The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
86
|
sequence length |
257
|
structure length |
243
|
Chain Sequence |
SLSTRIAPHLPYLRRFARSVTGSQSSGDAYVSAMLEALVADISIFPRASCDRIGTYWLFCHLFDQEQKTSAKLSYLTPRARQAFLLIAVEGFNEQEASEIMNLDARDFRKLLNQASIDISQQIATQVMIIEDEPLIAMDIEQMVESLGHQVVGIARTRKEAVVMYHQKKPRLILADIQLADNSSGIDAVNDILQNDRIPVIFITAFPERLLTGERPEPTFLVTKPFNPDMVKALISQALFFKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Co-Crystal Structure of Anti-anti-sigma factor PhyR complexed with Anti-sigma factor NepR from Bartonella quintana
rcsb |
| molecule keywords |
Sensory transduction regulatory protein, Anti-anti-sigma fac
|
| molecule tags |
Signaling protein/dna binding protein
|
| source organism |
Bartonella quintana
|
| total genus |
86
|
| structure length |
243
|
| sequence length |
257
|
| chains with identical sequence |
C
|
| ec nomenclature | |
| pdb deposition date | 2014-05-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00072 | Response_reg | Response regulator receiver domain |
| A | PF08281 | Sigma70_r4_2 | Sigma-70, region 4 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Butyryl-CoA Dehydrogenase, subunit A; domain 3 | Butyryl-CoA Dehydrogenase, subunit A; domain 3 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
