4QIFA

Crystal structure of pdua with edge mutation k26a and pore mutation s40h
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGHGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural protein
molecule keywords Propanediol utilization protein PduA
total genus 21
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qifA00
2A10A 5DJBA 3I6PA 3NWGA 4RBTA 3BN4A 2EWHA 2A1BA 4QIGA 3NGKA 4AXJA 3N79A 3VCDA 4P7VA 3IA0A 4P7TA 4OLOA 3MPYA 3DNCA 4OX8A 3CIMA 4QIVA 2G13A 4P2SA 4LIWA 3SSQA 3H8YA 4DDFA 4OX6A 3DN9A 3SSSA 4OX7A 4QIFA 4PPDA 4RBUA 3SSRA 3MPWA 4QIEA 2A18A 3CGIA 4OLPA 4AXIA 3I96A 3PACA 4RBVA 5L38A
chains in the Genus database with same CATH superfamily
1JKHB 4ECXA 1S1TA 3NAIA 4LF5F 4TKTA 1HNWF 1KP6A 5ETOA 1R0BG 1HMVB 3M8QB 1Q8KA 4HACB 4DX6A 1GK8A 1N54B 4TYAA 3TJAA 4MIAA 1YVFA 3NBPA 4WIQA 2OTLS 4G1QB 1N33F 4IDKA 2UXCJ 1S9FA 3H5XA 9RUBA 1Y0HA 2OSQA 3I5BA 3I82A 5B7WA 5J2MB 4B9VA 3D6FB 3L7UA 1UWBB 3RAMA 1VS3A 4OQJA 5KFBA 4NOHA 3GONA 4IUFA 1X4CA 3CXCR 3IWXA 3VGVA 4L73A 4OLPA 4O3QA 2VASA 2CDRB 2ZFHA 2AKWB 1XTZA 3I9ZA 5CAAA 2WBRA 1NK5A 1REVB 2YY3A 2HZAA 3OUYA 1SKSA 3ISNC 3D0GE 5CH7B 3SV4A 2MSTA 2LQ5A 3ENQA 3ICLA 2XSJA 4ZP7A 2V4QA 1NDLA 4DHVA 4Y00A 4J37A 2QFJA 2E7XA 2MQMA 1Y10A 2VBWA 3M2UB 5ETPA 3IR5B 2JEJA 5KFSA 1ZZFA 4Y2CA 2ZH7A 1DY3A 4F2RA 3QIDA 3BO3A 2KG0A 2R9LA 1F9EB 1IWGA 1N34F 3US5A 3QBCA 4JV0A 2DNHA 4FP9A 5AXKA 2G0IA 3NCPA 5F8HA 2GMLA 2YWGA 3OXGA 3R8YA 1NK4A 2J0SD 3DN9A 1T03A 2BJDA 5JJBA 3TZYA 2BQRA 4WZMA 4QWBA 3HT0A 2ZVIA 3RAQA 4DSJA 1KNZA 5IM0B 2MB0B 4NRUA 1SBRA 4PPZA 1N4LA 5LJ3Y 4WWSA 4HYKA 3QAUA 2HBZB 3CVKA 5RUBA 4R25A 3T1HJ 2KT5A 2QMWA 1TL1B 4QW8A 1EP4A 3GFHA 3DRSB 4C11A 4CT8A 6FD1A 2C2ZB 2DGUA 4E2FB 1Q95G 2GX8A 3UDEA 3UFCX 2V2KA 2IAJA 1IR0A 1JLFB 1TTHB 4MK8A 3LWLA 2FLNA 1YHQS 2YKOA 4X4PA 2R3VA 2J0XA 2AGOA 4NLSA 4QPXA 5K14B 4X62J 1I5OB 2YQ1A 4DBQA 4E8UA 1DJ0A 4IKAA 1BD6A 2NXJA 4OYWA 1XIQA 4M5LA 4OI4A 1FA0A 1SKWA 3G4SS 3M8WA 1XMQF 3P3DA 4CLWA 2R8HA 4DX8H 3Q2TC 1RAIB 2MKHA 4HLBA 2UXDJ 1Z4UA 3KDNA 1WHYA 2BJ1A 1U6ZA 4KGMA 4MFBB 3R1HA 2AIRB 3BGUA 2FIUA 4DSEA 1U0SA 3DRRA 5KOXA 2MYFA 3DRPA 3CC4S 1X5PA 4Y3CA 5K8PA 1NHKL 3PY8A 4EEYA 2MLYA 3EVWA 2KI2A 2M5YA 3G86A 3DI6A 4LRFA 4OHZA 3T19A 3HCXA 3PNIA 3L7PA 2ZJQQ 2JLGA 4F7VA 4DLEA 2ZH9A 3MAAB 3BS9A 2RDDA 3DLBA 2ZZMA 4K5SA 3JQMA 1Q8IA 5BR8F 4Q2MA 1KD1T 5B0FA 2GQCA 2CPDA 2GC8A 2HQCA 1HQUB 4I64A 5T7LA 5B0BA 1SUQA 2KHCA 1OPIA 4MK9A 2YQ3A 3Q8VA 3UQSA 1QTMA 4QIFA 1FRIA 1U25A 3LALA 3NCQA 4QW9A 4DZDA 4Q45A 2QZ8A 1X4FA 2HHSA 1TKZA 3J81Y 2RUSA 3DLKA 4OI2A 5JUMA 2E1PA 3L3CA 1AFIA 1EAYC 1R89A 3NS6A 2ROEA 3OL7A 2VKRA 3P45B 2J9EA 1U8WA 1FRMA 4ZJQA 3RBDA 1S9GB 3P4UB 2R4FA 3M8PB 5SUHA 3QSYB 3W2VB 3MUTP 4IDKB 3UWTA 3G6YA 3HSDA 2VDHA 1JK9B 2BE7D 1RCOB 2EWHA 1XEZA 5L8RC 4ETXA 3I56S 4DV5F 1JJ2R 5FDLA 4ELTA 3BQ1A 1HL6A 3C6TB 1SJRA 2HNDA 1YJ7A 3JXOA 3PFEA 4F4WA 4DF4A 3FSXA 4WFAQ 1QUPA 4K0KJ 4KBIA 1VR6A 2BANA 3JYTA 3QT8A 3R7NB 2XG8A 3DLGA 2NQPA 1HNIA 1GQEA 1NHVA 1X4GA 4IFVA 4XAKA 5E41A 1N6QB 1Q0NA 1LFWA 1RQ0A 2L08A 4AL7A 3J7A1 4F04B 4DQSA 3FBBA 3H4BA 8RUCA 2HS3A 4K2XA 5KG7A 2VA3A 4DR2J 1FKOA 1VQKS 5AE1A 1U7LA 4X64F 2V9WA 1GMUA 2QLJB 5J2NB 2Y1LB 4RU9A 4IG3B 2MKIA 5FLXY 2V4RA 4JI3F 2KO1A 2IVFB 8AT1B 1IJEB 3CJSA 1Q1KA 1WF2A 4CLPA 1S99A 4RNFA 1S57A 5E2QA 1T03B 2CVIA 3RB3A 2FVCA 4PRFA 4PAAA 2LA4A 3K7RA 1NPRA 1UFLA 2CZ9A 3BPSP 1ZM4A 2CG4A 2BACA 2JHEA 3AXKA 3LP1A 1VJWA 1WORA 2RS8A 2V4JA 3MM5B 2OI2A 5DQIA 4WFBQ 2DY9A 3L95X 2VD3A 1UEVA 2CQ0A 4DFKA 4JV1A 3L4BC 1E6VA 4PPDA 4USKA 1L3KA 4OZ5A 2B9XA 2EG2A 2DRBA 4V19X 1KLMA 2LEAA 1CJUA 2L9DA 2CJKA 4DR4F 2HGLA 1WTBA 2C28A 2VJVA 2F4VF 3F56A 5JVHQ 3SXLA 4KIAA 4B3RF 5DJBA 2R7TA 2OMLA 1FRKA 4PUOA 1TR0A 4O4GB 2R2TA 5DZ6A 2KYXA 2Z30B 4CYUB 3VGUA 2OPQA 3UO0A 2XSFA 4HHHA 8ATCB 1ROFA 2F1FA 4PABA 4X4UA 5J2QA 1X5OA 3V6KA 5F8NA 4YB7A 3K5PA 4C0OC 5KFMA 1S49A 1WELA 2QMUB 3I0RB 4GKJF 1OIAA 3SQGA 2K06A 3BGFA 3AJ2A 3EDRB 4WXOA 3DRRB 3R2DJ 3L9ZA 1HPZA 4OI3A 4M8LA 4CLZA 2IJNA 2ADCA 3O6QA 2FY8A 1FWLA 1LXJA 2HIQA 2JC1A 4NEYA 4OX7A 4RW7A 3NMRA 3I4PA 2CZVC 1UJ4A 4A8XA 4NCBA 4AYBD 2DIVA 2RF2B 2W9BA 3CC7S 5L39A 1U0HB 1YK9A 3R9LA 1I51B 2M8DB 3HDSA 5A6PA 2DY1A 1S6PA 4LRAA 1FCAA 3DGPB 3R3TA 4MH8A 2N3LA 1NJYA 2IFXA 5ADZA 1X5TA 2YXLA 3AB4B 2QL9B 2C2MB 2Y1RI 3D7SB 1N34J 1UVKA 1VMBA 5K8OA 1Y9OA 2V2VA 3QLHA 3PFOA 3VCDA 2RU3A 2W9CA 5L1IA 4DV0J 2RMLA 1NK0A 1IQZA 3DLKB 5BXIA 3FSYA 2BXJA 4P2SA 2P6SA 2OO4A 4X84A 3ZTRA 3HF5A 4N7TA 3TJ9A 2N4DA 2P9CA 4G3IA 4I7FA 2V63A 3NGSA 1RTHA 5HO4A 3CCWA 2AW0A 3HULA 3IGVA 1Y5IB 5C42A 1U49A 3GG0A 2DNNA 3TZWA 5MAOA 4QU6A 1HI8A 3IG1B 2AU0A 2QLXA 1BQXA 2LEPA 1C1BA 3OFGA 3OTEA 2ZWPA 4OV6A 4TXSA 3Q89A 1B7FA 3K5LA 1EARA 2HSEB 3UCZP 4H4MB 2HHTA 3DGVA 3QJLA 3DNCA 1D9AA 1B0TA 1NEEA 1PC4A 1NJZA 2VA2A 4YQWA 1M1KT 2VFTA 2MTLA 2VPYB 2BRKA 2Y3YA 2GZOA 1QTNB 1Y4ZB 1RUSA 2XYPB 1LK5A 1N88A 3MCSA 4ZVTB 4F02A 5KFWA 4ELUA 2GGPB 2D41A 4NLDA 1RTDA 3M1VB 1SPBP 2AX1A 1JJCB 5E3PA 2EVZA 2XS5A 2LLZA 1TL5A 1YRUA 2BM0A 1BQMB 2E44A 3BYPA 3C6UB 4LT6A 4WF9Q 3UD5A 3JB9k 5KT3A 3NWGA 1J5OB 5KFVA 4AD6A 2UXBJ 1M90T 1C4CA 3ZTPA 2P5VA 4DUTA 2OGUA 2WSCC 4CO3A 3PR4A 3ZZPA 3HSZA 4J9VA 5FIIA 4TYBA 1S77D 4PEOA 1QE1A 4QR2A 1SC4B 1RADB 3QFHA 5C24B 4NZ6A 4Q5VA 3NL0A 4YUDA 1T9YA 3H90A 2HAIA 2UUBF 4NCGB 2RHSB 2DT9A 3WIUA 1VQ9S 3EGWB 2ERRA 3HJFA 3MMCA 2UV8G 5EWGA 1FEEA 2C22A 4I2PB 1RWMB 1HR0F 3FDSA 1QD1A 4JI8F 1Y3JA 1SIWB 2RUGA 3C16B 3O2IA 3CNQP 4C7QA 1XNRF 3Q2SC 4XK8C 1R8BA 3QJJA 4DR7J 1F2GA 1X8DA 2RDJA 2V8DA 3T1YJ 3LAKA 1RTIB 3DOKB 3VVUA 4CTAA 2EPIA 4GO7X 2BYCA 2XO7A 2ZD1A 4ZP9A 4PG7A 2FLPA 3KMQA 3MM6A 1S1VB 4K8RA 2BE9B 2YKAA 1RT5B 4B3SF 2JX2A 1JJ4A 2KU7A 2W9BB 2CPXA 2CQ3A 4M5GA 1U0HA 3CMQA 1AZSB 3CCMS 2CQ4A 3D1HA 4NI2A 4DL7A 4ZVSB 1RBOB 4EU0A 2N4CA 2YWWA 2E1AA 3QT6A 1RLDA 3RW6A 3SSRA 2KT3A 2ZBQA 2ZE2B 2VH7A 3JSMB 5LSLA 2W01A 2AGQA 1UJ6A 3HXMA 2F8HA 3THPA 3Q86A 2Z8QA 2BQ3A 1Y7PA 2BZ2A 1LEOA 1OYDA 1W7WA 2XY5A 2I2YA 5IC6B 1YWXA 4DU8A 1R0CB 4M1KA 4DPWA 4R5PB 2AP6A 1IBLJ 1P1TA 1MMLA 4QPTA 5JMNA 2CQHA 3PW7A 4G1QA 4ZHRA 4GO5X 1VQ4S 2HHQA 3SQOP 1CJTB 4NLXA 4I7FB 3CE8A 5THWA 3DXBA 2XMKA 3RJMB 4O4RA 3W8GA 4ZPDA 4QOTA 4AQYF 1XERA 2CXEA 1VIOA 2FVPA 3SFUA 1NZ8A 1RAHB 4ZPBA 5A8RB 2X1AA 2H5IB 3OW2R 3NG8A 3NMAA 5FD1A 2ZBPA 2YKQA 2XMJA 3BR9A 3D6TB 3CEDA 3K5OA 5CYJA 2H4YB 2KH9A 2RDIA 4IO9Q 3TQ1A 3J81U 2FC9A 2DR8A 2UUBJ 1JB0C 1GMVA 4WE1A 3C46A 4KH1B 1HQ2A 1MN7A 2PFDA 3BB5A 5IT0A 1Q16B 4LF6F 3KUEA 4ZA1A 2LECA 1VIXA 1JWWA 5B0CA 2R42A 3G71S 2HQGA 2F7VA 2QFIA 3DU6A 3DMJB 3CO0P 3O1LA 3VVTA 3OHBA 4OJ3A 1VQ5S 1BWEA 4WPAA 1OY8A 4L3NA 1SL2A 3N79A 2XBPA 5AXMA 3UDLA 3ET6A 1GT8A 3Q8UA 1ZM3A 2ZC4A 3IXQA 2COLA 3PYGA 4UF4A 2V94A 3BH6B 4USWA 2IBKA 4QCLA 4L75A 3EGVA 4WYLA 3K89A 4KV8A 1FXLA 3OQ2A 2PA3A 5HROB 2BUNA 5AE2A 2VJUA 3FCVA 2HZCA 3QQCD 2EFQA 5C5JA 1Z1ZA 3GFXA 2EK6A 4PG5A 3W61A 1BQMA 5HMXA 4ED5A 4ANEA 4DOZA 2DNOA 2DRDA 3EXYA 2A6MA 1M1GA 1ZM2A 4BWMA 5A0YB 5KAKA 2FUG9 2DO0A 4NX9A 4MKVA 1YLXA 2OFGX 3UW1A 4DI6A 2OPPB 4JI0F 3ZZTA 4F0HA 5DG7A 3CIZA 1QSLA 2O3DA 2NSCA 4IOBA 3FK4A 3KTQA 5F3ZA 3J7YI 4C8OA 1O5JA 1KVIA 1BQNB 5EX3A 3DYAB 1HW8A 2JL9A 1U1PA 2J7KA 1HKAA 5E7OB 3SBMA 3VAHA 4WK3A 2CQGA 1N5QA 2FC8A 4RW4B 1HI0P 1RAGB 2CJYB 1I3OB 2GCFA 1Q53A 4AT1B 4CIOA 1VC5A 3M6WA 1T95A 2OJ3A 2IDLA 4X4NA 2V5HG 4B3MF 3I4HX 4M5IA 3MF5A 1RTIA 2AX0A 3DOKA 3SEOA 2MZ1A 3UN3A 2BQUA 1KC8T 3J80U 2CPYA 3LQVA 2E5JA 3BPDA 1WDDA 2C2EA 1HHTP 2H3EB 4DCPB 5L38A 3QGIA 5ETNA 1YTYA 4A8OA 3RB4A 3VAJA 4HI2A 3H25A 2HAFA 2YBVA 2R8KA 5I4MA 1C4AA 5M2PA 4CLSA 1Q82T 2BKOA 1HD0A 4HTJA 1QAXA 3JSMA 4Y2MA 5T7LB 4U67Q 1PG5B 3I31A 2FJDB 2OKQA 1H7XA 1XK8A 4CO2A 4WKYA 4NA3A 3M6UA 3P5TL 2GJFA 1DTQB 3SSQA 4ZCMA 2OLWA 4ED8A 3G8SA 4DV3F 1G7CB 1X0PA 1H74A 2AJ1A 4A4JA 1KLNA 4LF4F 4HKQA 1NJXA 4R5PA 2OTJS 5EX0A 1L5UA 1NJWA 1YJNS 2WK4A 2KFZA 5CA5A 1MMDA 3MPVA 3PEHA 3O8WA 1HQEA 5KG2A 3GU0A 4RNHA 2CADA 2GAGC 3R5AA 1MWYA 2R7OA 4WP3A 1R43A 4XDDA 3HP6A 3BO2A 5CYMB 5DS7A 4KO0A 2HQFA 3PRBA 1TVRA 4PG6A 4IH6A 3I0SB 4KHPF 4E98A 1WC0A 2X1GA 3A3NB 4FKXA 1IKWA 4LFAJ 3EDQB 4URQU 1SJQA 5D4OA 1S9EA 4UOCA 1BXNA 4V1Ak 2LKZA 2HVDA 2DNMA 5IFMA 4RLEA 2UU9J 2R2RA 3DOMA 2XYHB 5IT4A 4B9NA 3Q8YA 2N7CA 3LWMA 4F3MA 1QAJA 2W7AA 3DLEB 4ECRA 1VBYA 2I8EA 4BC9A 2WZ1A 3DC2A 2XNQA 3HHDA 4ZCIA 3DMJA 4ECVA 2FD2A 1N36F 2RD5C 4TU8A 4QIEA 3HM9A 1VQYA 1WI6A 2UXCF 4OZLA 2CPZA 2HGMA 2UUAJ 2AZ3A 1FJGF 5KFXA 2QA1A 3BGOP 4FZVA 1RDRA 3W65A 2QLWA 1QSSA 4R0JA 2E9ZA 4C97A 2E1MC 2C3UA 2VBXA 1NSAA 3ZZRA 5F8MA 3H40A 4I56A 3CD6S 2CPHA 4RW8B 3NGKA 3RYLA 4ZVPB 4I6YA 2UVWA 3MURP 2DGQA 3M6XA 1YITS 2OFHX 2X7IA 3ILIA 5A0YA 3EZUA 5E33A 3KUHA 2V4JB 3MM5A 3ZNUA 4B3OB 2VF3A 1NPPA 2PE8A 2XEXA 4Y0FA 3DM2A 2UUAF 1GEHA 4AUKA 5AXLA 3N01A 4UQGA 2AGPA 5T14A 1CJUB 2IMWP 3N0VA 3G9CA 4Y2KA 2B4VA 2DHHA 4NA1A 3OFEA 2FHJD 4FPIA 1HNVA 1R3NA 2IRYA 4RW4A 4RBVA 1UTAA 2RKIA 2V8HA 1NSQA 3WX4A 2K1RB 4EYIB 2HHHF 4LMZA 3EJMA 2A6OA 4CYUA 2JRSA 3N9UC 3P96A 3PR5B 2YQ0A 1LWEA 3UN2A 1SI9A 3AAWB 4ZLJA 5IWAJ 5A2QY 1AFJA 2O01C 5DDOC 4ILRA 4DV1F 2EFOA 3K2YA 2BX6A 4P7VA 2YKPA 1RTZA 1VLYA 3SQGB 3TW0A 2KXNB 4YY3F 3C3LA 4CM2A 3C66A 2VQEJ 4GC6A 2IVMA 2W7OA 5DM6Q 1XBWA 3AOAA 4JI4J 2DIUA 4PWDB 1DFDA 3BSCA 4EGLA 1LV5A 5CXTA 4K4ZA 2W8KA 2JVRA 1YBUA 4FN5A 4ZCLA 2CPEA 2LCWA 3PYEA 4K2JA 3R7SB 2XYGB 1S6PB 1KOHA 3ZFVA 1GH8A 1MWQA 5KFUA 4XPEA 2CQIA 1DTTA 2F9DA 3OT9A 2NYIA 2ZJPQ 3W9HA 4KGKA 2VPWB 2MKYA 3H98A 3HSGA 2GHWA 3LPYA 5KG5A 3MMJA 2HWTA 1FE0A 3QLHB 2W9CB 2GIQA 1I1GA 2Y0BB 5KT7A 4DR6F 1Q8BA 1IQTA 2VL1A 4PG4A 4K50A 1HWIA 2I5JB 4HR2A 1KBRA 3TYTA 4F2SA 2MJUA 2XI2A 4TU7A 1U6FA 1TUGB 2J6SA 1E6YA 1PSDA 3IN5A 1KQGB 1TL7A 2HK2A 1RT3B 2MJNA 3B6BA 3RGIA 3TUPA 1T9VA 2VBZA 1HR0J 1FXDA 1RHQB 2EC2A 2J9DA 2V8PA 1DQ8A 2B7BB 3MEEA 4H54A 4WFXA 1QM9A 4EBCA 2J7UA 2DNQA 5H9EK 1D1UA 3G2XA 4TY8B 5AT1B 4KO0B 2WW4A 2GQ2A 3OR1A 4LSLA 2WOMB 3FSIA 1PYSB 2W2PP 2YNHA 2ACMA 4NLGA 3NGRA 3KNAA 1WG4A 1IVZA 4FF3A 3ILJA 3PW0A 1S1UA 1T9XA 3AOCA 4N8OA 2H1YA 4YEAA 1A7GE 2XTJP 3DOMB 3TX0A 3WX8A 1HBOA 4GC7A 2HIYA 2QSFA 3W63A 3OVBA 3O44A 1VBZA 4YP3A 3MEGB 4ZVQB 1RHUB 2IA6A 2Z56B 5M2UA 5KFFA 1T02A 2V69A 1DLOB 4DV5J 2OEKA 5GAHU 1YJTA 7AT1B 4YFUA 4CQ1A 2FJVA 5DZ7A 2D69A 3MR3A 4OZ3A 2VG7B 1S5ZA 1UAWA 3RG6A 5J1PA 4PQAA 2DGVA 2YKNA 4WFYA 1W2BR 1EQMA 4QIWD 3TA0A 5B0GA 3U1MA 3GIMA 1T3NA 2Y8WA 3QIPB 4MKBA 3CMAS 5I3UB 4PXBA 1AB8A 4HI1A 1SXLA 1TKTB 4W90B 1T9WA 3WQPA 4FBTA 3AQPA 4P2FA 4O0NA 2ZHAA 1DRZA 1UPPA 3MM7A 2DGWA 3TP2A 4LF8J 1QY7A 2AD9A 4LFBJ 5KFKA 2YPYA 5HJYA 4ZPVR 2AYGA 4QWEA 1A6LA 2ILYA 1RACB 3CDBA 3GJRB 3QFWA 5KFAA 5C24A 1L3TA 2PO4A 4N47A 1EQ0A 2VC0A 3C14A 1IXKA 1EETB 2EXUA 4RL1A 3QZ7A 2ZM6J 2RB7A 1GXTA 2MHEA 5HQ8A 1JLQB 3N4WA 1RHKB 1RTJA 2FLOA 3D66A 4K7QA 1VRTA 4H4KA 1UL3A 4M63A 3AOBA 4ALZA 3RB0A 2PIIA 4IO1A 1T8EA 5DETA 1F5BA 2LVWA 2FZGB 1TV6B 1LWEB 4P9SA 4USMA 1JLCB 1WKJA 2HEKA 5ETQA 1RAJA 3W7BA 4DR1F 3CWJA 2DGSA 3W60A 3EMTA 2CUYA 4KC5A 3VGSA 1F0XA 3RTVA 2ROPA 4ID5A 4X65F 2BJ9A 3PIOQ 3EPIA 2IY5B 1Q8LA 1U8SA 2ZD1B 3LW5C 5LOQA 1D9FA 3TUZC 5JXSA 1JKHA 4HDGA 1H2TZ 1FFSB 2QL5B 2CNNB 1RAEB 2JC0A 3B54A 3GTYX 1D8YA 1HNZJ 1FESA 1QJHA 4BC7A 3PV8A 4OI1A 1AUSL 2L41A 1HNWJ 4HACA 2AHOB 2FY1A 5J1EB 1C1CA 1V9OA 4CT9A 4Z7CA 1YQHA 3PHTA 4LF7J 3DRXA 5IS2A 1UCNA 2V68A 2XLKA 1RKIA 5J2MA 1WOSA 3W64A 4ZK7M 5D77A 2Z57B 3T5JA 2ZZTA 1AA1B 2LQ9A 4K5RA 3MCNA 1GNKA 2ZHBA 1SKRA 1K8AT 4QYZK 4DCOB 3KK2A 3KG0A 1FX4A 3IO1A 4ZVFA 4K4SA 1N5YB 2XQCA 2DD8S 1F9FA 3BM7A 3MZIA 5E5NA 1OYEA 3FZBA 2B9YA 3A8EA 3UCGA 4B3TF 5J2PA 2J6UA 2EKNA 4F4AA 1AT1B 1RT3A 2RU9A 4IOAQ 1IBKJ 4K4TA 2DH7A 4O44A 1EIYB 4HDHA 3TEHB 4ED4A 3MEEB 2E5LJ 2XSJB 4NYZA 2RT3A 4PKDB 2QTWA 2X3GA 3FCWA 2V50A 4ANCA 3N6NA 2BOPA 3BDEA 1NAQA 1ZBTA 4EO8A 1FTRA 4LREA 3UE2A 2W24A 1FF2A 1JNZB 4Y2AA 3MAQA 2Q79A 2ZBCA 3CW2C 4RO0A 2FVSA 3BH7B 2YNGB 4FBUA 1S1UB 1R6VA 2BJ7A 3T5HA 3V5RA 1WHXA 1S79A 2ZM6F 2R8IA 2DISA 2NYHA 3H4DA 4Q8FA 3WDOA 1XJWB 3LPEA 4DLGA 4MYTA 4GVBA 4DQPA 1QVGR 4IYQA 4DV7J 4O23A 1Q79A 3A3OB 3D9BA 3H5SA 3UVJB 1X4DA 5IM0A 4EBEA 3JTPA 2DNRA 1FEHA 1NM2A 1X60A 4DCJB 3RAXA 4LRCA 3RR8A 2LQJA 2VQFF 2HNYB 1TL1A 3K8VA 4EBDA 4FNIA 3THTA 2HVEA 4CNYA 4HEA9 4A8SA 2PI4A 1VQ6S 3AODA 3IA0A 1PAUB 4J9PA 3BGRB 3CIMA 5KG6A 3T3FA 4USTA 2IJRA 4IG0B 2AV5A 5GADI 4DL3A 1ZS6A 2JWNA 2GVDA 4X66F 4DDFA 3GPAA 1BY9A 4OZ0A 5KT4A 6AT1B 2ZDPA 4C3LA 4WFNQ 4YR0A 5HP1A 5DGAA 1LK7A 1ZAWA 4KT0C 2PDAA 3E01B 3DHWC 4B17A 1XR7A 1NZAA 2DH9A 3I9V9 1BQNA 3Q83A 2H51B 4MFBA 3OLBA 2XGQA 3E8OA 3KWMA 3F73A 4C8YA 2GS8A 3KLGA 2NPFA 3MM8A 5KFQA 3ZXWA 2XGPA 3M9MB 3V81B 1YG0A 4ZIVA 4EK2A 4U7UD 1IKYB 3GE9A 3V6HA 3HHNB 3GSIA 3OTOJ 3IAM9 4NEZA 2A2CA 2R7VA 2E5HA 4DV2F 2P9EA 1V3RA 3BYRA 3MMAA 3QNWB 3IRXB 4RR5A 5KG1A 3W62A 4DFJA 1CQNA 2HVIA 5KG3A 4XDCA 3UDCA 1ACMB 4ZVEA 2UVVA 1RB0A 4LF9J 2RRNA 4IH5A 2E5IA 3KLHA 3N6MA 1PILA 1T9TA 2M3DA 1SUQB 4ED0A 3LP2A 1FRHA 4FS2A 3N6LA 1DQAA 1NSKL 3X3UA 1WUUA 4CM0A 3T5LA 4Q43A 3HLUA 4ZLNA 1ZPVA 4A8YA 2CQDA 1IM4A 2DR6A 2XMMA 2ZHOA 5J1EA 1QDUB 3KHGA 2GHVC 1FERA 4DPUA 4C98A 1Q5YA 2AEMA 3D3CJ 1WOOA 2R7QA 2ZBIA 2XMUA 2PMHA 5IV4A 5A8WB 3C6TA 1HBNA 1H72C 4OFZA 3W2WA 1S10A 1WHWA 2E7VA 3JTNA 4OHXA 2FHMA 5HJXA 3M30B 1CC8A 1TP7A 3K17A 1WJ9A 3PDNA 4LSNB 1B70B 2ZOMA 1I94J 2CJQA 2QE5A 1JQGA 4UW2A 1RBLA 5J2PB 2KXHA 3PRVA 2ZH4A 2ADBA 2RQKA 3ZTSA 3J7ZT 1WEYA 1T94A 1BLUA 4M5KA 5KT6A 2ZH8A 2MY7A 1O0PA 4J9UE 3G6XA 1RJJA 4J9SA 1U02A 3QJPA 3OHAA 1SL1A 1FKOB 3I0SA 2C2RA 4X2BA 5BJRA 2CPJA 5J2NA 1CULA 1WEZA 4QIGA 5L1LA 2G4BA 3K58A 2AJ4A 2NR0A 1RT7A 1PBUA 5F9LA 1VYAA 1Y5NB 3KYLA 1PJ7A 3QMQA 4AL5A 1S1XA 2BV3A 1N5SA 1FKPB 1C0TB 4OIXA 1TQLA 1UVIA 3CF5Q 4JOUA 3NNHA 5BYRA 2B56A 4NLOA 2HZVA 3SCJE 1I6JA 3V6DB 1IBMJ 2Q3PA 1PCAA 2J8AA 3NKYA 2HNZB 4N76A 1S12A 2QGFB 1KTQA 4OHVA 5SZTA 2O67A 1RT4A 2CAJA 1B99A 1KS2A 3LA0A 1X0FA 3OPKA 4L76A 1N5VA 4KB7A 1U6BA 5LM7E 2WW8A 4BLGA 1JLAA 2R7RA 3J7AN 3P49B 1RISA 2HHWA 1B64A 2NXCA 3HI9A 1N56A 2HQDA 3G82A 4M5DB 2LQBA 2DEJA 2O66A 4UY8T 5GMKa 1EKSA 1L3UA 2GVZA 4ZP6A 2PT0A 1CG2A 1FVSA 3MDFA 1GMWA 1PAEX 2DB1A 2HWHA 3QSIA 4QZVB 4EZ6A 4L74A 2JDJA 2XC9A 2OPQB 1CJVA 2DPJA 2D3UA 5J2QB 3OSPA 3E01A 4BDPA 3PG9A 4KKOA 4C8NA 4KGZB 4IR1A 1VI7A 1QAYA 1CEZA 1MN9A 2ILZA 3KJQB 3QO9A 4CWBA 3W9IA 4B9SA 2Z2LA 4DV4J 4DN9A 3H0PA 3FEZA 5A2QU 1NH8A 4DV6J 5KFNA 4FNHA 3PYDA 2U1AA 2J5AA 2GFFA 2G0CA 2XULA 1IUJA 2RKIB 5G4DA 3WBZA 2QL7B 1RKJA 2E29A 3FRZA 1S0NA 4JI2F 1U2CA 1VJQA 3IS9A 5IXUA 2XNRA 3D0HE 1S4EA 1YJRA 2W4PA 3UR0A 3J80Y 4OL8A 4GKJJ 3MECB 2BE2A 4ZJOA 3PW2A 3TQEA 3D6HB 4CI0B 1KN6A 3TX8A 4UUXA 1RHJB 2I1RA 4C0HA 2APOA 3ITHB 4KYZA 1WDTA 2ZITA 1TFWA 4O3NA 3RU0A 1HYSA 1XMOJ 3PYFA 3AA9A 2PD1A 4QYRA 2GO9A 4IH7A 4CLLA 1Q7LB 3IBFB 3TANA 1S6OA 3D0IE 1S72S 1M5VC 3GSDA 3IR7B 4EI2A 3H2LA 1SC1B 4Z7YA 5D0RA 2XY6A 3EZOA 1P9QC 2KYZA 4A8MP 1VC6A 3NBPB 2AJ0A 4WTYA 3TZXA 1UZDA 1RI7A 2VU5A 2HFUA 1FJEB 1R8HA 5A8WA 2CFXA 4PYAA 4RUAA 3AJ1A 1SV5A 2YX4A 3AH6A 2NREA 4AXJA 1RP5A 5F3TA 2R7XA 2VZ9A 1KSPA 2HMIA 2G2YA 3Q23A 1TL7B 2WRMA 5KFOA 3BDPA 5H9FK 2MQLA 1OWXA 2ZEJA 1JLEA 4UOHA 3VTIA 2MZJA 1X9MA 2IM3A 3L09A 1N0VC 4X66J 3B82A 3MWBA 4N5SA 2MZRA 4UZBA 3KLEA 1HI1A 1VFJA 2LU1A 3UD3P 4OI6A 1GMWD 5CYQA 5ETKA 3KJVB 2LXIA 3OR1B 2DJWA 4LSLB 5KFIA 4FPRA 1JX4A 2JJ4D 2HK3A 2QO3A 3M7VA 2CG8A 2CQPA 1G1XA 4K59A 1VRQC 5HVGA 1JJHA 1IBLF 1B7YB 4F36A 3A1YG 4DSLA 4OHYA 4PR6A 1D09B 3PO4A 2JEIA 1HBOB 2ZOFA 3I87A 3MFHA 4JI1F 1C0TA 4DV7F 4FVMA 3I55S 4DL4A 2SXLA 2PEHA 1MU2A 1J5OA 4TY9A 2QT7A 4Z2XA 1NK8A 5A8KB 1CVJA 5B0AA 1UFKA 2OSRA 1S1WA 1P9YA 1APSA 5DO2A 3KK1B 1IBMF 2RQMA 4AFFA 1YGYA 5HANA 2CQ1A 5LXRA 2ZH1A 1EB0A 2DHGA 3S8SA 4M95A 2YKNB 2EG1A 5LSOA 4B3SJ 4HL9A 4F8RA 4XPCA 3G82B 4M5DA 4ECSA 2V9KA 5KT2A 3OR2A 4B3MJ 2HMIB 1UMJA 1XMQJ 1H98A 1KQSR 2LFVA 1YX2A 4M94A 2DRAA 3I32A 4NLYA 4EFAC 2W2MP 2W25A 4OZNA 1UFWA 3OXLA 2LXUA 5IC4B 5F0WA 2H5EA 1TKXB 3OD2A 4DU7A 4F26A 3MXHP 2HS0A 2DKOB 4QQBA 1LOUA 2KVIA 3EICA 1FJCA 1ZETA 3H59A 5E3QA 4CTAB 1RAOA 1N5TA 1N32J 4B9LA 1RE1B 2H48B 3DRPB 3KFWX 4YN3B 2XI3A 3TNVA 3PTWA 2FJWA 4LQ3A 3IR6B 4EMDA 1RT5A 1G4CA 2BJEA 3TUIC 3VR1A 1IKVA 1NHUA 2IM1A 2RSQA 2VG6A 3QZ8A 3SMZA 2Y0SD 1YI2S 1TUVA 3W5ZA 3CUNA 3SFGA 2DCUB 4DR5J 2BKNA 2VODA 2EKYA 1RK8A 1XQIA 4ED3A 5F8IA 2QC3A 1X9SA 2J8SA 4ZPTR 5E3AA 2DR9A 2M9KA 5GMDA 1RWXB 3FGVA 1HQUA 3CD0A 3SSSA 1HFEL 5KFCA 3BQ0A 3W1YC 2PI5A 4P10A 1LXNA 3ETMA 1J2VA 4F4ZA 4YB6A 2POKA 3KHRA 1SC6A 2X1FA 1TAQA 1W26A 2HFSA 3M2RA 4UUWA 5BYQA 4OYXA 1BGXT 3FQKA 4LJMA 2ATCB 3G8QA 4MK7A 3NGUA 1C1CB 4NWBA 2JEGA 5BYSA 4FF1A 3CCVS 2OEMA 4ITSA 3BZQA 1LNQA 3KLIB 4ZCKA 4NLTA 4OX9J 2IM0A 5CHCB 3N5FA 1RXOB 2DGTA 3SZ2A 1NMEB 2B6AA 4C2MA 1C0UB 5F8LA 3PKMA 2JSXA 1GXLA 2QYCA 3VAIA 1OQ3A 2CPIA 2Y9HA 1HBUA 3LUYA 1S48A 4BCAA 1YJUA 1KONA 1MWZA 3M8RA 2BJ3A 2BJ8A 3FJ2A 1JLBB 4RU2A 4DF8A 1LWCA 4PWWA 1JLEB 3RRHA 2ROGA 2WAQD 3BKUA 4O44B 5F8JA 3PCOB 4IFVB 4P71A 1NDKA 1N6QA 1ZH5A 4OJGA 1F1BB 2C2DA 2R8GA 3N28A 1UEKA 1RHMB 2AT1B 1LFPA 3DU5A 4NZ7A 5B09A 1A0OB 2LDIA 2RRBA 5CYQB 3WZ0A 3V4IB 4NLVA 3KJVA 4EUVA 4WCEQ 2XCAA 4OYMA 2R2SA 1H0HB 2DK2A 3DHXA 4I0WA 1AYEA 1X4BA 3HVWA 3HZEA 4JUZA 2RRAA 4C8KA 4LVNP 4JI7J 4F3QA 1IM6A 2VFRA 2YNGA 4FYDA 1Z2LA 5HROA 3W5XA 6FDRA 2Q1LA 1WWHA 4G65A 4YDXA 1RYRA 3R2CJ 3AB2B 1H3DA 3EE3A 3BBFA 4P6QA 4WK1A 4ZLLA 3PVXA 3GQCA 2B8QA 1YRXA 5CD4H 3UVJA 4KGXB 4USHA 4K4UA 2AEJA 1RGVA 2CDQA 2CWKA 2DITA 3F0NA 4HH1A 3GMGA 4NMXA 5CCLA 3CJKA 4KSEB 1F3FA 2JFKA 3OL6A 5KFPA 4PG8A 2IJFA 2IBOA 1E6VB 4RBTA 1JLGA 3RUBL 3DYAA 4FYVB 3AT1B 3JSRA 3VQSA 4O0IA 2ASLA 1T05B 1M1HA 4KTQA 4TLQA 3ILLA 1XR6A 1OY6A 3GIIA 1FVQA 4S0MA 1S97A 1MSWD 3SV3A 2QMXA 4O4GA 5KFLA 1HW9A 2GVDB 3CCZA 4M5JA 5LSRA 1J5EF 1IN0A 2F5GA 1VQPS 1RWNB 4LBHA 1VQ8S 1UVLA 1QLNA 4C9DA 3MD3A 3JTOA 4ES1A 2KDOA 4DL6A 1TKXA 2AWZA 3Q8RB 1ELOA 3OL9A 2YKMA 3T41A 3HJVA 2A18A 2MKJA 3TRGA 4Y6IA 1BE4A 3ISZA 2RVJA 4HHJA 2ZOGA 4HT5A 4K4XA 4J9NA 4KPCA 3Q0AA 5GAEI 3TOQA 3JQKA 4USIA 4ZMMA 1TKDA 1IKYA 2ZNZA 3AXMA 5D4PA 4CDIA 2JFDA 2QEXS 4QU7A 3ZNJ1 4DR4J 5F8GA 1V5IB 2RF2A 2ZBRA 4U95A 2KHDA 4I1TA 4DSKA 4JI5J 1U1RA 3M8YA 3DGPA 1LQ9A 4MAKA 2K8GA 3IRXA 4NLUA 1TL4A 3AFGA 3BEGB 1IKXB 5C25A 4NE9C 3HKZD 2DGOA 3NXZA 2ZUGA 4H4OB 4L3KA 3U27A 3LP0B 3ZZUA 3KLHB 1ICEB 3UN5A 4YY3J 2FHKA 3CCES 4LFAF 2OUGA 2PGCA 1KOOA 1SH2A 1WSVA 2DNZA 3CSKA 4JBCA 1KVJA 1DTQA 2VOPA 2PA8D 3VWSA 2ZH2A 1U2FA 5HQMA 1RWWB 3E3XA 3GJQB 2YNIA 3M2RB 4DUZJ 1FNXH 4GMKA 5D4LA 4FYXB 1VQOS 2UVUA 2A10A 5I3QA 5HBMA 3MEDB 5D3GA 3RW7A 1NXIA 1YSJA 2C2KB 4B3OA 4ZVOB 1BC6A 1T0TV 3MM9B 4ZLPA 2DNYA 4RJVA 3D2WA 1U45A 4CZCA 1HBNB 4ZVHA 4EZ9A 1D8ZA 1WI8A 4OZJA 2OP5A 3GILA 4NYOA 4QIVA 5HMYA 1C1BB 5AJ3J 2ZUAA 4ZDNA 5GADU 1F9HA 1LWCB 3NS7B 5IQ6A 4WP8A 1REVA 3IP0A 5KFEA 1XNRJ 4A46A 1S0OA 2XMWA 1JXLA 1URNA 3A13A 4F0MA 4ED7A 4A47A 1KHVA 2B5JA 2Y1IA 3GZ7A 4RUCA 4DUYJ 3ISND 3M2VB 4RWWA 3S6EA 5EGYA 5GAGI 3THVA 4ETZA 3M9OB 4KHRA 3RRKA 4TQRA 1TUWA 1NU4A 1TK0A 4JI7F 1VHIA 4ELVA 1RT7B 5B0EA 2ASDA 1V3SA 2VBYA 2A1BA 2ZNYA 2GJIA 2V0NA 5A76A 4B3RJ 5DG9A 3M1VA 4WJBA 2HHHJ 4LSZB 5T41A 1D9DA 5AJ3F 1FKPA 4LF1A 3C6UA 3F44A 3EZ5A 1OSCA 4ZS6A 3M9NB 4DSFA 3KMSA 2DYAA 2LEBA 2WVBA 4JP8A 1K1SA 1CC7A 3A8IA 3WHIA 2KFYA 1O6XA 2MZTA 2MLXA 1FFWB 1ZA1B 4J91A 4P52A 1XNQJ 1NDCA 3UR3C 2O1PA 2YTCA 1K44A 4OX6A 2FLLA 5HI7A 4C8LA 5MLCV 4TQSA 1CS4A 5U47A 1JLGB 3K0JA 3QRQA 2EBGA 4UQTA 2EBEA 2PMWA 3J7Z5 2K7KA 5FLXU 2D9PA 2NLWA 3GV8B 1U1OA 5FJ4A 4NCGA 5KFHA 2HFVA 3BGLA 2QA2A 2LP4A 5K14A 3OSNA 1VK3A 1K0VA 2FB0A 2GVZB 1DBDA 4I2PA 4ZN3A 2HHUA 1EZZB 4ILLA 2OEJA 3HHLC 3KLVA 4FXDA 4MTPA 1C2PA 2O5DA 5D4NA 5ETMA 1U1MA 4A48A 1KTVA 3SCLE 4Q0BA 1VBXA 5HL7Q 3AY0A 3CCUS 3CD5A 2OELA 2NPIA 4I69A 4USUA 4EWTA 3ONQA 5H9FJ 2Z2MA 4IR9A 3M05A 3PW4A 3H8YA 3W5YA 2NXEA 3NEKA 2Z4PA 3GB0A 5E3RA 1RWOB 1SIZA 3FBFA 3DI6B 1RCXB 3IAS9 4DPOA 3ZTOA 1B3TA 2KZMA 5IT9Y 2C3YA 1T11A 1EJ7L 1LWFB 1FD2A 1GTHA 2GO8A 2AMCB 3R5BA 4NI2B 2MGZA 1RT6A 1P6TA 1B0PA 2CJ9A 1DTTB 5HATA 3KKFA 3IMQJ 3MAAA 1XR5A 1KKHA 1PKUA 3MECA 3MTKA 5G0RA 2ACYA 3GYGA 3L7OA 3OL8A 4G6VB 4ZJLA 2J76E 3U7JA 4TU9A 2H4WB 2FZKB 4JI0J 3CO9A 5I42B 2BM1A 3A8KA 3ITHA 4GKKF 2GHPA 4LQ9A 1M5SA 5ETSA 2CKWA 4CO0A 2ZC3A 2XLIA 4OJ1A 1VDHA 3G87A 1TKZB 2XCPA 1S4FA 4I4BA 2XZDB 3UPFA 1HNZF 4A8QA 1GX5A 2MPUA 4X4RA 2WONA 1S9GA 3SDEB 2PN6A 3M8PA 1VQLS 4A8WA 4DUZF 1HBMB 2ZJRQ 2HW3A 2B4PA 4ZHRB 2VFSA 2KJVA 2P9GA 4JV5F 4TY8A 2PC6A 5KFGA 2Z2ZA 1MLAA 4U7UK 3T9ZA 5KTQA 2H9ZA 2WVEA 2N82B 5A8RA 2YNHB 2RQ4A 4CP5A 2DR5A 3M6VA 3GIJA 4E0DA 1FJ7A 3QATA 1KRPA 4LF6J 3WIVA 1R7IA 1HNIB 3PJWA 2G9OA 3MOZA 2MZSA 1VLOA 3H2VE 3NGTA 4P73A 5KOWA 3BKFA 4LF7F 3NNAA 4C3MA 1B4SA 4RW9A 2CQCA 3PXGa 4UZCA 3ZZYA 3MEGA 3EGZA 5GAGU 2J0WA 1U2RA 3GFYA 2GAHC 2VV5A 2WSEC 1S6QB 4LFBF 2HPUA 2VG5B 3M2VA 1Q81T 4ES3A 3FZ2A 4M5HA 2LQ8A 1D3WA 4IQXA 3P8BB 4UTGA 4C48A 1KEKA 1CLFA 1N48A 4BHQA 3QPIA 1OY9A 4KV8B 2BABA 2YX7A 3M4XA 4CLTA 2OAUA 1NB7A 3HHKA 3JQJA 2EI5A 2GJ2A 3KG4A 1CJKA 2CJAA 1HWLA 2PEBA 4KE5A 7FDRA 5I3UA 3KK3A 4FF2A 1RYSA 3CMES 2NZ4A 4UY85 2JEFA 5A8KA 2JVOA 3AD7C 3MM7B 3IM8A 4UOFA 3QGGA 1ZZNA 1U24A 1S1WB 5M2RA 2AYBA 4NCAA 1KDNA 4USVA 1YBTA 3OFFA 4HVZA 1YKWA 1R0AA 4DV6F 2F8MA 1KLMB 3HVTB 1XWLA 5D0GA 4PQUA 1P27B 1HIYA 3K8WA 4WP9A 3TVKA 3UD4P 2XWYA 2AQ4A 4F4KA 5CCMA 1TU0B 2OHDA 1JLQA 1X4HA 3HD2A 4RUBA 3R97A 2B3TB 3HFZB 1NO8A 3B4MA 1FNMA 1RWPB 4C0BA 5DG8A 3M32B 1MROB 2GMHA 3LGHA 5ETLA 1TV6A 4QBUA 3NNCA 1IBKF 3VZIA 2GW8A 3CCJS 2RE1A 4KFBA 3LGMA 3TAMB 5HMWA 4X4SA 4Q0BB 4WZQA 3ELHA 3EX7B 1ZOTA 2Q66A 4MIWA 4IQMA 2DO4A 4DR1J 3QGHA 1PJ5A 2CPFA 4F25A 1GXUA 3MCOA 3TA1A 5AE3A 4J9KA 1H2VZ 4MJKA 2ZKTA 3HFKA 1FX2A 4X4OA 2YNFA 2XHWA 3MEKA 3OTCA 1UKUA 4FXVA 3ZZZA 2QX0A 4WU2A 1IKVB 2GV1A 2VG6B 1PO6A 5F41A 2HS4A 4OX8A 1RABB 4DPYA 1R8CA 4J7CA 2H54B 3VAGA 1S76D 1G3OA 3MGJA 2IHR1 3M8ZA 4U8YA 4DZ6A 3OJSA 3CJRA 2KJWA 5EWEA 2ZVSA 5B08A 2J6TA 1FKAF 4DV4F 1OMSA 3PEJA 2F40A 2HBQB 2WVDA 4H4KC 5I42A 3Q8SB 1S1TB 1H7WA 4NXMJ 2WVCA 3KK2B 4C4WA 2PFFB 4DG1A 1HMVA 1OS5A 3LF0A 3R5CA 4BBYA 3FBEA 4DR7F 2J0QD 2RH3A 1O8BA 4O3SA 2KRRA 3CJ3A 4N77A 2CWXA 4NPOA 5ETRA 1NRKA 2AJ2A 2B4OA 2GA7A 4DJBA 5HSPA 3ZZ0A 4P74A 3FRYA 4Q44A 1CPZA 1WHVA 4NLRA 1K73T 5EDWA 2MEWA 2GNKA 1FWKA 1FFGB 4DV0F 2EEYA 1TVRB 1EX8A 2IVYA 2B6AB 2W2OP 2CQBA 3D54A 3NOCA 3MR5A 1M5PC 3TZZA 4R8UB 4J90A 2L3MA 1CSJA 1X4AA 1SC3B 2HVZA 3C19A 2M2BA 3FMBA 1JLBA 1FHTA 4H4MA 4DR5F 3F41A 5E0OA 4ECYA 2XZTB 2OPSB 1K1QA 4C3KA 1KFDA 4NMLA 4K4WA 3V4IA 1S6QA 2HFOA 3QAEA 4YDDB 5AXNA 4DN0A 2EW9A 3C15A 3PX0A 2VB6A 1L3VA 1R31A 3ZZOA 3G8TA 1NK6A 1KFSA 4JI4F 4OX9F 1VISA 3ZO7A 1LWXA 1ZM9A 3TR5A 2HYIB 2CIMA 4MIBA 3OLAA 2R8JA 3RR7A 1Q86T 1NSPA 1FRLA 2GGPA 1RTDB 3CDWA 1WC1A 4WU3A 1KR4A 2L48A 3Q22A 1X31C 4RW8A 1U1QA 1IBCB 2QG9B 2QIFA 4W92B 3QT7A 5EWFA 4IG0A 2QLFB 1WF0A 4JI2J 4TNOA 4DV2J 2I38A 3MI7X 4JYAJ 1WTFA 3O5TB 3A3PB 2U2FA 5HVHA 3RBEA 1WEXA 1OQ6A 1WOPA 3GG1A 4ZPWR 3OV7A 2MHNA 3GIRA 2AZ1A 2Q43A 1NDPA 3ENAA 2DXFA 2D3ZA 3NLCA 5CZVA 4B02A 1IR1A 2QYGA 3A4TA 4C11B 2MKKA 1GX6A 2RILA 3AD8C 2DNGA 3I6PA 4YMEA 5KT5A 3OVAA 3HVTA 3TI0A 3CULA 3IGNA 4PQUB 2X3DA 4Q7AA 3VAMA 1M0SA 1SJ4P 4DPTA 4LFCF 3MM8B 3CCSS 1HA1A 1HNVB 3MAHA 4I2QB 2GMJA 5D8HB 4J5OA 4OMFG 3H42A 4BWJA 3UNGC 4B9UA 1P1LA 3M32A 1SH3A 4PWUA 3K57A 2KVQE 3DRYA 2V2QA 4KFBB 4DUYF 4JV5J 2YKMB 2ASYA 4J9QA 2KKHA 2ABYA 3GCWP 2KG1A 1ULRA 3MFIA 2M88A 4HH0A 1X9WA 3JAMU 1FD8A 3DDIA 2MQNA 3R5DA 4HTIA 3MM6B 1S1VA 4ZKAA 4LF9F 2KM8C 1XC9A 2DNLA 2YNFB 1WG1A 3PACA 2VQFJ 3HHLA 4FKYA 4QYZJ 1O51A 1SJ3P 4ZVGA 2AEFA 4F50A 3QRPA 4N56A 1AZSA 4OHWA 2P8IA 4B9TA 4Q8EA 5C25B 4FS1A 2W4DA 3IM9A 1S7IA 1YZ7A 1ZA2B 1K0TA 1T9UA 3DDNA 3GR0A 4P7TA 1LW2B 3D5MA 2NXNA 4Y2IA 2VUGA 4H4OA 1YBAA 3RBXA 3TO8A 3NY0A 2YWEA 4ZVRB 1RT2B 1NH7A 1WNEA 3OBIA 1FI4A 3A12A 3NOGA 4MKAA 4TLRA 3W2WB 4PXEA 5K20B 4ZITA 4DWIA 3M30A 4LSNA 4CH7A 2UP1A 1V5VA 5EHHA 3HO1A 1UW9A 2FVQA 2R7SA 2MXYA 2CRLA 3AJDA 3BV8A 2C2NA 2HLTA 5HAOA 5HBMB 5D3GB 2E5LF 4QR0A 4Z37A 1TMJA 2LMIA 3JSBA 3W2VA 3TAQA 2OIHA 4FVCA 4JI6F 2AJQA 4LUBA 3GFZA 2HBYB 5FDLB 2CNLB 1EKRA 3BN4A 2WOMA 2UUCF 1RHRB 4QWDA 3HKWA 2J7WA 4R8UA 1CULB 2CNKB 4OYBA 5K8MA 2PMZD 3MPUB 2BANB 1R6YA 5HQLA 5DLFA 2R7UA 1A9NB 1LW0B 3QT5A 2OPRB 3HSJA 2XHCA 2VPZB 1RA6A 2EFGA 2RHQB 2YX1A 3FNNA 4ZVUB 2XWXA 3R27A 3VGTA 2WB4A 3VZHA 2CZ4A 3MHYA 4YR3A 2MQ8A 3CB4A 1VK8A 2RJZA 1DLOA 3FC9A 4F4XA 1XNQF 1VRUA 1RU2A 1Z2ZA 3W3SA 2IPOB 1SKUB 3ET6B 2ASJA 3CD7A 2I9SA 1CQMA 3VQTA 1R8AA 2YH1A 3AHPA 4IRCA 2XB2D 3CJ4A 2LU2A 1ZAXA 4MYUA 1GTEA 5HVFA 1YIJS 1GFWB 1JLAB 3CJQA 4YHHJ 3HVAA 1NJIT 3POTB 3MR7A 3K5MA 3QIPA 1RAAB 3FEYB 5LMUF 1FK9B 1HLWA 1U26A 3MMBB 2V8VA 3GJSB 2B4UA 2BEFA 3LTOA 2Z2YB 5B0DA 3C2PA 2OPPA 3HD1A 2DEIA 1EHWA 2HBRB 4M5NA 3CCQS 2VIHA 4NYPA 2G1HA 4K0KF 2IRUA 3D28A 3QO9B 2DHAA 1UETA 3MUVP 3KUGA 3HVRA 1EETA 3T1HF 2RNEA 1DQ9A 3WC2A 4CLYA 2MZQA 3K59A 4C8ZA 1DHMA 3U1LA 3IWLA 1VRTB 4B9MA 3GP9A 3KXDA 5LMUJ 1TZ0A 2M8HA 4RZRA 4TN2A 1FWPA 3IS9B 1AXQA 3S7RA 4AE5A 3DLHA 1UVNA 4CO1A 2G1DA 1NBEB 4X64J 4PXCA 1TAUA 4DQRA 3I0RA 1AROP 4ID5B 2EFPA 4JI6J 4DV3J 2F9JA 3SI8A 4OLOA 1ZAVA 2IA0A 4KAIA 1JNRB 2DHSA 2N7YA 3NP5A 4P72A 5J1NA 4X4VA 2HURA 3CJ2A 2HWIA 4ED2A 1HYSB 2FHJA 1SQEA 2D1CA 2W4CA 4YS2A 2C3MA 1FDAA 4XO0A 1U1KA 3SCKE 4XTTA 2IIHA 4X62F 2WCXA 3UI3A 3MR2A 5DLGA 4EYHB 2XS2A 2D9OA 2XM3A 3FBCA 2AJFE 3MPWA 1JXEA 1LWFA 4ID8A 2MGZB 2KN4A 1KQFB 2DXEA 1WC4A 2UUTA 1PGZA 4PUOB 1NKCA 4ZP8A 5HLFB 3FUYA 2CJXB 1CBKA 1HD1A 1UPMB 1RT2A 2FJAB 4ENOA 3CCLS 3JAMY 4F4YA 2BRLA 1NKEA 4OYPA 3I5AA 1YDLA 2KB2A 2OH2A 5F9NA 2LA6A 5CZXA 2C3OA 4N41A 3R5GA 2M0GB 4KR0B 3CDAA 3BF4A 4IFYA 4AQYJ 3DLLQ 1YZ6A 2MSSA 3EM1A 3ENWA 4Y28C 4DPXA 2DPIA 3TWZA 4JYAF 1HWKA 4LIRA 5K5MA 3SDEA 5IT9U 2NXUA 4ICLA 2G2ZA 4RNOA 4URSA 2JZ5A 5IOLA 3B78A 5CYMA 4PXDA 4USJC 2VDIA 1S59A 5DM7Q 1U4BA 4MKYA 2GIFA 5L1KA 4NXNF 1NCLA 1SQFA 3CGIA 1N0UA 4AXIA 1SB6A 1IKWB 3VALA 5HK4A 2J9CA 5HMZA 2ZH6A 2B9WA 1SH0A 2FYXA 3MOJB 2YWHA 3R1LA 1NK7A 3KHLA 2WTFA 3Q24A 2DCLA 1UJ5A 2CVEA 3O3LA 4OV1A 2MKCA 3EYZA 3CPWR 2WB1D 4DS5A 2YWKA 1M5OC 2XZWA 3FMWA 3GCXP 2UZAA 3KJFB 4RW9B 3TVZA 4ANDA 1NKBA 2F4VJ 4MT1A 3GWCA 1PIEA 2QA4S 5LMNJ 5ITHA 2Y1JA 1VRUB 3IBCB 5LJ5Y 4ZPAA 4CNZA 3PKYA 3HZGA 3M8SA 1FE4A 3D6MB 3BSOA 2D74B 1T3OA 2YPZA 2C42A 3QYYA 2JLFA 2A2DA 2UVRA 2VQEF 3FQLA 3A8JA 4X65J 2H5JB 3POTA 3BGRA 3QGPA 1TMMA 1CJKB 5GVQA 3FEXB 4L72B 4F3OA 4ILMA 1J27A 3SCIE 2DXDA 2HKEA 3OR2B 4I6WA 3K5NA 4DL5A 3KOAA 2L9NA 3KHHA 2KT2A 2PSZA 3JSYA 1PBAA 4C6AA 1AW0A 3MCMA 1KVKA 4A8FA 3D1QA 4MMOA 3T6JA 3ADAC 1ZYQA 1OO0B 1H73A 4NA2A 1VQSA 3G96A 1UWAA 4DR2F 1V6HA 1R0AB 1FTCA 1M5HA 2V67A 5DDPC 4IRKA 3KJNB 4KHMA 5EUHA 2C1EB 1RU1A 1OSDA 3KLGB 3DKDA 4R0EA 3T9NA 5D6GA 3OTOF 1HNXJ 1QVFR 4P75A 1F5AA 2OMOA 3H20A 4CCHA 2XLJA 2K1RA 2Q6CA 2EFNA 3NGDA 2D3OR 1G6BA 2HRTA 3C16A 4RUHA 5JVGQ 2NZCA 1AUDA 3MMAB 1FXRA 3CJ5A 3TAMA 3CJ8A 4WXWA 4ED6A 2X51A 4Y34A 5KG0A 3TUJC 2ZH3A 5D78A 2BOAA 4ERDA 2IC3B 2VHGA 2E1CA 4GKKJ 1JIHA 2DNKA 3NWRA 3OXFA 1NB2A 3KLFB 1H38A 3LP2B 1X5SA 1J5EJ 4KHPJ 3CCRS 2WBMA 3IBWA 4PWDA 1FJGJ 2KM8B 3E2EA 2JLEA 1QAIA 1VHFA 2AF6A 3PHEA 3G6VA 4WKRA 1MNEA 3DOLA 3MD1A 1RWKB 1SJFA 2C3PA 4WBFA 1N8RT 4KJIA 1SL0A 1WACA 1N36J 3DCAA 3TVYA 1F3VA 2LYVA 1UEUA 2UUWA 3KDOA 4GVLA 5L1JA 1P8GA 4JI5F 3LANA 5I3PA 4O3RA 2M7SA 4FXWA 3HT3A 2MKSA 3EGNA 4OZ2A 5BR8J 2FHOB 2A3JA 5C7PA 2F65A 5LMNF 4ATNA 1PC5A 1YJVA 1ZTWA 1WC3A 4RW6A 3GYNA 2F63A 5A6WA 4DG1B 2I5JA 2RIJA 3HHLD 1VOMA 3DLJA 3EWGA 3H5YA 2W8LA 4Y65A 2BA9A 1N52B 1Q4RA 2I0XA 3EVMA 4NLPA 3BKTA 4CLKA 7FD1A 3OUYB 2BVZA 4YR2A 4O3OA 2Z0GA 2OD6A 4Q2LA 3SYZA 4ES2A 1CJTA 1OJ4A 2DVIA 5GAEU 3M2UA 4CO4A 1LKZA 5E3CA 2P2CB 1IR2A 1FT8A 4CH0S 1VC0A 3U1NA 3AA8A 3T1AA 2F8EX 2K7JA 1DAXA 5DQHA 4PZVA 4URGA 5CABA 2ALZA 2LDYA 4RBUA 1RZMA 2VFVA 4DXLA 4YB1P 4B3TJ 4WE1B 1HNXF 4RWXA 2K2PA 1S1XB 1XMBA 4DEZA 2V34A 3E51A 1S0MA 1Y5LB 2OPSA 2I6WA 1FRXA 2MLZA 3HFVA 1S0VA 4DX5A 2HQ3A 1ITPA 1Y3KA 2Q6BA 2RAQA 3V6DA 1REGX 3C15B 5DRKA 2HNZA 3CJ0A 3EPGA 1G2EA 1SJ1A 2VKZG 4UOGA 3UDVA 3OVSA 3R6GB 3DRSA 1DARA 4ZOSA 2R7WA 1OPZA 3RB6A 2BW7A 4JI1J 1Q78A 1F6TA 1F5CA 3VHQA 1U48A 1T05A 1JMTA 2J9DE 5LL6d 2E7WA 4G1IA 5C2CA 1V3ZA 2XS7A 2G2OA 1UA1A 2P6TA 1WSRA 2V8GA 1TKTA 3QRRA 2HRYA 2K3KA 1CJVB 2QA4G 4QJVA 3B8HA 1NK9A 5EN1A 1DURA 2ZWOA 1DZ5A 1SVDA 2IDEA 1PYOB 4NLQA 4QWAA 1WKKA 1BMQB 4PYDA 2YH0A 2G0JA 4OYAA 1WC5A 4W98A 4ZPCA 3MUMP 3TARA 3S01A 4ECUA 1FDNA 1RTJB 4I2QA 1U1NA 1Q7YT 2B43A 1B0VA 1ZPWX 1K47A 2IYIA 1TL3A 5GMEA 9ATCB 4HT7A 2DGXA 3OFHA 1H6KX 2B8PA 4NXNJ 4DQQA 2FTRA 2NSBA 2VPXB 1IKXA 1JXVA 3S1TA 2BE2B 4ED1A 2NS1B 2QN6B 2W2NP 4JB8B 3QWPA 4DQIA 1M5KC 4K4VA 2IC3A 2DHXA 5LT5A 1K9MT 4LR9A 5F0UA 1WC6A 4I6AA 2ZZNA 2DNPA 2IRXA 2WVFA 4F67A 1BUXA 1U1LA 1I94F 3HHLB 2MQQA 3GIKA 2BBEA 4YHHF 3DOLB 3PIPQ 2W7PA 2YNIB 3GLJA 5KFRA 2AYEA 1RT1B 4KPYA 3I5CA 5KFDA 4X4TA 1X7VA 1T7PA 2MQOA 1UW4A 4JI8J 1MMNA 2FJBB 3GJTB 4PCQA 1TELA 3VF0B 3MEDA 1HHQA 3B4DA 4W4MA 1LW2A 1SQGA 1FDBA 3FKBA 2HG4A 3MM9A 3RBZA 4B08A 3R6LB 4DR6J 4DR3F 2HNDB 1IWAA 4RW6B 2ALYB 1SV5B 2FGCA 4RKUC 1N5YA 3W66A 2AYMA 3D3BJ 3R5JB 4IRDA 2BW2A 2UV8A 3JYTB 5KFZA 3DLGB 1UP1A 1ZTTA 2X1BA 3LAMA 4I68A 3CJTA 2RQCA 3MPDA 4KQZA 1HQEB 2KTQA 4WFZA 3RZAA 3HX9A 2QRRA 3BBBA 5D0HA 4DL0C 3KLEB 4YB5A 1UVMA 3T5KA 3VAFA 2B5JB 3I96A 4LRDA 5GAHI 4AL6A 2UXDF 1X4EA 3G6ES 2IM2A 1YJ9S 5IZHA 3GV5B 1XMOF 2KFNA 1HARA 3GYXB 2JOQA 4IG3A 2WSFC 1YRTA 3HMJG 3IC1A 4K4YA 1S9EB 3PZPA 3W9JA 4DSIA 2HGNA 1LW0A 2HRUA 2OPRA 2CYYA 5ETTA 2CJBA 2C2OB 3DXSX 5ETVA 4HHUA 3ENVA 2QJ3A 3DLEA 3PJ9A 4GVBB 3PM9A 4WYWA 2YVSA 3J81j 1UVJA 3OTDA 3FVYA 2ZH5A 1MU2B 4DR3J 2D7SA 2M4MA 2XMVA 2NUUG 3LP1B 4RNMA 1NLKL 4NASA 3IRWP 3UCUP 4EO6A 2HNYA 2HVHA 3KK1A 4OZ1A 1FRJA 1CS4B 3MTJA 4DS4A 4JI3J 4KH0B 4CRJA 3Q8QB 4DL2A 5DDRC 4U7CA 2VICA 2DR7A 2UUCJ 5LXYA 3V2UC 2HHVA 3UNYA 3J7YU 3PRDA 4NLWA 4ZIWA 4DFMA 4M5MA 3PW5A 1BHNA 2DH8A 2F3JA 4OYIA 4U9RA 4O3PA 1U47A 1Q5VA 2CA9A 3D1OA 3NAHA 1FK9A 3MMBA 4P2XA 4F0KA 4YOEA 3N5BA 2W1BA 2YWFA 2XMAA 1IJFB 5CQGA 3DM2B 5HP1B 2B9EA 4GRSA 3LO3A 5KFJA 5IWAF 2KRBA 2NUHA 3FFIA 2E5GA 2DBBA 4DFPA 3X1LB 1SCJB 1HPZB 2ZDOA 1U09A 2M70A 3W8PA 5H1SV 4RW7B 3V6JA 3V81A 5L9XA 1RWVB 2N3OA 4ECWA 2BR0A 3BREA 4QR1A 2WHOA 3ILOA 1TL3B 2E9TA 3IWNC 3QWUA 4U6PA 3BBCA 4RNNA 3NCRA 1RT6B 1H2UX 2LXFA 4OJHA 1N33J 4KY3A 2CQ2A 5G0RB 1VQNS 1VBKA 2FJXA 1BWVA 1WG5A 3H5UA 1UA0A 3CT9A 3VAKA 2BMBA 3PX4A 2JH3A 4FYWB 2HFNA 1NNDA 4TVAB 3BN7A 3GV7B 1F60B 4CO5A 3ETOA 2VC1A 3M8QA 4LIWA 2Z58B 3VV2B 3RRGA 4FF4A 2MDAA 2RS2A 1QUVA 3Q8PB 3U02A 2XO6A 1RT1A 2JNJA 2WONB 1D0EA 1XN9A 3EXCX 1HHSA 3KNGA 2HFZA 1W25A 3CTRA 2V6AA 3BR8A 1HBMA 2IYGA 3KLIA 2MY8A 5KFTA 1RWUA 2KL8A 3GR1A 1WKLA 2GIRA 4KGVB 4N8NA 3AQOA 3BQ2A 4ECZA 3BSNA 3WC0A 5HLFA 1RTHB 2FQQB 5IQQA 3ZTQA 1UWBA 5C42B 2EC0A 2M52A 4U8VA 5KFYA 3BO4A 1N32F 3C8YA 1C0UA 1R8PA 2W9AA 3P5BP 2EFVA 1QSYA 1MW7A 1HBUB 1KHWA 1VCTA 1Y11A 1RLCL 2K3IA 3IG1A 4IFYB 4NZ0A 1E6YB 3SIPB 2FVRA 2V2ZA 1FDDA 1HWJA 4ER8A 2UU9F 4CLUA 4XIUA 2UXBF 4J9MA 4CH1A 2HLUA 4LRBA 2XY7A 4ICLB 2DTJA 3MPYA 1YJWS 3H2UB 1HWUA 1VQ7S 1S7HA 2EK1A 1WD6A 1RSCA 2G13A 3CDUA 3CDEA 4JV2A 2L9WA 4LR8A 3ZC4A 3OJUA 1URRA 4DV1J 2VG5A 3KG1A 2B51A 3PO5A 2A0FB 2E66A 3DFEA 4LF5J 4KRWA 2HHXA 2BDPA 5DQGA 2VFUA 4UT4A 3CCTA 5L46A 2R2UA 2ATLA 4ECQA 1VGYA 5D0EA 3OTBA 3IFEA 4ZN1A 3H7HB 4LFCJ 4OYZA 1MG7A 4LF4J 3TAPA 1FO1A 1F2HA 3PJXA 4WTOB 2QV6A 5K8NA 1KWMA 4A8KA 3KK3B 3HK2A 4OI0A 2E1RA 1L3SA 1RBAA 1NPKA 4U96A 5K9FA 4OYOA 3DDKA 3P6YC 4DMZA 2CNOB 4RPFA 3MR6A 4J9RA 3LGNA 4J9OA 4J9LA 3CJKB 4RX6A 4LF8F 4LBIA 4LBPA 2XMTA 4WIIA 1RT4B 1EP4B 2VG7A 3CC2S 5HN0A 1QE1B 3ULHA 1WF1A 2FPHX 1W2IA 3D68A 4V19J 2E9RX 4LVOP 2IAJB 1JLFA 4CLFA 1TK8A 1KQKA 4X4QA 4DX7A 1FNOA 5DDQC 3PX6A 4IOCQ 1TFYA 3TJ8A 2MMYA 1Y00A 3D4JA 2NCKL 3MMCB 3TEGA 3LOUA 3NS5A 3V4MA 2H65B 2Y8YA 1NUEA 4ECTA 3BSAA 4G1PA 5L9NA 3EVOA 2VONA 2BKPA 1MROA 2HHPA 2ZKUA 5H9EJ 3NRBA 5D15A 4BS2A 1RA7A 3HPOA 3EUNA 2HQIA 4FDFA 3FCHA 3JS9A 4KKOB 2FJEB 3R7BB 2B7CB 5CD4A 5C2GA 1UZHA 4NRTA 2FDNA 3FFIB 4NL5A 5IV3A 4LR7A 3BJYA 4NXMF 4I67A 2FZCB 3C14B 2FGOA 1GAOA 1PYTA 3D67A 4FYYB 5KG4A 1VQMS 2OD4A 2W2QP 2B0GA 2D3O1 2MQPA 4LF2A 1S6UA 4C8MA 4D3GA 2QSWA 2F4FA 1PJ6A 1JLCA 2VOOA 2IMOA 3T6BA 3AD9C 3HHEA 4L6V3 5DGBA 2KZZA 4P2MA 3T1YF 1R27B 2ZE2A 4D3HA 1TK5A 2KXFA 3TA2A 4QWCA 2QLBB 3KLFA 3LP0A 1RAFB 2GQQA 3LH2S
chains in the Genus database with same CATH topology
1JKHB 4ECXA 1S1TA 3NAIA 4LF5F 4TKTA 1HNWF 1HMVB 3M8QB 1N54B 4TYAA 4MIAA 1YVFA 3NBPA 2OTLS 4G1QB 1N33F 4IDKA 1S9FA 3H5XA 5J2MB 1Y0HA 2OSQA 3I5BA 3I82A 5B7WA 4B9VA 1UWBB 3RAMA 1VS3A 4OQJA 5KFBA 4NOHA 4IUFA 1X4CA 3CXCR 3IWXA 4OLPA 4O3QA 2VASA 2ZFHA 1XTZA 3I9ZA 2WBRA 1NK5A 1REVB 2YY3A 3OUYA 1SKSA 3ISNC 3D0GE 5CH7B 3SV4A 2MSTA 2LQ5A 3ENQA 3ICLA 2XSJA 4ZP7A 2V4QA 4DHVA 4Y00A 4J37A 2QFJA 2E7XA 2MQMA 2VBWA 3M2UB 2JEJA 3IR5B 5KFSA 1ZZFA 4Y2CA 2ZH7A 4F2RA 3QIDA 3BO3A 2KG0A 2R9LA 1N34F 3US5A 4JV0A 2DNHA 4FP9A 5AXKA 4ECWA 3NCPA 5F8HA 2GMLA 2YWGA 3OXGA 1NK4A 2J0SD 3DN9A 1T03A 2BJDA 5JJBA 2BQRA 4WZMA 4QWBA 3RAQA 4DSJA 1KNZA 5IM0B 2MB0B 4NRUA 1SBRA 4PPZA 1N4LA 5LJ3Y 4HYKA 3QAUA 3CVKA 4R25A 2KT5A 2QMWA 1TL1B 4QW8A 1EP4A 3GFHA 3DRSB 4C11A 4CT8A 6FD1A 2DGUA 2GX8A 3UFCX 3LWLA 2V2KA 2IAJA 1IR0A 1JLFB 4MK8A 2FLNA 1YHQS 2YKOA 4X4PA 2AGOA 2J0XA 4NLSA 4QPXA 5K14B 4DBQA 4E8UA 1DJ0A 4IKAA 1BD6A 4OI4A 1FA0A 1SKWA 3G4SS 1XMQF 3P3DA 2R8HA 4DX8H 3Q2TC 2MKHA 4HLBA 1Z4UA 1WHYA 1U6ZA 4KGMA 4MFBB 3R1HA 3BGUA 2FIUA 4DSEA 3DRRA 5KOXA 2MYFA 3DRPA 3CC4S 1X5PA 4Y3CA 5K8PA 3PY8A 4EEYA 2KI2A 2M5YA 3G86A 3DI6A 4OHZA 3T19A 3PNIA 3L7PA 2ZJQQ 2JLGA 4DLEA 2ZH9A 3BS9A 3DLBA 2ZZMA 4K5SA 1KD1T 1Q8IA 5BR8F 4Q2MA 5B0FA 2GQCA 2CPDA 2GC8A 4I64A 1HQUB 5T7LA 5B0BA 1SUQA 2KHCA 1OPIA 4MK9A 2YQ3A 1QTMA 3UQSA 4QIFA 1FRIA 1U25A 3LALA 3NCQA 4QW9A 2HHSA 4Q45A 2QZ8A 1X4FA 1TKZA 3J81Y 3DLKA 4OI2A 5JUMA 1AFIA 3L3CA 1R89A 3NS6A 2ROEA 3OL7A 2VKRA 2J9EA 3RBDA 1FRMA 1S9GB 2R4FA 3M8PB 5SUHA 3W2VB 3MUTP 4IDKB 3UWTA 3G6YA 1JK9B 2EWHA 5L8RC 1XEZA 4DV5F 4ETXA 3I56S 4ELTA 5FDLA 3BQ1A 1HL6A 3C6TB 1SJRA 2HNDA 3PFEA 4F4WA 4DF4A 3FSXA 4WFAQ 1QUPA 4KBIA 2BANA 3JYTA 2XG8A 3DLGA 1HNIA 1GQEA 1NHVA 1X4GA 4IFVA 4XAKA 5E41A 1N6QB 1LFWA 1RQ0A 2L08A 4AL7A 3J7A1 4DQSA 3H4BA 2VA3A 2HS3A 4K2XA 5KG7A 1VQKS 1FKOA 5AE1A 1U7LA 4X64F 2V9WA 5J2NB 4RU9A 4IG3B 2MKIA 5FLXY 2V4RA 4JI3F 2KO1A 2IVFB 1IJEB 4RNFA 1Q1KA 1WF2A 1S99A 5E2QA 1T03B 2CVIA 3RB3A 2FVCA 4PRFA 2LA4A 3K7RA 1UFLA 1ZM4A 2CG4A 2BACA 2JHEA 3LP1A 2KM8C 1VJWA 5DQIA 2RS8A 2V4JA 3MM5B 4WFBQ 4B3OA 3L95X 2VD3A 1UEVA 2CQ0A 4DFKA 4JV1A 4PPDA 1E6VA 1L3KA 4OZ5A 2B9XA 2EG2A 2DRBA 4V19X 1KLMA 2LEAA 2L9DA 2CJKA 4DR4F 2HGLA 1WTBA 2C28A 2F4VF 3F56A 5JVHQ 3SXLA 4KIAA 4B3RF 5DJBA 2R7TA 2OMLA 1FRKA 4PUOA 1TR0A 4O4GB 2R2TA 2KYXA 2OPQA 2XSFA 1ROFA 2F1FA 4X4UA 5J2QA 1X5OA 3V6KA 5F8NA 4YB7A 3K5PA 4C0OC 5KFMA 1S49A 1WELA 3I0RB 4GKJF 1OIAA 3SQGA 4WXOA 3BGFA 3AJ2A 3DRRB 1HPZA 4OI3A 4M8LA 2ADCA 2IJNA 3O6QA 2HIQA 1LXJA 2JC1A 4RW7A 4OX7A 3NMRA 3I4PA 2CZVC 1UJ4A 4A8XA 4NCBA 4AYBD 2DIVA 2RF2B 2W9BA 3CC7S 2M8DB 3HDSA 5A6PA 1S6PA 1FCAA 3R3TA 4MH8A 2N3LA 1NJYA 2IFXA 5ADZA 1X5TA 3AB4B 2Y1RI 1UVKA 1VMBA 5K8OA 1Y9OA 3QLHA 2RU3A 3PFOA 3VCDA 2W9CA 5L1IA 2RMLA 1NK0A 1IQZA 3DLKB 3FSYA 2BXJA 4P2SA 2P6SA 2OO4A 4X84A 3HF5A 2N4DA 2P9CA 4G3IA 4I7FA 1RTHA 5HO4A 3CCWA 2AW0A 5C42A 3IGVA 1Y5IB 1U49A 3GG0A 2DNNA 5MAOA 4QU6A 1HI8A 3IG1B 2AU0A 2QLXA 1BQXA 2LEPA 1C1BA 3OFGA 3OTEA 4TXSA 1KEKA 4YB1P 1B7FA 3K5LA 3UCZP 4H4MB 2HHTA 3QJLA 3DNCA 1D9AA 1B0TA 1NEEA 1PC4A 1NJZA 2VA2A 4YQWA 1M1KT 2VFTA 2VPYB 2BRKA 1Y4ZB 3MCSA 1LK5A 1N88A 4F02A 5KFWA 4ELUA 2GGPB 2D41A 4NLDA 1RTDA 3M1VB 2AX1A 5E3PA 2EVZA 2XS5A 2LLZA 1TL5A 3C6UB 1YRUA 2BM0A 1BQMB 2E44A 4LT6A 4WF9Q 3JB9k 5KT3A 3NWGA 1J5OB 5KFVA 1M90T 1C4CA 2P5VA 2WSCC 4CO3A 3PR4A 3ZZPA 5FIIA 4TYBA 1S77D 1QE1A 4QR2A 5C24B 4NZ6A 4Q5VA 3NL0A 4YUDA 2HAIA 2UUBF 4NCGB 2DT9A 1VQ9S 3HJFA 3EGWB 2ERRA 3MMCA 2UV8G 5EWGA 1FEEA 2C22A 4I2PB 1HR0F 3FDSA 4JI8F 1Y3JA 1SIWB 2RUGA 3O2IA 4C7QA 3Q2SC 4XK8C 1R8BA 3QJJA 1F2GA 1X8DA 2RDJA 2V8DA 3LAKA 1RTIB 3DOKB 4CTAA 2EPIA 4GO7X 2BYCA 2XO7A 2ZD1A 4ZP9A 4PG7A 2FLPA 3KMQA 3MM6A 1S1VB 2YKAA 1RT5B 4B3SF 2JX2A 1JJ4A 2KU7A 2W9BB 2CPXA 2CQ3A 3CCMS 2CQ4A 3D1HA 4DL7A 4EU0A 2N4CA 2E1AA 3RW6A 3SSRA 2KT3A 2ZE2B 2VH7A 3JSMB 5LSLA 2AGQA 1UJ6A 3HXMA 2F8HA 3THPA 2Z8QA 2BQ3A 1Y7PA 2BZ2A 2I2YA 2XY5A 1YWXA 4M1KA 4R5PB 2AP6A 1P1TA 1MMLA 4QPTA 2CQHA 3PW7A 4G1QA 4ZHRA 4GO5X 1VQ4S 2HHQA 4NLXA 5THWA 4I7FB 3CE8A 3DXBA 2XMKA 4O4RA 4ZPDA 4QOTA 4AQYF 1XERA 1VIOA 2FVPA 3SFUA 4ZPBA 5A8RB 2X1AA 3OW2R 3NG8A 3NMAA 5FD1A 3BR9A 2XMJA 2YKQA 3K5OA 3CEDA 5CYJA 2KH9A 3CCVS 4IO9Q 2RDIA 3TQ1A 2DR8A 2FC9A 1JB0C 4WE1A 3C46A 5IT0A 3BB5A 4LF6F 1Q16B 4ZA1A 2LECA 1VIXA 1JWWA 5B0CA 3G71S 2F7VA 3DU6A 3DMJB 3O1LA 3OHBA 1VQ5S 1BWEA 4OJ3A 4L3NA 1SL2A 3N79A 2XBPA 5AXMA 3UDLA 1GT8A 2FY1A 1ZM3A 2ZC4A 3IXQA 2COLA 4QCLA 2V94A 2IBKA 4WYLA 4KV8A 1FXLA 3OQ2A 2PA3A 5HROB 2BUNA 5AE2A 2HZCA 2EFQA 5C5JA 1Z1ZA 3GFXA 2EK6A 4PG5A 4ED5A 1BQMA 5HMXA 4DOZA 2DNOA 3EXYA 5KAKA 1ZM2A 4BWMA 5A0YB 2FUG9 2DO0A 4NX9A 2OFGX 3UW1A 2OPPB 4JI0F 3ZZTA 5DG7A 3CIZA 1QSLA 2O3DA 2NSCA 4IOBA 3KTQA 4C8OA 5F3ZA 3J7YI 1KVIA 1O5JA 1BQNB 5EX3A 3DYAB 1HW8A 2JL9A 1U1PA 2J7KA 5E7OB 3VAHA 4WK3A 2CQGA 1N5QA 2FC8A 4RW4B 1HI0P 2GCFA 1Q53A 4CIOA 1VC5A 3M6WA 1T95A 2OJ3A 4X4NA 2V5HG 4B3MF 3I4HX 3MF5A 1RTIA 2AX0A 3DOKA 3SEOA 2MZ1A 2BQUA 1KC8T 2CPYA 3LQVA 2E5JA 2C2EA 1HHTP 5L38A 3QGIA 1YTYA 4A8OA 3RB4A 3VAJA 4HI2A 3H25A 2R8KA 5I4MA 1C4AA 5M2PA 1Q82T 1HD0A 4HTJA 1QAXA 3JSMA 4Y2MA 5T7LB 4U67Q 3I31A 2FJDB 2OKQA 1H7XA 1XK8A 4CO2A 4WKYA 4NA3A 3M6UA 3P5TL 3SSQA 1DTQB 4ZCMA 4ED8A 2OLWA 3G8SA 4DV3F 1G7CB 1X0PA 2AJ1A 4A4JA 1KLNA 4HKQA 4LF4F 2OTJS 1NJXA 4R5PA 5EX0A 1L5UA 1NJWA 1YJNS 2WK4A 2KFZA 5CA5A 1MMDA 3MPVA 3PEHA 3O8WA 1HQEA 5KG2A 4RNHA 3R5AA 3HP6A 1MWYA 2R7OA 4XDDA 1R43A 3BO2A 5CYMB 5DS7A 4KO0A 3PRBA 1TVRA 4PG6A 4IH6A 3I0SB 4E98A 2X1GA 1IKWA 4URQU 1SJQA 5D4OA 1S9EA 4UOCA 2LKZA 2DNMA 5IFMA 4RLEA 2R2RA 3DOMA 5IT4A 4B9NA 2N7CA 3LWMA 4F3MA 1QAJA 2W7AA 3DLEB 4ECRA 1VBYA 2I8EA 4BC9A 3DC2A 3HHDA 2XNQA 4ZCIA 3DMJA 4ECVA 2FD2A 1N36F 2RD5C 4TU8A 4QIEA 3HM9A 1VQYA 1WI6A 2UXCF 4OZLA 2CPZA 2HGMA 1FJGF 5KFXA 2QA1A 4FZVA 1RDRA 1QSSA 2QLWA 4R0JA 2E9ZA 4C97A 2E1MC 2C3UA 2VBXA 5F8MA 3ZZRA 3H40A 4I56A 3CD6S 2CPHA 4RW8B 3NGKA 3RYLA 4I6YA 2UVWA 3MURP 2DGQA 3M6XA 1YITS 2OFHX 5A0YA 3EZUA 5E33A 2V4JB 3MM5A 4B3OB 2XEXA 2PE8A 4Y0FA 2UUAF 3DM2A 4AUKA 5AXLA 3N01A 4UQGA 2AGPA 5T14A 2IMWP 3N0VA 3G9CA 4Y2KA 2B4VA 4NA1A 3OFEA 2FHJD 1HNVA 1R3NA 2IRYA 4RW4A 4RBVA 2RKIA 3WX4A 2V8HA 4EYIB 2HHHF 2K1RB 4LMZA 2JRSA 3N9UC 3P96A 3PR5B 1LWEA 1SI9A 3AAWB 5A2QY 1AFJA 2O01C 5DDOC 4ILRA 4DV1F 2EFOA 3K2YA 4P7VA 3SQGB 2YKPA 3TW0A 1VLYA 2KXNB 3C3LA 4KHPF 4YY3F 3C66A 4GC6A 2IVMA 2W7OA 5DM6Q 1XBWA 2DIUA 4PWDB 3BSCA 4EGLA 1LV5A 5CXTA 4K4ZA 2W8KA 2JVRA 4FN5A 4ZCLA 2CPEA 2LCWA 1S6PB 1KOHA 3ZFVA 5KFUA 4XPEA 2CQIA 1DTTA 2F9DA 2NYIA 2ZJPQ 4KGKA 2VPWB 3H98A 2GHWA 3LPYA 5KG5A 3MMJA 2HWTA 1FE0A 3QLHB 2W9CB 2GIQA 1I1GA 5KT7A 4DR6F 1Q8BA 1IQTA 2VL1A 4PG4A 4K50A 1HWIA 2I5JB 3TYTA 2MJUA 2XI2A 4TU7A 1U6FA 2J6SA 1E6YA 1PSDA 3IN5A 1KQGB 1RT3B 2MJNA 2VBZA 1FXDA 2J9DA 3MEEA 1DQ8A 2B7BB 4H54A 4WFXA 4EBCA 1QM9A 1D1UA 2J7UA 2DNQA 1DFDA 4TY8B 4KO0B 2GQ2A 3OR1A 4LSLA 2WOMB 3FSIA 4NLGA 2YNHA 3KNAA 1WG4A 3PW0A 1S1UA 4YEAA 4N8OA 1A7GE 1HBOA 4GC7A 2QSFA 3OVBA 3O44A 1VBZA 4YP3A 3MEGB 2IA6A 5M2UA 5KFFA 1T02A 1DLOB 5GAHU 1YJTA 4YFUA 4CQ1A 2FJVA 3MR3A 2VG7B 1UAWA 5J1PA 4PQAA 2DGVA 2YKNA 4WFYA 1W2BR 4QIWD 3TA0A 5B0GA 3U1MA 3GIMA 1T3NA 3QIPB 4MKBA 3CMAS 5I3UB 4PXBA 4HI1A 1SXLA 1TKTB 4W90B 4FBTA 3AQPA 2ZHAA 1DRZA 3MM7A 2DGWA 3TP2A 1QY7A 2AD9A 4ZPVR 4QWEA 1A6LA 2ILYA 3CDBA 5KFAA 5C24A 1L3TA 2PO4A 2VC0A 1IXKA 1EETB 3QZ7A 2RB7A 1GXTA 2MHEA 5HQ8A 1JLQB 3N4WA 1RTJA 2FLOA 4KJIA 1VRTA 4H4KA 1UL3A 4M63A 3RB0A 4ALZA 2PIIA 4IO1A 1T8EA 5DETA 1F5BA 2LVWA 1TV6B 1LWEB 4DR1F 1JLCB 3W7BA 1RAJA 3CWJA 2DGSA 4KC5A 3RTVA 1F0XA 2ROPA 4ID5A 4X65F 3PIOQ 3EPIA 1Q8LA 1U8SA 2ZD1B 3LW5C 1D9FA 3TUZC 5JXSA 1JKHA 4HDGA 1H2TZ 1UA0A 1D8YA 2JC0A 1FESA 1QJHA 4BC7A 3PV8A 4OI1A 2L41A 5J1EB 1C1CA 1V9OA 4CT9A 1YQHA 3DRXA 5IS2A 2XLKA 1RKIA 5J2MA 4ZK7M 5D77A 3T5JA 2ZHBA 1SKRA 2LQ9A 4K5RA 1K8AT 1GNKA 3KK2A 3KG0A 3IO1A 4ZVFA 1N5YB 2DD8S 1F9FA 3BM7A 3MZIA 5E5NA 3FZBA 3UCGA 2B9YA 3A8EA 4B3TF 5J2PA 2J6UA 1RT3A 2RU9A 4IOAQ 4K4TA 2DH7A 4O44A 4HDHA 3MEEB 2XSJB 4NYZA 2RT3A 4PKDB 2X3GA 3N6NA 2BOPA 3BDEA 1NAQA 1ZBTA 4EO8A 1FTRA 3UE2A 3MAQA 2W24A 1FF2A 1JNZB 4Y2AA 2Q79A 2ZBCA 2FVSA 2YNGB 4FBUA 1S1UB 3T5HA 3V5RA 1WHXA 1S79A 2ZM6F 2R8IA 2DISA 3H4DA 2NQPA 4Q8FA 3WDOA 4DQPA 4DLGA 4MYTA 1QVGR 4IYQA 4O23A 1Q79A 4EBEA 5IM0A 3H5SA 1X4DA 3JTPA 2DNRA 1FEHA 3RAXA 3RR8A 2LQJA 2VQFF 2HNYB 1TL1A 3K8VA 4EBDA 4FNIA 3THTA 4CNYA 4A8SA 4HEA9 2PI4A 1VQ6S 3IA0A 4J9PA 3BGRB 3CIMA 5KG6A 3T3FA 4IG0B