4QICA

Co-crystal structure of anti-anti-sigma factor phyr complexed with anti-sigma factor nepr from bartonella quintana
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
257
structure length
243
Chain Sequence
SLSTRIAPHLPYLRRFARSVTGSQSSGDAYVSAMLEALVADISIFPRASCDRIGTYWLFCHLFDQEQKTSAKLSYLTPRARQAFLLIAVEGFNEQEASEIMNLDARDFRKLLNQASIDISQQIATQVMIIEDEPLIAMDIEQMVESLGHQVVGIARTRKEAVVMYHQKKPRLILADIQLADNSSGIDAVNDILQNDRIPVIFITAFPERLLTGERPEPTFLVTKPFNPDMVKALISQALFFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory transduction regulatory protein, Anti-anti-sigma fac
publication title Co-Crystal Structure of Anti-anti-sigma factor PhyR complexed with Anti-sigma factor NepR from Bartonella quintana
rcsb
source organism Bartonella quintana
molecule tags Signaling protein/dna binding protein
total genus 86
structure length 243
sequence length 257
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.160 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 4qicA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qicA02
2MSWA 2FLWA 3Q15C 2MYNA 3LUDA 1E2BA 4TMYA 1SD5A 1VLZA 2JB9A 3HUUA 3DLHA 3GL9A 3H1EA 2DRIA 3F73A 1MVOA 2FQWA 5KQLA 1XHFA 4RK7A 4G0OA 2QVCA 1JHZA 1TVMA 3TD9A 2O20A 3A0UA 3MM4A 1GLGA 1ZAYA 3QX9A 1ABFA 3IPCA 3O21A 1KMIY 3KLNA 2QXYA 4HYEA 4Z9AA 2HSGA 4RWEA 3RH0A 2FN9A 4DQDA 5CNKA 5EWJB 6CHYA 3DGFC 5JNVA 3JY6A 1QNLA 3MQ4A 5C5EA 1M5TA 4F06A 3HS3A 3KG2A 3O1HB 3EQ2A 4LDZA 4Z4FA 2FMHA 2JCGA 4QYWA 3HM9A 1KRWA 5IULC 3HDVA 4MR9A 2QZJA 1SXIA 3EQZA 1ZN2A 4LX8A 5IUNC 4W5RA 1JH9A 3HO1A 1QO0D 1ZHHA 4RY8A 3URMA 4CBVA 3JPYA 1XWWA 4PICA 1GUDA 4RXUA 1Z2DA 2E4ZA 3I5AA 2ZAYA 3QLVA 4IMIB 4N0QA 4RK5A 3UKJA 4ETMA 4EVQA 3HCWA 1ZGZA 3EULA 3LUKA 4G0ZA 3OLVA 3KYJB 1QO0A 2GKGA 1NXSA 1CHNA 4OATA 3LFTA 1VRVA 2FSPA 2FW0A 4YP9A 2JK1A 4MRMB 3Q9SA 2FEWB 2HQRA 5DTEA 4LRQA 4MQFB 5JNTA 1YS7A 1QP0A 3OQMA 3TO5A 2CHEA 2FMFA 3UK0A 1U04A 1Z15A 4QPJC 3I45A 1DG9A 4MAAA 2BGGA 3EDCA 3JPWA 4RKRA 2FLKA 2R48A 4JAVC 4JOQA 3LTEA 2M98A 2TMYA 1ZY2A 3LUFA 4H3KB 1Z16A 2QW1A 4MR7B 4O5AA 5IX8A 2CD7A 1DP4A 3NNSA 4RV5A 1TJYA 1DC7A 4Z9BA 3FDFA 1QMPA 3LKBA 4MR8B 5EWLB 2E4YA 4ZPJA 4QYMA 3Q7RA 1A2OA 3BRSA 1YIOA 3H75A 3OLZA 4YLEA 2IOYA 3DLBA 2VUHB 2E4VA 4N47A 1I3CA 3QK7A 5BRAA 1GUBA 1ZESA 3OM1A 1JX6A 4MLCA 1NATA 5TQ0A 4S05A 2VUIB 1BDHA 1SRRA 2WJWA 4E7PA 2FQYA 1J56A 1APBA 3S99A 3HJFA 4G86A 3CZCA 3CG0A 5TPZD 1USIA 4F12A 2W42A 1SC5A 5FWYA 2PUFA 3F7NA 4EYKA 1JDPA 2CWDA 1YMVA 3N6VA 2RJOA 3SNKA 3F6CA 4G0PA 3DGEC 1F51E 5TPZA 1DBWA 3L6UA 4G0MA 1LJLA 4KZKA 4RY0A 3MIZA 5IC5A 5CNIA 3NNDA 3O1JC 2NT3A 2H0AA 4JASB 4KMRA 4NCBA 1P6QA 4KQCA 4XASA 5EWMB 3I09A 4Z0NA 3RVPA 2OENG 1BDJA 1FFSA 2RGYA 3QLVC 2GWRA 5IBQA 3QEKA 3IDOA 5FWXA 3SY8A 4FE7A 4TN5A 4L4UA 4WXMA 5TPWA 1E6MA 4N03A 2JVJA 4DN6A 2WMYA 3K9CA 4RXMA 2GBPA 4L85A 2L17A 2GI4A 4RY9A 2R47A 4XLTA 4JP1A 4UHJA 1JFVA 2M1ZA 2B1JA 4RSMA 4YWHA 1EWVA 2PLNA 2PL9A 3O2SB 1Z25A 1MB0A 1QKKA 5CHYA 4YRZA 1GCAA 9ABPA 4Z4IA 3RVQA 1A0OA 3QEMA 2FN8A 3FFTA 3TX6A 4QICA 2E4XA 3EGCA 4LE1A 1JFTA 3HDGA 2GX6A 1CYEA 4KRFA 1RP3A 1BAPA 3K4HA 5FBKA 2PUCA 2YHAA 2P4UA 1ZDMA 5KQGA 4YR7A 4Z4HA 2JVIA 2NT4A 3OLXA 2VK2A 4RS3A 4M88A 5DCLA 1JWLA 2LBPA 3H5LA 1YK0A 2MYTA 4MQEB 2A9OA 5TQ0B 1EWKA 3KYIB 4ML3A 5CNMA 5DGCA 4Q6BA 3QELA 3T8YA 4EYQA 1ZVVA 5KQPA 4JA2A 5HM6A 1U2PA 4RKQA 3M6MD 1L5ZA 3A3KA 4RK1A 3H5WA 2PL1A 2ZWMA 4IGAA 1NXVA 5IUKC 1E6LA 2L18A 1JFSA 3C97A 2FEPA 1Z13A 1ZH4A 7ABPA 2WWVD 4NQRA 1LBIA 2XDYA 1PUXA 4YV7A 4KFCA 4OBBA 5KWSA 5FBHA 3RVMA 1DBPA 1NY5A 1A04A 3C3WA 1BA2A 4Z4EA 3M9XA 3OLYA 1TM2A 1NXWA 2JRLA 3H5TA 3H6HA 4LE2A 1RNLA 5D2CA 3CKMA 3LOPA 4TLMB 4KV7A 2JBAA 2X7XA 2P9HA 1ZH2A 2MSLA 3GBPA 1BDIA 1M2FA 4WXEA 1FFGA 1W25A 4KK3A 1D2AA 3I42A 2E4WA 4TLLB 3MA0A 1H9CA 3O2QB 1LJUA 3C3MA 2HQOA 2PAFA 4KK4A 4O1HA 4KPYA 4MS4B 1ISRA 1OXBB 2A9QA 2AYZA 3CG4A 1DRKA 2J48A 4Z99A 4F3TA 4KREA 4NICA 1E6KA 1Z17A 3OMWA 1C4WA 4WUTA 4JB0A 2IPLA 4RK0A 1JF8A 3N0WA 4PYRA 4KVFA 3BBLA 1SXHA 3CTPA 5HSGA 3VNBA 4OTZA 4ETNA 2IYNA 1WETA 5JS1A 4H60A 4W5TA 4OG2A 4XARA 3SM9A 1Z26A 4N0PA 1C0EA 3IP5A 5TQJA 1JBEA 4MS3A 4RZSA 4Z4GA 1TLFA 3KS9A 3QLUC 4IRXA 3IPAA 4YCSA 3RVSA 3TB6A 2KYRA 1D4ZA 1NXOA 3D8UA 4WT7A 4B09A 4LZLA 3NNNA 3OM0A 3LUCA 4N41A 1VPWA 1DC8A 4LE0A 2PE5A 3RVRA 2QR3A 6ABPA 2NZVG 3BILA 4OLAA 4RXTA 4EUKA 1EWTA 2A9RA 3LUJA 3CHYA 1ISSA 3BRQA 1U2QA 1NTRA 4MR9B 1JYEA 1YTUA 5KC8A 2YHBA 4Q7EA 3KKEA 1NXXA 4E7OA 3SQNA 3OQOA 5ABPA 3G1WA 1QP7A 5TQ2A 4ZJPA 3CLKA 1IIBA 1K66A 4G97A 1U0SY 2L2QA 1USKA 1DJMA 1D5WA 2RDMA 3HXMA 4G0QA 3GYBA 3KJXA 3BREA 3CS3A 3EJWA 5EWJA 1K68A 4KNYA 1SXGA 3T38A 4GNRA 1FQWA 3IP9A 3HUTA 2WY2D 4S04A 2FTKE 3KHTA 3RQIA 4O1IA 4XAQA 3O1IC 3NBMA 1P8AA 3OQNA 2QSJA 4HNSA 3FGZA 3RVKA 1EAYA 3SAJA 2LFWA 1DCKA 1Z12A 2PKXA 4HNRA 1QQAA 1MIHA 1DRJA 2I6FA 2HJ9A 5BQ3A 3F6PA 2LUOA 1PEYA 3OMXA 1KRXA 1Z18A 3HV2A 1R8JA 2LP4Y 3JVDA 3QLUA 4ZMRA 2WB4A 3FFWA 4N76A 2NUBA 5E3JA 3KLOA 3MMNA 3O75A 4D6YA 5T7BA 1T34A 3N0XA 1URPA 3P9YA 4MGEA 3GV0A 4IILA 3MF4A 5IEBA 1RXEA 3IP7A 3LUHA 1D1QA 5I4CA 1LK0A 4Q6WA 4EYOA 1FFWA 3N75A 4ZMSA 4MR7A 3GWGA 3C6QA 2PMCA 3LMKA 3KCNA 2FQXA 2IPMA 3H5VA 2FXIA 1RXIA 5FWYB 3Q41A 5EWLA 1M2EA 4IMJB 4EYGA 1L5YA 3CU5A 1EFAA 3LUGA 5JNSA 2A9PA 3RVJA 5KQMA 3D02A 3O74A 3HEBA 5GQSA 5JNWA 1YMUA 5TQ2B 2IKSA 3QLTA 3HK2A 3E61A 1YK1A 1JYFA 2E4UA 3OLWA 3GT7A 4G0XA 5JNRA 1NXPA 2VYCA 1U8TA 4LDAA 1DZ3A 3NHZA 3H5OA 4FB4A 1XHEA 2IPAB 5KI6A 5F64A 5BR1A 3O2JA 3HVRA 5FWXB 3A10A 3RVNA 3T6KA 4NCAA 5TPWB 2V0NA 3GA5A 5DLEA 3JVIA 1W9HA 3ILHA 4PZ0A 1M5UA 3A0RB 4EVRA 3UUGA 1DCMA 3N8IA 1RPJA 4KQ9A 2R25B 3CRNA 3VNAA 5EWMA 1TMYA 1JLKA 3M9WA 4ETIA 3B2NA 4P98A 3QEMB 1PHRA 3IP6A 4DADA 4XFKA 5IUJC 4MLDA 4D6XA 5BRJA 4YO7A 3H1GA 2MYUA 3L49A 2L19A 1USGA 3KTOA 4YGXB 2WRZA 4UHKA 4MPTA 1JL3A 5B3JA 1PEAA 4P1ZA 3RVLA 1AB5A 4RU1A 2JVKA 3W9SA 1VKRA 3QELB 5ED4A 3RVOA 2LIVA 4W5OA 1HEYA 3CFYA 2R4QA 3JS5A 4ZYLA 1QQBA 3KSMA 1Z2EA 2F8SA 1Y1LA 4FE4A 4RK6A 1ABEA 2PUGA 1DCFA 1JDNA 4MS1A 4NV3A 3CZ5A 2N9UA 4RDCA 5C5CA 4YS6A 2PUAA 1F4VA 4F8JA 5PNTA 5DKFA 2QV0A 3CNBA 4IF4A 1ZITA 3T95A 4EVSA 2ID9A 4D74A 3DZDA 1P6UA 2QU7A 1AB6A 5IEJA 3OO0A 4WWHA 5JNUA 1PNRA 4MQEA 3N0RA 4EY3A 5GOTA 1KGSA 2QVGA 2H3HA 2OQRA 2FMKA 1GCGA 5KC9A 3MYYA 2IDMA 1PNTA 2JBAB 3H6GA 3C3KA 4H3HB 2ID7A 2LPMA 4G0YA 4JB2A 2CHFA 3E3MA 4RK4A 3Q7SA 3Q7TA 2PJUA 3R0JA 4Z4CA 1S8NA 1QP4A 3QX8A 3DBIA 4W5QA 4W5NA 4F11A 1MAVA 2MSKA 2B4AA 3H5IA 2HPHA 2NZUG 2MYPA 4XXHA 2HQBA 3EODA 1YS6A 2WJAA 1D1PA 1DBQA 3FFXA 4Y9TA 3FMVA 5HKOA 1NXTA 1QPZA 3SG0A 3OO1A 2RJNA 4MRMA 1P2FA 5CNJA 3G85A 1MB3A 5TE9A 1B00A 3ROTA 4MQFA 2PUDA 4MYRA 3N53A 1RZRD 4OLBA 1FSPA 2AYXA 3ROFA 4GPAA 4MS3B 2PUBA 2FMIA 4HNQA 4MS4A 4EGSA 1EHCA 3GRCA 2PUEA 1YVUA 3EAFA 2IPNA 3HZHA 3ILYA 1RZRA 2Q5CA 3H1FA 1BVHA 4PE5B 4WZZA 3LKVA 1UDRA 5B3JC 1LBHA 2FKAA 1ZGGA 2FEKA 5HQJA 3GBVA 8ABPA 3LUAA 3NHMA 4PEVA 3TMYA 3HSYA 4MS1B 5JS2A 1CEYA 4MR8A 2FVYA 1OXKB 5T3YA 3JTEA 2F8TA
chains in the Genus database with same CATH superfamily
2SCUB 3IT2A 1JFLA 4W1SA 3U0VA 4KIJA 3GT4A 1EP9A 2O23A 1E2LA 4HDKB 3GL9A 3ZHUA 2DRIA 4BX9A 3F73A 4NPAA 4DR1B 2FQWA 1BMFD 3OIYA 4IDBA 5E4TA 1N6OA 2P2GA 1DWQA 2WSSD 4QPPA 3V7WA 1TIPA 2PIAA 3D7SA 1DXYA 3I0ZA 5AKHA 1FFXA 2XMPA 4TT8A 4HYEA 3R0IA 1KVQA 5BQOA 2R1VA 5M4MA 5HIMA 1VHWA 5DH9A 2VQ6A 1BYIA 4KEAA 3KCQA 5IVDA 5AK4A 2WA1A 1HE1C 2QRLA 4E88A 4HDSB 3K9WA 1N1EA 5F3DA 5BOSA 3WY9A 4KDFA 1Z56C 2O2IA 1W2GA 3HDVA 3UV6A 1PTJC 3TMAA 3EQZA 2UZ4A 1T0BA 2IYLD 1IXZA 5GGXA 2WTUA 1M6VB 1JH9A 5SYMA 3Q7IA 4CBVA 1FFDA 4E08A 3C7TA 4M0MA 3WBFA 4FP9A 3DP9A 1C9MA 5FPTA 1SEVA 2ZRJA 3BPSA 3C3EA 3FVWA 3L7NA 3PJEA 3QOWA 1NAIA 2JBHA 4IVRA 3RYCA 1CHNA 3FCEA 2ILTA 1N0WA 2P4HX 1Q84A 2Y9PB 3M34A 2OHVA 5ES3A 5LUAA 1NM5C 4ALJA 5A4AA 5AUQA 1QP0A 3MB8A 1JVNA 2RARA 1VGRA 3OHPA 1T9HA 1DTEA 2PGXA 1RI2A 3WL5A 4EEZA 5LQAA 4H7IA 4CNQA 2CUKA 4W8GA 3NTUA 2J8ZA 1U0GA 4P93A 4YV1A 4P80A 1HXHA 4KR0A 4XYEA 2WHQA 5YASA 4E1VA 3V4VB 2GM4A 5A1JA 2BZSA 4TKVA 4I08A 3QHQA 1OBOA 3PXEA 4FU0A 5E7MA 4CL8A 3DJFA 3CVXA 4MA0A 3M0EA 4BMPB 3K30A 4MRPA 4O5MA 1GGFA 4Y2TA 2X13A 2XZPA 5G02A 3WWPA 2J0QA 1KDYA 1HC7A 1VSUA 2Y2UA 4BNKA 1BMDA 2O1SA 3D6HA 3UPTA 4Z9BA 1OU0A 1MU0A 4FS3A 4IZIA 5EOVA 3DOCA 5EWLB 5ALGA 1IK4A 2J4FA 1RPAA 1A2OA 3BRSA 5L7YA 4LF6B 3Q0TA 2PK3A 4EYSA 1KJ9A 2ANCA 3KEQA 3A1VA 3C2QA 4EP1A 4LRWA 3JQCA 4L15A 2OYSA 5JBNA 3KDSE 1GUBA 5G3ZA 1M3SA 2H8KA 3H8JA 2BFDA 2X19A 4FMCF 5BW8A 3G2PA 1NRWA 1LK7A 3PQ5A 4G5OA 4E7PA 1W52X 2AHOA 3IO5A 1T43A 3CLRC 3EQ6A 1IHUA 2DR0A 1E1MA 1Q1AA 3A1UA 1JI0A 4LK2A 2CY0A 5JLAA 4WEQA 3RC9A 5IHXA 1XMXA 4DR3B 1JR3D 4I46A 3F6CA 3BHNA 3RJ5A 1F51E 4FN5A 2PSDA 4K88A 4LQ4A 2I6SA 2VJNA 4M0DA 1U6IA 3D59A 3DFFA 3KKPA 5CDYA 3CUUA 4R9UC 3UIEA 1PNQA 2J3KA 2YBDA 2FSUA 4WFIA 2R7KA 5LBIA 4X8LA 4EHFA 3C7AA 4QGGA 4ZRMA 2CFOA 2PZAA 3IKJA 4HUJA 3EK2A 4UARA 5CT9A 1L7VC 2XE7A 3ED1A 3MT8A 2V9ZA 2BMDA 5TC4A 3TVTA 4C05A 3LWNA 3QLVC 1NKVA 2ORVA 1PSZA 4RLHA 5GP1A 1QZ3A 1RWQA 2QJTA 3Q0IA 4I6GA 2IOHA 3MD0A 1PS9A 3KPJA 4LYJA 2H59A 1BS9A 1N9GB 3F3SA 4IW3B 3MTDA 3U3KA 3VKUA 3TGLA 3MGAA 1V5EA 2DLCX 3UFBA 4J0HA 1PL6A 1GPWB 3TPCA 1C1DB 2B4QA 4X92A 1FPMA 1AHPA 2G4CA 1O54A 4RIHA 3A6EA 4HATA 3RK1A 1KDTA 4P0PB 1NQUA 3IJEB 5C1PA 5E8RA 2OV4A 2R7LA 2Y4OA 3NIGB 4XDYA 1SMKA 4F84A 1UJ5A 3AF5A 2IU6A 3TAUA 4HR7A 2G1AA 1IOWA 1TCVA 1AGRA 3P9QA 5DX0A 5HIIA 3GU3A 4LZOA 2AYYA 2F67A 3O84A 3PE6A 4HQ0A 4ZQFA 5BYJA 5GADl 3TL6A 2E5WA 1YZLA 2D74A 4M1QA 3TKAA 5HXAA 1WJGA 5F98A 3NMUF 4DJDC 4IDQA 1OLXA 3VBEA 4P3NA 1WHSB 1E96A 1KI6B 3CQ9A 4IIJB 4U7PB 1EWKA 1YWGO 4TZ0A 3DONA 3JATB 1TOAA 1KYWA 2V0CA 3GCGA 4HHEA 4PX2A 4EGQA 3PXUA 5A1TA 2P2CA 4KLZA 4ZZ1A 3CSUA 1L8QA 3UJCA 1E3IA 1NW8A 4Q3OA 4B4VA 1BJKA 3KZNA 1YUMA 1JR3E 3AF1A 5KHAA 2YYLA 1NMEA 2PEZA 3QTLA 2C2KA 3LC0A 1XJ0A 4WKBA 4UU8A 1HOTA 3BB1A 3C97A 3DE0X 1S0UA 2B4YA 3U4DA 4K9OA 3WKAA 2YWFA 3CZ9A 4F1JA 3LHDA 1K89A 2ZT5A 4OBBA 1P8JA 5FBQB 1R4ZA 4ITUA 2AE2A 1ECFA 2CB0A 1Z73A 4C9BA 3O3NB 5FLEX 4WACA 2B35A 3DO5A 4B3FX 5AVWA 1HQYE 1QVAA 2C8VA 1YS9A 4E13A 2O5CA 1R9NA 4GBMA 1W5TA 4G4JA 1T3LA 2FWPA 1VHDA 4AJOA 4B9AA 3DVAB 4GNKA 4MHTA 3OIBA 5ENVA 1E2JA 2A1TA 3THWB 1EXDA 1H9CA 2IZ6A 1Y6ZA 3K8OE 2JKZA 2PS0A 1N6KA 3IB3A 3MIIA 4I50B 1GYQA 2BELA 3BFPA 4GRDA 5DISB 5FAXA 4RZXA 4OKNA 5BSUA 1VHJA 4NBWA 2CNWD 3DAPA 3ZY6A 2HEIA 4KREA 2M32A 2Z1NA 1T2VA 2PNFA 3QXHA 4D0NA 4TQAA 2ACWA 1I2BA 2DDHA 2H31A 2WBIA 1HLFA 4WASA 2FUNB 4HK4A 3UOGA 5ALUA 3GLGA 3MBOA 1WMBA 4MARA 1EJ2A 4DIOA 1X38A 4YCDA 2VOEA 4LQSB 3MG9A 2K2QB 3MMPA 4P58A 3ZNOA 4F72A 1WETA 3TE6A 5EJ4A 4WTOA 1FNDA 1YI0A 3Q7QA 2BY4A 2VHYA 3ADPA 3LBHA 4EATA 5B7GA 5G1PA 3GPLA 4PPYA 5C4GB 3T7DA 3ICOA 1LDBA 3DHYA 4QT4A 4PZDA 4K5QA 2Q45A 5KDDA 4BEBA 5G0WA 3VR6D 2CSXA 2IYFA 1H42A 2BU6A 4WFQA 2IY7A 1RPNA 3I34X 3BIXA 4CM1A 1UP4A 1KFBB 4DPKA 2RE8A 1DJPA 1FFXB 3I6YA 5L45A 3SMQA 4E3WA 4H1HA 4PPGA 3F5DA 3ZD7A 2R1VB 4E2YA 4PGMA 5KOJA 3L79A 3GCXA 2GZ3A 4KACA 5AVOA 1FJGB 2A6PA 4BYMA 5DTMA 3G2IA 4X62B 3ZR4B 1X6VA 4GLOA 4HWRA 1KY5A 4XM1A 3RGWS 3MTBA 4X61A 3E2MA 4KN9S 3IIIA 3LUJA 1E1RD 2FRDA 4NBVA 4GDMA 2PZMA 5BOSB 1RBYA 2MOKA 4MVJA 4MWZA 3FR8A 1G5FA 3BORA 3UWPA 5I7SA 2QAGC 2YYSA 4QECA 1FVOA 2BUCA 4Q4CA 2W8BA 4PSDA 4QU5A 3SYRA 2UUCB 3RRZA 3HP7A 3MHPA 3WIUA 3LL4A 1G7CA 1NP6A 3TTXA 1RQLA 3OZWA 3FTEA 2NN3C 4QTZA 3TZ2A 1D5WA 4QOSA 3RYCB 2CKDA 4AS2A 3NAMA 3F7OA 5L40A 3MOIA 2QY9A 3BREA 2Z1DA 3KJNA 5EWJA 3VR0A 5F9MA 5EIXA 2ZRMA 4C3ZA 4GNRA 4D2IA 3RAFC 4DR6B 2V96A 2D0DA 1NJGA 2IHZA 4XAQA 4RVSA 4MVJP 1HMYA 1NV8A 4JITA 3ZV6A 2EARA 2AXPA 1RJDA 2C5HA 4IIHA 3FCXA 3FSRA 3MWYW 5FBVB 4CLRA 3LYAA 3EPPA 4GIBA 4J6FA 1OU4A 2B21A 3D6UA 4FFBB 2YTZA 4J90A 4RVGA 3U31A 1NUUA 3K2EA 1RLMA 1PI1A 3PB3A 4MWBA 2ISSD 2A1UA 3UB4A 3CNHA 4ARZA 4DA6A 5EXPA 1OC4A 1KRXA 3PQ3A 4TTRA 1QIDA 1D7OA 1YCDA 1N4AA 3UCEA 1JHDA 2A94A 4BFCA 3D4BA 2HIGA 3G2MA 1UFOA 1E7RA 2JFFA 3CR7A 3DS8A 4GZ6A 3KLOA 1LS1A 1Q16A 2C2YA 4UDOA 2XJ9A 2PWAA 3HACA 2OZEA 4FMDB 2PMWB 1DSSG 1U8YA 3JXEA 1YB5A 3G2KA 3IP7A 5EA2A 4X7RA 4CTKA 4EDHA 3VV3A 3T1YB 1U2ZA 1XLVA 3E27A 4LGYA 5DFAA 4Q6WA 1UBHS 1YL7A 1I10A 2NYRA 2YXDA 3NHJA 2CNDA 4GGMX 5LU9A 1PLJA 4E5YA 3T1QA 1R6AA 5CB6A 3B1VA 1G8KA 1A1SA 2GD6A 1SVOA 1JSRA 2P2NA 4LI3X 4UBOA 2V8OA 1N75A 5BSVA 2VK8A 2VK4A 4QUKA 1NJSA 4FMPA 2WAMA 2A9PA 5KQMA 2PL5A 4BNLA 1Y3IA 2ODWA 3BFXA 4QGBA 1W6UA 4DV7B 1C30A 4K9DA 4C7XA 1O03A 2QX4A 3VADA 3OLWA 3VYVA 3ZGLA 2W2NA 3NEPX 4KLNA 4P2GA 1U8FO 4RTMA 1GT6A 1JU9A 1RJGA 3AHJA 3UZUA 2A0KA 1WS6A 4L4XA 2VBIA 3L4KA 1X8XA 1Q74A 4EABA 3WP0A 1X1CA 4JLJA 4LF5B 1GRQA 4Q0TA 4RM7A 2BGNA 4EQ6A 1W07A 2Q2WA 4DPMA 2CXHA 2VJYA 3N39C 2Q1YA 3Q5GA 3OHMA 3UG6A 2VCYA 2AOTA 2XWQA 4UXJA 3VPAA 4YQYA 1E2MA 5FUQA 3L8FA 2GDZA 2FDCA 5D1HA 2CFTA 4KFUA 5LA6B 1P4JA 4A8JC 3VNAA 2JCXA 2LKDA 2V74B 3C14C 5A4JA 3DCJA 2ZIGA 1Q7EA 4GH5A 1IG0A 3Q11A 3WQQA 2ZANA 2GERA 3FWKA 3C45A 2EKQA 1ZLYA 3LCCA 1RD4A 4RE6A 1ZUIA 5F77A 3H5AA 4L51A 4R51A 1ND5A 1L5VA 2JFNA 2VP0A 3KYCA 4OFBA 4JI6B 4BYGA 3IDSA 5B3JA 2Q29A 1U31A 1ORHA 5FL7A 4KMOA 1XRNA 1YR3A 1ZIOA 1VKRA 3A9TA 4XCXA 1QCZA 3COVA 3MJFA 4IG4A 1MC4A 3KQTA 2WZDA 1IUPA 2EOAA 2W6NA 2AEMA 2YWRA 4V0SA 1JHPA 2H1VA 3UWSA 3U56A 5BRMA 2KLHA 2NTVA 3K0CA 4W7SA 7MDHA 2O59A 2C20A 3E2PA 4NLLA 4RDCA 5LP6A 2EXXA 4EKDA 1NOIA 1DQZA 2VH5R 1BGXT 3ORRA 4MIOA 1I1NA 4Q3NA 5EJEA 5ELLA 2ZYSA 4BV2A 4AN0A 2V7PA 3BOSA 3VVLA 3KETA 3ERCA 1AB6A 1VJ1A 5IEJA 1U5BA 4QARA 3VSEA 5K0ZA 3BTOA 3HN6A 1N0IA 2D3TA 2QVGA 5EP2A 4ASUD 1KYXA 3IQFA 4W4TA 4ZYZA 2QTNA 2Z8YM 4LNUA 5I9TA 1RJ9A 1JHOA 1OGIA 5JEEA 3UPUA 3ZJTA 1K6MA 1PNTA 1A9OA 4HVLA 2A0WA 3BD9A 1IN1A 4Q7QA 5BSRA 2FI1A 4X64B 3EXFA 2CXRA 5JI3E 4TZTA 1ZCFA 2PZ8A 3AF4A 4YA6A 1BWPA 1BH6A 5E3HA 3GLGE 1H85A 3EPKA 3QX8A 5AHKA 1KZ1A 1UZAA 1VM6A 2P0EA 2JLXA 3ONEA 1X3LA 3RG8A 3Q22A 4INOA 4BO9A 3DKKA 3PD1A 1SVSA 2VF5X 5E38A 1XRRA 4O59O 1JPUA 2HMSA 3EVGA 5C37A 3S7WA 2PZGA 1NN3A 1PQUA 3GLGB 1RHRA 1S1MA 5JAOA 3JQ7A 3LGAA 3OP4A 2X2EA 4Z86A 3U17A 3FNBA 3OEWA 4TV8A 5BMOA 3CLTD 2QQ0A 5JAHA 4GWGA 3TLXA 4L5BA 3LA6A 1KIMA 2ZDQA 3JWEA 4WOPA 2MSEB 4MV5A 1R5OA 2OHGA 4HRVA 5L4NA 1S2IA 2DKFA 2Q0XA 3WYBA 4BU1A 3ROFA 1XBTA 3JQAD 2HBRA 2IXTA 1LWNA 1T2CA 4Q9NA 3HWSA 4KI7A 1ZIDA 3FZQA 1C7EA 3NHBA 3O73A 2IYVA 3A4MA 1RJFA 1W4CA 2Z4RA 3EBOA 4WL0A 5I01A 1SO8A 3EDOA 4MWSA 1NZDA 4CIBA 2DH6A 4M22A 5HQJA 3QKWA 5KOJB 4NFHA 2XKBA 4HV4A 3CLUC 3K72B 3N8GA 2ZAMA 1TX4B 1X91A 1MXFA 4ZI3A 1JQLB 1ESCA 2F2TA 5A4DA 3GJ4A 4EFKA 1M2OA 3L9XA 2FLWA 4DQXA 1FLAA 4XZ3A 3J81A 3K35A 2EW8A 4MRAA 3MWGA 4GXQA 1AKTA 1TA4A 5CW1A 2PZJA 4Z53A 1T3TA 2HBZA 3SHFA 1JQ5A 1G3IA 4NXLA 3ANNA 4ZO4A 5E1BA 4D8XA 1QK4A 4IJ6A 2OA0A 4BWFB 1MT3A 2D4HA 3EWNA 5BNZA 2OO3A 2Z56A 4OAPA 2I78A 3T7JA 4BVBA 4RWEA 2GRJA 1ODSA 3IBSA 4MV6A 5A5DA 2PVCA 2OEXA 5EWJB 2ZCJA 4IPTA 1N2HA 1QFSA 3ZZTA 5KTSA 4BCCA 3E9EA 3O1HB 3TUIC 2OG1A 4Z4FA 3ZHOA 1VE3A 2OILA 4G5SA 4LX8A 5J5AA 4R8MA 4CLRB 3KXIA 1QO0D 1ZHHA 1Z7WA 1JTEA 2VNIA 2Y0EA 4OBWA 5GV8A 3X43A 421PA 5K8IA 3DCYA 5DHQA 3DZGA 3SD7A 1A72A 1M7GA 3HVHA 4WY8A 5EP3A 4EVQA 1ICEA 4EX7A 1XA0A 4Z6KA 3OUZA 3U40A 3L41A 1PK0A 1PJSA 2A1UB 4IL5A 5BSMA 4ARZB 4MYHA 4B3XA 1YE3A 4C43A 4A03A 5J4KA 5B5WA 1F2UA 2NYAA 1SUBA 2JDIA 2FW0A 3FZEA 4JSYA 3O4IA 4UW9A 3KVYA 3A3NA 4PZAA 4UREA 3FKSD 1TA0A 3M6XA 3NTLA 4V0LA 4CLEA 2XF8A 4K1LA 5FYQA 3N2LA 2OFFA 3KQWA 1X8KA 4ZEOA 1TI7A 2I2FA 1Q3KA 2WWHA 1YAHA 3AILA 1JAXA 2I29A 3MNFA 3ZQ6A 3FY4A 4KUEA 5HGXA 5AVZA 4MVJI 3JPWA 3MDDA 4NBRA 3D1IA 3EVAA 1U0LA 4UZFA 3A2LA 1YZUA 1V7PC 2B4TO 2F1HA 5TY0A 1N7HA 2R6ZA 3VPFA 3F6YA 4RULA 3KFXA 2QW1A 1WZEA 3BCUA 3KYDA 5HKAA 4D1YA 4NOKA 3RGGA 2POQX 4IQFA 2VCEA 4MW4A 1NPDA 4U4AA 4MR8B 4OK3A 1MENA 3GQBA 4IRMA 1Q7TA 5EYPA 2A0XA 3WK5A 4CTJA 1OWLA 1RAGA 2IOYA 4MEBA 4M7OA 3D2BA 3CONA 3IT3A 3OU7A 3FPBA 1GT91 3AW9A 3ZPXA 1XQVA 4AW9A 3TXXA 4EHHA 1G6KA 4DREA 1C30B 3L1JA 4Q34A 5IPFA 3FH0A 3LGQA 4RZ2A 4G3XA 2WJWA 5IN5A 2R7AA 4L5AA 1U2EA 2V45A 2IF2A 4NR0A 1E2UA 3RO7A 2ZSEA 3ASVA 3T52A 3U4HA 1PFUA 5DT2A 1EK5A 4R6WA 1ITZA 1UBEA 2JAWA 4NCKA 1M73E 3GFFA 3DXFA 4G37A 3AY6A 1WL8A 1QHNA 4LHYA 4NXMB 5EVJA 2YR0A 3RYFA 4EO4A 3Q3CA 4EQ6B 2WZBA 5LQJA 2RJOA 1C9DB 5AVUA 1A1VA 3DGEC 4UDYX 4ZVLA 4J2OA 3L6UA 2ARKA 1QIHA 2AOTB 4GE0A 1Z4JA 3EIUA 1PW5A 4I8IA 2OZVA 3C5CA 4H7PA 2JFGA 1G9XA 1B14A 3Q2IA 1RM5A 1S89A 2ZP1A 3UH0A 4XASA 5EJ9A 1I5OA 1Z2PX 2Z6UA 4NG5A 2Q46A 4ZYJA 1IM5A 4QTTB 3E1GA 3UN1A 3LYLA 3UXYA 2PVSA 1J2JA 1NX6A 3AESA 2OESA 3O38A 2I62A 3ITEA 3O4GA 1Z6TA 3PHLA 3W6PA 2CW5A 5HFJA 3DVLA 1IL0A 3GLUA 4E07A 1E2DA 1G6HA 3E18A 4OHZA 3SJZA 1BX3A 1K8QA 4RL6A 5B58T 4IGFA 1SZDA 3LECA 1FJ2A 3KYCB 4XQCA 3HR4A 4GX2A 5LKRA 3DTYA 3R23A 4Y18A 2ZM6B 1EE1A 2J9XB 3FI9A 2VJLA 4PZZA 2PZFA 4EY8A 4ZI7A 2V3CC 1A5BB 3H9GA 1F17A 3T3HA 1VG8A 2AJLI 2P7IA 4GMKA 4EGAA 4F7DA 2ZO5A 4P4GA 1N5IA 2CNKA 4PPFA 5DB4A 3S1LA 5CEEA 4J1SA 4E03A 3TNFA 1QKKA 2XV1A 4Q1AA 1PJZA 1FF9A 1J0AA 1JLLA 2YMLA 4KE6A 1AJEA 2HA7A 4IV8A 1T25A 4M89A 4Q1DA 2GZDA 3UJAA 1JJBA 5CTJA 2V9PA 1WVGA 4FIDA 1RP3A 2J5QA 1X1AA 5KTTA 1RXUA 2BBOA 2BD0A 5AI9A 2PUCA 2I03A 3B3GA 3ZDCA 4GKJB 5C34B 4HQLA 1QHXA 4Z4HA 4WK4B 3LQQA 3C46A 2GN6A 4GQIA 4HBZA 4EH1A 1V8FA 5LNK6 3TZ0A 3RKRA 3UH1A 2FFJA 1P1IA 4RH1A 3QELA 2OP1A 3L6CA 2VHEA 2WSLA 3F71A 1YSCA 3ISVA 1BWSA 3EMDA 4CCWA 2O8EA 2EVWX 1PGQA 3QEJA 5E0KB 3JRWA 1NUTA 4NJEB 2VNHA 5AXBA 4WCFC 5HF5A 5B4TA 1TYBE 1TDJA 4IVQA 1AGPA 4EKEA 1T9DA 3EXFB 4H6PA 2ZWOA 4J4TA 4NBKA 1G3MA 1MFZA 1TW3A 1ZXXA 1F2VA 2WM3A 3O1LA 3NQ41 3ZS8A 4YMVA 3OPNA 2NSYA 4P38A 3M5PA 3KBOA 1CJVC 1KI3A 2WTXA 3K5HA 3WKBA 3ZWQA 2HHCA 2KW5A 1LNQA 3A6JA 2AZMA 3ND7A 1NA5A 3LPAA 5AQ1A 1XNJA 2QX6A 2JEZA 5I8PA 4GBED 3IS3A 2KQUA 2ABWA 3ZD6A 1ZH6A 2Q2NA 5EMJA 3JQ7B 5JTTA 4D02A 1SCAA 2NZ8A 1DKMA 2O2XA 2VPPA 3GLRA 1QH0A 3OFSA 4TV8B 2VF4X 3DT8A 4EMTA 2MSLA 1ZH2A 3EUFA 5JDCC 4F6CA 4FNAA 1MIOA 4GECA 2VWQA 1FFGA 3TLGA 4F5EA 1EGEA 1G0NA 3I42A 2E4WA 2ERYA 5ECGC 3LXUX 5H1YA 3C3MA 3NVMB 3D2CA 1R6UA 1M0WA 4JIZA 4JEUA 4IQ0A 4E46A 3R0VA 4A2CA 1VMDA 2J48A 2PR7A 2K4MA 2Q8NA 4AS3A 1U9ZA 2ZREA 1W46A 4JEMA 5AKIA 1U1DA 2XB8A 4FZ3A 5LWQA 4BN0A 4NARA 1Z5PA 2GZSA 1JEAA 1QLJA 2R8YA 2JKYA 3GRUA 3HJAA 3JQ6A 4XJTA 4UEWA 1JPNA 1U1GA 1PCXA 1RYYA 2PIDA 3WYNA 1IUNA 3F8SA 2UU9B 1VLHA 4IV0A 5DBIA 4GPIB 1L7PA 2OV8A 4MUMA 4WX2B 1GPH1 4ETNA 5HCUA 1W0JA 4JC5A 4BV9A 1M2OB 1QGUA 4TYQA 4R31A 1OE0A 1SUAA 2JBWA 4HG2A 3TM4A 4AJ1A 3K09C 3MTIA 4DA0A 1O1YA 2C2OA 3M6WA 4RZSA 1NPTO 4WECA 3L4BA 5JD5A 4F7WA 4QNRA 1UPXA 4GRAA 4IRXA 5DEOA 2AG6A 2JC3A 4O4HF 4RHXA 3KEGA 1XDGA 4KOAA 2VRWA 2WU4A 2WZCA 2ZR0A 2H0RA 4KQKA 4MVWA 4R0VA 3WIDA 2O54A 3O3MB 4QGHA 4N41A 2ASVA 1U0EA 1KP3A 3OPVA 4MKFA 2BDTA 2Z43A 2QZ4A 1XLTA 1VQ1A 1JQJC 3BH6A 3K9QO 4Z7JA 1WW3A 3D8RA 3G7SA 1LKZA 3PT9A 4BRZA 4HO1X 5G0VA 4DV4B 3RSSA 1YH3A 2VYQA 2GS9A 4KN8A 3ZY3A 1O87A 5JD6A 1M1UA 3U7QA 2H5JA 2GF2A 1EWTA 3UCXA 3WGHA 2BEVA 3BRQA 3DMNA 3PIRA 2O5VA 3SLKA 1FUUA 2PLFA 4GYYA 4TSFD 3RIXA 3RSOA 2LGJA 2C8KA 4QXPA 2HJRA 4J7UA 4B35A 1B76A 3GJZA 1F8YA 5IDXA 3MGCA 1B3BA 1P9OA 2FHPA 3C5WP 3NYRA 5TQ2A 3SHTA 1E6CA 1I1QB 1X1SA 3UJNA 1K5HA 4AY5A 3CX8A 1KDPA 3PHJA 5FV4A 1S8OA 1K8ZB 4UVDA 1F2UB 2BU8A 1GU6A 3R0QA 3EJWA 4LF9B 1R4NA 4F4FA 3GMSA 4PHTA 4FBGA 3K9LA 5B55A 2GCPA 5LNK1 4OGWA 5FOWA 1ZXLA 5F1YA 1ADJA 3HE3A 4TYPA 3IQHX 2QSJA 4DMKA 3OTOB 1YL5A 2P9QA 1FRQA 4L22A 1HYGA 4GSLA 2IUTA 5GJWE 3G8AA 4UE2A 4A2PA 5A4KA 5K9ZA 4W9NC 3QWHA 4EUNA 4X84A 2VPTA 5U9CA 3G7NA 3UU9A 2G4LA 3KEMA 4JMLA 4CV3A 1E9AA 3X1XA 1SVMA 1Z34A 1Q1ZA 2QLMA 4MQMA 3MCWA 3AC0A 1TLLA 4JOCA 1MEEA 5AM3A 1MW8X 1K1EA 2D7CA 2XQFA 2GESA 3PUZA 1YDMA 5HZKA 1D4FA 3TORA 1K06A 2YZKA 3GEMA 1ICIA 2YY7A 3BMXA 4UM7A 4ENTA 4RPLA 3C70A 5EYPB 3JQBA 1OFUA 4AKHA 1L4LA 4X3OA 3RUEA 4FLEA 3MWEB 3BXHA 1J5EB 1KC1A 4RKFA 3N0XA 1N0VC 3AIKA 1URPA 2D2XA 1ORDA 2FZCA 1U1FA 1JKIA 3CXUA 3WRXA 1EFPA 1PV1A 2QRPA 1R0RE 1J90A 4HWGA 1S2OA 2IIVA 2R8PA 3RFXA 5C18A 5KQSA 2AO2A 4O2AA 5AYVA 2CLOB 5DCWA 5HDQA 4DV3B 4BKMA 4DYHA 1LX7A 1UDXA 1PX2A 1KH1A 2DZDA 2AR0A 2VDMB 2WU8A 2XNJA 2QE6A 3CZRA 3A1SA 3ZK8A 2HRCA 3MCZA 3PGA1 4MI6A 1OR8A 3RYFB 3ZNPA 2NO9A 3U4AA 3M4JA 8LDHA 2ZI6A 3WZ2A 2OLKA 2GCGA 3VOAA 2JANA 4FD2A 4LS3A 1L5RA 3D02A 5ARBA 3HEBA 3X1YA 5BW4A 3HK2A 4JLOA 4E5VA 1N8NA 2OGSA 4IWYA 3HXKA 1K5DA 2W6MA 2OO5A 2C99A 2JK0A 2XSZA 3VOSA 2VDQB 3FNEA 4NZNA 2W22A 5LQCA 3Q5DA 2DR3A 1XVAA 3AESB 2O3SA 4YMSA 2AQIA 1BKDR 3EFHA 3QVGA 1UANA 4JJFA 5FPSA 4ZC1A 1RC0A 2GEBA 3PQ4A 3PUXA 3R3YA 1HT2E 3ILHA 4OQ4A 4YUVA 2F1IA 3I6BA 3AVUA 2GPWA 5EQFA 4TS3A 2OC9A 3RIYA 3AJ9A 4EB8A 1V3TA 4ZI7B 5AVJA 2DU8A 2EFDB 2AJBA 2CK3A 5FPYA 4PTZA 3ROEA 2Q3FA 1KQGA 1E32A 3RREA 4DCNA 1GKIA 1CF2O 3VTZA 3RIMA 2C12A 1UK9A 1V16A 4JN6B 3TNDA 1UPBA 4P98A 2ORWA 1JLLB 1UOPA 3M82A 4MKIA 4CF6A 1JVSA 4XFKA 4Q1BA 4QQNA 2GCOA 4XB2A 4Q7KA 3UGJA 4D9NA 1J42A 1FQOA 1K4MA 2AOWA 2RD2A 3D3NA 4JVNA 4LRTB 4OUDA 4RV9A 4UBNA 1DFIA 4UUNA 1MGOA 2YJNA 5CDFE 2BI4A 1MJGM 1M72A 1N7IA 1IOZA 1D07A 1S01A 2AR7A 3P26A 2EWVA 4TTAA 1U7HA 5D3MB 4GRIA 5JCXA 1T8UA 4IHQA 4PG8A 5JS7A 5KX5A 3QELB 4RCZA 4M9RA 1UKYA 1UP7A 2E5LB 2O7SA 3RADC 2WJPA 2L82A 2ZB3A 1QVVA 2KWIA 2VP3A 2BL4A 3AX6A 3FWYA 1JNYA 5GWXA 2G80A 4Q5BA 4D4LA 4WVLA 6Q21A 2WFMA 5AI4A 1E9SA 4RDHA 4MS1A 3U1VA 1NUQA 4UQPA 1KYVA 2I34A 4X93A 2CJ8A 5H80A 3ETGA 1CY1A 1LF0A 3L0ZA 3PIDA 4XGNA 3TLCA 1MAHA 2VWPA 3IE0A 3TLKA 4IIDA 2IYOA 2VDKB 2XPCA 3Q9LA 4OMFG 4F6LA 1AGNA 3ZHVA 1EK1A 4BAZA 5J1SB 4KCGA 3GFVA 1YAJA 2FP1A 4C20A 2PDAA 4LMPA 3L1VA 4BMDA 4FE3A 2P67A 4OIFA 1G8AA 2X2FA 1MIOB 1C4KA 1JAIA 3TLGB 4DUGD 1UEXC 4MGHA 2PJUA 1DADA 4GR4A 1UFKA 4B44A 4D4IA 1JEDA 2DQSA 1T5TA 3T7KA 1KERA 2WWXA 2YMQA 1WXQA 3QPCA 3ONWA 3OX2A 1WXFA 2K5UA 4LOKA 2B4AA 5CA0B 4JUDX 3MRTA 4MA5A 4K8RB 2Q4BA 1K4YA 4M9UA 4F0XA 1QYIA 2CYCA 2V8BA 4LXHA 5AVKA 5JADA 3EODA 4UTVA 2HV9A 4N6OA 4BVGA 3MD9A 4X60A 4U7HA 1RJEA 5DGXA 4QASA 1RPTA 3TNYA 4F9FA 3IIEA 4YMGA 1JJIA 4F4UA 1KP9A 3EHDA 1V3VA 3OO1A 1H3NA 3AB7A 4KBGA 4XIGS 5HCNA 1CULC 3BK1A 4FHFA 4N5HX 2GB4A 1BQ4A 1OXTA 1QGUB 2D1SA 3G85A 3I9OA 4NMXB 4WINA 2C0CA 3MKHA 2RGNC 5HF6A 1IJFA 1VYHA 3G89A 4RSHA 2YKGA 3PJRA 3D6TB 4U02A 4NWIA 1PWHA 1EHCA 4HLDA 2HU8A 5KAMA 3UAXA 4DQKA 4LGVA 1FDVA 1OZHA 2HN9A 2ILVA 2QVXX 5ALHA 3EZXA 3FGOA 4F91B 2FSHA 3R5SA 4YUXA 2QZSA 2ZYIA 4NI5A 5HZMA 4HUTA 1WUTA 2AC4A 3QUQA 4WBSA 4X66B 1C4OA 1UMBA 3AHIA 3ORQA 4KRGA 1DELA 2Q5FA 3DCIA 3GEPA 2J7AA 1QP8A 4NOLA 3VR1A 1G1MA 4GZLA 3RS0A 5BN4A 1LBEA 4LF7B 4I55A 3PNQA 3U7QB 2HRRA 7GPBA 5HE8A 2XRFA 2BEVB 4I3HA 4O4LA 3KFVA 3FO3A 3G02A 1HZJA 2BRUA 3BULA 4QEZA 4B4OA 5LP1A 2EFJA 4CIWA 1SELA 2J41A 3H1EA 3H04A 2PZKA 4HH0A 2CV0A 1BS2A 3BA6A 4PNPA 4KE8A 4GC5A 1TVMA 1FDRA 3Q3IA 4R2LA 4Q01A 2YOFA 1P6XA 3QBTA 4KYUA 5KPJA 1IZ7A 4QDOA 4OX9B 2VP4A 4C7KA 4JL6A 3I76A 4DXHA 2VUSA 1G2QA 2YS6A 2AN1A 3K7EA 3FYUB 1C1YA 1XXHA 3GARA 4JP2A 5DASA 3CV3A 3OIVA 3T3IA 2IBTA 2FMHA 3DL7A 2JCGA 3MN1A 4A2WA 1SC1A 4E30A 4I1PA 1KOGA 4GEGA 4MSUA 1GZ5A 1X87A 1HT3A 1D3AA 2W58A 4P3XA 4B6SA 3ZX4A 3URMA 4TTQA 2XYHA 1O89A 5CLJA 1VJ5A 4NZZA 5IAAA 2BFBA 2E4ZA 2Q41A 2ZAYA 1E3JA 5G2OA 2LW7A 2BJVA 3VC7A 1Y3AA 1KZ4A 1QE5A 3OWXA 1WXHA 3D7NA 1JLSA 3FIUA 3QVTA 1TC2A 1K7XB 3SR4A 3MSXA 3UMRA 4JWKA 3ZWAA 4CDRA 3L1UA 1IZ0A 1WXEA 4QPCA 4ZDWA 1GUZA 4DMCA 4M60A 2PSJA 1QKJA 4QDZA 5AUNB 4J4BA 3RS5A 1EQUA 4KPEC 2JBRA 3IIJA 2DFPA 5JMPA 5B30A 3GHYA 1FFCA 3SZRA 2AV6A 3I45A 2IEZA 1I6MA 2HIAA 3OQVA 4XW2A 4DLXA 5IJ9B 4DDVA 4P35A 1L7NA 1ONPA 3LOQA 2QGZA 2PBFA 1EFPB 1R3BA 1VRWA 2GRAA 2N0SA 3KOYA 4FFNA 4K26A 4HKSA 3BKWA 3TINA 3ZY4A 4BO6A 2YQ5A 1T4MA 2YJ3A 1T35A 4JOQA 3EQ8A 4O2AB 4V24A 3R76A 3W9BA 2ZDXA 1P9NA 2QQGA 3QKSA 1R6VA 1Z82A 3VC3A 2C97A 4V38A 1WP9A 3TNLA 3M6AA 3STXA 3TI9A 3SWOA 1LRLA 3V3KA 4N5IX 3SE0A 3E22A 2E4YA 3EIFA 2CWWA 1B26A 2HIHA 1PF7E 1VJTA 1YIOA 1FYFA 1FMLA 2JJMA 2R2GA 3H75A 6NULA 5AW9A 4KVGA 3SSMA 2I5PO 2V4UA 1N2XA 4JT8A 4FYXA 4NV0A 5DI9A 3SZGA 3TVDA 1KAQA 2GLXA 3L7JA 5DGIA 5EJ6A 1E4EB 5TXGA 4POOA 5IN4A 3QKIA 1QHGA 1T9KA 5LDGA 5TQVA 1GILA 1UWKA 1SRRA 2VUIB 3F47A 4EFNA 4RPHA 1BDHA 2FQYA 1GAEO 5E9JA 1MZVA 3MT9A 3OQIA 1O6ZA 4RX1A 4YMUA 3O8OA 1ZI8A 1PBTA 3HGTA 3QVGB 1O08A 1CZNA 2WUEA 1E92A 5TPZD 1PS0A 3PXCX 1MVLA 4NATA 3PEEA 1P62B 5E1DA 1YMVA 6GPBA 3JSXA 5COQA 5LQMA 1GL9B 2ZI5A 5KMGB 4MPDA 4RESA 1XTTA 3IYLW 4DNPA 1E0DA 1H8HA 3A4LA 3BS4A 3EISA 2CVHA 4LRXA 1TKCA 1QRUA 3BMNA 3IX7A 2GSDA 4DMMA 3J7AC 8MHTA 1U94A 2H9IA 6PFKA 1P72A 1KSGA 3MT0A 2FZLA 2YWDA 3C15C 2X0DA 3I09A 2VH1A 2JGAA 1YHYA 1NY6A 5HIJA 4NE7A 3LZDA 4BKRA 3G5AA 3EOAI 4DMRA 3CKLA 2GCOB 1IXRC 4M1KA 3HXPA 3IQDB 3IDOA 3EPJA 1TGVA 3QUTA 4C01A 5B4VA 1F7VA 4Y8VA 1YJ8A 1N7GA 1MJGA 4YUYA 4RKEA 1Z8HA 1MN6A 4EBFA 5G3YA 3ZOKA 1UM9A 5IYZA 3L6RA 2OUKA 1CUZA 4NZ9A 4N3AA 3IPRA 3TKYA 1XT6A 1MLDA 3PP8A 5KX5B 3FSGA 1YL6A 4K6GA 3AUFA 1YMQA 3PWTA 4JC4A 1KKMA 3BMCA 1AHHA 1EE2A 1XQXA 4FDLA 2RHLA 5DV9A 3R6WA 1CXZA 2OCBA 4AMGA 1U4OA 5TX7A 1XSEA 1NLUA 2H85A 3UJBA 3DDSA 4EEXA 3PEUA 4Z0PA 3Q9NA 2FPMA 2VFAA 3N7UA 1ONSA 3D54D 2WE8A 1B8VA 2ZSBA 5FNVF 5JSHA 3JD3A 3B3JA 1E58A 2O4UX 3FHJA 4BQNA 4GR5A 4BNYA 5JECA 1RBZA 2YHAA 3DTTA 2W2KA 5H9WA 1G64A 4FINA 1MQSA 2Q8PA 2R79A 3OF5A 4NJMA 2JGDA 4CKYA 4YRNA 5BMVB 1WPRA 1J1IA 1EX6A 3IAS6 3BD7A 1ZJ5A 1Z2CA 2WR8A 3LQYA 3HV0A 4F71A 4JA2A 5HM6A 2HTEA 4GX5A 3DC7A 5J47A 1O4WA 1I3OA 3IQWA 5FTMA 1ZSVA 4WLNA 5KEIA 5LXTB 3H5WA 4P79A 4IZHA 4UU1A 2VAXA 1YZGA 2OCKA 3BK7A 4DKJA 3V3TA 1FXWF 5C4IA 3SEZA 2PMKA 3L8CA 2VEOA 2R1TA 1JEQA 4FTWA 3TEJA 3HFGA 1K3UB 3ZZMA 2JFXA 4L5JA 3P2OA 4ZQGA 4GC9A 4UUQA 3RC3A 4FZ4A 3HBLA 4HLQB 4ZP1A 5IAGA 4ZAFA 5F3RA 2XDQA 3KTFA 3UTCA 3THYA 3ZV7A 3DBLA 2ZM5A 2HF8A 3QXCA 4DV0B 5HMLA 2VP9A 4MKHA 1WD5A 1SQ6A 3C3LA 2DUWA 3P5BA 1SRQA 4FGKA 3V4SA 5IJZA 1EFVA 2XNDD 3KKMA 2WDZA 2QL9A 1D2AA 2QRZA 1E7QA 5AK3A 3R8FA 3NVDA 1EVQA 4H1VA 3NHFA 3FFBA 1SGWA 2OC4A 1DWOA 1NYQA 2DJIA 4Q02A 3WGYA 1R5BA 4L6CA 1SK8A 4IFTA 1S1CA 4UVHA 3X3HA 1PT5A 2QJWA 3MXOA 4Z99A 3ZQUA 5JXGA 3F9CA 3OG9A 1DKQA 1OJ7A 2XBLA 3PD7A 2Q0SA 4HEJA 1EIWA 1KP2A 5EQJB 1H0SA 2YFYA 1UMBB 2PO5A 3ZOZA 2NMVA 3N0WA 2G25A 2BGWA 3UOWA 3OEHA 1WXWA 1Z9BA 5BN4B 5C5IA 4IDGA 3CVOA 1MO2A 2ECOA 3EA0A 3NALA 4O4LB 3S81A 3MMSA 4IMRA 4QD3A 5TQJA 4RTQA 1GRCA 3PNSA 1CUEA 1XCMA 3OWOA 3OY7A 2WFAA 1SZJG 2VXOA 2GFQA 3IPAA 1VIAA 3FJ1A 2UKDA 1Q92A 3D8UA 3HB9A 5EZYA 2R5NA 2DT8A 4PYOA 2OFXA 3OM0A 1J22A 2YYYA 3BXPA 2Z4SA 4BJ6A 1MP0A 2ZWVA 3GZJA 1YKSA 4EHIA 1W36C 5J9FA 1QTIA 4CFYA 3AI7A 1Y6QA 3KUKA 2WA2A 3D31A 4ISBA 1AXRA 3IEMA 4IINA 1HORA 2XWSA 3BE5A 4GM1A 4U6QA 3MOSA 4GXRA 5FLXA 1XMJA 4YJ3A 5EPUA 4HQFA 2P9FA 2QM3A 3WLMA 3KV3O 4EG4A 5HS4A 4AC9A 1ACLA 3MELA 4MB2A 3S8MA 1QP7A 2BFBB 4FOLA 4I81A 4LJLA 4O29A 1VI5A 3W2HA 2GMWA 3ZXYA 1A4XA 2LIPA 1XAHA 4ZJPA 4AJLA 3C3DA 1CY2A 3G13A 4XE5A 4ZGBA 2YWGA 3L6EA 4AO7A 3SCEA 3KPWA 2C2HA 3GYBA 3VU1A 2HSDA 2VZ0A 4CNBA 2CDCA 2A4KA 3QNMA 3ZWNA 1O9GA 2A0YA 2DEUA 4DOMA 2P1RA 3T41A 1G8SA 4G01B 5DWQA 2TMDA 2MCFA 2DFKB 5IJXA 1B16A 2G04A 2Z1QA 3IAS1 3FNGA 4BMXA 3OQNA 4N54A 4IJQA 1KVRA 1FYDA 1Q7RA 1GP2A 4JJEA 2HM7A 3E7XA 1I5RA 3ENQA 1RXYA 2B3TA 5FHRA 3VJMA 1AQIA 1LLQA 4CR8A 4MJXA 3TLEA 5JFGA 2VYFA 3EEQA 1EJ6A 1OX4A 4GW3A 4HD8A 3SQLA 2P30A 4CQMD 4YAOA 2NACA 1GTJ1 3QKSB 2OPHA 3HI4A 5CMLA 3Q3GE 1TA9A 4E00A 4LBYA 3GH1A 3PNMA 4MI3A 5CX1B 5AR1A 2RF7A 1YGYA 5A6VA 1PEDA 4G24A 2CJ6A 4URFA 3E22B 3VHLB 4UHFA 5IF3A 5BVHB 1YU6A 2R6DA 5JG7A 2VR1A 3PHBE 4ZAWA 5HNKA 1F7UA 3BJMA 3HGQA 1W7AA 1JIQA 1ORTA 2FN3A 5BWOA 5I45A 4D3XA 1BXRA 1E62A 4L5YA 1OIWA 3FR7A 3LSYA 3A14A 3PIIA 2BI8A 1C0PA 4IRUB 2I4OA 3KWLA 4RIGA 4U7JA 5D8DA 3WNDA 5CT8A 3WFIA 1BROA 3AUUA 5JYBA 3Q2OA 2GF9A 3IHTA 3CPSA 4NS1A 3STUA 1P75A 2V3WA 3OQIB 3L7AA 3NM4A 4NU5A 4XWGA 4XJXA 4EY5A 3O8OB 4MR7A 2PLWA 4G4SO 2GH1A 1XR3A 2GFIA 4JYMA 5COBA 2PMCA 5C1DA 3I62A 2QUAA 1RYMA 1SUSA 1ZQ1A 1FTGA 1RXIA 4PVCA 4WK0B 1H0KA 2X2OA 1TMOA 4JOBA 3NXKA 2PWBA 1EFAA 2IHJA 4ZVQA 5K0LA 4CQLA 4HKTA 1JSLA 3ZCPA 2XMCA 2XUAA 2YXEA 2FJUA 2ZUSA 2JLBA 3BMNB 3KOWA 2RKBA 1QB7A 1RRVA 3G6WA 3KPUA 3RASA 1DO8A 2B5OA 3KSUA 4TVKA 5B3LA 2O8CA 2CVZA 1ISHA 1WCXA 1NP7A 3ZUGA 4RTJA 1Y1RA 1Z4MA 4M8SA 2YW9A 4P7JA 5AW8A 2BVNA 1ZRNA 4A8HA 5JSUA 2C3MA 1U6KA 2F3UA 3GAFA 2JCYA 1AN0A 2QTWB 2YZ2A 3AUKA 3IMGA 4AN1A 4PO1A 1KFCB 1MT0A 2V0NA 3F8TA 1XCLA 2XTJA 4J43A 4KR2A 3DEFA 4KNVA 5C32A 2ZBQA 1PWEA 4I4NA 3OJWA 3IILA 1UM9B 4MGIR 2VBCA 1CBUA 2ENWA 3DOHA 1N9KA 3EEYA 2A1IA 4IFIA 1DMRA 2CUNA 5DBHX 2ZDGA 1TQDA 2QUIA 4Y2JA 4Z7OB 1XEAA 4UQLA 4KH0A 5TVGA 2HT6A 2XY4A 2BP7A 1RPJA 3LCUA 3LYHA 4LTMA 2W83A 1Y98A 3A1CA 3HNOA 1X77A 3PRHA 2B7BA 4GI1A 4K3UA 2Y1GA 2FSIA 4JBXA 4D43A 3DG9A 1PZGA 3RB8A 1U1EA 3U19A 1LLFA 2I3ZA 4DCTA 3FUXA 3H1GA 5EE0A 3K2QA 2F7SA 2XYVA 2HBYA 1Y5MA 1R9GA 3KX2A 2W2OA 4YGXB 3ZGVA 2W2KB 4PX5A 1W49A 1U7PA 5JO9A 3C87A 4EWLA 4NJMB 1JNXX 2JGDB 1JJVA 1AZLA 1AB5A 3AHEA 4RCYA 3LVQE 5DM2A 5FFNA 4BP8A 2JVKA 5TMBA 1KYQA 4WBXC 2GBLC 3DMYA 1L8OA 4BGDA 3Q3EA 3O95A 4PIVA 3NDBB 5I9BA 1DXHA 3CFYA 4N39A 2PH1A 3KSMA 1Y8NA 4X91A 3R4CA 2Z6AA 3DTVD 3DM5A 5FB3A 1DCFA 1BEUB 2X23A 4Z54A 2HFJA 3NH9A 4EW1A 2IXDA 4X6LA 4F8JA 4GX1A 4C14A 5A06A 1YVRA 4WN3A 4JEKA 3KSDO 1KEUA 4LMAA 1FNCA 1KEEA 2ORYA 2WJYA 1IE3A 1U98A 3FG9A 3U3JA 3BWYA 2ZJ7A 3A05A 4ZCSA 1TM1E 1P1RA 5LWHA 5TR9A 1TVKA 4R8VA 5BXQC 3WSWA 2XDQB 1YACA 1LPPA 3HCFA 4RF2A 4DQUA 3THYB 1KGSA 1EK0A 3DBLB 1UQUA 2HNAA 2PKCA 4I6EA 4WDRA 2G83A 1I30A 4JSTA 1TMGE 3ITNA 4KWIA 1EFVB 1BGWA 2ID7A 4E94A 3W8FA 1PTJA 3PFHA 1FX1A 3CSDA 2MSCB 2HLHA 3VX4A 2C61A 4D3FA 5NULA 1RWMA 1A9XA 2IYEA 3H4MA 2PL3A 3PRYA 3V2GA 1WQ4A 2JKVA 1EXMA 2GHTA 1JEEA 4DRZA 4DR2B 3VO8A 1K8YB 1H9BA 3F3YA 3WV4A 4K03A 1J2UA 4O4JF 1ENZA 1OWPA 2QSUA 4C0AC 2ZE8A 5JQGF 4WW0A 1NM5A 1BC5A 2OXFA 4BZQA 1ZZGA 2YYMA 3KEOA 1Z7GA 3NT4A 2IS1A 4F0JA 3FNQA 3T99A 3SDSA 3DP7A 4XGKA 5F3WB 4PZYA 1D2GA 1XZ8A 5ICFA 2BOVA 5CG2A 4G1FA 1WY5A 4KDCA 2W2VA 4UNNA 5EIEA 2WYWA 4R9NA 2REOA 3LWDA 4KQIA 3ZE6A 2RH8A 1BDMA 3AY3A 1XCGB 4ZQEA 3I2KA 3U37A 3OLCX 3PFWO 3AWIA 1E5VA 1UKEA 4NYIR 4XR9A 5GAJA 4EBBA 3ZXUB 5SICE 1EX9A 4Q39A 3DUWA 3DEAA 1H5QA 3VUEA 3ZBQA 2WJGA 1PJCA 1Q50A 2YYZA 4ARVA 3SQXA 3D5TA 4WZZA 3LFUA 4HNVA 1CD5A 1R6XA 3DLIA 3OZUA 5FL3A 5FR2A 4DLYA 4EHLA 3FD8A 3M7IA 4X1OA 1KI1A 1GTMA 5KYWB 3FYHA 4U8GA 5K99A 1MX1A 5JS2A 1H93A 3NTXA 3REOA 2NO5A 2GXSA 5BY2A 3BIOA 2BTOA 3SYMA 2XMRA 4R9RA 3FWNA 3VR3A 1C8LA 5JYDA 2DHEA 1FE8A 4YJ3B 1ZYUA 2FG7C 2MSWA 1H22A 2R4UA 2O19A 5LYJF 2G63A 1JZQA 2OKCA 3HDJA 1S6YA 2X4DA 4GQAA 4KU4A 2XUQA 4YRFA 4WJLA 4NF2A 1RAFA 5CVCA 4I66A 3K6KA 3AKDA 2R6AA 2GZ1A 3QPUA 4IDNA 1IMJA 2W6CX 2V6BA 3HKCA 1ZAYA 3CH4B 5SY6A 4JI5B 1XAIA 4E2XA 1M6YA 1SQFA 4RIEA 5CLIA 1UBUS 4LK3A 3C39A 4PF1A 3RRJA 1P7YA 2YY5A 1M5TA 1ZH8A 1CJUC 1AKVA 2IGBA 2OSBA 2OXRA 2YHUA 2FZEA 1S26A 3BSSA 3FB1A 4F6RA 1T9GS 4ZT2A 3T7RA 1YVDA 2QL6A 2VYVA 4MR9A 2VXCA 4OK6A 4C6SA 4YP7A 3WSVA 4PSAA 1CSEE 1Z8NA 5AIBA 1LDEA 4RGVA 1SUPA 2GZ2A 3QLVA 1HGXA 3C0KA 3UKJA 3SC6A 4J94A 2HHAA 4M87A 2A9KA 1LSSA 4U2BA 5A6SA 3R7KA 4JU8A 1GTRA 5DZSA 3VKGA 1NVVQ 4LGCA 5U4XA 1D6MA 1BQEA 1YJXA 2H4JA 2HQRA 2V5VA 2VC2B 5KREA 4MQFB 3K53A 4BY9E 4N49A 4TMXA 1S2GA 2C7VA 3RVDA 3WMRA 3C8HA 5LLTA 4ZHSA 1QZXA 1SQSA 1BXRB 2JBSA 2EYQA 3K73O 3RC1A 1J8FA 4P83A 2WOOA 4BFUA 4K86A 4UXIA 3BHMA 3BD8A 4L2IA 1U0TA 4LY3A 3C4JA 1P1BA 1C7IA 3H0KA 1RKVA 5CT4A 5FOTA 3MT7A 1QK3A 3T5GA 3ZXXA 5GIOE 4JAVC 3SZMA 4HT3B 4NK5A 3R40A 2FH5B 3RABA 4DG8A 3BWEA 1SURA 1C3VA 4MR7B 4XI9A 1QG0A 3QUCA 5EERA 2W6JA 3RE1A 1TECE 3AEXA 5AK5A 3K1AA 4Y9SA 4OQMA 3O26A 2Y8EA 3W4JA 1A97A 2ZVQX 3FZGA 3KVNA 4XX0A 4XYLA 1SQGA 1SC6A 5CFOA 1N8KA 3WV5A 4QODA 2Y2VA 2QK4A 3E0XA 2PRJA 2VPXA 3OLZA 4CU2A 1YB6A 2E4VA 2WKSA 1JW9B 1JILA 3ANXA 4G1UC 3WGLA 1N2OA 2HUNA 4WDQA 2D2IA 2AN4A 3OM1A 1KDZA 5LSAA 1V45E 2ODEA 2O9JA 4U1RA 5CVVA 3TIXB 3VH3A 2G9UA 1TQ2A 2O8CB 3PX7A 2AXNA 1NT4A 4L7QA 3ROQA 3PLNA 3HDTA 3B48A 4K9QA 5JSKA 3PL5A 3O0DA 2PLAA 4HAYA 3F6RA 5IFLA 2G67A 1KDVA 1Y82A 1QYVA 2VS1A 3CG0A 2B37A 3ELWA 5K1ZA 2W42A 2OXIA 3WSTA 5IU6A 5MN5A 4HPWA 1T10A 3FOFC 1GO2A 2VDLB 4NABA 2X7JA 4R40A 5IT0A 1I94B 3GWZA 3NHYA 4J4HA 1E2EA 4I1SA 4M7PA 1LQTA 4RY0A 1LJLA 3QVKA 3QW4B 4QDJA 2GD2A 1TADA 2GJ8A 4HYYA 2BP7B 2FW7A 3ON5A 2XS8A 3PU6A 4U3JA 1DQRA 1QCCA 4FYIA 3SNHA 1QBKC 4ZT6A 3WKCA 3CMCO 2OQVA 3MLEA 4BHTA 3KQLA 3CWZA 4E70A 1EGQA 4R05A 1P80A 1PL8A 4CHGA 1KYIA 5FWXA 4MW1A 3ZDYB 1DFHA 1TJPB 3OBBA 5CCEA 2VPIA 2VO1A 1RRFA 5TPWA 2CBZA 5FBZA 1RAHA 3D7RA 1EDOA 4S1TA 1E6MA 2DLDA 1W5FA 3AJEA 4TWIA 5KDLA 1LUAA 5B2FA 1TW2A 3DDHA 4LTDA 2FJPA 4JP1A 4PYNA 2XQKA 5GMOA 4C4RA 3P5SA 1CVRA 3NFRA 4C78A 5L7WA 3SDZA 3LT0A 1X1QA 2ZUEA 4LXTA 1M6NA 5JO0A 1NVMB 2Y6VA 1US8A 3BQMB 3NTQA 3OETA 4I4LA 4OYRA 5A3SA 5JH7A 4MI1A 2O7VA 4BO4A 1ECJA 4DJAA 2E1RA 4O5OA 4MB6A 4MJLA 3FVQA 3OA0A 5F33A 3HO6A 3OKPA 3CLRD 3TCNA 3EOBI 4L50A 1XWIA 1IONA 2GPTA 1QR6A 1KEEB 2O3JA 1AKUA 1LLDA 4S0XA 2NT4A 3B13B 4RS3A 4BTVA 1G4AE 1SU7A 5DCLA 4AX4A 1VI6A 1H8EA 1TVKB 5HVNA 4QKQA 2O0HA 1GKZA 4RJJA 1TFRA 2FOXA 1TCCA 4DBLC 4B4KA 2BFPA 3KXLA 1E6UA 1GGNA 2G9RA 2K7FA 2PD6A 3FF1A 1L5ZA 3M6MD 2P41A 4DMHA 1M2WA 3AF2A 3K8YA 4DYVA 3DT6A 4IIJF 3VAAA 5K3JA 5DU2A 5EKXA 3ZZ0A 2QAGA 1U0NA 3S70A 4F46A 5B58C 2DTXA 1ID8A 1R4MA 1A9XB 1ADFA 1AO0A 4DRYA 3GAAA 3QMMA 4ZT7A 4ZGWA 4XUDA 1NX9A 3WGGA 1FU4A 5EGNA 4HDNB 3V1MA 4Y1FA 3NBKA 4FF2A 4Z4EA 1BA2A 3AF3A 4GR9A 1CS4C 4RZHA 3CRRA 1NXWA 2A14A 4DLKA 1OMOA 1G66A 1R8SA 4J0EA 4MP2A 4NE9A 4TLMB 3TEFA 3WGIA 2X0EA 4MW6A 3DXYA 3TOSA 3WNVA 2YYIA 1N2CE 2H92A 4HCJA 4ADSG 4KR3A 4LWOA 1PS8A 3SVTA 4D5EA 4RTKA 4OHCA 2IC5A 3CPEA 1LJUA 1RWXA 3S1SA 3B20A 5JV5A 2JHFA 2AEFA 2FY8A 3AF0A 2P0AA 3GZNA 3K5IA 1KH2A 1PFGA 3OFKA 4GBJA 5F1OA 3HCDA 2A9QA 1XRJA 3HPQA 1NF3A 3WLEA 2J3IA 2Z9DA 2BUAA 4KR9A 4ZQHA 2DY1A 3TMKA 2WWTA 4DM7A 4LSZA 4G4IA 3TTYA 3FKJA 3P71T 1N2CB 4FGLA 3SSNA 4EUHA 1J99A 2WLSA 4WEOA 2BH2A 4OF4A 1C4WA 4RH0A 1PKEA 1DLJA 4I50F 4LUCA 3RHSA 4Y9DA 4L8FA 2Y93A 2H3EA 4C0BA 5E2AA 1J70A 3WB9A 4LFCB 2QRUA 5HSGA 2VTBA 1AQ6A 4OBXA 3JD2A 4MZXA 1RXWA 1E9DA 2EGUA 2B82A 2JGMA 4B3HA 1Z63A 2C54A 4YV0A 2WB2A 1YA4A 4YRMA 5EHNA 2ONKA 2Q5EA 2C1XA 2WAOA 2BFOA 1DVRA 2WWGA 2FB9A 4LECA 1FS9A 3LKDA 3I1FA 1JHMA 1CUUA 2PU7A 1CRPA 3G68A 3W4IA 4I5DA 1Z7EA 2E1PA 5HK8A 4J16C 1BZYA 1Z33A 3HKCB 4QU9A 3U16A 1C1XA 3CBGA 4B3JA 5CDGA 5J4LA 4ER7A 1DTWB 3EVTA 2BFNA 3A3OA 5F76A 4DM3A 1YGPA 1I33A 1P2BA 3DE7X 5H3HA 4QE3A 4B6GA 5HPYB 6ABPA 5DSTA 3I2FA 3GQVA 3W2TA 1ZD2P 2CCKA 3F6EX 4F6RB 2BGUA 4MR9B 1ECBA 3VDMA 4ETWA 2EV9A 3BZBA 4AMUA 1E4OA 2YHBA 3SI7A 4Q7EA 4P4LA 4EZBA 3U5ZB 2OP0A 4FR2A 3KLPX 3A7EA 4JB3A 4Q82A 4ISCA 2EDCA 3I1IA 4KWEA 4ZJUA 2MR5A 3KELA 4N3BA 2R0MA 2GJ4A 1X74A 5A9SA 3CLKA 3VPSA 5KYUB 1GD1O 1FTQA 1XEFA 5FP0A 3T1TA 3CNQS 5JRZA 5A6SB 3V9PA 4CXMA 4CL3A 1OF1A 2VUUA 3MJEA 3O3OB 2XMGA 3IJPA 3OEEA 4OCZA 4QXAA 4UCQA 2XNSA 3RU7A 2RHWA 1GNQA 1O57A 1EX7A 4KNYA 1OZGA 1DJQA 1THMA 2LR0A 3NAGA 3VZPA 3D4LA 3U80A 1I2CA 2G71A 1M1YE 4NYJQ 1KO5A 3W2IA 4WN9A 2FPSA 5B2ZA 4WXPA 1Z6QA 1EAYA 1G21A 4CMHA 1ZD3A 1Z12A 2PKXA 3DULA 5ICMA 3VMMA 4C2TA 4FXPA 4ZV9A 4QGAA 1JMKC 2NU9A 3BE4A 4GZMA 4Y9UA 3ANYB 4EVIA 4MV7A 3NDJA 4KP7A 2QN6A 2NPIA 3IELA 1FBTA 2I1LA 1L5QA 3PKIA 5A7HA 4CWAA 1E5DA 5DRYA 3S2YA 4DNFA 1WUKS 1R8JA 3K1AB 4PN7A 5JVDB 1L3CA 4XX0B 3D8NA 2JLVA 1JH8A 4H59A 4AKEA 4AAYA 2CLMB 3GNTA 4IFBA 1YJBA 4OL0A 3TLYA 1T34A 5EAIA 5LCXA 1SZPA 4TQGA 5JSQA 4MGEA 1AM4D 3SKYA 2ZYDA 3M5CA 4MKRA 5EPOA 1KAOA 1VA4A 1TM7E 2GD1O 5HJEA 3VNQA 4PC3A 1QRAA 2PFKA 3HEMA 721PA 3NRBA 2NU7B 4YROA 3PQ7A 4FMDF 2FU5C 3A1TA 2IFTA 2RMKA 1PJBA 3A1NA 3H5VA 3MJDA 4MGYR 4OMDA 4E15A 2CDBA 4PVDA 2P2DA 3ZHZA 1EA5A 4BQSA 1LPAB 3MWFA 3GGPA 4LX0A 3GJ8A 2D62A 5BSKA 5JNSA 4ND3A 2NO7A 4DM4A 2G70A 2FSVC 4YRPA 3S2GA 1SVLA 3FETA 4MITA 3TQHA 4BMSA 4IDOA 4MV4A 3D9DA 1KY3A 3H0EA 4NAUA 4MJ7A 4TYWA 5FWXB 1UC9A 1E1KA 1S7CA 2IYTA 3DE2X 2WNSA 4I19A 3D6NB 5TPWB 5CYPA 2IZOA 1PJRA 1K6JA 1T1JA 2AG1A 3H11A 3BJIC 5K0TA 3D4NA 4DT1A 4RA9A 1W4BA 5D00A 1WMAA 1IN6A 3PNOA 4BGIA 4Z51A 2W5UA 3JYLA 5EMNA 5LZ4A 1QIJA 2HMWA 4MRVA 4BU0A 3N8IA 4H31A 3LD9A 1US8B 4NC9A 3EVFA 1CUIA 3CRNA 4HGNA 3GLFA 3DZKA 1H23A 4J7XA 2Y27A 1H9AA 4LJ8A 5AI8A 5EN4A 4RJTA 1PDVA 3B2NA 2I3GA 3MLAA 2I76A 3NGMA 4YT5A 5J59A 4E31A 4LOAA 1A7KA 2NADA 5EE5B 1HBJA 4I4TF 3BXEA 3ESZA 4KWHA 3KP1A 1FZQA 2BC9A 4L6IA 3I04M 4U2CA 1B42A 1ZJWA 1USGA 5DM4A 3DYBA 1M7HA 2P9JA 3H4IA 4NMLA 2ZT6A 4LWPA 3DYIA 3P27A 5AW4A 5JYCA 2YIMA 1FQJA 1KSJA 3P9RA 4CEHA 4N3CA 2G08A 4LNAA 4LNHA 4L3XA 1I4LD 3JZMA 4XSHA 4FCCA 3WAKA 4ZGGA 5IYZB 2H08A 5TVKA 3V1TC 3QTBA 1ADCA 3NUQA 4KQGA 5JRDS 3O8QA 5AW0A 1PJTA 4EHJA 1ZLXA 2YVAA 5JD3A 4OQLA 5KYXA 4EELA 1NOKA 3KVOA 4FMCB 2QAGB 3BM5A 1R4MB 13PKA 1KL7A 3PFNA 3F0TA 3VYUB 2GYYA 5FPKA 3DOJA 3TQIA 5LC1A 3IUNA 4C0KA 4H0FA 2IK8A 4X7BA 5T4BA 4EVSA 4QJ5A 3NBZC 4BVFA 3LM8A 1HLGA 1MDBA 1MAAA 3DAHA 4MQEA 4HX9A 2OAP1 2Y0CA 1J0DA 4YCJA 5AW2A 4AFNA 5E6RA 5EIBD 1SCBA 2XT6A 3PNYA 4JODA 4XRRA 5L3SA 1U8VA 2EZTA 3WFJA 3IPLA 2QVLA 4HWPA 2V5UA 1PEKE 3KPVA 4LZZA 4YQEA 4F86A 4AURA 3R5TA 1HE3A 5JR3A 3A31A 3C3KA 3L5KA 2LPMA 3VPBA 3LQFA 5ARDA 1NVFA 3M6LA 4DEYA 2P0YA 4QZVA 4DLVA 4C22A 1QQ7A 3R0JA 2DERA 2XD4A 3PNVA 2A84A 5HZHA 4GVPA 3F5MA 3HA3A 4U6NA 4ZI2A 3CZPA 3V33A 3CN7A 4W5NA 1HSZA 5FAKA 2H07A 2ODAA 2C3OA 4XTCS 1H0RA 2RK3A 4PLTA 4ZWNA 4C0JA 1AKNA 1SAYA 2HLNA 4EUSA 4TLEA 4TYNA 1GKKA 1VSVA 2GN9A 2X8WA 1HF3A 3L1TA 2X9GA 3U7EB 3DMTC 1L1FA 4UTNA 4NMHA 1NXTA 3O4FA 3WK8A 5BR4A 1DJNA 3T3OA 3O8RA 3CLSC 3UK1A 2FFRA 1P2FA 2V65A 1XMSA 4N5DA 5TE9A 1KGDA 3ROTA 4C88A 1FDOA 4JJ4A 3W9UA 2IOFA 4NXNB 1RZRD 2ZI9A 1UEIA 4R71A 2QLJA 4FI3C 3PJGA 4QFBA 5AOVA 4BN5A 2PUBA 4FBLA 4HNQA 2P9EA 2GXUA 4HH3C 1C8BA 3GO4A 4B45A 4N8EA 1OZAA 3L2OB 2JIPA 3OP1A 2VTEA 2OEPA 3ESQA 4TWBA 1C1XB 2WFLA 2Z5GA 2CVPA 1RMYA 1R4AA 2OB2A 3L84A 3BCRA 1Z5ZA 4FWBA 1UDRA 3GH3A 4JHLA 4KKXB 5KS2A 1TJ3A 4P0TA 2FKAA 3CSSA 3KPYA 3RSQA 5A3QA 2J3HA 2W93A 2REQA 4GP6A 1T2DA 1NR5A 3EGWA 5KQRA 2QTVB 1NBAA 2WHYA 4PWYA 3QX3A 4I3GA 4YONB 4MMZB 1NW3A 5EHXA 2PGJA 4RFVA 1TU4A 3Q88A 2QKYA 1G55A 2VHTA 3OQ1A 4QQKA 5CK4A 1SIUA 4ZQCB 4YUAA 3ZU2A 1Z5NA 5DLPA 5J23A 3VVMA 1TYAE 2ZAGA 4EPWA 1XHFA 3VH4A 3W4KA 4RC9A 2F4NA 4AU1A 2DQZA 5LR6A 2R44A 1ZNQO 3MM4A 3M4NA 4G4GA 4J3NA 3QX9A 5A9SB 4H17A 1GQ2A 4MVJF 2X5OA 2X3FA 1N1MA 1G21E 2G5TA 3RH0A 4DABA 1GRRA 5H9VA 2CHVA 5CNKA 1UOEA 3H13A 5GJCA 1XQ1A 3WNQA 5C5EA 2X0IA 4UFNA 1A4UA 3AKYA 1SU8A 3AZPA 3A04A 1GSHA 4ZU3A 1U3VA 3V8RA 2J9GA 4FT2A 2OGUA 1UJMA 1CUBA 5IULC 4WN9B 4A8JB 1J0BA 3DDCA 1G21B 2Z2XA 4QJBA 1K9SA 2CXQA 1K6EA 4BKQA 1TTTA 1MG0A 1T24A 3AL3A 2Z57A 3OPQA 2NU9B 1R0XA 3HCWA 1ZGZA 2FPPA 2UYCA 4G9GA 4GSYA 1CC1S 3BJEA 3MJRA 5CX4A 1VBNA 2UVPB 2VQFB 3TR0A 3B3QA 3WHIA 4YP9A 1Z36A 2WAAA 3MK31 5EHGA 1EK6A 3B6MA 1FDTA 4LHWA 2V7QD 4LRQA 1KE2A 3ZCTA 1XD2A 3RWMB 3WR5A 4AY6A 1THZA 3BXOA 3BK2A 3CLUD 5CFZA 4BC0A 3VDXA 2J3LA 3NORA 3UA3A 2IHKA 2UZIR 4Q3AA 2JLWA 5DNDA 5ALJA 4YIKA 3K1ZA 4D8YA 2ZIEA 1VB3A 1U8AA 4WI1A 3L4EA 5ALXA 2Q8IA 5AOCA 1XVTA 1IATA 2C0PA 2NLOA 2FLKA 3CURA 3JQ9C 4LJYA 2EBWA 1DHRA 1ODCA 4PR0A 4R7ZA 1EM6A 4KXWA 7REQA 2QTBA 5IX8A 2NXNA 5DHUA 3RR2A 1E99A 3NNSA 4PR3A 1RTKA 3C5VA 1XNQB 1E9FA 1UPAA 4RM2A 1OLSA 4X20A 5REQA 2CJXA 4FK8A 3A6GA 2VHWA 1G19A 3W8DA 5F2OA 2A33A 3MUFA 4V3CA 3AUJB 4A6PA 4C7JA 2GARA 1MPXA 4FN4A 4LQCA 5CK5A 2Z3WA 1OREA 2CL7X 4PCLA 3GW8A 1MJNA 3QK7A 3TRKA 5ELXA 3CWQA 2CLDX 2CN1A 1X92A 1JX6A 4WCFA 4DLLA 1Q1QA 4DLWA 4GOJA 3G0CA 2H48A 3LPNA 5LM3A 4GVLA 1TRHA 1T9AA 1LB1B 1WZIA 2VDUE 5ALKA 2V6GA 3S99A 2FPLA 4JLUA 3OE7D 3Q24A 1HDXA 3QWIA 5G0UA 4L16A 3Q3JB 5CCBA 3ZKAA 4IX1A 3GG9A 3JWHA 1AKWA 1T5BA 3JX9A 4G41A 4NENA 3W78A 4BO5A 4EYKA 2CWDA 1KQPA 2WIKA 3KOZA 4I0WB 2I3BA 3AEKA 1RKBA 3LX5A 3N2YA 1SHZA 1RHKA 3H11B 1W47A 4H7FA 3UW1A 4DGSA 5CRIA 4WOCA 3ZDXB 2E48A 1F0PA 1RBQA 4RD0A 4BQIA 2JJ1D 5CNIA 1BX0A 4J1QA 4RHCA 5JDCA 4D99A 1SOMA 1FBNA 3ILXA 2H0AA 3INNA 4KKVA 1ULBA 3GLFB 4UVIA 4NCBA 1Z38A 1IZ8A 3NAZA 5AJYA 3UWMA 3BKXA 2QTHA 5DYIA 1M8GA 5FQNA 2HLPA 3H97A 3K5WA 3Q85A 2I80A 4GKKB 1ZK3A 2PN1A 3D2AA 1J39A 1QH8A 2WMNB 1L1EA 3ONFA 3WGQA 5FX2A 1UBTS 4DB4A 3I04A 4TN5A 4YBZA 2WMOB 4TRMA 1ZVQA 3F4LA 4DMUB 5AI6A 4P13A 4N7JA 4DKXA 5LZ5A 2L17A 4KYTA 4X95A 3WLRA 3MJHA 1EZZA 4XR4A 3QKUA 3LRTA 4Y6PA 3AFEA 4Q3EA 3X1ZA 3LHFA 3SXUB 4BC1A 1CR6A 1EPUA 1OFTA 4D0RA 4OL9A 2IS4A 2CNBA 3ZLTA 1M2KA 1V0JA 3P96A 4GLFA 5FXMA 3VUFA 4NK4A 5HUQA 4QXMA 1QGYA 1TEHA 1VL1A 1OA0A 1E4VA 1YBVA 2RIRA 3K09A 1QHIA 4BB5A 1FDSA 3FGPA 5KYXB 4HI0E 5E3IA 4UVGA 3TX6A 4MVJH 1VG0B 4R8LA 4AMYA 1A8HA 3G2NA 1E3DA 5DBFA 1P33A 3PKZA 3H3JA 4NHOA 2OB1A 4ZQBA 1I51A 4DPLA 5CA1A 1UK6A 5AHXA 3DHNA 3FOBA 3T0IA 3A6PC 3CLVA 4U7GA 2QMHA 1EGMB 4FW9A 4Y1GA 3TG2A 2MYTA 4MQEB 2ZJFA 4S3MA 4A6DA 4CM8A 4W5JA 1EVZA 1XAGA 5I4KA 5E6RB 4V02A 1O8CA 3VR4A 5L3SB 2XYQA 3PEWA 1UZLA 1O6FA 3FNIA 1KVUA 3QFFA 3ESAA 1I9CA 4ER3A 3I23A 3TSYA 4F38A 4JB8A 4RK1A 1JAHA 1PR0A 3QRWA 4H1TA 4XVUA 2PAAA 1AH2A 1YZHA 2WV7A 1Y5LA 4MICA 4PAQA 2XMBA 2XAAA 1MQ8B 1K88A 3D0QA 5CLHA 9LDBA 2Q6OA 2D2VA 4OXIA 3MPUA 4BCDA 1GYRA 2IJGX 1PJ3A 2QDXA 2QN2A 4Q4JA 2A1TR 4B81A 3ZDAA 4ZCRA 2BFCA 3KR0A 2XJ4A 1NY5A 4ID9A 3W5DA 3KTDA 1FRZA 3GJ6A 1ZX1A 2H16A 4I9FA 4Y67A 2I1QA 2D1YA 3O9VA 4FX2A 5GGYA 1A9RA 3RQSA 5EJ5A 2J7PA 3SZUA 2OJQA 4PG5A 3RK4A 5K3EA 2YQ4A 3PSHA 1YRAA 5C8DA 1XHLA 2Z2KA 2CJWA 2XMDA 3DDUA 3GA0A 4MWDA 3F6SA 4LRUA 5JAIA 4PQFA 4WK6A 1PJQA 2HQOA 4UASA 3UJ6A 4LYDA 3E05A 4RMNA 1QGED 5J71A 1TMKA 1UJ4A 2MT9A 4YCAA 2E21A 4MUBA 4Z5XA 3QMPA 1MV5A 3M2TA 1AZTA 1PG5A 1WPXA 4DZYA 3IMFA 3OMWA 2WFLB 3RFCA 3RKUA 4PAOA