4QIFA

Crystal structure of pdua with edge mutation k26a and pore mutation s40h
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
b'QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGHGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural protein
total genus 21
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qifA00
4P2SA 3NGKA 3N79A 4P7VA 4RBVA 4QIEA 4PPDA 3IA0A 4P7TA 3BN4A 4OX7A 4OX8A 4AXJA 4QIFA 3NWGA 3MPYA 2A18A 4OX6A 3SSRA 4AXIA 2A1BA 3CGIA 4RBTA 4OLOA 5L38A 3SSQA 2A10A 2EWHA 3H8YA 3MPWA 4DDFA 3PACA 3I6PA 3VCDA 4QIGA 4LIWA 4RBUA 3SSSA 3CIMA 4OLPA 3DNCA 5DJBA 3DN9A 3I96A 4QIVA 2G13A
chains in the Genus database with same CATH superfamily
3OLAA 2VJVA 1FD8A 1S0NA 2CQHA 3VVTA 5CHCB 1UWBA 4MH8A 4F0KA 3H2UB 4K4UA 4XDCA 4H4KA 2J0SD 2FC8A 3AXKA 1S1VB 1DTTB 3DRPB 3GP9A 4C8YA 3GMGA 1S59A 1IKYA 1KONA 5AXNA 1CS4B 4NLPA 4ZN1A 1HNXJ 2ZWOA 3QZ8A 2AD9A 2M52A 3AH6A 3CO0P 3QATA 3CJTA 1FKPB 2V2KA 4ECUA 3AT1B 2KYXA 2M0GB 3HXMA 4EO6A 2MLXA 4QWAA 1LV5A 3VAFA 3RBZA 2GIRA 3TQEA 2O66A 2R3VA 2UVWA 4DN9A 4PXCA 4AL6A 1H72C 3NBPB 1HNIA 4CH1A 4ECYA 3OL8A 4M5KA 4CI0B 3SIPB 3WBZA 2Y9HA 3G2XA 4OI1A 4DV1F 2UVVA 4AQYJ 1IWAA 3NNHA 4A8QA 1BQNB 3W66A 3V5RA 4IFVA 3VAKA 4FNIA 3LANA 1KHVA 4BDPA 1OO0B 4LUBA 3AFGA 3HZGA 4WIQA 2M70A 2OPSA 1RDRA 4NXMJ 2RMLA 2HAIA 4MKAA 2UXDJ 2HS3A 8ATCB 2GAHC 2Z2LA 2C3MA 1S1XB 2Q3PA 3FKBA 3ENAA 4N77A 1OYDA 1HNWF 3H4DA 1X4EA 4CNYA 2RUGA 4PQUA 3EGZA 3F73A 5F41A 2DCUB 4DL6A 2ACMA 3MMAB 5CABA 1VC5A 1RA6A 5I3UB 1L3SA 1XMOJ 1TKZA 2IIHA 3S1TA 2FJVA 2QN6B 4DPYA 4GRSA 1R3NA 1RAIB 5HJXA 3C6UB 3AB4B 1NHKL 5B09A 1LWXA 3H90A 3ZTOA 1IN0A 2ILYA 3KLHA 4B9UA 1TZ0A 2Y1IA 2IAJA 4KHPJ 1HWUA 5FDLB 4ZN3A 1GX5A 2Y3YA 3KHGA 4O3SA 2D9OA 2VFUA 3CO9A 2JRSA 1QE1A 1HBNA 3J7A1 1M5HA 3W2VB 1QDUB 2E7VA 1GEHA 3B4MA 3CDEA 4J9UE 2EFOA 3AJ2A 4MK9A 1Z2LA 2RRBA 5BR8F 1H2TZ 1NCLA 3M8SA 2FDNA 2I5JA 3GIRA 1TFYA 1VS3A 3GG0A 3NWGA 4WP9A 5EX0A 2ZC4A 3NY0A 3C66A 4NWBA 1PILA 3TAPA 2GQ2A 2JX2A 5E7OB 1EETB 1GK8A 4DPTA 1BMQB 3MAHA 2MHNA 5DM6Q 2AYEA 1FNOA 3H8YA 3I0SA 4DR6F 4RW4A 2ZHOA 4J90A 5BYQA 4TU7A 1AUDA 2CDRB 2EEYA 3MPUB 2FVQA 3OPKA 2F5GA 2J9DE 3C16A 2XC9A 4X62F 4CH0S 3P45B 3CT9A 5DQHA 5ETLA 5M2PA 4E8UA 2FVSA 3OVSA 1SJ1A 2M5YA 4K5RA 2YQ0A 2GS8A 3SYZA 4FYXB 1WC4A 2KB2A 2DHXA 4LR9A 3ZC4A 1N8RT 4MT1A 4WYWA 1FEHA 1PYTA 1ZBTA 3K0JA 1YTYA 1O0PA 1PJ7A 3UN2A 5K9FA 1KWMA 2HMIA 2KDOA 2HLUA 2HWIA 4LMZA 3PX4A 1FVQA 4WWSA 3RG6A 1YGYA 3GWCA 2QMUB 1JJ2R 1FRHA 2XS2A 4EFAC 2CPHA 5JJBA 4KGKA 5D6GA 2EFQA 3LA0A 3BR8A 1JLCA 1NK4A 1QTNB 2HNZA 2FY1A 3LF0A 4OJ3A 2XY7A 4CRJA 4J9PA 3LOUA 1NXIA 1S0VA 4I7FB 4B3SJ 2CKWA 2E29A 2JC1A 4ECXA 1AA1B 2W01A 5F8LA 1RAJA 4X64F 2NCKL 4FXVA 4RPFA 2KZZA 1CJVA 4ED2A 2DBBA 4K4ZA 3E2EA 2DJWA 3MZIA 5E3QA 3CE8A 2CQDA 3EICA 1BWVA 1U49A 3I5CA 2AW0A 2E9ZA 1B0VA 4MKYA 2R8KA 5KFFA 4Q45A 2HHWA 3BBBA 4JV1A 1WEXA 5HI7A 2FC9A 3SQGA 2IA6A 2FGCA 4Y3CA 5HMWA 4B3OA 5AE3A 3QLHA 2HBQB 2XWYA 1S1TB 2LVWA 5C24B 4MFBA 5J2QB 2J7WA 2RKIB 5B0EA 1XNQF 4A48A 2E5LJ 3AXMA 2HNDB 1SBRA 1S72S 3BV8A 4UQTA 3KK3A 5T41A 4B02A 1RTJB 4NCAA 2KM8C 5DRKA 1YBUA 2BRKA 1TFWA 2CQGA 2H48B 4DV3J 4URGA 4DV4J 1IKVB 3CF5Q 2VPYB 1SJQA 4RBVA 4DI6A 4ICLB 1ZZFA 3BSAA 4DF4A 3BB5A 2CQ3A 5C25B 4H4MB 5CA5A 1TV6B 3SSQA 1YITS 3BREA 2V8DA 2JLGA 2UUCJ 2JZ5A 2LU1A 1WTBA 2DY9A 1RWPB 5DQIA 5I42B 1UVKA 2OD4A 2CQCA 4LFBJ 2I9SA 1SQGA 4Q0BA 1TKDA 2QA4S 3MM6B 4HACA 1UP1A 2P9CA 1FXLA 5HBMA 4FZVA 2PEHA 3OTDA 1SL2A 4BWJA 4ELVA 1Y3JA 1F1BB 3M6WA 2MKJA 1IBMJ 3SMZA 2OFGX 4L72B 4RW9A 1OPIA 2LQ5A 1QSSA 3H5XA 1SQFA 3E01B 4ZVTB 5IWAF 4A8OA 1WF0A 3IG1B 4C8NA 2DR7A 3KJNB 2DR8A 1RBOB 3D4JA 2FVRA 2NSBA 5K14B 3E8OA 1B99A 3QT8A 3BGRB 1VQNS 4Z7CA 3DI6A 2XHCA 1WKLA 4YB7A 1R27B 2Y0SD 3QIDA 2Y1RI 3M2VB 5DG8A 1NZ8A 2WAQD 4RW8A 2OKQA 2V5HG 2AMCB 1U0HB 4L6V3 2VFRA 3MUMP 2VONA 3R5JB 2AJFE 3ZZOA 3CCSS 3EZUA 4ZVOB 3TP2A 2WHOA 2HRUA 1FJGF 3HLUA 1ZS6A 3FBEA 1KQSR 2WONB 3OTOJ 1AB8A 4K0KF 4DFMA 5LXRA 2OMOA 1I3OB 3Q8SB 2WSEC 1RAOA 3TZYA 2CNLB 2UUTA 4URQU 4PYDA 2DGWA 1VQSA 1Q8IA 3BQ0A 1KFSA 2RS8A 1RWWB 1S1UA 4X2BA 5B0CA 5SUHA 1Q8LA 1X0FA 2YKPA 3FCWA 2LXIA 4ZPAA 2DPIA 1UW9A 3F0NA 4PEOA 1FNMA 2GQCA 5E3RA 2JWNA 4K5SA 3GONA 2CZVC 4U8VA 1CJTB 3GIMA 2GVDB 3CSKA 3N6MA 2OPPB 2VASA 4MK8A 1J5OB 2HHQA 5GMKa 3MMJA 9ATCB 3B4DA 5ETSA 2UZAA 4XIUA 1SH2A 2BM0A 3N5FA 2V8HA 2MEWA 3L09A 5IC4B 4Y2CA 2FY8A 3OW2R 3D6TB 3EJMA 4R0JA 4UOGA 2CWKA 3PACA 1IKXB 5LJ3Y 1HQEB 1FDBA 5HN0A 1F60B 2RH3A 5GADI 2HRYA 1M1GA 4DUZF 2CUYA 4W90B 5KFHA 2ZH6A 3RBEA 2HS0A 2HQDA 3T5LA 1X7VA 3IR7B 2PSZA 3RYLA 5KT3A 1E6YB 4O0IA 1ZA1B 3EVMA 5F8JA 3CTRA 2AQ4A 2ATLA 2BDPA 1JJ4A 3RRGA 1C0TB 3ILJA 2YNGA 3IWLA 2WVCA 3KK1A 3J7AN 2QRRA 1HNZF 3RBXA 4C8MA 3OXFA 1C1BB 1WSRA 4ECZA 3BBCA 2XNRA 3M8YA 2J0QD 4DLGA 3G6YA 4PG8A 1WHXA 2RDIA 1RT7A 2R2SA 1S9EA 3TO8A 2XMMA 1RBLA 2QSFA 3P3DA 1DJ0A 4CNZA 2XNQA 2DPJA 3QGIA 1VQ9S 4IFYA 3EDQB 1NSKL 2LCWA 4QZVB 2B4OA 2MDAA 4PQUB 3IRWP 1WSVA 1TL3B 4JBCA 4L74A 3GV7B 3D0HE 3R6GB 2WRMA 2HWHA 4RNMA 4ED6A 3PV8A 5K8OA 2XY6A 4J9LA 3L4BC 5EN1A 3DM2A 2F65A 4ZCMA 3HFVA 3DKDA 1WKKA 3ZZUA 2P9EA 3OR1A 3PFOA 4E98A 1EJ7L 3I56S 2QL7B 1RABB 3I5AA 4RU9A 2XG8A 3W2WA 2B9XA 1X8DA 4EZ6A 1V9OA 4URSA 2V0NA 3LGNA 1F9FA 5DZ6A 4DUTA 3RRKA 1M1HA 3KUEA 1WDTA 3P96A 1Q79A 4GVBB 1UVIA 5CH7B 1VCTA 4IG3A 4DX8H 3ZXWA 4KBIA 3KLIA 3FMWA 2FUG9 4F67A 2IDEA 1L3KA 2HQFA 4O4GB 4G6VB 3V4IB 3MAAA 2X7IA 1AFJA 3L3CA 4Y2KA 3MR2A 3C2PA 2ADCA 4LF4J 3POTA 4P75A 2R7QA 4DCPB 4GVLA 2AV5A 1YI2S 4WK1A 3M2RA 4GKJJ 2BXJA 1UJ5A 1SC6A 2CPYA 3CJ2A 3QGPA 4ZVSB 2XMAA 1RWMB 3ZTRA 1CQMA 1ZAVA 1HL6A 2MQLA 3H2VE 3A4TA 4LF7J 3AODA 4QR2A 1S76D 1LFPA 3IC1A 3C16B 1RHRB 4LSNB 2YWHA 4RO0A 1PBUA 2FLNA 4ES3A 3ET6B 5I3PA 4OYAA 3HHLA 3TAQA 2E5IA 1IUJA 1WOOA 4B9NA 3JS9A 4CH7A 3OV7A 2V50A 2EI5A 1CBKA 4L73A 2CPFA 3TNVA 4I64A 1SKSA 5IV4A 2ZBPA 2EPIA 2W24A 2ZFHA 3IAM9 4PZVA 1B70B 1SKUB 4KGZB 3WQPA 1IBLJ 4FBUA 3BDEA 2HFZA 1NB7A 1KVJA 1Q78A 1FFSB 2CAJA 2PMHA 1HW8A 3JXOA 3C19A 5B0BA 2F7VA 3D7SB 3JB9k 2PMZD 2XSFA 4C9DA 2FD2A 3HHLD 1QVGR 1RZMA 4UUWA 1EARA 3K5LA 2RVJA 3CMES 1TELA 2Z4PA 3PRVA 3IS9A 2J6SA 3R5GA 4P71A 4P72A 3T1AA 3L95X 3MEDB 3H4BA 2W7OA 5D0EA 2Z2MA 4LF6J 3M8WA 2M8HA 1ZAWA 4ZHRB 4NA2A 4IO9Q 3FZBA 2VA3A 3WIVA 4DL7A 3ZO7A 1N0UA 3MM8A 2DNKA 3M05A 3LP0A 4K4YA 2GO9A 1SI9A 5J2MA 4NE9C 1FHTA 4WBFA 3GG1A 1UZHA 3KK2A 1FFGB 3SQGB 4I6AA 2O3DA 4RLEA 5DDRC 2HHXA 5CZVA 1Q1KA 1T3OA 3C3LA 3CJ4A 1T94A 4P74A 5L1IA 3UI3A 2DH9A 4OZLA 5D77A 3HK2A 3FNNA 5ETOA 2LU2A 1ZPWX 2H3EB 2CA9A 3BGUA 3CD6S 1T05A 1VBYA 2Q66A 2KHCA 4EYIB 3KDOA 3D0IE 3KJVA 3MM7B 2V2VA 3M7VA 2QEXS 2GV1A 2B51A 4RR5A 1UEVA 1A7GE 2E66A 2AKWB 3CJKB 2XS7A 2YH1A 1H98A 4F4ZA 1R8AA 1IM6A 1FKOA 3UFCX 2CNOB 3SXLA 4NLSA 3SSRA 2VC0A 4RUHA 1RT3A 2DGSA 4WFNQ 1B0TA 5A0YA 2E7XA 1P6TA 1TKTB 1WACA 2ZJPQ 2VG5A 5L1LA 4B9LA 3FQKA 3G82B 2NQPA 4NLVA 3A8IA 3BM7A 2N4CA 2K1RA 1M5KC 4Q0BB 3GILA 2LYVA 4HACB 4MTPA 2G0IA 4OZ5A 5HROA 4ANEA 3IBFB 4NXNJ 2HLTA 1HR0F 4PG5A 2G9OA 3KG1A 3BH6B 2GGPA 2C42A 3FSYA 4TYBA 4KR0B 4ED8A 4JI8J 5H9FK 3EM1A 2MZJA 1U1LA 4PXEA 3MM9B 2PIIA 4CLFA 1U48A 1YQHA 4HH1A 1Y7PA 1GMWD 4HEA9 3OD2A 2FJBB 4XDDA 3NMAA 1Q16B 5KG3A 3N9UC 3PEHA 1TQLA 1QSLA 3UNGC 2D3UA 5KFVA 2YNHB 3PR4A 2RF2A 1KQFB 2NUHA 3GYGA 2NPFA 4B08A 2LQ9A 1C2PA 4I56A 2CQBA 2VD3A 2QX0A 4ANCA 1L3UA 1MROA 4CT8A 4Y34A 3RW6A 3OFFA 2R2TA 1A6LA 3EMTA 4B3TF 1WC6A 3WHIA 3LH2S 2OAUA 3BO3A 3RGIA 2DY1A 1VJQA 1F5BA 4KH0B 1DY3A 4NLGA 1WHWA 2CRLA 3LPEA 1LW2B 2G2YA 4RW7B 2CJQA 2D3OR 5KOXA 2XMJA 4A8XA 4X4RA 4ZVHA 4E0DA 5BYRA 3TA2A 2WB1D 4HI2A 2ZD1A 2J7UA 1PIEA 4YUDA 1SL1A 3RTVA 1REGX 4CLTA 3OTEA 5JVHQ 1WEYA 4KGMA 4FS1A 4QIWD 1EKRA 2XYPB 5E2QA 2OGUA 2HSEB 2IVFB 3OL6A 3MWBA 2EG1A 3LW5C 1MU2A 1LWEB 4NLYA 2EBEA 2A6OA 3THTA 1V5VA 2Z56B 3FBCA 1PKUA 1UKUA 4ZK7M 1TK8A 4BHQA 4DV1J 4WXOA 3TJAA 1S97A 3H0PA 4OJ1A 2WTFA 3ZZTA 4EZ9A 2FYXA 2RDJA 1B3TA 5J2PA 2R7OA 3FFIA 5IFMA 3VCDA 5M2UA 4LFAF 5HATA 3GTYX 2ZE2A 4F26A 1FVSA 1U1NA 4ATNA 4Q2LA 4YEAA 1HNVB 4X4OA 1TUGB 3TAMA 3K5NA 4DV2F 2WVFA 4KT0C 3EDRB 4F7VA 2MQQA 1HNWJ 3MOJB 2CJXB 5IQ6A 2R7XA 2BACA 1EZZB 1JB0C 4F4YA 2W1BA 3IRXA 5CYQB 3M4XA 4KSEB 2VQFF 2E1MC 4PPZA 5D0GA 1RKIA 4F25A 4DV0F 1N5QA 3KG4A 1DZ5A 4MIWA 5HO4A 4ZIVA 2BV3A 2HHTA 1DQ9A 2WB4A 2C3YA 1SXLA 1GAOA 2HYIB 5HMZA 2BQUA 4N76A 4LVOP 3DXBA 4N56A 2LKZA 4OZ0A 5DQGA 5AJ3F 3P5BP 3CC2S 4AL7A 1RAEB 3FGVA 1RT7B 1F3VA 2XO6A 2V4JB 2JFKA 4NI2B 2R7UA 2YWWA 2VDIA 4LF1A 4ZVFA 2HVDA 1TL1A 3CJ8A 5AXKA 3DLGB 2WOMB 3ZZ0A 5F8MA 4GO7X 4P10A 2EC2A 2DGXA 5BR8J 3LP2B 4A8WA 1RT2B 2ZZMA 4QWDA 2BKOA 2L48A 4L3KA 4JI3J 4TQRA 2NXEA 1U8WA 3DLLQ 1FERA 2PFDA 2OO4A 1VHIA 3BS9A 4GKKJ 1XMQF 5A8RA 7AT1B 3I5BA 4AT1B 1Q86T 3FBBA 3NEKA 4QU7A 2CFXA 2YKMA 4UW2A 1HD0A 2MJNA 2UXBF 4DR6J 4HT5A 3Q8QB 2F9JA 4O3NA 2DEIA 2JHEA 3W2WB 5KG7A 2YKNB 3LPYA 2AYBA 1FF2A 1OWXA 3Q89A 5A6PA 4NLOA 2VC1A 4ZKAA 2IMOA 4P73A 2MZSA 5L46A 3RB4A 3PYGA 3PO4A 1WHYA 2P6TA 2MGZB 5H1SV 1RT5A 2FHJA 2C2RA 1O51A 3MAAB 1YJWS 3UCUP 3MCMA 3POTB 5DLGA 3I0RB 2J7KA 1RUSA 2BQ3A 4IO1A 2R7TA 3BN4A 2RQKA 4HDHA 4ALZA 4YHHJ 3C6TA 4AYBD 3KLEA 1HBMB 3GZ7A 4N47A 1S6QA 2H4YB 3MD1A 4EO8A 4XPCA 2X1AA 1RSCA 3N79A 3OVBA 2O67A 2LLZA 2H5JB 1TKXA 2XMWA 1SPBP 4DR2F 3JSMA 1ZPVA 3H59A 1FK9B 3IWNC 5KT5A 4O3RA 4X64J 1BQMA 3VWSA 3LP1B 1KEKA 2WK4A 2XSJA 2W9BA 3HHDA 3W7BA 4IRCA 5G0RA 3VAHA 3ISZA 1LK7A 3OTCA 4WFBQ 4HVZA 2D3O1 2X1GA 3NKYA 3LWMA 3UN5A 3HT3A 1OQ3A 3F56A 4LBIA 4CTAA 2W4PA 4DS4A 3D1QA 5LMNF 1VBZA 1YVFA 4ZLJA 2MB0B 3DLBA 5FLXU 1VQ5S 2ZZTA 2B9EA 2VG7A 4J9VA 1PAEX 2DGTA 4LJMA 3GFYA 2CQPA 2CVEA 2IVYA 3MAQA 1JJHA 3DMJB 2P6SA 4QYZK 2AF6A 1R8HA 1XNQJ 3T5KA 4KFBB 2VICA 3DN9A 3R9LA 1CJKB 2NUUG 3QO9A 4F4WA 1U1PA 1RU2A 4M5DA 1RWUA 5FLXY 3M8ZA 1DQAA 1OSDA 2ZOGA 1S0OA 2PEBA 2QA1A 1FD2A 2N7CA 3PO5A 1IR1A 5GADU 3KXDA 2DNRA 3LP0B 1Y9OA 1HI8A 2YKAA 1S6OA 1WORA 4Y2MA 2DITA 1YKWA 1R8CA 3KK2B 4DPXA 2IRYA 5HP1A 1NJZA 1U6BA 2BMBA 5A8WB 4LR7A 2MKCA 1UVLA 1A0OB 2XB2D 5B0FA 1BLUA 4A8MP 1YJUA 1XR6A 3HULA 3HSZA 1H73A 2BOAA 5A76A 2B7BB 4MJKA 3MUVP 3SFGA 3H5YA 4ZPDA 3MR7A 4KIAA 2HPUA 3HVRA 1T9XA 2QJ3A 2ZH9A 5H9EJ 1NPKA 5E41A 2HAFA 3SDEA 3TEHB 1U47A 2HVEA 1Z2ZA 1TP7A 1P9YA 1ZM2A 3E51A 5IWAJ 3MPWA 4MAKA 1U45A 3GJRB 2MKKA 3UVJB 1P8GA 2RHQB 3VALA 4I2QB 1URNA 1PG5B 2JJ4D 2R7RA 4B9SA 1X5SA 2EWHA 4JI4F 3H5UA 5J1EA 4J9NA 3V2UC 4OYPA 1D3WA 5A0YB 4B3MF 4F3QA 5KFDA 2POKA 1R43A 4EU0A 1UFLA 4S0MA 4LF5F 2CZ9A 1EB0A 2XLKA 2PC6A 4RUBA 1ZM9A 4LBPA 2FTRA 1RKJA 3IWXA 4P9SA 3PR5B 1WWHA 1FRMA 1FJGJ 3V6JA 2ACYA 3QJLA 2E44A 3NCRA 4K0KJ 2JNJA 2ZVIA 4USWA 3OXGA 2ZWPA 2AU0A 3D66A 3VGTA 3GCXP 4PG4A 3AJDA 2UXCF 2QL5B 2UU9F 3DC2A 2BVZA 4W4MA 3R7SB 1K8AT 3ENVA 2BABA 2CJAA 1VQOS 2WVDA 3OSNA 5KG5A 3KYLA 3RU0A 3TZXA 4ZVRB 1N6QB 4J7CA 3MPVA 2U2FA 4B3RF 2L3MA 3FBFA 4UQGA 1K73T 1W2BR 3BKFA 2MZTA 2NXCA 2V34A 4OYZA 2DR9A 4LQ3A 3CDAA 1U4BA 3ZTQA 2WW4A 5L39A 3DNCA 5ETMA 4ED7A 1MROB 2UP1A 3U1NA 3CCZA 2W7PA 1UVJA 1S99A 2BUNA 1D09B 3OXLA 4CLWA 3KWMA 5IM0A 3RRHA 4YB6A 3VAIA 3M1VA 2QL9B 1R7IA 1R31A 1UCNA 3FEZA 1JLQA 3KHLA 3V81A 3DLJA 2JEIA 1U2CA 1VHFA 3BBFA 4DUZJ 3PXGa 3LGHA 3EZ5A 3S01A 1SUQA 4UF4A 2CG4A 4CLYA 2KRRA 1TK0A 1S0MA 5E0OA 3JSBA 2DNQA 2OPRA 3CDUA 1EQ0A 5F8HA 3J81U 3I31A 3TYTA 3CIMA 3HFKA 4EI2A 5LSOA 3EPIA 2Y1JA 1HNZJ 3BDPA 1UEUA 3PHEA 4TKTA 4F02A 3BSCA 5HMXA 2G2ZA 4OJHA 2YKOA 4JI2F 4DSKA 2H5IB 1G6BA 3DYAA 4NLUA 2BA9A 4ER8A 2H4WB 2MTLA 1WELA 1RTZA 2AIRB 4KB7A 2ZE2B 2R8JA 2AX1A 3AA9A 2RQ4A 1JXVA 3L9ZA 4M94A 3ILLA 3CD7A 2XULA 1RWKB 2MLZA 4KE5A 4LREA 1DURA 2HGLA 4LF9F 4NCGA 4Q8FA 2H51B 1HKAA 5L1KA 1SJFA 1ZOTA 3W9JA 3CW2C 2KT3A 2KRBA 2BJDA 2ZUAA 1VOMA 3NAIA 4ID5B 4XPEA 1X4HA 3ZNJ1 3UWTA 4C0HA 1Y0HA 2HS4A 4K4SA 1XK8A 2ZNYA 4QU6A 4A8SA 5KG2A 4ILRA 3JQMA 4WF9Q 3BR9A 2CPXA 2HK2A 1NKCA 3ZFVA 1LW0B 4OLOA 4LRDA 2BM1A 2GW8A 3MOZA 3BN7A 4ID8A 1YBAA 3EZOA 2BX6A 1HYSA 4PAAA 1EIYB 1R0AA 1CC8A 3V6DA 5C42A 3RR8A 1DLOB 4XTTA 3TUPA 1X9SA 2DHAA 2KH9A 1FXDA 1TAQA 2J9DA 3NG8A 3EX7B 4DZ6A 5HLFB 2ZM6F 3D9BA 2MKSA 7FD1A 2QGFB 3KLGA 3PW4A 4ANDA 1NDPA 3FRZA 3S8SA 1JLAA 4RUAA 2BANA 1ZTTA 2LXFA 2VB6A 4G65A 1KN6A 1FRXA 5E33A 2W25A 5B08A 2XZTB 1MN7A 2QIFA 1F3FA 2HQIA 4WFYA 4CYUA 4WK3A 2XCPA 5T7LB 3IMQJ 1VQ4S 3BZQA 4DN0A 2OELA 3QRQA 3T1HF 7FDRA 3M8QB 4V19J 2Q79A 3M2UB 2WSFC 4DSLA 2IMWP 4OHYA 3T5JA 4F0HA 2B6AA 1RT6B 4WU3A 3VAJA 4RW6B 4DWIA 1N5SA 5ADZA 3DGPA 3SCJE 3D1OA 2OPQB 4H4OA 3W61A 3RBDA 4CM2A 4RWXA 2C2KB 4Y28C 4TXSA 3C15A 5IV3A 4XAKA 4ZP7A 2FZKB 1WKJA 3GE9A 2F8EX 1GX6A 3QIPA 1N88A 1FEEA 2JL9A 1EP4A 5D3GA 2KXNB 1LK5A 4U8YA 3MECB 2MYFA 3GR1A 3KLEB 2AGQA 4OHVA 2OHDA 4WZQA 1D9AA 1BGXT 3W3SA 4PWDB 2YNFA 5ETVA 1HMVA 5A8KB 1WG1A 4WU2A 3GQCA 3W64A 2FJAB 4BC9A 3ZTPA 1TVRA 1U2RA 3KNAA 2CDQA 4YDDB 1RTHA 1S6PB 4PXBA 2BE2A 3M9NB 3IGVA 2PO4A 2OSQA 1REVB 1FKAF 3QYYA 3DLEA 1FJCA 5D4PA 1S12A 2HHVA 2VG7B 1UZDA 3AOAA 4LSLA 1RLCL 1VBXA 4KH1B 2W2NP 4PRFA 1CSJA 1N52B 1BY9A 3US5A 1HWLA 4DXLA 1R89A 4L3NA 4LSZB 4EGLA 1SJ3P 4BCAA 1I6JA 5J2NB 5IXUA 4DG1A 4C11A 5AT1B 1RTIB 5B7WA 1R6VA 1B4SA 4LFCF 6FD1A 3MD3A 4DPWA 4M5JA 4LRFA 3PVXA 1N5YA 2NXNA 2OEMA 1CEZA 1RT1B 2NSCA 4DV5F 4ECSA 2KL8A 4DFJA 1AFIA 1VRTA 4WFXA 3QSYB 3DCAA 4QWBA 2FHMA 3SCIE 1RGVA 3DXSX 3L7UA 5FJ4A 1G2EA 1M5VC 2GO8A 3DLKB 3CIZA 3TANA 2BE9B 3C14A 2WVBA 3GB0A 1H2VZ 4E2FB 1N34F 5LJ5Y 1VRUA 2H65B 3X3UA 1KQGB 3DRSA 1JLEB 2M88A 3PW0A 3BGFA 5E3AA 3NOCA 1NSQA 3GV8B 2QFIA 1SC1B 2EKYA 1FRJA 1HR0J 3SBMA 3MMBB 3FMBA 2DGOA 2IHR1 4P2SA 4OYMA 3R5CA 4IH5A 1IR2A 4O23A 4DZDA 2Z58B 3M9MB 2BRLA 1TL4A 3QSIA 4CP5A 4DQQA 5KTQA 4O3PA 3MEGA 3QGGA 1KOHA 2RB7A 2KXFA 2Q43A 3VQSA 2X1FA 4FYWB 2C2NA 3KLFA 4J9OA 2DT9A 1CJUA 4L75A 1FXRA 1SL0A 1UETA 4V1Ak 2QG9B 5KT6A 4M1KA 3CJSA 4CO5A 3KMSA 3Q23A 5D8HB 5JXSA 3MEEA 3R5DA 4M5MA 1QAIA 4B3TJ 4IDKB 5IQQA 1UPPA 3PEJA 2IJRA 1X31C 1JWWA 3QT5A 1YJ7A 2R7SA 3GLJA 1I51B 3QPIA 1AROP 1JMTA 3HVAA 3FCVA 5D15A 4I67A 3OR2A 2B5JB 2CPDA 4ETXA 1YZ7A 1YJRA 4C2MA 2VUGA 4MKBA 4PKDB 2XMUA 2BYCA 2K7KA 5FD1A 1KLNA 3M32A 3I9ZA 3K57A 1Q7LB 1HPZB 3LWLA 1D8YA 4RBUA 3O8WA 4NLRA 1Y00A 2KJWA 2IC3A 2W9CA 2BW2A 3CCRS 3HI9A 3GFXA 4BLGA 4NYOA 3N5BA 2RE1A 1JKHB 3TUIC 1WG5A 4DX7A 1NKEA 1RT4B 2LQBA 1LKZA 1S1WB 1RK8A 5LSLA 4ZPWR 3FSIA 1WI6A 4OX6A 2WVEA 1AUSL 1SB6A 1NO8A 3Q8PB 3MI7X 1XJWB 4R5PB 5AXMA 3BGOP 2HKEA 1XNRF 5F8NA 4UT4A 4LFAJ 2CQ1A 1X9MA 1NEEA 1HBUA 4C0OC 1RCXB 1Y11A 1RLDA 1VC0A 4DV2J 1U1KA 1NH8A 1NB2A 3UD5A 4RNHA 1FJEB 4PXDA 5GVQA 2Z0GA 1CPZA 3ETOA 3A3NB 4CLUA 3UR0A 4IRKA 4JB8B 1SC3B 2VQFJ 1OJ4A 2C3OA 4GC7A 1EKSA 2GVZA 3G6XA 4DV0J 2KVQE 2FPHX 4J9SA 4B9TA 3PW7A 1AZSA 5E3PA 3WIUA 4X4QA 3VTIA 2V67A 1CULA 2OSRA 2LEPA 1ZYQA 4P2XA 1WF2A 1HARA 3CJ0A 3NMRA 4KV8A 1QSYA 2W7AA 2UUCF 4TY8A 2KT5A 2BBEA 3LUYA 2VZ9A 3I96A 5AJ3J 5KFYA 2HGMA 1ELOA 2XZWA 1YRUA 2IJNA 3P49B 1Q95G 2KYZA 4YN3B 3G87A 2IVMA 2DK2A 2CWXA 1EX8A 3VAMA 3P4UB 3AD8C 3BO4A 4M5HA 3CMAS 2DNZA 1K0TA 2ZBRA 2B8PA 2D9PA 2M9KA 3R3TA 3TOQA 3I82A 4HT7A 4O0NA 1RTDB 2OIHA 1UL3A 4HYKA 3K5MA 1PJ6A 4CLSA 3R1LA 2JSXA 2DR6A 4KO0B 2QO3A 1XMQJ 4QIGA 3MTJA 5I4MA 4DQIA 3OLBA 4A8FA 2UUWA 2VODA 4J9QA 2FHOB 2K8GA 2UXBJ 2GC8A 4R25A 3FDSA 3TA1A 4FYVB 4NEYA 2ASLA 2IM2A 1TK5A 1SH0A 1LWFA 1F9EB 3HPOA 2E1CA 3SV4A 2QTWA 2WBRA 1V6HA 1D0EA 3G9CA 3CULA 5GAEI 3W5XA 4KHMA 1ZTWA 5HMYA 1NK5A 3DDNA 4ITSA 2F4VF 1HYSB 5CAAA 2KFNA 1S5ZA 4TLQA 5ETPA 1S1VA 1DTTA 4WZMA 2VPXB 1S9GB 2ZKTA 2A2CA 3DRRB 3DRPA 2AEMA 2A10A 4WXWA 1IM4A 3GFZA 1CS4A 3IBWA 3TJ9A 3M6XA 2CG8A 4K8RA 3CD5A 1FKPA 5LMUF 2GFFA 3THVA 1FDAA 4DPUA 3BYPA 3I6PA 3MCNA 2VQEF 1HBOB 4Q5VA 4YMEA 2FGOA 4P2MA 4C8OA 3CJ5A 4LR8A 3NBPA 1FRIA 3RJMB 2Z57B 3R7BB 3VV2B 2V8VA 3MR6A 2HBYB 4ELTA 2LA4A 2VU5A 2FB0A 4DR3F 1VQLS 1BQNA 2B6AB 4DR2J 2BJEA 3AA8A 1WHVA 2P8IA 2HIQA 4FF3A 4USKA 5DLFA 1OYEA 3KHRA 2IM0A 1DBDA 2YPYA 1S1XA 4KRWA 2KN4A 4OHWA 2BJ8A 1KDNA 2I8EA 5KT7A 3TVYA 2A6MA 3PHTA 3MMAA 4JI1F 2AEJA 4J9KA 2QE5A 2LP4A 2QV6A 5I3UA 3ISNC 4OZ2A 1KNZA 2DEJA 3M9OB 2E5GA 4P6QA 2J0WA 1T03A 2L9WA 1SKRA 4EWTA 2MSTA 3OFHA 5D4LA 1O8BA 1KLMB 1K0VA 3C6UA 4PR6A 2XI3A 4F36A 1G1XA 4ELUA 3HF5A 4DR5F 4FVCA 2UUBF 3GJQB 8RUCA 2XGQA 1U1MA 1UWAA 3B54A 3AOCA 3H5SA 2KKHA 1LOUA 1GMUA 5FDLA 1TL7B 3M8PB 3B82A 3DRYA 1WG4A 1ZZNA 2LMIA 3JYTB 1HMVB 2RAQA 1XEZA 2XM3A 3UD4P 3W2VA 3CC4S 3BPDA 4ZP9A 3OUYB 4ECTA 4IG0B 3Q8RB 3ITHB 2V4RA 3Q22A 1PBAA 3DGVA 4QWEA 4JOUA 3PYFA 4ES1A 2DNLA 5KFLA 3HVTB 1VIXA 3H25A 3CMQA 1SV5B 3OHAA 5KFAA 2IBOA 3DRXA 2AEFA 3TW0A 1FWPA 4RJVA 2YNIA 4USJC 2GJFA 4DMZA 4Q44A 1GTHA 4LSLB 2VKRA 5C2CA 4QOTA 1Y3KA 2DIUA 4X4SA 1WD6A 1NUEA 3CCQS 4CO2A 2A18A 1EETA 4O44B 1RBAA 2DGQA 3TR5A 1P27B 4LIRA 1NDCA 3JTNA 2V9WA 3R6LB 6FDRA 5CZXA 2JLEA 3DOKB 2GA7A 1UA0A 4ZVGA 5LXYA 5DGAA 1FT8A 1WEZA 2AHOB 4C11B 1T7PA 3VGVA 2CXEA 2XCAA 2DH7A 4YY3F 2XS5A 3G8QA 4WP8A 4ZOSA 4M8LA 5IOLA 4KHRA 2YKQA 1Y5NB 3BKTA 2HHHF 4OIXA 5M2RA 3TZZA 2B43A 2YQ1A 3PFEA 3HKWA 1NSAA 3L7OA 1JLGB 4LIWA 4EUVA 1YJ9S 1ROFA 2LECA 4JI4J 1F5CA 4O4RA 2QT7A 2DRDA 4KYZA 4X4UA 4CLZA 4B3MJ 2VFTA 2NYIA 5D4NA 4PUOB 1N32F 3QRRA 3AAWB 2XYHB 3W9IA 5DO2A 2BR0A 3HP6A 4UZBA 2ATCB 2MQPA 3CCJS 4HHJA 2H54B 1W7WA 4DJBA 5CYMB 4DV7F 2DO4A 1IR0A 1X4CA 1FI4A 3DOMA 4FF4A 3A13A 4USVA 3GPAA 2UU9J 3JTOA 3PX0A 1JNZB 2OEKA 3PRDA 3MEGB 4ECRA 3CWJA 1Q5YA 4I7FA 2Z2YB 4QR0A 3GFHA 4ED0A 4M63A 1RYRA 2BQRA 2DD8S 4QBUA 1PAUB 4B3RJ 3CCVS 1IVZA 1YJVA 1KOOA 2C3UA 4TNOA 1UWBB 2V4QA 3CDBA 4DU8A 1P1LA 2Y8YA 2V2QA 4Y65A 4OMFG 4I1TA 1BUXA 3C8YA 4ZLPA 2DKOB 1VDHA 4ZPBA 1IKYB 1X60A 1SVDA 2VBZA 4JI6F 2ZBQA 4PABA 2I0XA 3FCHA 2HHUA 3PW2A 2F3JA 3R1HA 2K3KA 3K8VA 4WKRA 1S1TA 2KU7A 5C24A 1DTQA 5J2QA 1NJYA 1X4AA 3U7JA 2RKIA 2D3ZA 5DG9A 4UZCA 2XMVA 4FS2A 1NKBA 2HNDA 1HNIB 1H2UX 2DGVA 3AD7C 1KRPA 4UOHA 1Z1ZA 4ZPVR 3N0VA 2W9AA 4HHHA 3O6QA 2D74B 4IFVB 5AE1A 2MHEA 3OL7A 3V6HA 2JOQA 2WBMA 2GJIA 1IKVA 4IRDA 2LXUA 2VV5A 4C7QA 5MLCV 4ICLA 4HR2A 1T9TA 2OPSB 4RWWA 3A3PB 5C25A 4H4MA 3DU5A 5RUBA 5EGYA 4OYIA 3J7YU 3TX0A 4DR4F 3TEGA 1C4AA 5C2GA 5THWA 4JI2J 2OTLS 1QVFR 3RR7A 3PG9A 2AYMA 2P9GA 4HTIA 1B7FA 5I42A 4OL8A 5HSPA 4DFPA 1GMVA 1C1CA 1TKZB 3MM6A 4WE1A 1S7HA 2ROGA 4USIA 1HBUB 4JI5F 5HQMA 3SFUA 1J5EJ 2DXDA 4DHVA 2RS2A 5ETQA 3N4WA 3KLHB 3H40A 2RDDA 3MXHP 1X5TA 2IAJB 3UDEA 4LF9J 2NYHA 4FXWA 1UVMA 3PDNA 3E01A 4UOFA 1VK8A 5K20B 4ZIWA 2ROPA 3W5ZA 3IG1A 1QE1B 1HBNB 3KG0A 3LQVA 5K14A 5LOQA 3ZZZA 2Z30B 3BSOA 5IT9U 3EXYA 3TX8A 1YBTA 3BGRA 4LF8F 4ED5A 1XIQA 1VBKA 1NHUA 1Y5LB 1R0BG 4JYAF 1RJJA 4KV8B 4C8LA 5KG4A 1KD1T 3PKMA 3M2VA 2LQJA 2PN6A 2LEBA 2ZH1A 4CO1A 2I5JB 2AJ1A 1U0HA 3GU0A 4OHZA 5EHHA 2B7CB 2HHPA 2L9NA 1OY6A 2VPWB 3FQLA 1DFDA 5IT9Y 4IR1A 2VPZB 2WONA 2LA6A 3SEOA 3O44A 2EK6A 4ZCLA 2K06A 4IOCQ 3I0SB 5KG6A 1NK7A 1RHJB 5KFBA 4YR3A 1LXJA 3WDOA 1JQGA 2RU3A 4Y2AA 3QFWA 1M5SA 4RW4B 3QRPA 1S4EA 5SZTA 4Q7AA 2E5JA 4K2XA 2ZM6J 1S7IA 2YX1A 3DDKA 1RADB 2F40A 2BJ3A 3K5PA 2MSSA 4PWUA 2GMHA 1UMJA 2IPOB 2XY5A 3I87A 5E5NA 4W98A 1CJTA 2GVDA 3MDFA 2OPPA 3BQ1A 3MCSA 4I69A 4ZCIA 1PO6A 1VQ8S 3WX4A 3D6MB 3NWRA 1KKHA 4U9RA 2CPJA 1WJ9A 3V4MA 3CVKA 1VI7A 4C3MA 1HQUA 2QMXA 4X4PA 2O1PA 2UV8G 3EUNA 3UR3C 4K7QA 1MMDA 2XGPA 1JXEA 2HMIB 3IGNA 1IKXA 1HQEA 4R0EA 1KC8T 1WDDA 3R5BA 1RYSA 3QWPA 3B8HA 2H1YA 2CVIA 5JUMA 3NGDA 4I68A 5CXTA 4OX9F 4CO3A 2E7WA 4IOAQ 5HK4A 1VLOA 3QJPA 3NS5A 2KXHA 1N54B 1JLCB 1AYEA 2HNZB 1IXKA 1E6YA 1CLFA 2ZUGA 5DZ7A 2RJZA 1C0TA 2DXFA 1ITPA 4NMXA 1KFDA 1S48A 1CJVB 2K7JA 4OI2A 5LM7E 1OIAA 4NLTA 1IWGA 3A8KA 4F0MA 2MLYA 4JV2A 1ICEB 1IKWA 1C1BA 4QQBA 2VL1A 4DR1F 2GIFA 3Q0AA 2VOPA 2DIVA 3PCOB 1UVNA 4JP8A 2ZHBA 3KMQA 3M30A 1OQ6A 3I9V9 4DR7F 2CPEA 4B3OB 1DHMA 2BOPA 3QLHB 1M0SA 4NZ0A 3A12A 4WJBA 1HHTP 2DNGA 3CD0A 1WNEA 3B6BA 4MFBB 4KGVB 4DSEA 4I4BA 4P7TA 1HD1A 3RAMA 5KFGA 4OJGA 1U02A 3HDSA 5BXIA 1TL3A 2VF3A 4PG6A 1I94J 1MWQA 5DJBA 1A9NB 3KK3B 4DPOA 3Q2SC 4IYQA 1M90T 4MMOA 4NYZA 4PYAA 1T03B 3W60A 2ZOMA 1RWVB 4ZP6A 1QAJA 3W5YA 1TAUA 1WC0A 2FJDB 1VK3A 3K58A 2HHSA 1RI7A 4IQMA 2DNMA 1K1QA 2GCFA 4C3KA 4FPIA 1U25A 4DU7A 2PE8A 2YY3A 3OSPA 1VQMS 3JQJA 1WF1A 2HURA 1MMNA 3MM5A 3PNIA 4IH6A 4LFCJ 3PKYA 2CJYB 4ETZA 3MCOA 1GMWA 3V6KA 4AXIA 2V8GA 1BWEA 4DV5J 1J27A 3D1HA 4GVBA 5LT5A 4EYHB 4QIVA 1IJFB 5HBMB 2ERRA 2GAGC 2IFXA 1KHWA 3T1YF 2R7WA 4O4GA 3V4IA 3MMCA 2YNIB 4JI3F 4V19X 3NXZA 2XHWA 4PWWA 1TL5A 4LRCA 4ZPTR 1ZA2B 3EPGA 4W92B 3HVWA 4RW9B 3TUJC 4NCBA 1N34J 1Q7YT 4GKKF 4X65F 2R42A 3FSXA 2R2UA 5CCLA 2IY5B 2IBKA 1R6YA 4RBTA 1RISA 1RB0A 1BC6A 1GT8A 4FPRA 3DI6B 2MQMA 1H38A 1VR6A 3OQ2A 4X4NA 1GFWB 2CJKA 4KPCA 2DGUA 4LSNA 4RW8B 5HJYA 3ET6A 2VA2A 2MQ8A 1D8ZA 2XBPA 5AE2A 2D1CA 2ZDOA 4YQWA 3Q24A 2ROEA 4NZ7A 3HHNB 3E3XA 5GMEA 1TUWA 1PC5A 4KJIA 4G1QA 2PDAA 3H42A 3ENQA 3QWUA 3U1MA 3UCGA 2HGNA 1S1UB 3DFEA 1YWXA 4C6AA 4IH7A 4YHHF 4J91A 2FZGB 1JK9B 1VJWA 1VMBA 1GH8A 2W2MP 3D0GE 3W9HA 3RAXA 1U6ZA 5E3CA 2DRAA 1U1RA 2MKYA 2LDYA 4CT9A 1K9MT 1IQTA 3DOMB 1S10A 1QUPA 3AD9C 3MEDA 2PFFB 2EVZA 4TN2A 1U7LA 1U1OA 4KQZA 3FRYA 1F2HA 4QYZJ 1LNQA 4NPOA 2EG2A 3K8WA 3MFIA 3ULHA 4ZHRA 5GAEU 2MZRA 2AJQA 2BW7A 4G1PA 1HWJA 2J9CA 1HHSA 3HJFA 4CDIA 1YZ6A 1KTQA 1P9QC 1XWLA 3D2WA 2FLOA 2AGPA 1M5OC 2APOA 2HRTA 3N01A 4FNHA 3VF0B 2ILZA 1KP6A 4TLRA 4U6PA 4NYPA 1NPRA 1VQKS 4M5GA 4N8NA 1OSCA 5JVGQ 4U67Q 1SQEA 2C22A 2A3JA 3T19A 1XNRJ 1DTQB 2YNGB 5HAOA 2X3GA 1NJIT 4OZNA 5DDQC 3KK1B 3B78A 2ZHAA 3GSDA 3SSSA 2DNOA 1T95A 2LDIA 3HD1A 4LVNP 4QYRA 1PYOB 1UJ4A 2B4UA 3I32A 2VFVA 3A1YG 1Q8KA 1OY8A 3MM7A 1OMSA 2OI2A 2VH7A 4AL5A 3CJKA 4ZVQB 1S9EB 4UY8T 3I4HX 2HVHA 4TU8A 4AE5A 4D3GA 2RU9A 1N33F 4LT6A 4DV6F 4IFYB 4FN5A 4MIAA 4NX9A 2MQNA 4PG7A 1TKTA 2A0FB 4USMA 4QPXA 4M5NA 3CCWA 5KT4A 3G82A 3IR6B 2UUAF 1C1CB 3NLCA 3NS6A 2MQOA 4WE1B 2J8SA 5KFNA 3OBIA 2JC0A 2H5EA 3DM2B 3ETMA 2FHKA 4LQ9A 3MURP 3O2IA 5HANA 2EFGA 4K4XA 3OR1B 3MM9A 2HFUA 1VISA 3ISND 2KG1A 3EE3A 4Z7YA 3D28A 2R7VA 3UD3P 4M5LA 1JLBA 2C3PA 3KJQB 2R8IA 4X62J 4MK7A 2FZCB 1Q53A 3K17A 2YNHA 1H3DA 2OTJS 4GO5X 4IG3B 1PCAA 4ZMMA 1L3VA 2HVIA 2UV8A 3KLIB 2FLLA 2LFVA 3NNAA 1EQMA 1Q5VA 2CADA 3F44A 4U7UK 5L38A 2XEXA 5KFCA 2R8HA 3NL0A 3JSYA 4WFAQ 1FWLA 2MKIA 5GAHI 2B9WA 4FYYB 2GIQA 4MYTA 4EEYA 2DR5A 2HFNA 3M2RB 2QYCA 2F4VJ 4UTGA 4WKYA 2YWEA 1LW2A 2P2CB 3CGIA 4DL0C 4RW7A 3LAMA 1SJ4P 4JV0A 2XMKA 2ZNZA 5CD4A 2O5DA 3G8TA 2I2YA 1KTVA 2YPZA 4Q2MA 2DISA 2NS1B 5LMUJ 4NA1A 3G71S 1T3NA 3QFHA 1BQXA 2MZ1A 3RB6A 3HHLB 4WYLA 1XMBA 4JI7F 5F0UA 5C5JA 5HQLA 2C2OB 3W65A 1T9WA 2VQEJ 4C8KA 3CCTA 4AXJA 3BO2A 2UVUA 5GAGI 2JEGA 3KDNA 4C48A 4JV5F 1UA1A 1LWEA 2NPIA 4WTOB 5KFKA 2G1HA 4PCQA 1W2IA 1MWZA 2OD6A 3GYNA 5KFWA 1Q4RA 2QFJA 5ETTA 4K4VA 2EK1A 4DQPA 3KUGA 2C2DA 4YR2A 4ZVUB 1HQUB 3KOAA 2QA4G 2HIYA 4DR3J 4WFZA 3R97A 2N7YA 3SZ2A 1U09A 1X4BA 3THPA 2J76E 3OHBA 5HVGA 2KO1A 3OFEA 2ZBIA 2JEJA 1SC4B 1HHQA 3QAUA 2RIJA 3A8JA 1FO1A 3D3CJ 1FCAA 5GMDA 4CIOA 1HNVA 1RAGB 3IS9B 2ASYA 1Q0NA 1I1GA 3IR5B 4GC6A 3VZHA 2BJ7A 1NK8A 2DH8A 3G6ES 2DHGA 1MMLA 1XBWA 1R8BA 1TMMA 2I38A 4JI1J 1ZM4A 5CYQA 3TA0A 3PJXA 4ZS6A 3Q8UA 3QMQA 2BKNA 1WOPA 4UOCA 1IJEB 5IT0A 2W8KA 3WC0A 4J9MA 2YXLA 1VQ6S 3UO0A 4B9MA 4R8UA 3MM8B 1RE1B 3ICLA 2YWFA 5HL7Q 3UDVA 1K1SA 5D78A 2VHGA 5L1JA 2KT2A 4DR5J 2UUBJ 2YTCA 1IKWB 1M1KT 5J2MB 5G4DA 3GCWP 4ZJOA 3S6EA 3P6YC 3M30B 5L8RC 1VRQC 1LEOA 2AX0A 3KJFB 4OX7A 3MPYA 3DOLA 2V4JA 3AQPA 4ZDNA 4NI2A 3VHQA 3G96A 1FE4A 1X0PA 2HG4A 2PMWA 3DLGA 2WOMA 3MF5A 4NA3A 3CCMS 4B17A 2L9DA 1QAYA 3LP2A 2LQ8A 1RT2A 3FEXB 4QPTA 1S6UA 1BD6A 3HSGA 4DDFA 2G4BA 1JJCB 4X4VA 5EWEA 1FESA 3S7RA 4KAIA 1PSDA 4C98A 1F2GA 4L76A 5U47A 3IP0A 2JVOA 1T05B 5A6WA 5ETNA 1HWKA 3NGSA 4LBHA 3KJVB 1NH7A 2F8MA 3GJSB 2NZCA 2DNPA 3BH7B 2HBZB 2ZKUA 4N8OA 4G1IA 5KT2A 2EFVA 3PRBA 2XZDB 1GTEA 4U7CA 1FKOB 3HCXA 4NLDA 1IBKF 1FFWB 3RW7A 3TUZC 1RT3B 2EXUA 3VVUA 1NHVA 4YY3J 3NAHA 3MM5B 2YKNA 2ADBA 3PTWA 2VG5B 4A4JA 4O3OA 3SV3A 2HHHJ 2CNNB 2K1RB 1N4LA 4I2PA 4F50A 2Y8WA 2B4VA 5B0GA 5HROB 3D6FB 2IJFA 5BJRA 2MGZA 3T5HA 5KFMA 5KFIA 3MMCB 4NMLA 1F5AA 1SH3A 1MWYA 2GGPB 3QT7A 2CPIA 2BKPA 3I0RA 3CJQA 3QQCD 1N32J 1NJWA 2MY7A 1SCJB 1X5OA 2VG6A 5KFEA 5KG1A 2YX7A 1YRXA 2NXJA 4KKOA 1HBMA 1NDLA 3SQOP 2MY8A 2RF2B 1S9FA 5KFTA 4DV7J 3W63A 2XMTA 3HJVA 3VGSA 3MTKA 4F4AA 9RUBA 4ZJQA 3UNYA 1KVKA 3TJ8A 4DUYF 2VKZG 1X9WA 2RT3A 3IXQA 1RQ0A 1EHWA 2E1PA 2NREA 4QW9A 4K2JA 3H20A 2G13A 5L9XA 2RNEA 1FK9A 1CC7A 2MJUA 1RWNB 1SIZA 3CDWA 2PT0A 1S49A 3LP1A 3HO1A 1G7CB 3DHXA 3R5AA 4C0BA 4F3MA 3T6BA 3ZZPA 2EKNA 4ED3A 1CQNA 4YS2A 4KGXB 3NGUA 1N56A 4G1QB 4JI0F 4OYBA 1S57A 5CYJA 2ZZNA 4C4WA 5KFRA 1QUVA 4IQXA 3NP5A 1UJ6A 4Q8EA 4JI6J 1H0HB 2ZD1B 5F8GA 3LO3A 1FNXH 1VQPS 1J2VA 1D1UA 1I5OB 4AUKA 2NXUA 5FIIA 4WTYA 1GQEA 4Z2XA 3FJ2A 3DMJA 2B3TB 4M95A 1MNEA 4B9VA 2HEKA 2N3OA 3JTPA 4KFBA 1KQKA 3NGRA 2DB1A 1CJKA 2F4FA 1MU2B 3VGUA 1FDDA 2C2EA 4FF2A 2L41A 1TMJA 1Y10A 3CCES 2X3DA 2E9TA 2OJ3A 3O1LA 4DCOB 2J6UA 5DS7A 2HWTA 3EYZA 1TU0B 5I3QA 4RUCA 4Q43A 5J2PB 3CNQP 5ETKA 3FFIB 3PZPA 3PJ9A 1Y4ZB 2RSQA 5F3TA 1YJTA 3TAMB 4M5IA 2C28A 4DR4J 1N0VC 2ALYB 4LRBA 4QWCA 3QJJA 1IBCB 3QAEA 4DL2A 3KLVA 3D68A 3IRXB 3GR0A 4FP9A 4FXDA 5A8WA 4UUXA 3MPDA 4QIEA 3EWGA 2ZJQQ 4NZ6A 1MN9A 4JI5J 2YBVA 4EBDA 3BF4A 2OFHX 1N36F 2BEFA 2CQ4A 2RHSB 5IT4A 1F9HA 3G8SA 3HHKA 1DRZA 3JSRA 1YK9A 4NL5A 3KTQA 1UAWA 4USHA 1NK0A 4HHUA 3ZZYA 1X5PA 3NGTA 4X84A 2IRXA 4TQSA 4K59A 3UVJA 2DVIA 1VC6A 5K8PA 1NK6A 1E6VA 4I2QA 4LF8J 4FVMA 1TL1B 4EBEA 1T11A 2HZCA 4JYAJ 2Y0BB 1YSJA 3NRBA 1RHQB 4J9RA 2J8AA 1NJXA 1JLFA 2AWZA 3P5TL 3Q8YA 2ZEJA 4MIBA 4X66F 4ED4A 4EK2A 2V94A 2KM8B 3H7HB 4Y00A 3FUYA 2FJWA 2FJXA 3GSIA 4ES2A 3GYXB 1U6FA 3W1YC 5A8RB 3HSJA 1ULRA 3MEKA 2G0CA 2J5AA 1V3RA 4AD6A 2OH2A 5EWGA 2O01C 4HKQA 2YKMB 1C0UA 4DX5A 2Y1LB 3NGKA 3VZIA 2DNNA 2IDLA 2J0XA 2AYGA 1CG2A 3GIJA 4ZVEA 2GX8A 2MKHA 1N6QA 3BPSP 1JLBB 1NAQA 2W2OP 4FKXA 2BZ2A 3I55S 4ILMA 4PQAA 1QM9A 3NS7B 2CQ2A 3IN5A 4F3OA 4DSIA 1LQ9A 1AXQA 1H6KX 5L9NA 2ZVSA 3D3BJ 1OY9A 1T9UA 1NK9A 2N82B 2HQ3A 2QC3A 1RT5B 4HL9A 4UY85 1NNDA 3IM9A 1X4FA 3J7YI 4DS5A 4N41A 2FIUA 1QTMA 2F9DA 1HNXF 4WPAA 1YLXA 1FTRA 1RACB 1QY7A 4NRUA 3K2YA 4OI6A 2ZH4A 2QMWA 1RP5A 3D6HB 1FJ7A 2AGOA 4OV6A 5CCMA 3AJ1A 1F0XA 3C6TB 3LAKA 2E1RA 4F8RA 1S6QB 2YVSA 3HSDA 4OX9J 1Z4UA 2KFZA 1G4CA 1OPZA 4RNNA 2VBWA 2W4CA 1TKXB 4AQYF 1HI0P 1W26A 3RUBL 3PIOQ 2COLA 2IYGA 4USUA 5C7PA 5BYSA 3SCKE 3JSMB 2AJ0A 1D9FA 5F0WA 4DBQA 3UE2A 2LEAA 1BQMB 2XSJB 2W9BB 3IFEA 3RZAA 4NXMF 5G0RB 4I6WA 1RA7A 3PX6A 2UXDF 1V3SA 4DQRA 3AB2B 4F2SA 2WCXA 3DLHA 3QT6A 2ZBCA 3IM8A 3AHPA 4RU2A 2FVCA 2V2ZA 1B0PA 4BWMA 5F9LA 4DR1J 1PGZA 4FF1A 4CTAB 4ECVA 4HI1A 2QLJB 2AT1B 2XYGB 2M3DA 2KFYA 2PD1A 1HIYA 1XMOF 4DR7J 3HFZB 4ZITA 2IYIA 3Q86A 2FVPA 3C46A 5KOWA 2E5HA 4A47A 4ED1A 4ZJLA 3A8EA 5KFJA 3W62A 3DU6A 2CPZA 1AW0A 2R4FA 2AP6A 2D7SA 2PA8D 3TQ1A 4BC7A 4DL4A 4CCHA 4KHPF 4N7TA 2QLBB 1S79A 4QJVA 2XLIA 3BQ2A 3QO9B 1RAHB 4OX8A 4OQJA 4M5DB 4Z37A 3PYDA 2XWXA 2ZH8A 3FVYA 5CQGA 2RQMA 2VJUA 4ID5A 3SCLE 1URRA 4RL1A 4R8UB 1SKWA 2B4PA 1TR0A 1UW4A 5KFUA 5F8IA 5DETA 3D54A 4WP3A 1MSWD 3BSNA 2XQCA 1WOSA 1S77D 2R8GA 4LRAA 4U95A 2M2BA 3ELHA 2B0GA 3CB4A 3N28A 1U1QA 3EVWA 3DOLB 5HP1B 1LW0A 2U1AA 2HZAA 5MAOA 2UVRA 3W8PA 4OV1A 2EC0A 2ASJA 3T1YJ 1DLOA 3QGHA 4H4KC 3HD2A 1WUUA 3U27A 5HLFA 2ZJRQ 4YB1P 3SDEB 1VQYA 2M4MA 4Y2IA 1LWCA 2VBYA 2DNHA 1U26A 1DARA 1BE4A 4X65J 2KJVA 3TVKA 2M8DB 2YWKA 3BJYA 1LFWA 3D67A 4U7UD 4J5OA 4OLPA 3T6JA 1PJ5A 3GIKA 5B0AA 1GNKA 1TUVA 2HFOA 5T7LA 2DTJA 2D41A 3O5TB 3M8QA 1WC1A 5J1EB 4ECWA 4U96A 3QZ7A 3T9NA 3CC7S 1FA0A 3M2UA 3I4PA 4Y6IA 2W4DA 2I1RA 1V3ZA 1FDNA 1MW7A 3PW5A 2RRNA 2B9YA 1RT6A 2K3IA 4RW6A 1NSPA 2DXEA 2ZITA 4OYWA 2AZ3A 3GIIA 4OZJA 4I2PB 4CO0A 2MZQA 2ZC3A 2JH3A 2OPQA 2BJ9A 5K8MA 4HDGA 3KKFA 3LTOA 3FC9A 2JFDA 3J7ZT 1K44A 1NZAA 2HFVA 2I6WA 2V9KA 1NDKA 2YX4A 3N6NA 2MMYA 1RHMB 3MHYA 1QLNA 2ALZA 2OP5A 4RZRA 1RHUB 2HFSA 2YQ3A 4MYUA 4B3SF 2VG6B 4MKVA 1Q8BA 1L3TA 4FKYA 4QR1A 2C2MB 3MECA 3PJWA 3HM9A 4KKOB 1YRTA 4O3QA 2Z8QA 1R0CB 2FHJD 1WTFA 2V68A 3Q83A 4OI0A 1PC4A 1EAYC 2GZOA 2DHSA 3QNWB 4OYXA 4C97A 3EGWB 4PWDA 4JUZA 1YHQS 5A8KA 3VR1A 5GAHU 5T14A 5LSRA 3J81j 2PA3A 4ILLA 4NLXA 2MPUA 3M6VA 1NMEB 5IM0B 1S6PA 2V63A 3M1VB 5A2QU 4YFUA 1JLQB 1REVA 5KFZA 3V81B 2E5LF 1T9VA 1QJHA 2HNYA 3K5OA 1ACMB 2E9RX 2GHVC 1SUQB 4DSFA 4P2FA 4RNOA 2QYGA 1DQ8A 2GHPA 5LL6d 5F3ZA 1RAFB 4ZPCA 1CVJA 3P8BB 3HT0A 1RWXB 3CCUS 1X4GA 2OPRB 1NRKA 3VQTA 4DV3F 3ADAC 4DV4F 1N5TA 1APSA 3U02A 1U0SA 2OEJA 4OFZA 3OTBA 5GAGU 3Q2TC 1FE0A 5A2QY 3UW1A 3UQSA 2J6TA 2RILA 3JQKA 3OT9A 5EX3A 1B64A 1O5JA 5D4OA 5J2NA 3EGNA 2A1BA 2YH0A 5EWFA 1GXLA 1RTIA 2W2PP 2OMLA 3UCZP 3WC2A 4DQSA 3DYAB 5KFSA 3CCLS 1PYSB 2FJEB 1RT1A 3EVOA 4LFBF 1LXNA 1F6TA 3EGVA 2KZMA 4YDXA 2CNKB 4DL5A 3SI8A 2B56A 2HK3A 3LALA 1N33J 4DV6J 3PIPQ 5HVHA 3DLKA 3IO1A 2J9EA 4TY9A 5ITHA 2XLJA 1XTZA 1FRLA 1IBMF 4NCGB 4C3LA 4OZ1A 2G1DA 3CPWR 4TVAB 1Q82T 2UUAJ 1RU1A 1JLEA 5J1PA 4A46A 4CQ1A 1YJNS 3T9ZA 3WX8A 1C4CA 3MMBA 5IC6B 1K47A 3G86A 4DOZA 2OUGA 1KSPA 2WW8A 4ZLNA 3NCQA 3WZ0A 3TVZA 3EXCX 4YB5A 3L7PA 4AFFA 2NLWA 4XK8C 2F63A 3UN3A 1YDLA 3F41A 4GMKA 3OVAA 2XO7A 2X51A 3MR3A 1T0TV 4QIFA 3J80U 1U8SA 5K5MA 1E6VB 4CM0A 3RB0A 3UPFA 3OTOF 1MG7A 3FK4A 2D69A 5F9NA 1VQ7S 1GXTA 1XC9A 1JLFB 2V69A 2HVZA 4A8KA 2V8PA 1R0AB 1U2FA 3V6DB 1UTAA 5C42B 3R8YA 1S4FA 4ZLLA 4RKUC 3OL9A 1V5IB 2IM3A 1T8EA 5CD4H 2HZVA 3KLGB 3HX9A 4K4TA 2ZH3A 4P52A 4DLEA 4IDKA 2HW3A 4FDFA 4NOHA 1JLAB 4LF2A 4CWBA 3J80Y 2IRUA 2BANB 5DG7A 3CXCR 2DRBA 2V6AA 2DHHA 4YR0A 1C0UB 5KFPA 4QW8A 2B5JA 1U24A 3H2LA 4CYUB 1WC5A 2ZH2A 3R7NB 4DL3A 4CZCA 4RNFA 2JDJA 2JLFA 4YP3A 1HPZA 1BHNA 2KI2A 2F8HA 3R27A 2NR0A 4KTQA 4JI7J 4YOEA 2ZOFA 2GMJA 5IS2A 1VFJA 1VYAA 3DGPB 4J37A 3UDLA 4H4OB 1HA1A 1JKHA 4JV5J 1HQ2A 2GQQA 4WCEQ 3C15B 1RT4A 1MLAA 3KUHA 4IOBA 4PPDA 2AJ2A 1S1WA 2KHDA 4KY3A 4WIIA 4HLBA 4R5PA 2ZDPA 4CLKA 5LMNJ 3QIPB 1RAAB 1HLWA 4DEZA 3T41A 1EP4B 2ABYA 1KVIA 5D3GB 1GXUA 1HW9A 3M6UA 1BXNA 5KG0A 1L5UA 2N3LA 3TARA 2VFSA 4F4KA 1UFKA 2AJ4A 2CJBA 4FBTA 2EFPA 1DAXA 1IQZA 3CJRA 4C8ZA 4OZ3A 2GNKA 4F2RA 2QSWA 2YNFB 2DYAA 5KFQA 2NZ4A 2XI2A 2XTJP 1TVRB 2X1BA 1N48A 2HBRB 3TZWA 4ZVPB 3ILOA 2G0JA 5DDOC 4HH0A 1RTHB 3BEGB 2BE2B 4F4XA 4DSJA 3BYRA 1W25A 3K7RA 2QLWA 1WC3A 1XR7A 1M5PC 5DDPC 5AXLA 3G6VA 3HHEA 1TTHB 3GV5B 2PGCA 3DLEB 2C2ZB 3H98A 3J81Y 1JX4A 2C1EB 3ILIA 1FTCA 2EW9A 1J5EF 4G3IA 2KVIA 4EMDA 2A2DA 3OJUA 3MFHA 1AT1B 3IBCB 4NLQA 4ECQA 4NLWA 4A8YA 1KR4A 1T02A 2IA0A 4H54A 2VBXA 1NM2A 2PI4A 2Z2ZA 2H9ZA 1RTDA 1R8PA 1H7WA 4DG1B 4BBYA 4IUFA 4DFKA 3DHWC 4KO0A 1VGYA 1O6XA 1N5YB 1YX2A 4DF8A 3CUNA 3G4SS 1VRTB 2CQ0A 1UPMB 3K59A 2F1FA 4ZCKA 1IBKJ 3U1LA 5EUHA 1XR5A 3A3OB 2HQCA 3BGLA 3MUTP 3HMJG 2IM1A 2Q6BA 4P7VA 3C14B 1N5VA 4LF4F 3ZNUA 3VAGA 4KC5A 1D9DA 1VRUB 3ONQA 4LF5J 3DRSB 4CLPA 1B7YB 2DNYA 4GKJF 3D5MA 3BKUA 2PI5A 5HQ8A 3O3LA 2GJ2A 5H9EK 1T9YA 4ERDA 2QZ8A 3KFWX 1YG0A 1HI1A 2Q1LA 1S9GA 2N4DA 2BE7D 3DRRA 3LGMA 3OJSA 4LF7F 4BS2A 2RRAA 2ZH5A 4K50A 1LWCB 5J1NA 2UXCJ 4DX6A 4TU9A 1FX2A 2WZ1A 3Q8VA 2AZ1A 1SJRA 2DO0A 3NCPA 4OI3A 1JNRB 3RAQA 4N5SA 4OI4A 1YIJS 1HBOA 2JVRA 1G3OA 4ENOA 3HZEA 1RWOB 1QAXA 3CJ3A 3KLFB 3MR5A 2VIHA 3R2CJ 5KAKA 3T3FA 2RUSA 2CZ4A 4Y0FA 3FEYB 3AY0A 1XN9A 2W8LA 4FYDA 2FQQB 1CJUB 1IBLF 1NU4A 1WI8A 3NNCA 4DUYJ 2GHWA 4TYAA 2VDHA 4CO4A 3TWZA 2WSCC 8AT1B 1FX4A 4IR9A 3MEEB 4RX6A 4D3HA 3PY8A 1FWKA 3N6LA 2VOOA 5B0DA 3MGJA 2YWGA 1VLYA 3ZZRA 3K89A 1KS2A 1RXOB 4I0WA 2GMLA 5JMNA 4JI0J 1HWIA 3RB3A 3OR2B 5KFOA 1RHKB 2CIMA 1KBRA 4LF6F 4K4WA 1RTJA 3X1LB 3M32B 2OLWA 2P5VA 1ZAXA 3QBCA 1KLMA 1RCOB 3HKZD 1ZETA 1Y5IB 2IC3B 4NRTA 2W9CB 1H7XA 2MXYA 4DCJB 1TL7A 3M8PA 1TV6A 5DM7Q 3AOBA 1UEKA 3JYTA 1NPPA 1UFWA 4F04B 2G2OA 1VIOA 1QD1A 3KNGA 1JIHA 3OUYA 2SXLA 2EBGA 4IG0A 2CQIA 3FZ2A 3ITHA 4USTA 3ENWA 2QLXA 1X4DA 3HVTA 2CJ9A 4ZP8A 1SV5A 1HFEL 4X4TA 1I94F 2HNYB 6AT1B 5ETRA 4HTJA 3M8RA 4KPYA 3KHHA 2ZH7A 3J7Z5 3W8GA 3TRGA 1P1TA 2R2RA 1JXLA 5D0HA 5H9FJ 3JAMU 2E1AA 2GVZB 4O44A 2RD5C 4OHXA 5DGBA 4OYOA 4QCLA 1AZSB 2EFNA 3TI0A 4CLLA 1CULB 3DOKA 2BJ1A 1N36J 2ASDA 1OS5A 5K8NA 4TY8B 5EDWA 3AQOA 2KTQA 5D0RA 3PYEA 2CYYA 2R9LA 2JEFA 1Q81T 1H74A 3OFGA 3JAMY 1FRKA 2FLPA 2RQCA 2L08A 2QA2A 3HHLC 1JLGA 4NXNF 1ZM3A 4XO0A 2Q6CA 3UDCA 1XERA 2B8QA 4JI8F 2W2QP 3IAS9 3ZTSA 4PUOA 4X66J 4NASA 1NLKL 4NEZA 1NBEB 5IZHA 3GJTB 2K2PA 3DDIA 3NOGA 4EBCA 3PM9A 2DCLA 5KFXA 5CYMA 1XQIA 4I6YA 5HVFA 2HQGA 2KG0A 1J5OA 3IA0A 3CEDA 2M7SA 3R2DJ 4ZA1A 1ZH5A 4IKAA 1SIWB 1LWFB 3T1HJ 2QLFB
chains in the Genus database with same CATH topology
4ZP9A 1FNXH 3OLAA 1VQPS 1J2VA 1FERA 3OUYB 4ECTA 1FD8A 2OO4A 4IG0B 1D1UA 3BS9A 3Q8RB 1S0NA 2CQHA 1XMQF 5A8RA 4AUKA 3ITHB 2V4RA 3Q22A 3I5BA 1Q86T 2NXUA 5CHCB 5FIIA 4QWEA 4WTYA 1GQEA 4JOUA 4Z2XA 1UWBA 4ES1A 3FJ2A 3DMJA 4MH8A 2DNLA 2B3TB 5KFLA 3HVTB 4M95A 1MNEA 1VIXA 4B9VA 3H2UB 3H25A 4K4UA 2N3OA 4QU7A 4XDCA 2CFXA 4H4KA 1SV5B 2FC8A 2YKMA 4UW2A 3OHAA 2J0SD 1HD0A 2MJNA 5KFAA 3JTPA 4KFBA 2IBOA 1S1VB 3DRXA 1KQKA 2UXBF 2DB1A 1DTTB 1MU2B 4HT5A 3Q8QB 2F9JA 4O3NA 1FDDA 3DRPB 3TW0A 2C2EA 4C8YA 3GMGA 2JHEA 2YNIA 4USJC 3W2WB 4FF2A 5KG7A 1IKYA 1KONA 2L41A 4DMZA 4Q44A 1GTHA 5AXNA 3CCES 2YKNB 3LPYA 4LSLB 4NLPA 2E9TA 2AYBA 2OJ3A 2VKRA 3O1LA 2J6UA 5DS7A 3QZ8A 2AD9A 2HWTA 2M52A 3AH6A 1FF2A 1FKPB 2V2KA 4QOTA 3EYZA 4ECUA 1Y3KA 5I3QA 2DIUA 4RUCA 4X4SA 4Q43A 2KYXA 1OWXA 1WD6A 3CCQS 2M0GB 4CO2A 3HXMA 4EO6A 2A18A 1EETA 4O44B 5J2PB 5A6PA 4QWAA 2DGQA 4NLOA 2VC1A 3FFIB 3TR5A 3PZPA 1LV5A 1P27B 4LIRA 4ZKAA 2IMOA 3VAFA 2GIRA 2O66A 3JTNA 2V9WA 2UVWA 2MZSA 1Y4ZB 4DN9A 2RSQA 6FDRA 3RB4A 5F3TA 3PO4A 4PXCA 4AL6A 1WHYA 5CZXA 1YJTA 3TAMB 2P6TA 2JLEA 2MGZB 3NBPB 3DOKB 2GA7A 1UA0A 4ZVGA 5H1SV 1RT5A 2FHJA 2C2RA 5LXYA 1O51A 1HNIA 5DGAA 2C28A 1FT8A 1N0VC 1WEZA 4C11B 1YJWS 1T7PA 4CH1A 4ECYA 3OL8A 4CI0B 3WBZA 2XCAA 3UCUP 3POTB 2DH7A 4OI1A 4YY3F 5DLGA 4QWCA 3I0RB 2XS5A 3QJJA 3QAEA 3G8QA 4DL2A 3KLVA 4DV1F 4ZOSA 4M8LA 2UVVA 4KHRA 3IRXB 3NNHA 2J7KA 1BQNB 3GR0A 4FP9A 4A8QA 4FXDA 5A8WA 2YKQA 3V5RA 4IFVA 1Y5NB 3VAKA 4FNIA 2BQ3A 4IO1A 2HHHF 4OIXA 4UUXA 3LANA 4QIEA 5M2RA 1KHVA 2B43A 4BDPA 2R7TA 1OO0B 4LUBA 3BN4A 2RQKA 2ZJQQ 3HZGA 4HDHA 4NZ6A 2M70A 3HKWA 3PFEA 2OPSA 4ALZA 1RDRA 3L7OA 2RMLA 2HAIA 1JLGB 4MKAA 3C6TA 2HS3A 4AYBD 3KLEA 1HBMB 4LIWA 2Z2LA 3GZ7A 2C3MA 4N47A 1S6QA 1S1XB 2Q3PA 4EUVA 4EBDA 1ROFA 1YJ9S 3BF4A 2LECA 1F5CA 4O4RA 2OFHX 3MD1A 4EO8A 4XPCA 2QT7A 2X1AA 1N36F 3N79A 3OVBA 4N77A 2O67A 2CQ4A 4X4UA 1HNWF 3H4DA 1X4EA 4CNYA 2RUGA 4PQUA 5IT4A 2VFTA 3F73A 3EGZA 2LLZA 2NYIA 5D4NA 3G8SA 5F41A 3HHKA 2DCUB 1DRZA 4PUOB 1N32F 4DL6A 1TKXA 3JSRA 3MMAB 2XMWA 1VC5A 1RA6A 3AAWB 4DR2F 4NL5A 5I3UB 1L3SA 3KTQA 3JSMA 1TKZA 1ZPVA 3H59A 1FK9B 5F8GA 5KT5A 3IWNC 1UAWA 4USHA 1NK0A 4O3RA 3ZZYA 1BQMA 1X5PA 5DO2A 3VWSA 2BR0A 3LP1B 1KEKA 2WK4A 4X84A 2XSJA 3S1TA 2FJVA 2W9BA 3HP6A 3HHDA 2IRXA 4TQSA 4K59A 3W7BA 2DVIA 1VC6A 4IRCA 5G0RA 5K8PA 2MQPA 1NK6A 1R3NA 3CCJS 3VAHA 1E6VA 4I2QA 4HHJA 4FVMA 3ISZA 4DJBA 1TL1B 4EBEA 3C6UB 1LK7A 2HZCA 3AB4B 3OTCA 5B09A 5CYMB 4WFBQ 4HVZA 4DV7F 1YSJA 2X1GA 3NKYA 3NRBA 1IN0A 3LWMA 2DO4A 2ILYA 1IR0A 3KLHA 2J8AA 4J9RA 4B9UA 1TZ0A 1X4CA 2Y1IA 1NJXA 3DOMA 1JLFA 2IAJA 2AWZA 3HT3A 1OQ3A 1HWUA 5FDLB 4FF4A 3F56A 3P5TL 1GX5A 4CTAA 4MIBA 2W4PA 3JTOA 4DS4A 3KHGA 3PX0A 4O3SA 3D1QA 4X66F 5LMNF 1JNZB 1VBZA 2KM8B 2D9OA 1YVFA 2V94A 2VFUA 3CO9A 3PRDA 2MB0B 3DLBA 3MEGB 4ECRA 4Y00A 1VQ5S 2JRSA 1QE1A 1HBNA 3CWJA 4I7FA 4QR0A 3GFHA 3J7A1 4ED0A 4M63A 1RYRA 1M5HA 3W2VB 2VG7A 2FJWA 2BQRA 2DD8S 2DGTA 4LJMA 4QBUA 4ES2A 3GFYA 2FJXA 2CQPA 3B4MA 2CVEA 1U6FA 3GYXB 3CDEA 5A8RB 3CCVS 2EFOA 3AJ2A 2IVYA 1YJVA 1KOOA 2C3UA 3MAQA 1ULRA 4TNOA 3MEKA 1JJHA 1UWBB 2V4QA 3CDBA 2G0CA 3DMJB 4MK9A 2J5AA 1V3RA 2P6SA 1P1LA 1Z2LA 2AF6A 2OH2A 2RRBA 5EWGA 2O01C 5BR8F 1R8HA 4HKQA 2YKMB 1C0UA 3T5KA 1H2TZ 4KFBB 3DN9A 4Y65A 4OMFG 3NGKA 3M8SA 2NUUG 3VZIA 2DNNA 2FDNA 4I1TA 2I5JA 2J0XA 3C8YA 4ZLPA 3QO9A 1TFYA 1VS3A 3GG0A 3NWGA 4F4WA 2AYGA 1U1PA 1CG2A 3GIJA 4ZPBA 1IKYB 5EX0A 4M5DA 4ZVEA 2GX8A 2MKHA 2VBZA 4JI6F 2ZC4A 1N6QA 1RWUA 1JLBB 5FLXY 1DQAA 1NAQA 3C66A 1OSDA 2I0XA 2BZ2A 3FCHA 4NWBA 3I55S 2HHUA 2ZOGA 4ILMA 1S0OA 4PQAA 3PW2A 2QA1A 2F3JA 3R1HA 1FD2A 1PILA 2K3KA 3TAPA 1QM9A 2CQ2A 3K8VA 3IN5A 4DSIA 2GQ2A 2JX2A 4F3OA 4WKRA 1S1TA 5E7OB 2KU7A 5C24A 2N7CA 1LQ9A 3PO5A 1DTQA 1EETB 5GADU 5J2QA 2DNRA 3LP0B 1Y9OA 1NJYA 1AXQA 1X4AA 2MHNA 2RKIA 1H6KX 3MAHA 3U7JA 5L9NA 2D3ZA 5DM6Q 2ZVSA 5DG9A 2AYEA 1FNOA 3H8YA 3I0SA 1HI8A 2XMVA 2YKAA 4DR6F 1NK9A 1S6OA 2N82B 4FS2A 2HQ3A 4Y2MA 4RW4A 1NKBA 1RT5B 2HNDA 2ZHOA 4TU7A 2DITA 5BYQA 4HL9A 1AUDA 1HNIB 4UY85 1H2UX 1NNDA 1R8CA 3KK2B 2FVQA 2IRYA 3OPKA 1X4FA 3J7YI 2DGVA 4DS5A 2J9DE 4N41A 2FIUA 1KRPA 2XC9A 1QTMA 1Z1ZA 4ZPVR 3N0VA 2F9DA 4X62F 5HP1A 1NJZA 1HNXF 1U6BA 4CH0S 2W9AA 1FTRA 3O6QA 1QY7A 4NRUA 3CT9A 2D74B 5DQHA 5A8WB 4IFVB 5AE1A 2MHEA 2MKCA 1UVLA 3K2YA 2XB2D 3OL7A 4OI6A 3V6HA 2JOQA 5B0FA 1BLUA 2WBMA 2GJIA 5M2PA 2ZH4A 1IKVA 4E8UA 4A8MP 2FVSA 4IRDA 1YJUA 2QMWA 1XR6A 2LXUA 2VV5A 4C7QA 1RP5A 1SJ1A 5MLCV 3OVSA 2AGOA 1FJ7A 4ICLA 2M5YA 4K5RA 2OPSB 4RWWA 3AJ1A 5CCMA 3SYZA 2B7BB 4H4MA 1F0XA 4MJKA 5C25A 3MUVP 3C6TB 3SFGA 3H5YA 3DU5A 4ZPDA 2KB2A 3LAKA 2E1RA 2DHXA 4F8RA 1S6QB 2YVSA 5EGYA 3J7YU 4KIAA 2HPUA 1Z4UA 3HVRA 4DR4F 2ZH9A 5H9EJ 1C4AA 3ZC4A 2KFZA 1N8RT 5E41A 5THWA 1OPZA 4RNNA 3SDEA 2VBWA 1FEHA 4WYWA 2OTLS 1QVFR 3RR7A 1U47A 1ZBTA 3K0JA 1Z2ZA 1TP7A 1YTYA 1ZM2A 2AYMA 1O0PA 2W4CA 1TKXB 4AQYF 2P9GA 1HI0P 4HTIA 3PIOQ 2COLA 2IYGA 3E51A 5K9FA 5I42A 4OL8A 1B7FA 5BYSA 3MPWA 4DFPA 3SCKE 2HMIA 3JSMB 2AJ0A 1C1CA 1D9FA 5F0WA 4MAKA 1TKZB 4DBQA 1U45A 2KDOA 3UE2A 2LEAA 2HLUA 2HWIA 3MM6A 4LMZA 1BQMB 3PX4A 1FVQA 4WE1A 2XSJB 2W9BB 3IFEA 1S7HA 3RZAA 2MKKA 2ROGA 1P8GA 4USIA 1YGYA 4NXMF 3VALA 1HBUB 5G0RB 3GWCA 1JJ2R 4JI5F 4I6WA 1RA7A 3PX6A 3SFUA 2UXDF 4I2QB 1V3SA 1URNA 2JJ4D 1FRHA 4DHVA 2R7RA 4B9SA 1X5SA 2RS2A 4DQRA 2XS2A 3AB2B 4EFAC 2CPHA 2EWHA 4F2SA 2WCXA 5JJBA 4JI4F 4KGKA 3DLHA 5D6GA 3H5UA 2EFQA 3N4WA 5J1EA 3KLHB 3H40A 4J9NA 2ZBCA 3V2UC 3MXHP 3AHPA 4RU2A 1X5TA 3BR8A 2IAJB 1D3WA 1JLCA 2FVCA 5A0YB 1B0PA 4BWMA 5F9LA 4F3QA 1NK4A 1PGZA 4B3MF 4FF1A 5KFDA 2HNZA 4FXWA 2FY1A 1UVMA 4CTAB 3LF0A 4OJ3A 3PDNA 4ECVA 2XY7A 4HI1A 3E01A 2POKA 1VK8A 2M3DA 1R43A 4EU0A 4J9PA 1UFLA 2ROPA 2KFYA 4LF5F 3IG1A 3LOUA 2PD1A 1QE1B 1HBNB 1XMOF 4I7FB 1S0VA 2CKWA 2E29A 2JC1A 3KG0A 3LQVA 4ECXA 2PC6A 2XLKA 5F8LA 1RAJA 5K14A 4X64F 2IYIA 4FXVA 2FVPA 2KZZA 1ZM9A 3ZZZA 2FTRA 3BSOA 1RKJA 3IWXA 4ED2A 3EXYA 3PR5B 2DBBA 4K4ZA 3TX8A 3C46A 3E2EA 5KOWA 2E5HA 4A47A 1WWHA 2DJWA 4ED1A 1FRMA 3BGRA 4LF8F 4ED5A 3MZIA 5E3QA 3CE8A 2CQDA 3A8EA 1NHUA 3V6JA 1Y5LB 2ACYA 5KFJA 3QJLA 2E44A 3DU6A 3NCRA 2CPZA 1AW0A 4JYAF 1U49A 1RJJA 3I5CA 2R4FA 2AP6A 2AW0A 4KV8B 2D7SA 4C8LA 5KG4A 1KD1T 3OXGA 2PA8D 2AU0A 3PKMA 2E9ZA 3M2VA 3TQ1A 4BC7A 2LQJA 4DL4A 4CCHA 2PN6A 4PG4A 1B0VA 4MKYA 4KHPF 2LEBA 2UXCF 2ZH1A 2R8KA 1S79A 2UU9F 4QJVA 2XLIA 3DC2A 5KFFA 4CO1A 4Q45A 2HHWA 2I5JB 2AJ1A 3QO9B 2BVZA 3BQ2A 1K8AT 4JV1A 3ENVA 1WEXA 2BABA 4OX8A 4OQJA 2CJAA 5HI7A 1VQOS 2FC9A 3SQGA 3OSNA 4M5DB 5KG5A 3KYLA 4OHZA 2IA6A 3RU0A 2FGCA 4Z37A 2XWXA 5EHHA 1N6QB 4Y3CA 5HMWA 2ZH8A 2B7CB 3FVYA 2HHPA 4B3OA 3MPVA 2U2FA 5CQGA 2RQMA 5AE3A 2L9NA 3QLHA 4ID5A 3SCLE 2VPWB 1URRA 4B3RF 2L3MA 3FQLA 1DFDA 2XWYA 5IT9Y 4IR1A 4R8UB 2VPZB 1S1TB 2LVWA 4UQGA 1K73T 1SKWA 1W2BR 5C24B 2B4PA 2WONA 2LA6A 4MFBA 3SEOA 1TR0A 5J2QB 3O44A 1UW4A 2MZTA 2EK6A 4ZCLA 5KFUA 5F8IA 2J7WA 2RKIB 5DETA 5B0EA 3D54A 4IOCQ 3I0SB 1XNQF 5KG6A 1NK7A 5KFBA 4YR3A 1MSWD 1LXJA 3BSNA 3WDOA 2DR9A 4LQ3A 3CDAA 4A48A 1U4BA 1S77D 2RU3A 4Y2AA 2R8GA 1M5SA 5L39A 4RW4B 2HNDB 3DNCA 1SBRA 4ED7A 2M2BA 1S72S 1MROB 2B0GA 5SZTA 4Q7AA 2UP1A 2E5JA 4UQTA 3KK3A 3CB4A 4K2XA 3U1NA 5T41A 4B02A 2YX1A 1RTJB 3CCZA 3N28A 2W7PA 1U1QA 1UVJA 3DDKA 3DOLB 4NCAA 2KM8C 5DRKA 2F40A 5HP1B 1S99A 2BUNA 2BRKA 3OXLA 1TFWA 2CQGA 3KWMA 1LW0A 5IM0A 3K5PA 2MSSA 4PWUA 2GMHA 3RRHA 4YB6A 1UMJA 4URGA 1IKVB 2XY5A 3I87A 5E5NA 3VAIA 3CF5Q 2U1AA 2VPYB 3M1VA 1SJQA 5MAOA 1R7IA 3MDFA 4ICLB 4RBVA 1ZZFA 2OPPA 1R31A 3BQ1A 2UVRA 3BSAA 4DF4A 3BB5A 3FEZA 1JLQA 2CQ3A 5C25B 4H4MB 3KHLA 4OV1A 3V81A 2EC0A 3DLJA 3MCSA 5CA5A 2ASJA 2JEIA 1TV6B 3SSQA 1DLOA 1VHFA 4I69A 4ZCIA 3QGHA 1YITS 1PO6A 1VQ8S 3PXGa 3WX4A 4H4KC 3EZ5A 3BREA 3S01A 1SUQA 2CG4A 2V8DA 3U27A 5HLFA 2JLGA 2ZJRQ 2JZ5A 2LU1A 4YB1P 2KRRA 4U9RA 2CPJA 1VQYA 3SDEB 1WTBA 2M4MA 1TK0A 1S0MA 4Y2IA 3V4MA 3CVKA 1VI7A 4C3MA 1HQUA 2QMXA 1LWCA 4X4PA 5E0OA 2VBYA 3JSBA 2O1PA 2DNQA 2DNHA 1U26A 3EUNA 2UV8G 3UR3C 1DARA 5DQIA 5I42B 2OPRA 2KJVA 3TVKA 1UVKA 1MMDA 2XGPA 1JXEA 3CDUA 2M8DB 2OD4A 2CQCA 2YWKA 3IGNA 5F8HA 1LFWA 2I9SA 3BJYA 2HMIB 3I31A 4Q0BA 1TKDA 1IKXA 4J5OA 3TYTA 1HQEA 3MM6B 2QA4S 3CIMA 4OLPA 3T6JA 3HFKA 5LSOA 4R0EA 1KC8T 3EPIA 3GIKA 1UP1A 2Y1JA 3R5BA 5B0AA 1RYSA 2P9CA 3BDPA 3QWPA 3B8HA 1GNKA 1FXLA 1UEUA 5HBMA 4FZVA 1TUVA 2PEHA 3PHEA 2CVIA 5JUMA 3OTDA 4TKTA 2HFOA 4I68A 3NGDA 1SL2A 5T7LA 2DTJA 5CXTA 4BWJA 4F02A 4ELVA 4OX9F 3BSCA 4CO3A 2E7WA 2D41A 3O5TB 3M8QA 4IOAQ 5J1EB 4ECWA