4QI9A

Crystal structure of dihydrofolate reductase from yersinia pestis complexed with methotrexate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
167
structure length
158
Chain Sequence
MIISLIAALAADRVILPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLNIVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEVGGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERRGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dihydrofolate reductase from Yersinia pestis complexed with methotrexate
rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Yersinia pestis
total genus 41
structure length 158
sequence length 167
chains with identical sequence B, C
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4qi9A00
3IA4A 3SRWX 1DDRA 3NXOA 3QLSA 2D5NA 1RH3A 1J3JA 2W9HA 3OCHA 4XT8A 3JWKA 1HFPA 3FRBX 4KJJA 5DFRA 5HT4A 5CC9A 4KD7A 3KFYA 4KNEA 4P3RA 1S3WA 2W3VA 4XRBA 1DHIA 4RGCA 4P68A 3SA1A 2W3MA 4Q6AA 1AI9A 2ANQA 4H98A 3QLRA 4XT4A 4IXGX 1AOEA 1YHOA 2W9GA 1KMVA 4ECKA 1RX7A 3DL5A 5HF0X 4H97A 4DDRA 3NZCX 1DDSA 2ANOA 2C2SA 5ECXA 7DFRA 4KM2A 3RG9A 4EIGA 4CD2A 3I8AX 4HA7A 4X5JA 4EILA 2QK8A 2AZNA 3FQOA 4PSSA 4M2XA 1CZ3A 3CD2A 3QLYA 4IXED 1LUDA 4X5GA 3TQBA 2C2TA 4XT5A 3QL3A 3EEKA 3OAFA 1RA2A 1DLSA 4ELEA 4IXFX 3NZDA 4HOEA 3IRNA 3M09A 6DFRA 1BOZA 1RX1A 1DR4A 1M79A 4H96A 4QJCA 4PDJA 3FL9A 5DXVA 4GH8A 3ZPGA 4ELGA 3UM5A 1KLKA 3SR5X 1DG5A 1CD2A 3S7AA 1TDRA 1RX6A 4KYAA 3NZBX 5HI6A 3CL9A 1DF7A 2DRCA 1RX9A 4DFRA 3NXRA 3F0SX 1LY4A 3F0XX 3RO9A 1OHKA 3FQFA 2OIPA 2HM9A 3FY9X 3DATA 2CD2A 3E0BA 4I1NA 1DYRA 4XECX 5JA3A 1U71A 3KGYA 4DPHA 4I13A 1DRHA 4XE6X 1DHJA 1IA1A 3HJ3A 3N0HA 3DFRA 3TQ9A 2CIGA 3JTWA 3GHVA 4LEKX 3QLXA 1DR3A 5HUIA 1JOLA 5U26A 1M7AA 1D1GA 3ROAA 5HQZA 4QHVA 4KLXA 3CLBA 3JWMA 1DYHA 2W3AA 2B3ZA 5JG0X 4HOFA 3EIGA 3SA2A 4KAKA 1RX3A 4OSGA 4EJ1A 1DR1A 3L3RA 2W9TA 4LAGX 1DYJA 1RA8A 3EEMA 1HFQA 1RA9A 1DG8A 3JWCA 3NXTA 3NU0A 3FREX 1RX5A 3VCOA 3D80A 1RC4A 5CCCA 1DR2A 1U70A 3JW3A 3SQYX 3FYVX 2LF1A 2L28A 1RA1A 3GI2A 4KJKA 4OR7A 3GYFA 4G95A 4FGHA 3DL6A 3FY8X 4Q0EA 3UM8A 3FQVA 1S3UA 4PSTA 5HT5A 1BZFA 4M6JA 1IA2A 3F8ZA 5ECCA 4X5HA 4FHBA 1AO8A 1DR5A 1RB3A 4PSYA 1OHJA 4HOGA 3IROA 3DRCA 3Q1HA 1HFRA 3ZPCA 3EEJA 4FGGA 4Q67A 3IA5A 1DLRA 3INVA 3F8YA 2OBCA 3D84X 4KFJA 1RE7A 4KY4A 3SRSX 1S3YA 2H2QA 3FQ0A 3NZ9X 4DP3A 1DRAA 3GHWA 4KM0A 1IA3A 3QLWA 3FRDX 4QLFA 3NTZA 1MVSA 3UM6A 3R33A 2D0KA 5FDAA 4LAEX 2BL9A 3QL0A 3TQ8A 5E8QA 4ELFA 4ELHA 2GD9A 3EX8A 1RX8A 3DG8A 3FRFX 3K47A 3F0VX 4KJLA 1VDRA 1ZDRA 3F0BX 5U27A 3DAUA 1RA3A 2FZIA 4QLEA 5HVBA 1DRFA 3K45A 1S3VA 4NX7A 5HSUA 1VJ3A 3F0QX 3FYWX 1DR7A 2DHFA 3FL8A 4KBNA 3NZ6X 3NXXA 1RD7A 2ITHA 2BLBA 3JWFA 8DFRA 3S3VA 1J3KA 5HSRA 1DISA 3NZAX 1QZFA 3TQAA 2W3WA 3FS6A 3KY8A 5HPBA 1JUVA 4NX6A 4M7UA 2BLAA 3IX9A 2P4GA 3I3RA 1DR6A 1DREA 4QI9A 3M08A 1RG7A 1SEJA 5HVEA 2BLCA 4KEBA 3FRAX 5HF2X 3SRRX 4M7VA 3FQCA 3QYOA 4Q0DA 3LG4A 4M6KA 1PD9A 3JW5A 3S9UA 4H95A 4HA9A 3QGTA 3NRRA 1MVTA 3QLZA 2O7PA 1U72A 4QJZD 4KY8A 4ELBA 3SGYA 3DGAA 1IA4A 1JOMA 3KJRA 3SH2A 3EELA 1DHFA 3QG2A 3NXYA 2FZJA 3CSEA 4DPDA 4P66A 1RF7A 4X5IA 4X5FA 2KGKA 3SRUX 5HQYA 1M78A 3JVXA 4XT6A 3F0UX 1PDBA 1RX2A 3QYLA 2ZZAA 2HQPA 2W3BA 2W9SA 1DYIA 2INQA 4TU5X 1E26A 4G8ZX 3JSUA 3KJSA 3K2HA 4LAHX 4QLGA 2XW7A 1DRBA 3QFXA 4KL9A 1DIUA 1LY3A 1J3IA 1DAJA 3HBBA 3FQZA 3IRMA 3NXVA 4EIZA 3K74A 4PTJA 4PTHA 5EAJA 4XT7A 1RB2A 3GHCA 1DG7A 4P3QA 2JYBA 3F91A 4G3MA 3SRQX 1KMSA 2G6VA 2HXVA 1PD8A 1RX4A 3TD8A 2FZHA 4M6LA 3SAIA
chains in the Genus database with same CATH superfamily
3IA4A 3SRWX 1DDRA 3NXOA 3QLSA 2D5NA 1RH3A 1J3JA 2W9HA 3OCHA 4XT8A 3JWKA 1HFPA 3FRBX 4KJJA 5DFRA 5HT4A 5CC9A 4KD7A 3KFYA 4KNEA 4P3RA 1S3WA 2W3VA 4XRBA 1DHIA 4RGCA 4P68A 3SA1A 2W3MA 4Q6AA 1AI9A 2ANQA 4H98A 3QLRA 4XT4A 4IXGX 1AOEA 1YHOA 2W9GA 1KMVA 4ECKA 1RX7A 3DL5A 5HF0X 4H97A 4DDRA 3NZCX 1DDSA 2ANOA 2C2SA 5ECXA 7DFRA 4KM2A 3RG9A 4EIGA 4CD2A 3I8AX 4HA7A 4X5JA 4EILA 2QK8A 2AZNA 3FQOA 4PSSA 4M2XA 1CZ3A 3CD2A 3QLYA 4IXED 1LUDA 4X5GA 3TQBA 2C2TA 4XT5A 3QL3A 3EEKA 3OAFA 1RA2A 1DLSA 4ELEA 4IXFX 3NZDA 4HOEA 3IRNA 3M09A 6DFRA 1BOZA 1RX1A 1DR4A 1M79A 4H96A 4QJCA 4PDJA 3FL9A 5DXVA 4GH8A 3ZPGA 4ELGA 3UM5A 1KLKA 3SR5X 1DG5A 1CD2A 3S7AA 1TDRA 1RX6A 4KYAA 3NZBX 5HI6A 3CL9A 1DF7A 2DRCA 1RX9A 4DFRA 3NXRA 3F0SX 1LY4A 3F0XX 3RO9A 1OHKA 3FQFA 2OIPA 2HM9A 3FY9X 3DATA 2CD2A 3E0BA 4I1NA 1DYRA 4XECX 5JA3A 1U71A 3KGYA 4DPHA 4I13A 1DRHA 4XE6X 1DHJA 1IA1A 3HJ3A 3N0HA 3DFRA 3TQ9A 2CIGA 3JTWA 3GHVA 4LEKX 3QLXA 1DR3A 5HUIA 1JOLA 5U26A 1M7AA 1D1GA 3ROAA 5HQZA 4QHVA 4KLXA 3CLBA 3JWMA 1DYHA 2W3AA 2B3ZA 5JG0X 4HOFA 3EIGA 3SA2A 4KAKA 1RX3A 4OSGA 4EJ1A 1DR1A 3L3RA 2W9TA 4LAGX 1DYJA 1RA8A 3EEMA 1HFQA 1RA9A 1DG8A 3JWCA 3NXTA 3NU0A 3FREX 1RX5A 3VCOA 3D80A 1RC4A 5CCCA 1DR2A 1U70A 3JW3A 3SQYX 3FYVX 2LF1A 2L28A 1RA1A 3GI2A 4KJKA 4OR7A 3GYFA 4G95A 4FGHA 3DL6A 3FY8X 4Q0EA 3UM8A 3FQVA 1S3UA 4PSTA 5HT5A 1BZFA 4M6JA 1IA2A 3F8ZA 5ECCA 4X5HA 4FHBA 1AO8A 1DR5A 1RB3A 4PSYA 1OHJA 4HOGA 3IROA 3DRCA 3Q1HA 1HFRA 3ZPCA 3EEJA 4FGGA 4Q67A 3IA5A 1DLRA 3INVA 3F8YA 2OBCA 3D84X 4KFJA 1RE7A 4KY4A 3SRSX 1S3YA 2H2QA 3FQ0A 3NZ9X 4DP3A 1DRAA 3GHWA 4KM0A 1IA3A 3QLWA 3FRDX 4QLFA 3NTZA 1MVSA 3UM6A 3R33A 2D0KA 5FDAA 4LAEX 2BL9A 3QL0A 3TQ8A 5E8QA 4ELFA 4ELHA 2GD9A 3EX8A 1RX8A 3DG8A 3FRFX 3K47A 3F0VX 4KJLA 1VDRA 1ZDRA 3F0BX 5U27A 3DAUA 1RA3A 2FZIA 4QLEA 5HVBA 1DRFA 3K45A 1S3VA 4NX7A 5HSUA 1VJ3A 3F0QX 3FYWX 1DR7A 2DHFA 3FL8A 4KBNA 3NZ6X 3NXXA 1RD7A 2ITHA 2BLBA 3JWFA 8DFRA 3S3VA 1J3KA 5HSRA 1DISA 3NZAX 1QZFA 3TQAA 2W3WA 3FS6A 3KY8A 5HPBA 1JUVA 4NX6A 4M7UA 2BLAA 3IX9A 2P4GA 3I3RA 1DR6A 1DREA 4QI9A 3M08A 1RG7A 1SEJA 5HVEA 2BLCA 4KEBA 3FRAX 5HF2X 3SRRX 4M7VA 3FQCA 3QYOA 4Q0DA 3LG4A 4M6KA 1PD9A 3JW5A 3S9UA 4H95A 4HA9A 3QGTA 3NRRA 1MVTA 3QLZA 2O7PA 1U72A 4QJZD 4KY8A 4ELBA 3SGYA 3DGAA 1IA4A 1JOMA 3KJRA 3SH2A 3EELA 1DHFA 3QG2A 3NXYA 2FZJA 3CSEA 4DPDA 4P66A 1RF7A 4X5IA 4X5FA 2KGKA 3SRUX 5HQYA 1M78A 3JVXA 4XT6A 3F0UX 1PDBA 1RX2A 3QYLA 2ZZAA 2HQPA 2W3BA 2W9SA 1DYIA 2INQA 4TU5X 1E26A 4G8ZX 3JSUA 3KJSA 3K2HA 4LAHX 4QLGA 2XW7A 1DRBA 3QFXA 4KL9A 1DIUA 1LY3A 1J3IA 1DAJA 3HBBA 3FQZA 3IRMA 3NXVA 4EIZA 3K74A 4PTJA 4PTHA 5EAJA 4XT7A 1RB2A 3GHCA 1DG7A 4P3QA 2JYBA 3F91A 4G3MA 3SRQX 1KMSA 2G6VA 2HXVA 1PD8A 1RX4A 3TD8A 2FZHA 4M6LA 3SAIA
chains in the Genus database with same CATH topology
3IA4A 3SRWX 1DDRA 3NXOA 3QLSA 2D5NA 1RH3A 1J3JA 2W9HA 3OCHA 4XT8A 3JWKA 1HFPA 3FRBX 4KJJA 5DFRA 5HT4A 5CC9A 4KD7A 3KFYA 4KNEA 4P3RA 1S3WA 2W3VA 4XRBA 1DHIA 4RGCA 4P68A 3SA1A 2W3MA 4Q6AA 1AI9A 2ANQA 4H98A 3QLRA 4XT4A 4IXGX 1AOEA 1YHOA 2W9GA 1KMVA 4ECKA 1RX7A 3DL5A 5HF0X 4H97A 4DDRA 3NZCX 1DDSA 2ANOA 2C2SA 5ECXA 7DFRA 4KM2A 3RG9A 4EIGA 4CD2A 3I8AX 4HA7A 4X5JA 4EILA 2QK8A 2AZNA 3FQOA 4PSSA 4M2XA 1CZ3A 3CD2A 3QLYA 4IXED 1LUDA 4X5GA 3TQBA 2C2TA 4XT5A 3QL3A 3EEKA 3OAFA 1RA2A 1DLSA 4ELEA 4IXFX 3NZDA 4HOEA 3IRNA 3M09A 6DFRA 1BOZA 1RX1A 1DR4A 1M79A 4H96A 4QJCA 4PDJA 3FL9A 5DXVA 4GH8A 3ZPGA 4ELGA 3UM5A 1KLKA 3SR5X 1DG5A 1CD2A 3S7AA 1TDRA 1RX6A 4KYAA 3NZBX 5HI6A 3CL9A 1DF7A 2DRCA 1RX9A 4DFRA 3NXRA 3F0SX 1LY4A 3F0XX 3RO9A 1OHKA 3FQFA 2OIPA 2HM9A 3FY9X 3DATA 2CD2A 3E0BA 4I1NA 1DYRA 4XECX 5JA3A 1U71A 3KGYA 4DPHA 4I13A 1DRHA 4XE6X 1DHJA 1IA1A 3HJ3A 3N0HA 3DFRA 3TQ9A 2CIGA 3JTWA 3GHVA 4LEKX 3QLXA 1DR3A 5HUIA 1JOLA 5U26A 1M7AA 1D1GA 3ROAA 5HQZA 4QHVA 4KLXA 3CLBA 3JWMA 1DYHA 2W3AA 2B3ZA 5JG0X 4HOFA 3EIGA 3SA2A 4KAKA 1RX3A 4OSGA 4EJ1A 1DR1A 3L3RA 2W9TA 4LAGX 1DYJA 1RA8A 3EEMA 1HFQA 1RA9A 1DG8A 3JWCA 3NXTA 3NU0A 3FREX 1RX5A 3VCOA 3D80A 1RC4A 5CCCA 1DR2A 1U70A 3JW3A 3SQYX 3FYVX 2LF1A 2L28A 1RA1A 3GI2A 4KJKA 4OR7A 3GYFA 4G95A 4FGHA 3DL6A 3FY8X 4Q0EA 3UM8A 3FQVA 1S3UA 4PSTA 5HT5A 1BZFA 4M6JA 1IA2A 3F8ZA 5ECCA 4X5HA 4FHBA 1AO8A 1DR5A 1RB3A 4PSYA 1OHJA 4HOGA 3IROA 3DRCA 3Q1HA 1HFRA 3ZPCA 3EEJA 4FGGA 4Q67A 3IA5A 1DLRA 3INVA 3F8YA 2OBCA 3D84X 4KFJA 1RE7A 4KY4A 3SRSX 1S3YA 2H2QA 3FQ0A 3NZ9X 4DP3A 1DRAA 3GHWA 4KM0A 1IA3A 3QLWA 3FRDX 4QLFA 3NTZA 1MVSA 3UM6A 3R33A 2D0KA 5FDAA 4LAEX 2BL9A 3QL0A 3TQ8A 5E8QA 4ELFA 4ELHA 2GD9A 3EX8A 1RX8A 3DG8A 3FRFX 3K47A 3F0VX 4KJLA 1VDRA 1ZDRA 3F0BX 5U27A 3DAUA 1RA3A 2FZIA 4QLEA 5HVBA 1DRFA 3K45A 1S3VA 4NX7A 5HSUA 1VJ3A 3F0QX 3FYWX 1DR7A 2DHFA 3FL8A 4KBNA 3NZ6X 3NXXA 1RD7A 2ITHA 2BLBA 3JWFA 8DFRA 3S3VA 1J3KA 5HSRA 1DISA 3NZAX 1QZFA 3TQAA 2W3WA 3FS6A 3KY8A 5HPBA 1JUVA 4NX6A 4M7UA 2BLAA 3IX9A 2P4GA 3I3RA 1DR6A 1DREA 4QI9A 3M08A 1RG7A 1SEJA 5HVEA 2BLCA 4KEBA 3FRAX 5HF2X 3SRRX 4M7VA 3FQCA 3QYOA 4Q0DA 3LG4A 4M6KA 1PD9A 3JW5A 3S9UA 4H95A 4HA9A 3QGTA 3NRRA 1MVTA 3QLZA 2O7PA 1U72A 4QJZD 4KY8A 4ELBA 3SGYA 3DGAA 1IA4A 1JOMA 3KJRA 3SH2A 3EELA 1DHFA 3QG2A 3NXYA 2FZJA 3CSEA 4DPDA 4P66A 1RF7A 4X5IA 4X5FA 2KGKA 3SRUX 5HQYA 1M78A 3JVXA 4XT6A 3F0UX 1PDBA 1RX2A 3QYLA 2ZZAA 2HQPA 2W3BA 2W9SA 1DYIA 2INQA 4TU5X 1E26A 4G8ZX 3JSUA 3KJSA 3K2HA 4LAHX 4QLGA 2XW7A 1DRBA 3QFXA 4KL9A 1DIUA 1LY3A 1J3IA 1DAJA 3HBBA 3FQZA 3IRMA 3NXVA 4EIZA 3K74A 4PTJA 4PTHA 5EAJA 4XT7A 1RB2A 3GHCA 1DG7A 4P3QA 2JYBA 3F91A 4G3MA 3SRQX 1KMSA 2G6VA 2HXVA 1PD8A 1RX4A 3TD8A 2FZHA 4M6LA 3SAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IA4 A;  3SRW X;  1DDR A;  3NXO A;  3QLS A;  2D5N A;  1RH3 A;  1J3J A;  2W9H A;  3OCH A;  4XT8 A;  3JWK A;  1HFP A;  3FRB X;  4KJJ A;  5DFR A;  5HT4 A;  5CC9 A;  4KD7 A;  3KFY A;  4KNE A;  4P3R A;  1S3W A;  2W3V A;  4XRB A;  1DHI A;  4RGC A;  4P68 A;  3SA1 A;  2W3M A;  4Q6A A;  1AI9 A;  2ANQ A;  4H98 A;  3QLR A;  4XT4 A;  4IXG X;  1AOE A;  1YHO A;  2W9G A;  1KMV A;  4ECK A;  1RX7 A;  3DL5 A;  5HF0 X;  4H97 A;  4DDR A;  3NZC X;  1DDS A;  2ANO A;  2C2S A;  5ECX A;  7DFR A;  4KM2 A;  3RG9 A;  4EIG A;  4CD2 A;  3I8A X;  4HA7 A;  4X5J A;  4EIL A;  2QK8 A;  2AZN A;  3FQO A;  4PSS A;  4M2X A;  1CZ3 A;  3CD2 A;  3QLY A;  4IXE D;  1LUD A;  4X5G A;  3TQB A;  2C2T A;  4XT5 A;  3QL3 A;  3EEK A;  3OAF A;  1RA2 A;  1DLS A;  4ELE A;  4IXF X;  3NZD A;  4HOE A;  3IRN A;  3M09 A;  6DFR A;  1BOZ A;  1RX1 A;  1DR4 A;  1M79 A;  4H96 A;  4QJC A;  4PDJ A;  3FL9 A;  5DXV A;  4GH8 A;  3ZPG A;  4ELG A;  3UM5 A;  1KLK A;  3SR5 X;  1DG5 A;  1CD2 A;  3S7A A;  1TDR A;  1RX6 A;  4KYA A;  3NZB X;  5HI6 A;  3CL9 A;  1DF7 A;  2DRC A;  1RX9 A;  4DFR A;  3NXR A;  3F0S X;  1LY4 A;  3F0X X;  3RO9 A;  1OHK A;  3FQF A;  2OIP A;  2HM9 A;  3FY9 X;  3DAT A;  2CD2 A;  3E0B A;  4I1N A;  1DYR A;  4XEC X;  5JA3 A;  1U71 A;  3KGY A;  4DPH A;  4I13 A;  1DRH A;  4XE6 X;  1DHJ A;  1IA1 A;  3HJ3 A;  3N0H A;  3DFR A;  3TQ9 A;  2CIG A;  3JTW A;  3GHV A;  4LEK X;  3QLX A;  1DR3 A;  5HUI A;  1JOL A;  5U26 A;  1M7A A;  1D1G A;  3ROA A;  5HQZ A;  4QHV A;  4KLX A;  3CLB A;  3JWM A;  1DYH A;  2W3A A;  2B3Z A;  5JG0 X;  4HOF A;  3EIG A;  3SA2 A;  4KAK A;  1RX3 A;  4OSG A;  4EJ1 A;  1DR1 A;  3L3R A;  2W9T A;  4LAG X;  1DYJ A;  1RA8 A;  3EEM A;  1HFQ A;  1RA9 A;  1DG8 A;  3JWC A;  3NXT A;  3NU0 A;  3FRE X;  1RX5 A;  3VCO A;  3D80 A;  1RC4 A;  5CCC A;  1DR2 A;  1U70 A;  3JW3 A;  3SQY X;  3FYV X;  2LF1 A;  2L28 A;  1RA1 A;  3GI2 A;  4KJK A;  4OR7 A;  3GYF A;  4G95 A;  4FGH A;  3DL6 A;  3FY8 X;  4Q0E A;  3UM8 A;  3FQV A;  1S3U A;  4PST A;  5HT5 A;  1BZF A;  4M6J A;  1IA2 A;  3F8Z A;  5ECC A;  4X5H A;  4FHB A;  1AO8 A;  1DR5 A;  1RB3 A;  4PSY A;  1OHJ A;  4HOG A;  3IRO A;  3DRC A;  3Q1H A;  1HFR A;  3ZPC A;  3EEJ A;  4FGG A;  4Q67 A;  3IA5 A;  1DLR A;  3INV A;  3F8Y A;  2OBC A;  3D84 X;  4KFJ A;  1RE7 A;  4KY4 A;  3SRS X;  1S3Y A;  2H2Q A;  3FQ0 A;  3NZ9 X;  4DP3 A;  1DRA A;  3GHW A;  4KM0 A;  1IA3 A;  3QLW A;  3FRD X;  4QLF A;  3NTZ A;  1MVS A;  3UM6 A;  3R33 A;  2D0K A;  5FDA A;  4LAE X;  2BL9 A;  3QL0 A;  3TQ8 A;  5E8Q A;  4ELF A;  4ELH A;  2GD9 A;  3EX8 A;  1RX8 A;  3DG8 A;  3FRF X;  3K47 A;  3F0V X;  4KJL A;  1VDR A;  1ZDR A;  3F0B X;  5U27 A;  3DAU A;  1RA3 A;  2FZI A;  4QLE A;  5HVB A;  1DRF A;  3K45 A;  1S3V A;  4NX7 A;  5HSU A;  1VJ3 A;  3F0Q X;  3FYW X;  1DR7 A;  2DHF A;  3FL8 A;  4KBN A;  3NZ6 X;  3NXX A;  1RD7 A;  2ITH A;  2BLB A;  3JWF A;  8DFR A;  3S3V A;  1J3K A;  5HSR A;  1DIS A;  3NZA X;  1QZF A;  3TQA A;  2W3W A;  3FS6 A;  3KY8 A;  5HPB A;  1JUV A;  4NX6 A;  4M7U A;  2BLA A;  3IX9 A;  2P4G A;  3I3R A;  1DR6 A;  1DRE A;  4QI9 A;  3M08 A;  1RG7 A;  1SEJ A;  5HVE A;  2BLC A;  4KEB A;  3FRA X;  5HF2 X;  3SRR X;  4M7V A;  3FQC A;  3QYO A;  4Q0D A;  3LG4 A;  4M6K A;  1PD9 A;  3JW5 A;  3S9U A;  4H95 A;  4HA9 A;  3QGT A;  3NRR A;  1MVT A;  3QLZ A;  2O7P A;  1U72 A;  4QJZ D;  4KY8 A;  4ELB A;  3SGY A;  3DGA A;  1IA4 A;  1JOM A;  3KJR A;  3SH2 A;  3EEL A;  1DHF A;  3QG2 A;  3NXY A;  2FZJ A;  3CSE A;  4DPD A;  4P66 A;  1RF7 A;  4X5I A;  4X5F A;  2KGK A;  3SRU X;  5HQY A;  1M78 A;  3JVX A;  4XT6 A;  3F0U X;  1PDB A;  1RX2 A;  3QYL A;  2ZZA A;  2HQP A;  2W3B A;  2W9S A;  1DYI A;  2INQ A;  4TU5 X;  1E26 A;  4G8Z X;  3JSU A;  3KJS A;  3K2H A;  4LAH X;  4QLG A;  2XW7 A;  1DRB A;  3QFX A;  4KL9 A;  1DIU A;  1LY3 A;  1J3I A;  1DAJ A;  3HBB A;  3FQZ A;  3IRM A;  3NXV A;  4EIZ A;  3K74 A;  4PTJ A;  4PTH A;  5EAJ A;  4XT7 A;  1RB2 A;  3GHC A;  1DG7 A;  4P3Q A;  2JYB A;  3F91 A;  4G3M A;  3SRQ X;  1KMS A;  2G6V A;  2HXV A;  1PD8 A;  1RX4 A;  3TD8 A;  2FZH A;  4M6L A;  3SAI A; 
#chains in the Genus database with same CATH topology
 3IA4 A;  3SRW X;  1DDR A;  3NXO A;  3QLS A;  2D5N A;  1RH3 A;  1J3J A;  2W9H A;  3OCH A;  4XT8 A;  3JWK A;  1HFP A;  3FRB X;  4KJJ A;  5DFR A;  5HT4 A;  5CC9 A;  4KD7 A;  3KFY A;  4KNE A;  4P3R A;  1S3W A;  2W3V A;  4XRB A;  1DHI A;  4RGC A;  4P68 A;  3SA1 A;  2W3M A;  4Q6A A;  1AI9 A;  2ANQ A;  4H98 A;  3QLR A;  4XT4 A;  4IXG X;  1AOE A;  1YHO A;  2W9G A;  1KMV A;  4ECK A;  1RX7 A;  3DL5 A;  5HF0 X;  4H97 A;  4DDR A;  3NZC X;  1DDS A;  2ANO A;  2C2S A;  5ECX A;  7DFR A;  4KM2 A;  3RG9 A;  4EIG A;  4CD2 A;  3I8A X;  4HA7 A;  4X5J A;  4EIL A;  2QK8 A;  2AZN A;  3FQO A;  4PSS A;  4M2X A;  1CZ3 A;  3CD2 A;  3QLY A;  4IXE D;  1LUD A;  4X5G A;  3TQB A;  2C2T A;  4XT5 A;  3QL3 A;  3EEK A;  3OAF A;  1RA2 A;  1DLS A;  4ELE A;  4IXF X;  3NZD A;  4HOE A;  3IRN A;  3M09 A;  6DFR A;  1BOZ A;  1RX1 A;  1DR4 A;  1M79 A;  4H96 A;  4QJC A;  4PDJ A;  3FL9 A;  5DXV A;  4GH8 A;  3ZPG A;  4ELG A;  3UM5 A;  1KLK A;  3SR5 X;  1DG5 A;  1CD2 A;  3S7A A;  1TDR A;  1RX6 A;  4KYA A;  3NZB X;  5HI6 A;  3CL9 A;  1DF7 A;  2DRC A;  1RX9 A;  4DFR A;  3NXR A;  3F0S X;  1LY4 A;  3F0X X;  3RO9 A;  1OHK A;  3FQF A;  2OIP A;  2HM9 A;  3FY9 X;  3DAT A;  2CD2 A;  3E0B A;  4I1N A;  1DYR A;  4XEC X;  5JA3 A;  1U71 A;  3KGY A;  4DPH A;  4I13 A;  1DRH A;  4XE6 X;  1DHJ A;  1IA1 A;  3HJ3 A;  3N0H A;  3DFR A;  3TQ9 A;  2CIG A;  3JTW A;  3GHV A;  4LEK X;  3QLX A;  1DR3 A;  5HUI A;  1JOL A;  5U26 A;  1M7A A;  1D1G A;  3ROA A;  5HQZ A;  4QHV A;  4KLX A;  3CLB A;  3JWM A;  1DYH A;  2W3A A;  2B3Z A;  5JG0 X;  4HOF A;  3EIG A;  3SA2 A;  4KAK A;  1RX3 A;  4OSG A;  4EJ1 A;  1DR1 A;  3L3R A;  2W9T A;  4LAG X;  1DYJ A;  1RA8 A;  3EEM A;  1HFQ A;  1RA9 A;  1DG8 A;  3JWC A;  3NXT A;  3NU0 A;  3FRE X;  1RX5 A;  3VCO A;  3D80 A;  1RC4 A;  5CCC A;  1DR2 A;  1U70 A;  3JW3 A;  3SQY X;  3FYV X;  2LF1 A;  2L28 A;  1RA1 A;  3GI2 A;  4KJK A;  4OR7 A;  3GYF A;  4G95 A;  4FGH A;  3DL6 A;  3FY8 X;  4Q0E A;  3UM8 A;  3FQV A;  1S3U A;  4PST A;  5HT5 A;  1BZF A;  4M6J A;  1IA2 A;  3F8Z A;  5ECC A;  4X5H A;  4FHB A;  1AO8 A;  1DR5 A;  1RB3 A;  4PSY A;  1OHJ A;  4HOG A;  3IRO A;  3DRC A;  3Q1H A;  1HFR A;  3ZPC A;  3EEJ A;  4FGG A;  4Q67 A;  3IA5 A;  1DLR A;  3INV A;  3F8Y A;  2OBC A;  3D84 X;  4KFJ A;  1RE7 A;  4KY4 A;  3SRS X;  1S3Y A;  2H2Q A;  3FQ0 A;  3NZ9 X;  4DP3 A;  1DRA A;  3GHW A;  4KM0 A;  1IA3 A;  3QLW A;  3FRD X;  4QLF A;  3NTZ A;  1MVS A;  3UM6 A;  3R33 A;  2D0K A;  5FDA A;  4LAE X;  2BL9 A;  3QL0 A;  3TQ8 A;  5E8Q A;  4ELF A;  4ELH A;  2GD9 A;  3EX8 A;  1RX8 A;  3DG8 A;  3FRF X;  3K47 A;  3F0V X;  4KJL A;  1VDR A;  1ZDR A;  3F0B X;  5U27 A;  3DAU A;  1RA3 A;  2FZI A;  4QLE A;  5HVB A;  1DRF A;  3K45 A;  1S3V A;  4NX7 A;  5HSU A;  1VJ3 A;  3F0Q X;  3FYW X;  1DR7 A;  2DHF A;  3FL8 A;  4KBN A;  3NZ6 X;  3NXX A;  1RD7 A;  2ITH A;  2BLB A;  3JWF A;  8DFR A;  3S3V A;  1J3K A;  5HSR A;  1DIS A;  3NZA X;  1QZF A;  3TQA A;  2W3W A;  3FS6 A;  3KY8 A;  5HPB A;  1JUV A;  4NX6 A;  4M7U A;  2BLA A;  3IX9 A;  2P4G A;  3I3R A;  1DR6 A;  1DRE A;  4QI9 A;  3M08 A;  1RG7 A;  1SEJ A;  5HVE A;  2BLC A;  4KEB A;  3FRA X;  5HF2 X;  3SRR X;  4M7V A;  3FQC A;  3QYO A;  4Q0D A;  3LG4 A;  4M6K A;  1PD9 A;  3JW5 A;  3S9U A;  4H95 A;  4HA9 A;  3QGT A;  3NRR A;  1MVT A;  3QLZ A;  2O7P A;  1U72 A;  4QJZ D;  4KY8 A;  4ELB A;  3SGY A;  3DGA A;  1IA4 A;  1JOM A;  3KJR A;  3SH2 A;  3EEL A;  1DHF A;  3QG2 A;  3NXY A;  2FZJ A;  3CSE A;  4DPD A;  4P66 A;  1RF7 A;  4X5I A;  4X5F A;  2KGK A;  3SRU X;  5HQY A;  1M78 A;  3JVX A;  4XT6 A;  3F0U X;  1PDB A;  1RX2 A;  3QYL A;  2ZZA A;  2HQP A;  2W3B A;  2W9S A;  1DYI A;  2INQ A;  4TU5 X;  1E26 A;  4G8Z X;  3JSU A;  3KJS A;  3K2H A;  4LAH X;  4QLG A;  2XW7 A;  1DRB A;  3QFX A;  4KL9 A;  1DIU A;  1LY3 A;  1J3I A;  1DAJ A;  3HBB A;  3FQZ A;  3IRM A;  3NXV A;  4EIZ A;  3K74 A;  4PTJ A;  4PTH A;  5EAJ A;  4XT7 A;  1RB2 A;  3GHC A;  1DG7 A;  4P3Q A;  2JYB A;  3F91 A;  4G3M A;  3SRQ X;  1KMS A;  2G6V A;  2HXV A;  1PD8 A;  1RX4 A;  3TD8 A;  2FZH A;  4M6L A;  3SAI A; 
#chains in the Genus database with same CATH homology
 3IA4 A;  3SRW X;  1DDR A;  3NXO A;  3QLS A;  2D5N A;  1RH3 A;  1J3J A;  2W9H A;  3OCH A;  4XT8 A;  3JWK A;  1HFP A;  3FRB X;  4KJJ A;  5DFR A;  5HT4 A;  5CC9 A;  4KD7 A;  3KFY A;  4KNE A;  4P3R A;  1S3W A;  2W3V A;  4XRB A;  1DHI A;  4RGC A;  4P68 A;  3SA1 A;  2W3M A;  4Q6A A;  1AI9 A;  2ANQ A;  4H98 A;  3QLR A;  4XT4 A;  4IXG X;  1AOE A;  1YHO A;  2W9G A;  1KMV A;  4ECK A;  1RX7 A;  3DL5 A;  5HF0 X;  4H97 A;  4DDR A;  3NZC X;  1DDS A;  2ANO A;  2C2S A;  5ECX A;  7DFR A;  4KM2 A;  3RG9 A;  4EIG A;  4CD2 A;  3I8A X;  4HA7 A;  4X5J A;  4EIL A;  2QK8 A;  2AZN A;  3FQO A;  4PSS A;  4M2X A;  1CZ3 A;  3CD2 A;  3QLY A;  4IXE D;  1LUD A;  4X5G A;  3TQB A;  2C2T A;  4XT5 A;  3QL3 A;  3EEK A;  3OAF A;  1RA2 A;  1DLS A;  4ELE A;  4IXF X;  3NZD A;  4HOE A;  3IRN A;  3M09 A;  6DFR A;  1BOZ A;  1RX1 A;  1DR4 A;  1M79 A;  4H96 A;  4QJC A;  4PDJ A;  3FL9 A;  5DXV A;  4GH8 A;  3ZPG A;  4ELG A;  3UM5 A;  1KLK A;  3SR5 X;  1DG5 A;  1CD2 A;  3S7A A;  1TDR A;  1RX6 A;  4KYA A;  3NZB X;  5HI6 A;  3CL9 A;  1DF7 A;  2DRC A;  1RX9 A;  4DFR A;  3NXR A;  3F0S X;  1LY4 A;  3F0X X;  3RO9 A;  1OHK A;  3FQF A;  2OIP A;  2HM9 A;  3FY9 X;  3DAT A;  2CD2 A;  3E0B A;  4I1N A;  1DYR A;  4XEC X;  5JA3 A;  1U71 A;  3KGY A;  4DPH A;  4I13 A;  1DRH A;  4XE6 X;  1DHJ A;  1IA1 A;  3HJ3 A;  3N0H A;  3DFR A;  3TQ9 A;  2CIG A;  3JTW A;  3GHV A;  4LEK X;  3QLX A;  1DR3 A;  5HUI A;  1JOL A;  5U26 A;  1M7A A;  1D1G A;  3ROA A;  5HQZ A;  4QHV A;  4KLX A;  3CLB A;  3JWM A;  1DYH A;  2W3A A;  2B3Z A;  5JG0 X;  4HOF A;  3EIG A;  3SA2 A;  4KAK A;  1RX3 A;  4OSG A;  4EJ1 A;  1DR1 A;  3L3R A;  2W9T A;  4LAG X;  1DYJ A;  1RA8 A;  3EEM A;  1HFQ A;  1RA9 A;  1DG8 A;  3JWC A;  3NXT A;  3NU0 A;  3FRE X;  1RX5 A;  3VCO A;  3D80 A;  1RC4 A;  5CCC A;  1DR2 A;  1U70 A;  3JW3 A;  3SQY X;  3FYV X;  2LF1 A;  2L28 A;  1RA1 A;  3GI2 A;  4KJK A;  4OR7 A;  3GYF A;  4G95 A;  4FGH A;  3DL6 A;  3FY8 X;  4Q0E A;  3UM8 A;  3FQV A;  1S3U A;  4PST A;  5HT5 A;  1BZF A;  4M6J A;  1IA2 A;  3F8Z A;  5ECC A;  4X5H A;  4FHB A;  1AO8 A;  1DR5 A;  1RB3 A;  4PSY A;  1OHJ A;  4HOG A;  3IRO A;  3DRC A;  3Q1H A;  1HFR A;  3ZPC A;  3EEJ A;  4FGG A;  4Q67 A;  3IA5 A;  1DLR A;  3INV A;  3F8Y A;  2OBC A;  3D84 X;  4KFJ A;  1RE7 A;  4KY4 A;  3SRS X;  1S3Y A;  2H2Q A;  3FQ0 A;  3NZ9 X;  4DP3 A;  1DRA A;  3GHW A;  4KM0 A;  1IA3 A;  3QLW A;  3FRD X;  4QLF A;  3NTZ A;  1MVS A;  3UM6 A;  3R33 A;  2D0K A;  5FDA A;  4LAE X;  2BL9 A;  3QL0 A;  3TQ8 A;  5E8Q A;  4ELF A;  4ELH A;  2GD9 A;  3EX8 A;  1RX8 A;  3DG8 A;  3FRF X;  3K47 A;  3F0V X;  4KJL A;  1VDR A;  1ZDR A;  3F0B X;  5U27 A;  3DAU A;  1RA3 A;  2FZI A;  4QLE A;  5HVB A;  1DRF A;  3K45 A;  1S3V A;  4NX7 A;  5HSU A;  1VJ3 A;  3F0Q X;  3FYW X;  1DR7 A;  2DHF A;  3FL8 A;  4KBN A;  3NZ6 X;  3NXX A;  1RD7 A;  2ITH A;  2BLB A;  3JWF A;  8DFR A;  3S3V A;  1J3K A;  5HSR A;  1DIS A;  3NZA X;  1QZF A;  3TQA A;  2W3W A;  3FS6 A;  3KY8 A;  5HPB A;  1JUV A;  4NX6 A;  4M7U A;  2BLA A;  3IX9 A;  2P4G A;  3I3R A;  1DR6 A;  1DRE A;  4QI9 A;  3M08 A;  1RG7 A;  1SEJ A;  5HVE A;  2BLC A;  4KEB A;  3FRA X;  5HF2 X;  3SRR X;  4M7V A;  3FQC A;  3QYO A;  4Q0D A;  3LG4 A;  4M6K A;  1PD9 A;  3JW5 A;  3S9U A;  4H95 A;  4HA9 A;  3QGT A;  3NRR A;  1MVT A;  3QLZ A;  2O7P A;  1U72 A;  4QJZ D;  4KY8 A;  4ELB A;  3SGY A;  3DGA A;  1IA4 A;  1JOM A;  3KJR A;  3SH2 A;  3EEL A;  1DHF A;  3QG2 A;  3NXY A;  2FZJ A;  3CSE A;  4DPD A;  4P66 A;  1RF7 A;  4X5I A;  4X5F A;  2KGK A;  3SRU X;  5HQY A;  1M78 A;  3JVX A;  4XT6 A;  3F0U X;  1PDB A;  1RX2 A;  3QYL A;  2ZZA A;  2HQP A;  2W3B A;  2W9S A;  1DYI A;  2INQ A;  4TU5 X;  1E26 A;  4G8Z X;  3JSU A;  3KJS A;  3K2H A;  4LAH X;  4QLG A;  2XW7 A;  1DRB A;  3QFX A;  4KL9 A;  1DIU A;  1LY3 A;  1J3I A;  1DAJ A;  3HBB A;  3FQZ A;  3IRM A;  3NXV A;  4EIZ A;  3K74 A;  4PTJ A;  4PTH A;  5EAJ A;  4XT7 A;  1RB2 A;  3GHC A;  1DG7 A;  4P3Q A;  2JYB A;  3F91 A;  4G3M A;  3SRQ X;  1KMS A;  2G6V A;  2HXV A;  1PD8 A;  1RX4 A;  3TD8 A;  2FZH A;  4M6L A;  3SAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...