA 1M1YE 2G1KA 2J46A 3KKQA 4Q01A 1EGAA 3R9XA 2O8CB 2JLYA 2NOAA 1NIPA 1X8LA 2CMKA 1SM4A 5IF9A 1MT0A 2XNDD 4TTQA 3SNHA 1QGZA 3CC2B 3B2EA 3PEVA 4CF7A 3OAAD 2KI5A 2XTMA 2V6JA 3GEHA 1KDRA 4YDSA 5L8VA 3E2IA 3IILA 3B1ZA 5JI2E 5JI3E 1YI2B 3CUEF 3ZD7A 4WXPA 5LBIA 1W36B 2CCJA 1QF9A 2P6UA 3B85A 1XXHE 3VHXA 4YAFA 2GESA 2VQSA 2R8RA 2HUPA 4JVLA 4KJZA 1IHUA 1JQLB 4CEIA 1W2GA 2WJIA 1KI9A 5JCPA 3EZFA 4P4TA 3BC1A 5JS7A 821PA 2ZE8A 1OT3A 1Z07A 2PLRA 5EJEA 1OIVA 4KYUA 4D26A 4DZZA 1E1QA 1OYYA 4JLBA 2P67A 3B9QA 4G1VA 3LBIA 1ZM9A 4Q7KA 5FPSA 3CX7A 2R6GA 2FEOA 3IKJA 1Z6XA 3JZAA 1P2TA 1KO5A 3FPAA 2F6RA 3RRZA 3T12A 1QHSA 3AF2A 1ZD9A 2QTVB 3C8UA 2CVHA 4QXAA 2D06A 4CT5A 2JLRA 2MSEB 2ZRJA 4G5QA 2ATXA 4Q03A 1NJFA 4HDCA 2GRJA 5GJWC 3LXXA 4B3XA 2AXPA 3BORA 3FWYA 5KYKA 2PZGA 2GK6A 3QSYA 4UKDA 2ODEA 4AKHA 2RGDA 1NVUQ 3SQWA 4LJ8A 3ZQJA 1Z0IA 4KITB 1ZINA 2QTFA 5KU1A 3HP1A 1TF7A 4DCTA 3O8BA 3SOPA 3EC2A 4C3ZA 4MH0R 4RD4A 1ZCAA 3QVUA 1G4UR 1SVIA 4TQUS 2QTLA 1KD1D 3CH4B 3W8NA 4AKEA 5M04A 4DQKA 5ELXA 1ODFA 3LLMA 5FBVB 4LPSA 2F55A 3FHOA 3OE7D 3B82A 3GLGE 1JA0A 2A5DA 4X8HA 1GAQA 4DLSA 2ZI6A 5JSZB 1TADA 4NH0A 2GK7A 4Y9UA 1JXMA 1QRAA 2PH1A 4PO8A 2XX3A 3TQCA 4OK3A 5LDDC 4NMMA 3EWAA 3KJEA 3R8CA 3BH6A 1OPXA 1CR1A 3AVWA 1QG2A 1CF4A 1P2VA 1ZM2A 1RIFA 2HV8A 3EZ7A 3FMOB 4L9WA 3ZQ6A 3W8RA 4PC2A 2ZU6A 3O8DA 1YKSA 1G8FA 3K0AA 4GFDA 3V9PA 4TQ9A 4DLRA 1Y63A 4MUBA 2DETA 1ETUA 3GLHA 4OYHA 1I2DA 4LBVA 4A0RA 3TAUA 3K0CC 1BQEA 4Z1MD 4B3GA 1Z63A 4IDQA 3W9YA 2XNSA 2PMKA 4Q48A 4ZV4A 3IO5A 2XTZA 3EX7C 4M1WA 4KXFB 3X1XA 1W2BB 1K8AD 2HLDA 3W2HA 1EP3B 2C99A 1M7GA 2G1JA 2J87A 4WA7A 4Y0VA 4D0NA 2GQFA 2ZETA 3EZ2A 1R8SA 2NPIA 4DWJA 1LVGA 1P5ZB 3VR3A 4MYUA 5DI3B 2BKUA 2ZXUA 3IO3A 2ZJZA 2RHMA 1HQYE 1PLLA 1M7HA 4AKGA 1W47A 5BQ5A 4IOKA 1HE1C 5F9HA 1A5TA 3U4QA 1E2JA 3REGA 3K70C 4PGOA 1EFCA 1E64A 1S9HA 1TQDA 1WCV1 2FX3A 2KBEA 3SBDA 3BFVA 1TUIA 1ZD8A 2A5FA 3ADBA 2IK8A 4TL6A 2GXAA 2FSHA 2ODBA 1KJZA 1UKZA 1K5DA 2WIBA 1X8KA 1EP2B 1S1MA 2VEDA 3VKWA 2AWNA 4WZAE 3B6EA 3LW7A 2AKYA 3GLFB 2HYIC 5CK5A 1SVOA 2BBWA 2W0SA 1KI6B 1C1YA 1FFHA 4EQ6B 2JATA 2IF0A 4KI0A 3I5YA 1N5KA 4YDHB 3TUIC 1AKEA 4BLPA 1DDGA 3ZGXA 2CNWD 2AX4A 1OB2A 4HDQB 2QM8A 1GDDA 3A1TA 1MOZA 1SXJC 1VCMA 5FBQB 4EIWA 2OUKA 3F0TA 4TLBA 1T8TA 3KFXA 4IFBA 3JVVA 5DGXA 2C98A 3DVLA 1DG1G 2WKRA 3MUFA 4ZIRA 1CULC 1A4RA 3AVPA 3MWJA 1SKQA 4Q1AA 1E2IA 2CCGA 2OV2A 1I2MA 2L0XA 3HU3A 4MRRA 5GV8A 2QMUA 2V1UA 4PPQA 2GXUA 1R0WA 2EU8A 2H5EA 5JWOA 2O0JA 4AK9A 3OF5A 4GOJA 5FTLA 1GVHA 4JJZA 1VQ4B 2GEVA 1GL7A 5DN6D 1J99A 1N6PA 3HYTA 5JJIA 1VPLA 1QHNA 4HUQB 4A0HA 2WWYA 2KBFA 4B73A 2XNCA 1II9A 2OK7A 3KL4A 3WXMA 1GSIA 2VIIA 4Q1FA 1Z0JA 2QA4B 3DL0A 4DJTA 4OHZA 1GP2A 2GTPA 5D3MB 4NYMR 2QBYB 2WWGA 2GEDA 2JJ1A 3UG7A 2XSZA 2GAOA 1TU3A 1V43A 5G3YA 2GWHA 5FL3A 5J4YA 2QSYA 2ZI9A 2AK2A 3QUSA 4LJ4A 5FI0B 2ZRKA 4TSFD 4PAQA 2R6HA 2JDIA 3VU9B 4HDOB 3WP1B 1P72A 4KLNA 2IS6A 1SVLA 1OW3B 2Q6TA 4IEEA 1FX0B 1OV4A 2NO9A 4LUCA 1COWA 2OK8A 5EUMA 4B32A 4DHEA 4G5GA 1WMSA 4Y0AA 3MMPA 2RGCA 2BGIA 1CP2A 1E2DA 4QGFA 4TMKA 2BMEA 2NZ8A 2PX3A 2G6BA 2V8OA 3NBYC 3DM5A 4WQMA 1Q22A 1S4QA 4C7OA 3CB4A 2C5LA 4RFSB 1D9ZA 3KQKA 4YONB 2QT0A 1CRQA 2ZRIA 2F9MA 4NZYA 1E0SA 1MRSA 1A2BA 1KHTA 1NN0A 1XMIA 2FFHA 2H1LA 2X1VA 2ZSBA 2B8WA 5TB5A 2BKEA 4NPHA 3KB2A 4E03A 2J1LA 5C46F 4RZUA 4NCHA 5L3RA 3UK6A 3HWSA 4M2LA 1VG8A 4EKDA 2WIAA 4TYQA 5C18A 1W4CA 1FTNA 4C0KA 2J0UB 4TT3D 2WM9B 4YAOA 3L2OB 5FBRB 1FQKA 3Q5EA 1CJUC 721PA 3PUVA 5JEDA 1OIXA 2IYWA 1T9HA 4D0LB 4ASUD 2B7CA 3U6BA 4C0HA 4DT1B 2Z4SA 4TL7A 3OIWA 3HYRA 4B43A 1KAOA 3CMEB 1MO5A 4W9MC 4MYHA 1MABB 3WMEA 3W5JA 2AWOA 2HF8A 5EP3A 2ZYUX 5AJYA 2VF8A 1KI1A 1GKIA 1G1MA 1R5NA 1KTVA 4RZ2A 5FBWB 1UDWA 1Z0DA 5DH9A 4MKIA 3TMKA 5CB8A 2KE5A 3ZZUA 4PQFA 1T3SA 1TLLA 1E94E 3AQ4A 1F6BA 4RKFA 2NO7A 1QH0A 5KNBA 3EPHA 1RW4A 4TMTA 1SVWA 2GNOA 1NDHA 3O47A 4Q1EA 3QFTA 1GG2A 1QVRA 2RGGA 1GWNA 3I73A 4MKGA 3SDZA 3TIFA 1KK2A 3CR7A 3K1JA 2OILA 4QGGA 4KSBA 2CE2X 4JVSB 1KJYA 4HLUA 3V76A 4FI3C 4KHZA 2WHXA 5SZKB 1NBMD 4TYYA 5HKKD 1YITB 2AK3A 2JCSA 3ETLA 4M8NE 2ERXA 2QTHA 3NC0C 3DMNA 3VR1A 5GADl 3DHWC 3RNLA 3CPHA 4AC9A 3GFPA 2Q9BA 4EPVA 3ICQB 4RZXA 5IT5A 3CWQA 4ZGQB 5KSYA 1TQ6A 2J5XA 1KY3A 2YZ2A 1D2MA 4Q66C 6Q21A 3FMPB 1R10A 3EASA 4B48A 3H86A 3IDQA 5K8TA 1ZUNB 4FCTA 4HAZA 4FWIB 4AYXA 1U9IA 4JLMA 2NMVA 2QROA 2ZRHA 4MGZR 1DARA 3RRNA 3GP8A 5F98A 4IXNA 2WPDD 3TUZC 1OFIA 4LC0A 4U00A 4DLYA 1HV8A 2F1HA 1CU1A 3FJOA 2BMJA 4LHWA 1H8EA 1TTTA 1VG1A 3LV8A 1RC8A 2ZEJA 3BBPA 3X1DA 4BUJA 1ZM4A 2P5TB 1YJWB 2Q3HA 2YOHA 5L3VA 3DZ8A 2FN4A 1KDPA 1N6OA 5HTKA 1JALA 1E9FA 1E9EA 4TLAA 4MRPA 4E22A 1GILA 2W00A 4L4UA 3WYFA 2C96A 1US8B 2H57A 3CH5A 3JQRA 4IEIA 4KSCA 1U81A 3ASZA 5DSZA 4N3GA 4NL4H 2ZSFA 1J7KA 1UEIA 2OLKA 2QM7A 4KFSA 4A8JC 3FPKA 1Z2AA 5P21A 1SXJB 4C9BA 4MA4A 3ZBTA 1VQ9B 1JR3A 5TDHA 2JGNA 3CRMA 5IK2A 2LKDA 3LQQA 1OXTA 3AGQA 3WHLA 5C4MA 1HY3A 1NJGA 1QHHB 3I56B 1KI3A 3K9NA 4RVCA 1BMFA 2GJ9A 1NBME 3VQTA 4BLTA 4V0ME 1YJ9B 2J7KA 3QY0A 1OGJA 4N3NA 2BEJA 2GVDC 2FV8A 2HEIA 4YLGA 5FTMA 4EFNA 4RD2A 3EA5A 3CKLA 1G19A 3TUJC 3UXMA 3VFDA 4LZZA 2IYVA 5F9FA 1M90D 4NYJR 5AJWA 2DERA 4Q02A 2V55B 1RRFA 3BFXA 1FDRA 3UMRA 1OHHA 4QM7A 2GDJA 2AL7A 3SN6A 1BX0A 2QE7A 3BH7A 1I4DD 1Z6TA 1IY1A 3AVUA 1KO1A 1IXRC 4ITRC 3GLFA 3ZJYA 3G71B 5AJXA 4HZUA 4EQ6A 3FMFA 2GXSA 2IEZA 1R5BA 2SHKA 2J41A 4KBGA 4HAYA 3SJBA 2J0QA 4FD2A 2D62A 3PJRA 4B44A 1II8A 1S3GA 4AURA 2Q21A 3WMFA 4LBWA 2C2HA 3FFAA 1XB2A 4KCGA 1R0XA 5EE3A 2EFGA 4XTCS 1M7BA 3L0PA 2FGJA 4HLQB 4IJMA 4QBIA 4BFWA 3U44A 2QP3A 1ZJ6A 1E4VA 2BMFA 2IYZA 1N6HA 3L0IB 3DMDA 4PPGA 2RAPA 4AWXA 4LCBA 1P2SA 4UJ3A 5EE0A 5B64A 1KI7A 2OXRA 4Q18A 4NCKA 2YHSA 4BFTA 1N0VC 5B57C 4X8OA 1R7RA 1UBEA 3C4JA 2P5SA 3T06B 3ADCA 3EW9A 3H4MA 4CW7A 1DAGA 4IDPA 4QNMA 2EFHB 4Z54A 4US1R 5BYJA 5EE1A 1B2RA 4PFSA 4P4SB 1LF5A 1XTIA 3ZVMA 4C0AC 3Q7PA 3KTAB 4X8MA 4DBLC 2YWHA 1TMKA 1CR4A 1YR7A 2BCGY 4HUQA 5JRZA 2FSIA 5KHOC 2KB0A 1RJ9B 1SHKA 1G5TA 2G83A 3IGFA 3LLUA 2IYXA 2VNKA 2ZUBA 1CR0A 2YKGA 3ADKA 2VNHA 1DBSA 4EDHA 3K9GA 1VIYA 2QQEA 3HR7A 4Q47A 5D3MA 4A4DA 2QBYA 1G6OA 3SJCA 2B21A 5JHHB 2WWHA 2EFDB 2VSOA 1HUQA 1W1WA 2BN4A 3PUXA 4UNRA 3E5HA 4QHSA 4NBSA 3J81k 4URWR 1CJMA 3L82B 1T3LA 4AYWA 3V4RA 3TNFA 5DO9A 3DO6A 5HE8A 1VQPB 4GPTA 3B8HA 1FTSA 2R62A 2ZR0A 1OLOA 2RGXA 2A5GA 1KSHA 3Q5DA 1QFZA 2BF4A 4OQFA 4DCVA 4GZMA 2IUUA 2ASEA 4QGHA 3K0EA 1NY5A 4Q5IA 5EE9A 1E9CA 3U7EB 4PTLA 2HYDA 4OQXA 1TF5A 1XEXA 2VYFA 1X86B 2ONJA 4F93B 2BBTA 1UAAA 3AKYA 4AF6A 2PEYA 1ZYUA 5FUYA 1KKMA 3QFCA 4DIEA 3IPYA 2FNAA 4RFSA 4MGIR 4TZ0A 3CO5A 4JL6A 3RC8A 3BJIC 1HA3A 4E07A 2I1QA 4WBSA 4UNQA 1EFUA 2Q0HA 3KKOA 1NLYA 3OZXA 4PANA 4BZPA 3MAAC 1ZU5A 4II7A 3ZC3A 1Q57A 4ON9A 2GHIA 2IUSA 5JRJA 1W0KA 5FPTA 2WOJA 1ZNZA 3NBXX 1OXUA 1S3SA 3CCEB 1E2NA 2XJ4A 2ATVA 1DAHA 2ZRMA 3ES9A 4JKIA 3M6AA 2VO1A 4PAOA 4CYMA 3AVYA 4FW9A 4G5RA 5B58C 4HE6A 3TBKA 1PJRA 2FE4A 2P6NA 1YRAA 1W5TA 3CXCB 5C1BA 4XD7D 3IBYA 1OH8A 3QBVA 4DT1A 1Z0FA 4GOKA 1S2MA 1P9NA 4I1SA 4S2EA 4UNSA 1TAGA 1OFHA 1AK2A 2BIFA 4UQOA 5AJZA 1XE1A 2QPAA 4DLTA 1K9MD 1OXSC 3UMFA 5GV7A 3NDBB 2OAP1 5JEEA 3GJXC 1P4SA 4M1SA 3V00A 4NCNA 4PPFA 3G0HA 2F7SA 3U3RA 2BHRA 4RD6A 3H0KA 3QNUA 4AY2A 5GJCA 1XJCA 2CK3A 2KSQA 3S1AA 1EESA 2ZRAA 4O3MA 1EK0A 3OFNA 1SVMA 3CRQA 3C7KA 2Z4RA 4U7DA 4IW3B 1XXHB 5JECA 3LA6A 2OFXA 1NNEA 1IN8A 1QUEA 2RGBA 3AF3A 4WZBE 4DLXA 1A2KC 4JT4A 3KKNA 3MWYW 3PITA 2QG6A 2WSMA 1X6VA 4ZDWA 2J7PA 4Q4AB 2OBNA 4PR0A 1F2UA 2QEXB 5HCIA 3BB1A 1P62B 3T1TA 4A8JB 5AUQA 2IYYA 3RANA 1QUFA 3W5HA 4IDNA 4XVUA 3X1ZA 4DDVA 5JLJA 1E69A 3QPUA 4URUR 4ACBA 2CHGA 4PO1A 5HZKA 4HE5A 1VYVA 1E63A 2JJ1D 1YQTA 4IOLA 1EFRA 4TLDA 1VQ5B 2ZS7A 5H5JA 1XCGB 2GJKA 2Z0MA 3KFVA 1P75A 2JDID 3QFSA 3W34A 4EPXA 4L9SA 2DWQA 1W87A 1XD2A 2R6AA 4HATA 4JKYA 3WHKA 2ZUDA 4TYPA 1C4OA 4I81A 1E9SA 3U60B 1COWD 1UPTA 4I4LA 4TMXA 1OXXK 4ARZA 4A0FA 1KDOA 3U7HB 4PX9A 4F38A 4QG7A 2ZRDA 4CEJB 4IDOA 1QHXA 3X1YA 1YHQB 4LWZA 4Q9HA 1JBKA 1KO4A 4DQLA 2RC5A 4HAWA 3FB4A 4GMXA 3ZH9B 3NBZC 3KQNA 3VTKA 3WRYC 2XAUA 3MD0A 2DFTA 1A1VA 1H65A 1FNBA 3LO5A 1VQKB 2AD1A 3F5FA 1M2OB 5JWHA 2F9LA 4OK6A 3CX6A 1AQUA 1NSFA 3GLGB 2C04A 4V0KA 1XMJA 4QBFA 2GVZC 3RS2A 2ZSEA 2YJTD 3TW8B 3FTQA 5J4KA 1P7CA 4QOSA 1KMHB 1TVCA 3SR0A 5KDDA 2ZE6A 2JLXA 4FXPA 1N6IA 5AWFC 2R9VA 4B3BA 1Z8FA 1VQ6B 1P6XA 5FPKA 2ZRGA 3H1TA 3A4MA 1DTSA 4D25A 3DKPA 1GR1A 3I55B 1K6MA 3G4SB 2BOVA 3AVQA 4XVQA 3D6TB 3VR2A 1BH2A 1CQXA 4LJ9A 1GOTA 3AKEA 1P73A 2R65A 4PSAA 4PQRA 4W5WA 1YVDA 5EXSA 5EZ6B 5FR2A 3W2IA 3K53A 1G18A 2H16A 1E0AA 4FMCF 5TXGA 1G6HA 1XNJA 2BJVA 1Z83A 2CL0X 5JWRA 3QPWA 1Q86D 4JLAA 1IM2A 2YC4C 2O8FB 3OEHA 4F7DA 2G77B 1G3IA 1RKBA 2X77A 3NDPA 4QC2A 1XDBA 1WBBA 2RB4A 3CPWB 3GD7A 4Q7MB 5EUQB 3EIHA 5GJVC 4WXRA 5JBQA 1BYIA 4DSUA 1ZW6A 1N5JA 3A1UA 3L43A 2XZOA 4YALA 1AJEA 2EIXA 1NLZA 2IF2A 1KZGB 4O2RA 4MDEA 1R4AA 4DC9A 3B1WA 4G1UC 2OTJB 1C9KA 1UBGA 1W4BA 2W0MA 3C5CA 2MSCB 4GZLA 3E1SA 3TRFA 4A6XA 3HDTA 4TTRA 5DHAA 2QSZA 2GPJA 4IKEA 3F3YA 4LHVA 3SU8A 3PENA 2PT5A 2UZIR 2V9PA 4YC7A 1LY1A 3A36A 2YNMA 1KC8D 2WJJA 5EP1A 4P4SA 1ZM7A 2E9SA 2CBZA 4LSGA 2ODWA 1RFLA 5FUXA 4BFSA 5J4LA 2CRVA 1J90A 3GJ0A 1IB0A 1S8FA 4KYIB 1MO4A 2IX3A 1E2QA 1OGIA 1RJ9A 3WP0A 4OHXA 3VNUA 2E87A 1A8PA 4K8OA 2OFWA 2NO6A 1S1CA 3LY5A 4MYTA 2VHUA 1LF0A 5KSPA 2P6RA 3TR5A 2IT1A 1XD9A 3IEVA 2GA8A 4CEHB 1FPMA 3BK7A 1ZNXA 1KDTA 4JMPA 3RC3A 2V7QA 4KV9A 2QRZA 1R0YA 2H92A 4MKHA 5BXQC 3UATA 2QN6A 2GF9A 4A82A 4D0GA 1J8MF 1N0UA 4PQYA 3R7WB 1GAJA 5E7JA 4OJQA 1E0JA 1WRBA 2XGJA 3QFRA 4ABYA 3LXRA 2XJ9A 4K46A 1DOAA 3FVQA 4P33A 2I4IA 3WMGA 1JR3D 2WJGA 2E1RA 1GJRA 2BBOA 3SJZA 2YINC 3QENA 2ONKA 5FOUA 4BASA 5IHPA 2EFCB 1D6JA 2WKQA 3CRW1 2LWIA 2WMOB 4JL8A 4Q4LA 2AKAB 1G64A 1Q81D 3OEEA 4J0QA 1R0ZA 1BMFD 4NDZA 2QDXA 1E79A 2A3RA 2VYQA 1Z6GA 2A9KA 3NHAA 2WV9A 3BERA 3QVVA 2RMKA 3FOZA 3ZZ0A 2WJHA 1E4YA 3H2YA 5CM8B 2BV3A 5TR9A 1RZ3A 4QBGB 4BEBA 1E9RA 3G82C 1JXOA 3WYAA 1BX1A 3VKGA 5FTKA 1N6NA 4ILEA 3VMFA 5DIFA 4M1MA 3ZVRA 1IN7A 3FGNA 4M53A 4EPWA 4UAJA 2AFIE 4AKIA 4FCVA 4TTPA 1OHHD 3A6PC 2GJSA 4LGMA 1OF1A 2J59A 4L8GA 5E7IA 1QHYA 5DISB 1QZXA 2EYQA 4XSHA 3ONWA 2QE7D 5L3SA 1M1KD 4KLZA 4RFVA 3QG1A 3EC1A 1F2TB 5K8UA 2HT1A 3CONA 4YMTA 2X2EA 3QKUA 3UG6A 1F20A 2EWVA 2VP2A 3JVUA 2O8EA 1X1RA 4G1BA 1KO7A 5G53C 2KJQA 3HPQA 3DOFA 2BEKA 2GBLC 2WJYA 1SHZA 2R6CA 1YZGA 2ZSAA 3P4YA 2ZQ5A 4OHWA 4B2PA 1NP6A 4D4MA 3ZZTA 3Q85A 1J9ZA 4HB2A 2FWRA 1QG0A 1AKYA 4O25A 4ZGNB 1P9RA 1Q82D 4G3XA 1T3HA 3PEWA 4JYCA 4EJSA 5HR5A 2WWWA 3KQLA 4CIDA 4URXR 2GAAA 2C78A 3EPLA 4Q7JB 1JR3E 4C0SA 1E0KA 5H70A 2JLUA 2OFOA 1TQ2A 5EQTA 4JJKA 5DE3A 2ORIA 2ZJ8A 3BB4A 1MO3A 3KXLA 2FPLA 1A7JA 2W6JA 4Q4AA 1MO6A 2EYUA 4YMUA 2IS1A 4A8JA 3QF4A 2ORWA 4V0OA 4E5UA 1Q1EA 2QUZA 1E2EA 4LHYA 1F5NA 4JLNA 3CCVB 2FG5A 3IUYA 2HT6A 3QEJA 2DYKA 3ZDQA 3C15C 4AI6A 2O8BB 2ZAMA 3TKLA 1DE0A 3QG5A 1AZTA 5CIWA 4QGAA 2DWOA 4K81B 4C4PA 5BN3A 2G88A 5L3QB 3G5UA 3RS7A 3U3JA 1D8TA 1ZC4A 4MITA 3SFVA 4MRNA 4QBHA 1KSGA 4F4CA 4I1VA 5JJLA 1FP7A 2ZS9A 2LCFA 1R5OA 2CDNA 1QBKC 2WBLC 4JZKA 3GLFE 1XTRA 4N0DA 1ZNWA 5CJPA 2FOLA 3NBFA 2NG1A 2QMHA 4HLCA 4QJ4A 4A92A 2O8CA 3KUCA 2FSGA 1XX6A 2IYRA 3GPLA 4JLOA 3C14C 3KQHA 1YU9A 2N42A 4B33A 3X1WA 4CEJA 1ZUIA 1UMKA 4OL0A 1G16A 2ZI7A 4V03A 3B1YA 1UFQA 4OQNA 3W3AA 3NTUA 2VSXA 1DAIA 4GP7A 2FGKA 4PC7A 1XTKA 5DHFA 1XEWX 3THWB 2ZRPA 2D3WA 3I62A 3L0OA 1VTKA 2CLCX 2GCPA 4POAA 2JLSA 4BFXA 4LPKA 5FUWA 2VTKA 3NIBA 5KTYA 2X2FA 5AJVB 2ZR7A 2MSDB 1RRCA 1BIFA 1FMLA 1XTJA 4B71A 3GLGA 4TMVA 3W6OA 4LC1A 2ZANA 3RRYA 3PUYA 3AUXA 1ANKA 2CVFA 1VMAA 2HJVA 3MGCA 4JL5A 1DS6A 1KMHA 4GP6A 1XPRA 2JEOA 1JPNA 3LFUA 5FOVA 1Q20A 3QQ5A 3W2EA 1CJVC 2G9NA 4NYMQ 5B30A 1G17A 2WOOA 3DEFA 1W0JD 1E9DA 2EFEB 1JJ2B 1VQMB 3SEAA 4YQFA 2RHDA 2AXNA 2VSFA 1XBTA 5A5GA 4OKSA 3LDAA 4F91B 2PJRA 3MWLA 1YZUA 4M1OA 3BE4A 4ZCLA
chains in the Genus database with same CATH superfamily
3ROKA 4B34A 4V0LA 2FFAA 3KOWA 3LC0A 1FJGB 4MUIA 3DHVA 3G0BA 5J23A 4P2NA 3L8YA 1NVAA 3ZVLA 2D3TA 2PQ2A 3QVLA 1YRYE 3FNFA 3I6IA 1U1DA 5E4FA 2DX7A 1E43A 2GJAA 5AVZA 2ZVQX 3PVSA 4M76B 2WWFA 1D3AA 1ISRA 1N4DA 1IH8A 2ZRNA 2XIQA 3CIOA 2FF7A 5HJEA 2X8LA 1KBOA 5AJUA 5JXWA 2O59A 1D9XA 4U2DA 2ECKA 2IZZA 3GC6A 3BGWA 3AF0A 3VR5A 3TLMA 3GROA 2YC2C 3OLXA 4NCJA 1G3UA 1U0EA 3IBGA 4YEDA 4YX9A 3IDOA 3CF4G 2A5JA 3HUDA 3OD5A 4D4KA 3NE5B 2P11A 4JXXA 1UZMA 4HN4B 2JLAA 4MWEA 1UM8A 1XZKA 2O48X 5KX5A 1V1MA 1F3OA 1D03A 5EI5A 1HH4A 2XITA 4ZV7A 3GQBA 3HGQA 1AY0A 5G0UA 4EENA 4MNTA 1MG5A 2IYTA 4TVOA 4ENUA 5G41A 2XIJA 5TQJA 1PZXA 1RYHA 1ZMRA 2FZLA 2JIRA 3DP7A 3Q1KA 1BDBA 1V8BA 2WRZA 4JUDX 1YDWA 1ZN9A 4HHEA 3SHWA 1JX6A 1P1FA 5CBKA 3K70D 1ZN8A 3EGCA 1AMOA 3HXLA 2ERCA 2J0SA 4FDMA 4TV9B 2W2NA 2W70A 5KYYB 1Q3HA 1FY2A 1P4HA 4MJLA 3REFA 2ZRLA 4DUYB 1TA9A 4IEFB 4K9LA 4AQ7A 1QAQA 4YT2A 2OESA 3NT5A 4BVBA 3DFKA 2IW3A 5FTWA 4BCCA 1KOGA 1PNQA 3BXGA 4CEHA 1UJ6A 3BC9A 1AKQA 3JWIA 3JVEA 1JEJA 2GX6A 4JYPA 3S2EA 1PW7A 2DBQA 2QUIA 4UNPA 1JJBA 4RY0A 1QE0A 1QTRA 1EM6A 4X3PA 3MWEA 4JHXA 2RB5A 1WY5A 2ST1A 5I7WA 2ZSJA 5DI3A 2FJ0A 5C8YF 2R6FA 3IIJA 3B6MA 4UE3S 1T1GA 4JEHA 3Q7EA 3KJIA 3HCBA 3ONUA 4O2BF 1IEWA 4LRSB 1GQ2A 3GRPA 1BKDR 1UT5A 2I4NA 1NKTA 2YVKA 4KKXB 4KGDA 1SA0B 2HK6A 4OH1A 5AM3A 1E5TA 2ZUCA 4IFEA 1JF8A 1A8UA 1YGYA 2OCYC 3B38A 2YIMA 3TNJA 1XRMA 4IWNA 4QRHA 2QGZA 1PL7A 1MNQA 4PXAA 5F2KA 3SD7A 3VI4B 2QU8A 1GEEA 1ZVKA 3ELWA 3G9ZA 2PYDA 3V8BA 3TE6A 1JG7A 2AR7A 4CLRB 4NYIR 3B53X 3PR3A 5F78A 1Q92A 2VN8A 1XRJA 4S05A 1FFYA 1A7KA 1QOQB 3D8UA 4OI0A 2XB2A 2VJAA 5D7BA 2ZAOA 2YWXA 1BA2A 2B6HA 1Z29A 2A88A 2WJAA 3LX8A 4I46A 1WA5A 4P7BA 4YQZA 4J7XA 5H3HA 4E33A 4C30A 4FT2A 1EAYA 1LPPA 1HTWA 1QC5A 1ADFA 1UOPA 2O20A 3IXQA 3MJFA 1MC8A 4U63A 3ZKWA 1YF3A 2CSXA 3QX7A 3FPLA 4M8IA 3TYXA 3QVKA 4TRMA 3VX4A 3TF5A 3LVQE 2C5AA 4KN9S 1CY4A 1VJDA 4IUDS 4KJXA 1T6XA 2QU7A 4GT1A 2DGDA 3ZE6A 4IWXA 3RRJA 4RIGA 5FI1B 3CCCA 4C06A 4RVGA 2I1VB 3AWIA 4HL6A 1M2VA 4MKZA 2ZYDA 2XUOA 4X8LA 5D5PA 4ZI2A 1RHRA 1SXHA 4KR6A 3IJPA 1PZFA 2VS1A 4D4JA 1UPFA 4FYKA 1ABFA 4ZCTA 5CFOA 1RLUA 2E5WA 1OLSB 3L6RA 3WLRA 1NSTA 3OEHD 2IS2A 4OOXA 2PSDA 3HACA 4OB6A 2RCNA 3BFPA 4QPZA 4RWZA 5GGYA 5FO0A 2WU3A 3O1HB 4KL8S 4PLYA 2EBFX 2PY6A 1TQ8A 2BFPA 2J4DA 3QKTA 4XA8A 5K8IA 4S24A 1KMIY 5IT9A 1BGXT 4AZSA 4U6SA 1YR8A 3EC7A 1NGSA 4UVHA 3DOIA 5G1PA 1N7GA 5AXBA 4C0BA 1H93A 2ETXA 1VRWA 3BXOA 3GJ3A 1EUDB 1E18A 1A5BB 2REOA 1DI0A 1PE0A 1UFOA 2ILVA 2P6MA 2VF4X 4CCSA 4OGLA 4CCAA 1E2MA 2NQ2C 5EPOA 4UVEA 4ESHA 3B7PA 1NW6A 1WKVA 3DAOA 2ZAGA 5ESXA 3V4FA 5FJJA 3U1TA 1U0LA 4MW1A 4YJFA 2X9GA 2JGIA 3DZIA 3FRIA 1SQ5A 3HKCB 3L8EA 4CL0A 4QFMA 1DEOA 1DTWB 1L2TA 1Z13A 2D2FA 3FDZB 3WNZA 1WW3A 1VRVA 3ZU2A 4J0KA 4BZWA 2HCRA 5KYUB 4GAEA 4OOEA 4KO2S 2P8SA 4K5QA 3S2YA 2YQZA 5JVDB 1YB2A 1CIPA 3EIQA 2YV5A 1PEKE 3FD8A 3LHKA 3SLDA 2FFJA 1VBNA 4JYBA 4NYJQ 3GJ4A 5DWDA 4Z4ZA 1Z18A 2VHEA 4HXFB 3HY3A 4MR9A 1J1ZA 1KYXA 3CZ4A 1KU0A 1G9XA 1WULS 1I4OA 2Z43A 2WM8A 1WV0A 3KPUA 2K5UA 5IDQA 1VSUA 2GEFA 3ZDFA 1JKFA 1AHPA 4LY9A 1PUJA 3INGA 4KK3A 2UUPA 5M29A 3H5NA 3L01A 1VQ7B 3O4IA 4MW2A 3K09C 5K8LA 4FINA 4INPA 1C1DB 3FPGA 3FX2A 1EFHA 2PFKA 2P3SA 3IAAA 1JNYA 1J8QA 1QO0D 1JIJA 3I58A 2AOTB 4GSYA 4OKNA 3WYDA 2IA5A 3CBGA 1PQPA 3EUWA 2GM5A 4H2DA 2AI2A 3TAXA 3I9V1 1G21E 3E9RA 3OESA 3ZCUA 4OJKA 5CDUA 2Y1EA 4B82A 4PSDA 5TMPA 1Y3CE 1YONA 2PT7A 3FTPA 2B7LA 2DQKA 4WY2A 3WLTA 4JX8A 1GPDG 3JRNA 1M33A 1QRUA 5IAGA 2HGSA 2NVUA 4MP8A 1ZUD1 2JGDA 4K9MA 1X15A 2BGMA 3ASRA 2GH1A 2PVPA 2W2MA 4L2IA 5F7ZA 1IXZA 1H5NA 3IHWA 1GTVA 3PQ7A 3RC2A 1ZUWA 1ECFA 2NXWA 5IS2A 1YQEA 1U9CA 1J97A 3RRFA 4ZI7B 2WT9A 2C4WA 2A9VA 4CE6A 2ACKA 1XCLA 3P9IA 4R7ZA 2CKDA 1L5HA 4M9RA 5HOEA 5JIBA 2J0UA 4PO9A 1NIJA 1NC3A 2ZU0C 3W2FA 5DW0A 1QGUA 5LCXA 2AHOA 4RLZA 3TOSA 4CLOB 2YBDA 4YRRA 3KSUA 4UE6A 4B74A 3ICOA 5KAPA 1RXSA 2W8ZA 4HLDA 4GYKA 4KTTE 5SY6A 5C9ZA 3VGPA 4BMSA 1L9XA 3DZBA 1OXMA 3S2FA 1DMRA 2VDNB 4PSCA 4XWTA 5G4KB 2JF0A 4DQUA 4N1AA 4C43A 1JHQA 1YZKA 5IYRA 3A3PA 3COWA 3EGWA 4W4TA 3UH1A 4HMOA 3ZE2B 5K6TA 4RLSA 4ZKDA 1HDGO 2J8ZA 3N76A 1RHMA 4JU9A 5FPYA 3P2IA 3GLHE 4XQFA 1TNDA 2B2NA 4HADA 5G0SA 1MENA 1O0CA 1E58A 4CN8A 4FIDA 4C5CA 2GHQA 1OAOC 1TGVA 3O4HA 1QVAA 4WCFB 1NRJB 1O3YA 1ULUA 1N2CE 3RYCA 1E6CA 3Q38A 3ETEA 4JLVA 3AERB 1QH8B 4G0YA 4OQMA 2HSWA 4XB1A 3AVXA 2GAFA 4AICA 1ZBDA 2VUSA 1CUYA 1KZ7B 4I2VA 1JHXA 4QXQA 3WGGA 1GLNA 5HIJA 3FIJA 2W2VA 2IIQA 2DY1A 1GXSA 4B3IA 3MLAA 2ZIGA 5LKRA 1AZSC 4H1HA 2W6OA 4G0PA 4JA0A 5I7FA 2ZYTX 5KPJA 3VC7A 2XF8A 1G2IA 2RH4A 5K3EA 3VA7A 4NJMA 3ZBQA 1XMVA 3L05A 2OM6A 4EGFA 3RYIA 1UANA 5I8PA 1SPXA 4OYLA 5FL7A 2WJWA 2D7CA 2RAVA 3NOOA 4ZU1X 3K9LA 4D96A 3N2ZB 5JW6A 2DXIA 2NYRA 1G20E 2YYSA 1YU6A 3P26A 4PGHA 3VAAA 5CLIA 1R37A 1AGNA 4EX7A 4MWDA 2QL5A 1XKQA 4ZOEA 1CTQA 4FQ8A 1JIKA 3KKPA 1OSNA 1TTQB 1KI4A 4YMWA 3DL2A 3SOZA 4EY5A 2DTDA 1U2GC 2WD7B 4RH1A 4DIMA 2WF8A 1B8PA 4QUJA 1Z22A 4HIZA 5D1HA 1VL1A 3ZCTA 1AHIA 5FLYA 3T51B 3K6RA 5EIAA 4ZDIA 1DELA 1I2ZA 3RB8A 2VT7A 3L02A 3NHBA 2PUVA 3NEYA 4MJXA 1HURA 4B9EA 4NATA 5K7SA 3QU4A 4NY1A 4JI6B 2V0NA 1LEHA 3UT0A 1RRVA 4YPFA 1SK8A 4U2GA 4CMIB 1LSSA 4WLOA 1JNXX 2P68A 4EJFA 4FNOA 3C97A 4QFBA 1Z5GA 2Q1SA 2O8DA 4OPSA 2DTXA 1L4FA 4MDFA 1H6BA 2RHHA 2ZRBA 2I2XB 1US8A 2W58A 3CRVA 3ANMA 2Q29A 4OBEA 1F4VA 2JI8A 4OO3A 4X1KB 2DT8A 1U28C 1MBZA 2VLIA 3SGLA 4FWTA 3U9SA 2VPXA 5TT0A 2ARKA 1T2DA 4D99A 5C4GB 3ET4A 4O59O 1N75A 2NGRA 3W3AD 3TCNA 1W36D 4TL9A 4XONA 3AKDA 2G0AA 3Q7IA 1VL6A 3UT6A 4XLEA 1QHHA 1T0JB 5J5VA 3M34A 1VZ3A 5H68A 2P0EA 4RZSA 2AC4A 4ZEMA 3QBDA 4L85A 1M34A 4KU4A 4X7MA 4ETNA 5F3WB 2OL4A 3TSZA 2QRVB 4LW8A 5I9MA 2OYCA 3WGKA 4D3DA 3KEWA 4PC6A 1OA1A 3AR3A 4TS1A 4CGYA 4B2LA 4EBBA 3LQ1A 4DNQA 1JI0A 1JIVA 2R1VB 1LS1A 3M1AA 3JYNA 2BEVA 2XYVA 1UC9A 5LPNA 2FLWA 3CZ5A 3LCMA 2OY0A 2PKYX 4LJ7A 5EEHA 2JVKA 1QMGA 1SCNE 2GN2A 4CKCB 1DEXA 3WGVA 1XQ1A 1JDVA 5H7XA 4BX8A 1Z7WA 3AUJB 2Z2YA 4HSEA 4OSEA 1RC0A 1HLGA 2XBLA 4GX2A 5TQ0B 2IPAB 4M22A 2ZJBA 1L1EA 1BE0A 4WRRA 1C80A 2YJZA 4GWKA 3GI1A 1UXJA 2BSAA 1PO7A 1V8DA 3KS9A 1IN6A 1HDZA 3M82A 1P0IA 1MJNA 3NYIA 4MO9A 3MPUA 1G7TA 4UMFA 3SC3A 2ZE7A 5JSUA 1N32B 3VKHA 3KKLA 3IPXA 4DY4A 2O57A 3THXA 5CA0F 3N39C 5FDFA 1L6IA 3PHLA 1P1CA 2ZTLA 1I4TD 1KJ8A 4DA9A 5BORA 2IPNA 2H1RA 2OKCA 4OQYA 1XTTA 2HHAA 5EQFA 3PVZA 1CNEA 1AHNA 2C07A 2P2SA 1XU4A 4OSPA 4OX9B 2XB8A 5FA6A 2BFEA 1TO6A 2YRXA 3B51X 1FFXB 3EXEB 3GJ7A 5E2IA 3IB6A 5LZ9A 4TKZA 3MJTA 5EJFA 4BVEA 4KVZA 3TLCA 4ZD6A 3CXUA 2H85A 3UMSA 4QPPA 1ZI8A 1F7UA 1TK2A 2IGBA 3URMA 1IIRA 1BX3A 3DCJA 1L7PA 1WUJS 2X0KA 1UEJA 2JFQA 2WA1A 2VJBA 1X8JA 1XA3A 2RI1A 5T41A 4CKYA 4GZ6A 4BE9A 1MN6A 1NVFA 4M99A 2DULA 3RRXA 3ZXYA 4U9UA 3LQYA 4TVBA 4BNWA 3CUTA 4B4UA 4E4YA 1D07A 4P6VF 1OKKA 2OCAA 2XZLA 3FBWA 4XLTA 1GRVA 5T4EA 1A98A 4PNPA 4UE2A 4ZOBA 3TLBA 4BLVA 2XYRA 3Q8LA 4O4LA 4URYR 1G6Q1 2ZRCA 2BEWA 3P9XA 3QEMB 3RC7A 1KAGA 3TRJA 3CCQB 1E9BA 2VKTA 2W83A 3RGWS 2G7MC 4ZZ2A 5JH7B 4YTEA 5CLLA 4I9GA 1RFGE 2D9RA 3SEJA 3ZOKA 1UK9A 1QVVA 3P8ZA 2HCBA 3IT0A 3H84A 3VH3A 3VDRA 4ZHQB 5KYYA 2MYNA 3FYCA 1M1ZA 4OB8A 2GJ8A 3PL5A 3CBQA 1G59A 5H9WA 4E0FA 3T61A 3L6BA 3A9VA 3MEQA 3PQ8A 4YO8A 5DJ5A 1VHDA 3VV2A 3WFIA 4F85A 1M6NA 2F3QA 4YP6A 2WU1A 3GDGA 2Y76A 3RABA 4KWCA 2P77A 2XWJI 3FCEA 4WVFA 4CM1A 3EZ9A 1QH1A 3W5VA 1G8PA 3JQFC 1HL7A 3KZMA 4GMFA 4L0CA 1DUVG 3T95A 2JHPA 3EX7C 5CVUA 1T8YA 1HOXA 1CUAA 1YJQA 3CG4A 3N2NA 4N5NA 1DQZA 2GF0A 3G59A 3L6CA 5IK2D 3KB8A 4CTJA 3T5AA 5HILA 3IIKA 4ZOQI 2I9KA 4B80A 4AVYA 2EG5A 4F5ZA 5JAMA 4FJ1A 4FD3A 2OGUA 1OX4A 1XT6A 2I6XA 3QIAA 1AKTA 1Q7YD 1SKMA 2FETA 4YP0A 3BCHA 1E2PA 4L0DA 5DM4A 3C3CA 3EWNA 2NU6B 4JSYA 4KXMA 3WBKA 1G5PA 5T3YA 1QX4A 4XTRA 1F7VA 2HLNA 4PSVA 3U7FB 3C6BA 4NBKA 4K88A 1QWOA 3UHPA 2DLDA 1VL2A 4EJMA 3PX2A 3IRUA 4MLZA 4R6WA 5DNCA 4TWAA 3WIDA 4O29A 1KY5A 1ACLA 2VXOA 3FPPA 3IBSA 3JQ6A 4KKVA 4QFCA 4W1QA 4CR6A 1RBQA 1LWOA 1R6VA 1RYFA 2XV1A 2UXCB 1YJAA 2VF7A 2C9YA 3CUSA 5HF9A 1HT0A 1Q21A 2FSPA 2P3OA 1OTYA 3CEMA 3O2QB 4P38A 3CUWA 4AZ0B 5CFMA 4JSTA 4YJDA 2GXAA 3PIRA 4JJEA 4R5HA 2ZK7A 1QSGA 4HVTA 1UMCB 4DDHA 1RQXA 1T4DA 2P9BA 3I6MA 4GOMD 4JASB 4X60A 4DM7A 4ZA2A 1VPTA 2LIPA 5HCUA 3LQFA 4A9AA 4EKYA 4RPBA 4FKZA 4DE5A 4HLNA 4LF9B 2IZ0A 1RKXA 3LUDA 4UBMA 2ZP1A 5BRJA 1JWAB 2BKLA 5ECGC 3DO5A 2W6ID 1CX9B 1TM7E 3I34X 1ULAA 3ASSA 4IRUB 1S0UA 5L6MB 2PZMA 3OZSA 3LRPA 1IVNA 3SYLA 4P25A 1IMJA 4OXYA 4TQGA 5IH7A 3ICEA 2GREA 3AEKA 4ZOLF 1AKMA 3H87A 3C6YA 4K9NA 3W90A 3FRJA 2PMDA 3WK6A 3ZUPA 4AY5A 1JEQA 2ODAA 3TECE 4QVJA 1WTCA 4F5DA 4LI0A 3F5DA 3G9TA 4CFYA 2PUCA 4TZTA 3FWNA 4KRFA 5ALDA 2B36A 3U3MA 1N9GB 4KMSA 1OJ7A 5JYDA 1L9KA 2C84A 2D2VA 2P41A 4JNKA 1LDMA 4HBGA 2VXCA 4WH0A 5AW5A 1GN8A 5T6MA 3TOVA 5G40A 5A7HA 4QOIA 2BM1A 4PC1A 4DMHA 3U3DA 4Z4TA 4LQDA 3FYUA 3HADA 2CJPA 3VC1A 3CTMA 5CYOA 1L5SA 4B76A 5HKLA 1KGDA 2IYQA 3ZX5A 4I14A 1FE8A 4QHYA 3D1LA 1BNCA 2EFJA 3AVOA 2ZVPX 2JJ8A 2PK3A 3V80A 4DNOA 4ZVTA 1DIOB 2JGRA 4IS2A 3IURA 3OM0A 3TQSA 3A31A 5BNWA 1OFTA 2IY9A 3DE0X 3H9UA 3PFNA 5TARA 5TX7A 4O4JF 2H8GA 2FPXA 2CHVA 1G41A 3K1YA 3ZYZA 4D3FA 3NM4A 1AN0A 2HJWA 4LZWA 1VCHA 4P34A 1JHYA 2PL1A 5BSKA 3LBYA 2Z08A 4DJ5X 2VOEA 1ZD4A 4L4XA 4EY3A 1EIWA 1BS1A 3F3KA 1G9TA 4W82A 2UUBB 1HSOA 4AJOA 4P83A 4MWSA 1Q1QA 3TBHA 2I6QA 5T8KA 3PTZA 3B60A 4XAQA 2HIHA 4KVAA 4C7JA 2OXFA 2QB5A 1UZUA 3EVBA 1U2EA 2HA5A 1ZRMA 1RMYA 2NZYA 3JWJA 4BLQA 1YHNA 1JQKA 2EL7A 5CITA 3EE6A 3GP3A 5JARA 4PG5A 3EGEA 4HQRA 4P4UA 3VUEA 1R6BX 3DULA 4EW1A 3QLUA 1P7ZA 3RTAA 1D7OA 2ZT6A 4B3DA 3NC1C 4NOLA 2OBLA 3W9UA 5HJ7A 1NMQA 3O93A 1DV1A 4DSZA 1UBCA 4N9WA 5IZCC 1OAKA 1SZDA 2ZROA 4FDVA 4R8MA 2ZZEA 1ISJA 1LQ2A 3LQ2A 4EYKA 4CL8A 2O2GA 2UXBB 2AN9A 2PRYA 4L78A 3HWX1 4LG1A 3I8XA 4REOA 4D8YA 4Q7QA 1DIAA 3IALA 4MMXB 4CWAA 1TIPA 4LYGA 4JLPA 4HNTA 5IM4A 1OWOA 3RVQA 1SOAA 3PHIA 2OBMA 3HA3A 3D8SA 2X8JB 3S55A 2CFTA 4RUKA 4XOIA 1I3OA 4JLDA 1VXOA 3MRXA 5BURA 4JBNA 3EH2A 2X0JA 3KE8A 2P65A 3TINA 5A2QA 1BXKA 3V1MA 4OAOA 1QIKA 3ILHA 2IU4A 1HMYA 4GP9A 4IBOA 3GJQA 4X7FA 3RSHA 2DIEA 2H8KA 5KWEA 2CEKA 2LXNA 4KODA 3CNNA 4OXIA 4YJGB 5KUTA 1F2DA 1ZESA 3IX7A 4UM9D 1Z5UA 2ZXIA 5LA6B 4DXAA 1Q7EA 2QJTA 2VPPA 2OORC 5A9SB 1C2TA 5ALWA 2W6QA 1TVMA 2FLKA 3L9XA 4MEJA 4ABTA 2FPMA 2ZITA 4E51A 2Q5FA 1QIMA 1A71A 2ACWA 2LBPA 2ZSKA 2QAIA 1TRHA 2CK3D 3IOBA 2A0KA 1E6EA 4LZOA 4YBZA 1JXAA 4B3MB 1N5LA 3ASYA 5D51S 2F43B 1BOFA 4TWRA 1CW2B 5IMSA 2A0FA 4EF5A 4Z4QA 1PT5A 3GGGA 5I7EA 1Y3FE 1CPYA 4C4AA 1MJHA 2B8NA 3EEBA 2PR2A 1G7SA 3GPIA 2O5VA 1V1RB 1DLJA 3G88A 1ZOSA 5H4HA 2P3LA 3T9EA 3IXMA 5CYPA 4OUKX 2YWFA 1Z2OX 1Z34A 2G0NA 3GDOA 2QQGA 3U3OA 2EDAA 1HOTA 1W5FA 2QLFA 3FFWA 3Q41A 4LX0A 4Q00A 3Q87B 4XWAA 4K0KB 4M83A 3LPCA 1OILA 1TECE 3W9BA 1ES9A 4F97A 3V1KA 1UUFA 3GJTA 1FOEB 3L5KA 3BEDA 1LLCA 1DWOA 4MRSA 2FRDC 5FOXA 1F2UB 1F4LA 3ZW8A 1L5VA 3UUGA 2JK1A 2Q2QA 2W7TA 3DOCA 2FG6C 4YB8A 2C77A 4AD8A 3ZDXB 1YB1A 1YZHA 2V7GA 2B25A 4H9GA 3NPAA 4P3NA 5BQOA 5F2EA 3OOCA 4XYMA 2PSFA 4WKNA 1TUEA 5BN5A 2FSSA 2JFZA 3GRYA 4RSMA 3NXSA 3IAS1 4PPNA 3BEOA 2PZLA 2XZDA 3CCUB 1BS9A 2X58A 1Z0KA 1D04A 4DOMA 3I2KA 2R4UA 3QP9A 1VQNB 4GKVA 4RKQA 1G1AA 1G8GA 1W85B 4R2HA 2R86A 4RACA 1DBPA 1TZJA 1MEJA 3BSWA 3PHJA 1D2NA 4L9AA 2BCEA 3FZYA 1XQXA 2SKCA 1G42A 3MWDA 2ANBA 3LHSA 4PBRA 3WZLA 5JCJA 4Z1MA 2YJ4A 3AJAA 2PZBA 1XVIA 2B2CA 3MOGA 3BHJA 4DLLA 4Z4HA 3MB8A 2A0WA 4DL9A 4FVTA 1CJKC 3G9UA 4ND7A 4QGBA 1QIHA 3N2IA 4G97A 4EJSC 5LYJB 1LBHA 2PBLA 2W4IA 3ASUA 4Y2HA 3C4QA 5CW1A 3ESBA 5PNTA 1KRWA 2JFHA 1C4XA 1WXGA 3U62A 5HHTA 1HT2E 4RELA 3H5IA 1UR5A 4RJJA 3AVVA 2E6UX 2ZM5A 5LXTB 3KK0A 1IZZA 2F1JA 2P35A 3DKVA 3EIUA 1RJWA 3JR7A 3U39A 1UT6A 1NW3A 2ID9A 3KKEA 4GECA 1EK1A 2AUTA 2Q45A 3JARB 3DL7A 1XHLA 3K9WA 1SXJD 3KVVA 1AQJA 4N0PA 2IV3A 4FHFA 3R5XA 2DUJA 3UANA 4MZDA 4EAQA 2B5VA 5LZ7A 2R8XA 2I66A 2OBBA 4H3SA 3WLPA 3PX3A 1E1MA 3I30X 5HZGA 4PZPA 2HCTA 1R8XA 3V2HA 1PFVA 2AYXA 1FRQA 2W6CX 3QYAA 4C88A 3WY9A 4PLPA 3TTWA 5JS8A 3GMTA 4JAVC 2QP3A 4DCMA 4DVGA 2B5WA 4IH4A 3IHLA 5DK6A 5B7GA 4DDWA 4UARA 3SHQA 4JS0A 5CYFA 4KGXA 3ROMA 4Z51A 3FWHA 4UUNA 2P5YA 4RL4A 1UDAA 4WPGA 3RWOA 3PC7A 2YHIA 1X1BA 3A27A 4UTXA 4DIDA 3FDXA 2PFGA 4LJ6A 1EBBA 1RT9A 3AHEA 4GLLA 5A88A 1M6VB 2YIJA 4I5FA 2EKDA 2O3SA 4UDNA 1OAAA 1W5SA 3ESAA 3GCGA 1UKVY 3M6FA 2QYHA 2GKSA 3N9IA 3ACCA 1KY4A 5CNKA 4NXMB 5JNSA 4G24A 1AK1A 5IBPA 1W75A 2E18A 4MWOA 3GJ5A 4NCXA 2VP6A 3DYVA 5CT9A 1VCNA 1R4ZA 1T8RA 5AK3A 2X4LA 3KYCB 4ATNA 5BMVA 2LTAA 1U0BB 1X7GA 2WG2A 2ZVDA 1MQ9A 3G3EA 3LBNA 3RO7A 2UVPA 4ZHSA 5KNCH 5L53A 1YZNA 2GK4A 1STOA 3GIWA 3L4JA 4CQMA 4XE5A 2IBMA 1A7UA 2XEXA 2ATEA 4WZEA 4XN0A 2DH6A 5JADA 4V0QA 2G3YA 2PMFA 4B5LA 2WB2A 4OK5A 4LVCA 3WK4A 4PAWA 3W6ZA 4HZGA 4EB3A 4TYMA 1BXZA 2CDCA 1T4BA 2YV2A 4RGVA 4ZRMA 4BWVA 5CFRA 1WY7A 4RDIA 4H7JA 1PX0A 1XCJA 2BR5A 3IKMB 1FP6A 1RYMA 1SXJE 4BX9A 4CF6A 4YN3A 3RWMB 4ZI3A 5EXDA 3EXHA 3RYHB 1TX4B 2X4IA 3QE0A 5KPDA 2YNMD 5JLAA 4UBLA 5AKYA 5G3ZA 1IAQA 3N8DA 1OBVA 5JRDS 2EP8A 3AF5A 5JY6A 1G7CA 3H5VA 2YY5A 1JLMA 4YRZA 5FHRA 4Y2JA 4DCUA 2R1TB 4XPIA 2VP9A 1DKLA 5E1DA 2JGLA 1W88A 1J8DA 3IQWA 4G1FA 1NN5A 3QHAA 4RDHA 4AJ4A 5IFKA 2PX0A 1V9CA 2KLHA 1ZKDA 2FHPA 4NJOA 2B92A 1BCSA 1EWKA 2N47A 3AR7A 4KQHA 2G71A 3KHKA 4PLTA 5HSGA 1UDBA 3KZCA 2NO0A 1JQ5A 1S6YA 5K03A 2O1WA 2DFVA 2NU7A 3E7XA 1PR9A 3LX5A 3FETA 5HXAA 2O8BA 5BVGB 4OA5A 4AS3A 3V1TC 3MXOA 4ND8A 4CDRA 4JB2A 1CRLA 2RSLA 5IXJA 3ZBUA 3FNEA 2H6EA 3WL7A 1IATA 3L6OO 4HJRA 4I5GA 4GF5A 4HLUC 1KOFA 1NJ5A 4KQ2A 3BJRA 2TSYB 3D7MA 1RRGA 1A8HA 2H0QA 3QXXA 4IMPA 3UXYA 4EFLA 3TL2A 2WMYA 4IDGA 3EQ6A 4BNDB 4MYSA 1WUTA 2Q0XA 4N39A 1FBNA 4J3NA 3TSOA 3R9WA 1QIIA 3SYNA 3ER8A 3NBAA 4H08A 3AVTA 4UEKA 3NFRA 5P8WA 1PJQA 2CMHA 5JJBA 2ZZKA 3SHVA 4FXUA 3FCUB 3IMEA 2OCXA 3OHPA 3KP1A 4OHYA 1BSVA 4X1YA 3JYQA 1TKRA 2JA1A 1H85A 2XE7A 2XPCA 5CFPA 4TYNA 1R5JA 1LBTA 1ZIOA 2HRZA 2PCJA 3D54D 3LX6A 3OEED 1PJAA 4JI3B 3BN3A 2JLVA 1GVNB 2Q99A 3M8KA 3OIUA 1AMUA 4H7FA 2HCJB 1VZ2A 4M21A 1T8SA 4NP6A 1TK9A 2ZW9A 2C9DA 3UGKA 2PBRA 3MMXA 2ZDGA 3USZA 4AB1A 4QIHA 4DNPA 1EP9A 1JUDA 5AN9A 4W5JA 2RHTA 3VPDA 2PKQO 2GBFA 1KIFA 2XZTA 2AE1A 3H8VA 3U5ZB 4YV1A 3DMYA 1F0YA 2M6KA 5CDFE 1DADA 3RJ5A 3UFXA 2QY6A 1T2AA 3EA0A 5HFNA 5KQSA 2JIPA 2CFSA 3KBOA 1EEXB 1FP4A 4M38A 4F96A 3JZMA 1RLIA 1V37A 3CVUA 4M89A 1USVA 1XQ9A 2OE2A 4FHEA 3RU2A 5C53B 3INRA 2NP7A 5FLKA 3HYNA 3QXCA 2DB3A 2VBSA 4GI5A 3CWZA 5HA5A 3LHDA 4HDMA 4PHFA 1W0JA 1FS4A 3GAFA 2DCMA 3KWLA 3MJEA 5CD9A 3KCQA 3IP9A 4RHFA 4UXIA 1NF2A 5CNIA 4OLJA 4BMNA 3WIVA 4X07A 1CWUA 3T9BA 3G5TA 1NM5C 1XRSB 1MQAA 1I6KA 4HB4A 1LW6E 4YLEA 3A10A 3Q2OA 4B45A 3T3EA 5H59A 1YKFA 2GARA 1EDEA 1V8OA 2HV9A 2AF4C 2IXGA 1H8HD 3LDHA 4G5XA 4F8EA 5JNWA 2JB9A 1G3QA 4Q12A 4XIJA 3N6RA 1KL7A 2VQ3A 3O2NA 4AIRA 3FVVA 4D9NA 3UFBA 2WD9A 3FLEA 4I66A 1MT3A 4AZTA 2ATCA 1VOTA 1VIAA 5DBGA 3CVYA 1Z56C 1J2UA 1YA4A 1OT5A 3EB9A 4TS9A 1P3JA 1FXWF 5IWAB 3UPTA 5I5GA 4D0RA 4RA9A 4DUGD 3T5BA 1MKYA 2FW9A 1OB5A 1EYZA 3NUQA 4HGQA 5FBZA 5KCMA 4ZCPA 3P0RA 4MINA 2EG9A 5CRIA 1L4UA 4RK0A 4HEQA 1NVVQ 1HZEA 1GO2A 3LQRA 5HKKA 2BMAA 5F21A 3B6IA 2PTGA 1DAOA 1R8YA 2IY7A 3HR8A 4PLFA 4MV0A 1J2JA 4A8PA 2IDKA 4V02A 3UJ9A 3WB1A 4EG7A 4EW3A 5F4JA 3R6TA 1X2BA 4K9RA 1CQJA 1CBUA 3DDHA 2Z09A 2V7UA 3QE4A 4O0LA 4GM4A 3D8BA 4EZEA 4I6EA 5IN5A 4TSRA 1IUOA 1F5SA 2ZBRA 1J7JA 4DJJA 4EMTA 3FW1A 3CHYA 3CRRA 1T8PA 3HCAA 1V6SA 1CXZA 4MUAA 2W2PA 1P60A 4BEJA 1WE2A 2PWAA 3USCS 1COZA 5EEGA 5DW3A 1B6SA 3KNZA 1QYIA 4WBNB 3KTOA 4NTZA 3HAGA 2ZWOA 3PE3A 1USIA 3GLTA 3K0FA 4GPBA 3BMNB 5AKJA 3ZV4A 1AS3A 3SBXA 1NKSA 2CSUA 1QV9A 3HFSA 2OZLB 4YI5A 4WD3A 5AUPB 1AC5A 2OHGA 3C6ZA 5J5AA 3SM9A 4D5EA 1V5GA 3O0DA 3SYTA 5EJ9A 4RPIA 3JYLA 3OECA 3PGA1 1TT5A 2V45A 1KYWA 2PRZA 5TT1A 4F2WA 1YQWA 2LR0A 2XMZA 4WNCA 2X1HA 2GYVA 1E89A 1UWCA 2JLYA 1P0PA 2GZ1A 2CMKA 5IF9A 1Q11A 2XNDD 4TTQA 3SNHA 5CDGA 3B2EA 3D9QX 1TLTA 3OAAD 3C43A 5EZYB 1K75A 2JJYA 5GMOA 3PSAA 5LR6A 3GGSA 4YDSA 5I7RA 1FYDA 2YWDA 3GUCA 4RDLA 5T57A 3TSCA 5JI2E 1YI2B 3NU1A 3ZD7A 3KPYA 5LBIA 1G5HA 1PJ5A 3MTGA 4JK3A 3MW8A 4YAFA 4GWLA 2C29D 4GKBA 2HUPA 5ENVA 1PBTA 1JQLB 2V9CA 4GE3A 4XUGB 4C7KA 4ARBA 2Q62A 3COSA 1B14A 4FS3A 5HMLA 3BC1A 3A9RA 3KQVA 4AZVA 4F1WA 4FE4A 5EIFA 1E5LA 1SQGA 5JS7A 1OIVA 3WGYA 1C1XA 4KYUA 3NO4A 1GAXA 4CLRA 1B0AA 1OYYA 2VJCA 4YELA 1TM4E 2P67A 2V7PA