4QIFA

Crystal structure of pdua with edge mutation k26a and pore mutation s40h
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGHGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural protein
total genus 21
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qifA00
3I6PA 3I96A 4QIEA 4OX7A 3CIMA 4RBUA 4OX6A 3SSRA 3BN4A 2A1BA 2G13A 3MPYA 3NGKA 4OLOA 4P7TA 4RBTA 4RBVA 4P7VA 3MPWA 5DJBA 4LIWA 2A10A 4QIGA 3DN9A 3H8YA 4OX8A 3VCDA 3CGIA 4OLPA 4AXIA 3NWGA 4PPDA 4QIVA 2EWHA 3PACA 3DNCA 4QIFA 2A18A 5L38A 3IA0A 4AXJA 3SSQA 4P2SA 3N79A 3SSSA 4DDFA
chains in the Genus database with same CATH superfamily
2QC3A 2E5JA 4OI0A 3AB2B 1ZETA 1P27B 1UW4A 1K47A 2ZBRA 1ACMB 4I1TA 2BANB 2LQBA 2UU9J 3W63A 1N0UA 1IBKJ 4WKYA 2N4DA 3GIMA 4OYXA 2YKMA 1S9FA 4BC7A 3G86A 2XCPA 5HK4A 1X60A 3UDEA 1N54B 1U25A 2A2DA 3CVKA 4WP8A 2VJVA 2KHDA 3TUIC 1AA1B 2QA4S 3THTA 1S1XA 1WDTA 5KFOA 1JLAA 5FJ4A 3JYTB 1WOPA 2C2OB 1NDPA 5CCMA 4N41A 2PT0A 2YKPA 4RZRA 3K5PA 5LM7E 2FHMA 3AQOA 1DQ9A 2M0GB 1NH7A 2QYCA 4RPFA 5IV3A 3TAQA 2LXFA 1HIYA 1IR2A 3VAJA 4YN3B 1HYSA 1NRKA 3TA0A 3TZYA 3R6GB 4G1QB 1VCTA 1YZ7A 4DS4A 2QX0A 2EC2A 1T05B 2LEBA 1IQZA 5I3QA 2LEAA 1Y5LB 2Z30B 1KC8T 5M2RA 1IBMJ 4E0DA 2V9KA 1Q8IA 4ZJQA 4ANCA 2DRAA 3E2EA 3J7A1 5DQGA 2ZWOA 1FDAA 5HQMA 2ZH8A 3W61A 3VVUA 4JI3F 2WOMA 2HEKA 5H1SV 5K8NA 4CLTA 3JSMA 4RW9B 4Q2MA 5F8JA 2XMTA 1HNXF 2ZHBA 2HK2A 4X4PA 3W2VA 4FYDA 2LQ8A 2E66A 3ELHA 2MY7A 1Q7YT 2I6WA 4DFKA 5A8WB 1UJ6A 4DFMA 1RT6B 1V3SA 4WK1A 2Y8YA 4RJVA 1VQOS 1PBUA 4FYYB 1RA6A 4DR2F 2MEWA 4DUZF 3C15B 3HHLC 3H2LA 3M8YA 2CNLB 4GMKA 3IC1A 2VG5B 3MTKA 1BC6A 2E5IA 1R8PA 1UJ5A 3DRPA 4ZMMA 2O67A 2RUGA 4FKXA 1K44A 5KG3A 1WOOA 1C1BA 1NPRA 2RKIA 4NLDA 3JQMA 2XC9A 3W5YA 3HSGA 1E6VA 4C3LA 4N8NA 3ILIA 2ZNZA 3AJDA 1FF2A 5BJRA 3W8PA 2D3OR 1HLWA 2E9ZA 1J5OB 2VG7B 1U45A 1OJ4A 4LF8F 1K9MT 5GAEU 2GNKA 3RBEA 3W64A 4A8OA 4RUHA 2NS1B 2OMLA 7AT1B 3AT1B 2YNGA 1CJVB 2R8IA 1NSPA 3US5A 3KMSA 1SH0A 1EP4A 2YWKA 3KOAA 2BR0A 4TNOA 2AGQA 2P6TA 5IWAJ 2VPWB 2ATCB 3OPKA 3VGUA 4DPYA 1VYAA 3IWNC 1VFJA 2O1PA 1V5VA 4DUTA 1RT5A 4C0OC 2HIYA 4KQZA 1SBRA 2G1DA 2ADCA 4FPIA 2X1FA 3BGLA 1ZBTA 3MFHA 3CJ5A 4F4YA 3LPYA 3J81Y 3PJXA 1LEOA 3Q8YA 4ED3A 1VQ5S 2LECA 1KEKA 2NR0A 1AUDA 3CJKB 1FNMA 2ZOFA 4DX5A 4KAIA 2QFIA 4OYAA 2GGPB 1S6PB 1VRUB 3C14B 1PAUB 3LF0A 2DR7A 5KG7A 3WQPA 5KG0A 2XSJB 2RHQB 2V5HG 1PCAA 2R8GA 2NSBA 4DUYJ 3AOAA 4Y2AA 2H54B 4DV2J 2R7WA 2JOQA 1S9GA 1AZSA 4EMDA 5DQHA 3IR5B 4JI1F 2A18A 3UNYA 3NGSA 4DX7A 1X9MA 3QWPA 1X5OA 1FDNA 1HNZF 3PEHA 3P4UB 2MKCA 4X4QA 2CG8A 1W26A 2BKPA 3I0SA 2VQFJ 1FDDA 2KM8C 3NGTA 4ED1A 4PUOA 3N6MA 1CJTA 3NL0A 3IGVA 1AB8A 1SH3A 2BW7A 4J9KA 3DKDA 2CYYA 1NHKL 2AJ2A 2I9SA 1HBNA 4URSA 3F0NA 4IG0B 2CPJA 2ASJA 1N32J 2ZDOA 4ZDNA 4WYLA 4LF7F 5AXMA 3C46A 1ZPWX 2K1RB 4Y2MA 4OLPA 2P2CB 2ZEJA 5FLXY 1CJUA 4K50A 4RUAA 2YNIB 1U1KA 2DY9A 3P5BP 1RE1B 2EFPA 2F7VA 2RS8A 4DJBA 1BWVA 2OD4A 1L5UA 4K4VA 2J7KA 2G2ZA 4OYBA 3CSKA 2HNYA 3GTYX 2L48A 5KFSA 1UKUA 1TK0A 1RDRA 3CE8A 2UVWA 1IJFB 2HZVA 1LQ9A 5DG9A 2IJFA 2NPIA 4KH1B 3R8YA 3PHEA 2W8LA 3AY0A 5KFNA 3W2WA 2Y8WA 2YQ1A 5E7OB 2MJUA 4OYZA 2AYBA 4Y2KA 3QJJA 4B3SJ 4ED0A 2CPZA 3DLKB 3R5BA 3BR9A 1OSDA 3I31A 5F8HA 1R0AA 2VQEF 2CJKA 3T1AA 1H73A 4E2FB 5MLCV 1RA7A 3E8OA 4RO0A 3THPA 4AL6A 3G6VA 1YIJS 3M32B 4D3GA 3MMBB 1AUSL 3TQ1A 5LOQA 1EAYC 4KFBB 4M5GA 4LF5F 5A6WA 2MQMA 3MWBA 3QGHA 3SZ2A 3OXFA 2PEBA 3ENWA 2RB7A 3J80Y 1XQIA 1F2HA 2I5JB 2HVEA 4KY3A 4QIWD 3Q8SB 2V8GA 2KXNB 3CJ3A 3KK1A 3PEJA 4KH0B 3VAGA 1G2EA 2MLZA 2C1EB 2JZ5A 1L3TA 2X7IA 4IUFA 1ZAWA 2AJ4A 4NLGA 2BACA 2AJQA 3ONQA 1ZM2A 2MHNA 1I94J 3R1LA 2G1HA 4Q7AA 4LF1A 1VC0A 5K20B 2HGNA 4ZIVA 4EO8A 2IDLA 4UOCA 4B3RF 1S1VB 1HQUA 4YB1P 3R7BB 3H25A 2M8DB 5T41A 2FLOA 3GILA 2XB2D 3OLAA 4IFVB 3IGNA 1IM6A 3THVA 3LP1A 1YWXA 2DH7A 5A8RB 1A6LA 5I42B 1Y3JA 1C0UB 4ELVA 4PWDB 3HZGA 2XI2A 3CO0P 1KQSR 1Y3KA 5EUHA 1RAIB 2W9CA 1JJ4A 3UFCX 3DDKA 4KHMA 4LQ9A 1HHTP 4I56A 2WB4A 1EIYB 1NEEA 4L76A 1DBDA 1P1LA 4OI3A 4N76A 2B6AA 4I2QB 3FNNA 5F0UA 2HHHJ 4C0BA 2ROPA 1S6UA 1VGYA 4USKA 3PIPQ 5AXNA 2HPUA 1SPBP 3EWGA 1FE4A 2UUAJ 2HFOA 3U7JA 4TU7A 1UEKA 3C16A 4ER8A 3KLEA 1U1QA 1J5EF 5LMNF 2QG9B 1C0TB 2J0XA 5HSPA 3PW4A 3V4MA 2LQ9A 3D67A 1GNKA 4L3KA 1R8HA 2W9BA 4HTJA 4QIFA 3QIPA 2I0XA 2DR9A 2B56A 3MMCA 2NYIA 2FVCA 1B70B 3KK2B 5EDWA 1BUXA 1HBOA 1TKTB 2DEIA 2V4RA 2V34A 3OXLA 5KG5A 3WDOA 1B0PA 2O5DA 3ZNJ1 4B9MA 1TK8A 1E6YA 2XSFA 4HTIA 1RWUA 1DURA 5EX0A 5AE3A 2RT3A 4QU7A 4C8YA 3PFOA 4GO5X 2YKAA 4RW6B 1MN9A 1GAOA 1NPKA 4DV0J 1Q1KA 1JLFA 3G8QA 2BW2A 3DDIA 2ABYA 3CCMS 2V9WA 4OHXA 3PHTA 1TTHB 4O3RA 1T9WA 4G1PA 3Q8RB 1WWHA 2DNNA 4M1KA 3PRBA 3KG1A 2NUHA 1FNXH 1VQSA 1LWFB 3G96A 4RU9A 4LSZB 1NAQA 3IR6B 3IXQA 1F5BA 4A8SA 2C28A 1EKRA 2HNDA 5C42B 2DH8A 3DOMA 3PNIA 2KYXA 3BR8A 1FWKA 4OQJA 4C97A 2F9DA 1W7WA 4X4TA 1U48A 4E8UA 2OHDA 5LXYA 8AT1B 3R5GA 4OX8A 1T03B 3CD0A 2HQFA 2BANA 3KHGA 4TVAB 2GVZB 3GZ7A 5DZ7A 1QE1B 3P45B 3K57A 2OEJA 5JMNA 3OW2R 2DNRA 1VRTA 2OFGX 4DL5A 2ACYA 2WBMA 5FD1A 1NB7A 2B9YA 2R7OA 2HWIA 4IH6A 3MOZA 4NI2A 2NXNA 2ZH1A 3L09A 2OPQA 3BBBA 3SQGA 2YX4A 3T1YJ 3I9V9 3IA0A 1ROFA 4WIQA 5K9FA 3I6PA 4KV8B 1JLBB 2DGWA 2OSRA 2XWXA 4NMXA 2B4OA 1H3DA 4N47A 3EGNA 3MDFA 4XK8C 2KT3A 3ET6B 4NCAA 3E3XA 2J0SD 4DPXA 3MD1A 2CDRB 1VQNS 3H42A 2MKSA 1S49A 5J1PA 2DR6A 1NU4A 3IS9B 3R5JB 3ZXWA 2CA9A 1KQKA 3M2RB 1UTAA 4EWTA 1FTCA 1KRPA 4FNHA 3RTVA 2B9EA 4JI0J 4AD6A 4YP3A 1RAAB 3LALA 4I2PB 3ETMA 1F60B 2UUBF 1GTEA 2BQRA 3OL7A 4ZOSA 3ISNC 3ETOA 2MGZB 3J81U 4DF4A 2LCWA 4ZN1A 5F8MA 1O0PA 4WFYA 1KWMA 1SXLA 3GJRB 4L73A 1NJXA 4I67A 1IJEB 3KUHA 4ECYA 5B0CA 5GAHI 4RW9A 1S1TA 3N6NA 3EDQB 3M8QB 1HI8A 5KT4A 3GR0A 4UTGA 4U7UK 5F8IA 1UZDA 2IYIA 3N6LA 5KFQA 2BM1A 5A8WA 3VV2B 3HMJG 2YKNA 1EETB 1RT6A 1GX6A 4PG6A 3LP2A 3W8GA 2DO0A 1QDUB 2PIIA 4ATNA 1XWLA 4NYPA 3L7OA 3M05A 3HD2A 2A6MA 3MUMP 3RB6A 2HKEA 4MIAA 4B3OA 3VCDA 2DHXA 1LNQA 3DNCA 2VG5A 2F8MA 1GMWD 4UUWA 4ANDA 3NLCA 2X1AA 2MZSA 1OY8A 2KN4A 1S4FA 2RU3A 1XR7A 1PSDA 4USVA 2GMJA 1C1CB 4TQSA 3AB4B 4Y2IA 5A0YA 5ETOA 2K7JA 3WHIA 2IPOB 1ZS6A 5L1KA 1HD0A 4K7QA 4JI4F 3CDUA 3QBCA 3QGIA 4D3HA 4DV5F 2HVDA 3BO2A 5U47A 4Q43A 1J5OA 4R25A 2FPHX 1Q8KA 4X65F 2IMOA 1UWBA 1D3WA 2UUCJ 5ETKA 1DTQA 2UUTA 1CJVA 5FLXU 3KFWX 2ZOMA 3H2VE 2R7QA 4M5DB 2XNQA 1YTYA 1WEXA 2DXFA 1SJ4P 1VIXA 2COLA 1B0VA 3K17A 3RJMB 5F9NA 3RBZA 4CNYA 1GMWA 1G4CA 1H2VZ 1ELOA 1VK8A 1IBCB 5KFCA 5BXIA 4KHRA 1F1BB 5ETNA 5A8KA 2A0FB 1UPMB 1VQMS 2I2YA 4DWIA 1JXVA 5GADI 4IOAQ 1K0VA 2JLGA 2RNEA 3D6MB 4DI6A 3TX8A 2HRYA 4B3MJ 4C98A 1FJEB 1N6QA 1XC9A 3GP9A 3EUNA 4UT4A 2D9PA 3FEZA 3CO9A 1S57A 1MU2A 2IRUA 2AHOB 5J2MA 1XR6A 2GGPA 1VRUA 2HHQA 3HP6A 2B9XA 3QT7A 4DL0C 4ECUA 1DLOA 2J6SA 3BGRB 1VQYA 2XSJA 2VBXA 2Q6CA 2PMZD 1V6HA 4JI8F 3BKUA 2J8AA 2A6OA 2HLTA 3TZXA 3QNWB 4CO4A 1VQPS 5KG2A 1R8CA 1V3ZA 2IC3B 4WU2A 3H90A 3TUZC 4Q44A 3Q86A 5DDRC 3M2VA 3OD2A 4CO2A 4X2BA 4P73A 1QSYA 1V9OA 3BS9A 1OYEA 4XPEA 1SC1B 2QO3A 1NNDA 3J80U 3D0HE 1TKZB 4J5OA 2XLIA 3LWMA 1JLEA 2I8EA 2E7VA 2MPUA 2R42A 1FXRA 1NXIA 5IFMA 2UXCF 4QPXA 1WC0A 5IM0A 2J6UA 3A12A 2H51B 1U49A 3HLUA 2GMLA 5D4PA 5HQ8A 4HR2A 2VU5A 4KGVB 2M3DA 4DR7F 2RF2A 4HT5A 1G6BA 2C42A 4CI0B 4CRJA 3HT0A 2L3MA 1KFDA 1P9QC 2KZZA 1Q8LA 2YNIA 4NMLA 4U6PA 3FUYA 3QSIA 1Q81T 4QOTA 1U47A 1D9DA 2A1BA 5HP1B 1XBWA 1UWAA 1FI4A 2BJ8A 1CC7A 3IWXA 1C4CA 3VR1A 2WVDA 3OVSA 5BYQA 4LVOP 5HMXA 2L9NA 5L9XA 2IJRA 4AQYF 5I3UB 3MAHA 1IKVA 4NE9C 2JH3A 4Z2XA 4LRBA 1AXQA 4IO1A 1SV5B 3MGJA 1U6BA 2ASDA 2MKYA 2NXCA 2ROGA 3PXGa 1B7FA 2LQJA 2IVMA 1HNIA 3HXMA 3N28A 2L08A 1YLXA 1BY9A 3G8TA 2L41A 3B78A 4KFBA 1N4LA 2ALZA 4URGA 4XIUA 1WSRA 1ZM4A 4O3OA 2PMHA 5D3GA 3VZIA 5CABA 2GFFA 2IVFB 2HZCA 4U7CA 4ALZA 1VMBA 2JFKA 1HQEB 2B8PA 4M5MA 2AYMA 3PACA 2K2PA 2DEJA 5KFIA 1NK9A 1GX5A 1OIAA 3KJFB 2FJVA 1RTJB 2RS2A 2DYAA 2C3PA 3MM8A 2UVRA 1APSA 4OI1A 2BMBA 3Q89A 4UZBA 1T9XA 1DQAA 4JBCA 5DZ6A 4ZLPA 1RACB 2W2QP 3TOQA 2EG2A 2V4JA 3O2IA 2XCAA 2XYHB 2B4UA 3HKZD 1O5JA 3TW0A 4J9VA 5KFRA 2Y9HA 3R5CA 2QE5A 2WAQD 2IM2A 2Q6BA 3W9JA 2KFYA 4ZS6A 1X9WA 3MAQA 2HHWA 3U27A 2ZZTA 4RW4B 3DRSB 5B0FA 4A8KA 4X84A 4DR2J 2HGMA 2E5LF 3H0PA 4CLWA 3FCWA 2B43A 4LF4F 3N4WA 1WTBA 1WF2A 2Z2ZA 4O4RA 1C0UA 4PWDA 1RLCL 3MM7A 1FX2A 4JV5F 1YRUA 4LREA 1RLDA 3IFEA 4P2XA 4ZPWR 2ZHAA 4DV6J 5IC4B 1ZPVA 2HGLA 4X66F 1RAHB 2GMHA 2PEHA 2DHHA 1VISA 3Q8QB 2PGCA 1JQGA 2V69A 2UXDJ 2EFOA 2DGQA 1R6VA 4EBDA 5KAKA 4TLRA 2FHKA 4GKKF 1HWUA 1LWCB 4I2QA 4KKOB 3FQLA 3H5SA 4DG1B 4IOBA 4EBEA 5BYSA 4HH0A 2CQ1A 4YDDB 4U67Q 3PZPA 3W7BA 2MKKA 4K4SA 3V5RA 3M8SA 3QJLA 3I55S 2VONA 1JLGA 4ICLB 3LP0B 1X5SA 4TY8B 4CWBA 3J81j 2C3YA 3QGPA 4UOFA 3NEKA 3O8WA 2QA1A 4PQAA 3W5ZA 3NCRA 4WTOB 2WONB 4CM0A 3TVKA 5KFPA 3KK2A 1FERA 2OPRA 2DPIA 1VQ9S 5AJ3F 2HMIB 5J1EB 1QY7A 2C2ZB 5KFUA 4PXBA 2BV3A 2E1AA 5KFKA 1NUEA 1RI7A 1TKXA 3KLGB 2JVRA 2AEMA 1BE4A 3PRVA 3KYLA 3EMTA 1DJ0A 2Y0BB 4X4RA 2XO6A 5HMZA 2R9LA 3M9NB 2Z2LA 4ZN3A 5IT9Y 1RT3A 4C2MA 3OVBA 1UL3A 1FVSA 3FRZA 1PO6A 1NSAA 1URNA 2Z57B 4JI1J 1JLQB 1WSVA 4LFCF 4I6WA 1BQMA 1FESA 5L46A 5F9LA 2AIRB 1HNZJ 1LWFA 1HBMB 4GVBA 4ID5A 4CLKA 5T7LB 4J9SA 2M2BA 3OFGA 3D1HA 2FY8A 3DRYA 2FGCA 2GAHC 1Y9OA 1KNZA 1RCXB 4DV4F 2DR5A 2Z8QA 4NZ7A 4B17A 3MUTP 4FNIA 2CJBA 3T41A 4CLUA 4BBYA 2IA0A 3QT6A 4ED2A 2VJUA 1JNRB 3HHDA 1RUSA 3BDPA 2J7UA 1K8AT 3UD5A 2GVZA 1QTNB 2RHSB 4R5PA 1VS3A 1QE1A 4LF7J 3FEXB 4NASA 1HWIA 4QJVA 2O66A 3QRRA 2MY8A 1CC8A 2YKMB 3VF0B 4PZVA 3GV7B 1FDBA 3EZUA 1U2RA 1L3SA 2WRMA 4NOHA 3CD5A 3MECA 1N36F 3IRWP 2DHGA 4QR0A 2W2OP 4QWAA 3M9OB 2D3O1 2LP4A 2PA8D 4Q2LA 4H4KA 3SQOP 4LIRA 5L1IA 4F36A 1S1XB 4LF9F 1JLAB 4FXDA 2IDEA 4F0MA 2JSXA 2OUGA 3EVMA 3ET6A 4LSLA 4J9UE 3A13A 1PYTA 2HW3A 4CT9A 1VQLS 2EC0A 2PC6A 3ZC4A 4Z7YA 3EE3A 2VH7A 1SJRA 5AE1A 1FRIA 3QJPA 5KFJA 3M2RA 1KVIA 1HYSB 2DGVA 1M0SA 3FSXA 4C3MA 2VQEJ 2XI3A 4RNNA 2WSEC 2IFXA 3CPWR 1JX4A 1J2VA 4YS2A 4IO9Q 4JI6F 3M1VA 1VBYA 1HWLA 2FB0A 2M70A 4HT7A 2OIHA 1XK8A 3DOLA 4YB5A 4C8ZA 3FBBA 5K8PA 2LLZA 2VBZA 2CWKA 4A8FA 1IBLF 4ZP7A 3P8BB 2WOMB 2YQ0A 3JSMB 4FP9A 1Q0NA 3D6FB 3W2VB 2V0NA 5AE2A 1XNQF 1FRXA 1HW8A 1X4AA 4C4WA 1HL6A 2DIVA 3HVRA 4ZHRA 2XS5A 4DPOA 1YK9A 3ZNUA 1XMQF 1VHIA 1ZAVA 2M7SA 4YQWA 4NA1A 4K0KJ 1U24A 3ZZUA 4B9VA 3MAAB 1CSJA 2CQHA 2XMMA 2ZD1A 4OX9F 4MT1A 5CAAA 1WF1A 3B54A 2V4QA 5L1LA 4YFUA 2OP5A 3G82A 3QRPA 4O0IA 2GC8A 4G1IA 3PW5A 4LR9A 3HHKA 3E01A 4DHVA 3DRPB 4B3RJ 3C6UA 2EBEA 2P8IA 3TEGA 2V8VA 1C1BB 4AYBD 1E6VB 2OTLS 2KB2A 3HK2A 1TL3A 2FZKB 2DNHA 3FSYA 3QT8A 1ZZNA 3V6JA 4NPOA 4LSNB 1QVFR 4PKDB 1VQ8S 1PG5B 3VQTA 4PXCA 2V8HA 1S1WA 3Q24A 1MN7A 3PKYA 1FKOA 3OVAA 2W25A 3HVAA 1Z4UA 2CUYA 4IYQA 4I69A 2QJ3A 1NKBA 3RB4A 3FKBA 1O8BA 5KFHA 1YKWA 3NCQA 4RNHA 4QIGA 1QLNA 3M30B 4O3PA 1JJ2R 2AU0A 1FEHA 3UN2A 5KFBA 4DX6A 5D0RA 9RUBA 1VR6A 3UNGC 1RT5B 4H4OA 3CT9A 3T19A 2VBYA 2E29A 1IKXA 4PR6A 4WE1A 2CJAA 3FMWA 1OS5A 5CQGA 4K4TA 2OAUA 3FZBA 2LQ5A 3MPYA 2IYGA 4Q8FA 3BYRA 1PJ7A 1BMQB 5LMNJ 2YWGA 1FK9B 3PX0A 2OSQA 1TV6A 5T14A 3BGRA 2GJIA 4NXNF 2UXBJ 3HHEA 5F8GA 3ENAA 1NLKL 4MTPA 3O3LA 1WORA 3N9UC 3PYEA 3U1LA 1L3VA 2XMWA 2DNKA 1HNWF 2EXUA 3JQJA 5CA5A 2JEFA 3L9ZA 1T94A 5BR8F 1URRA 5DS7A 3DMJA 3PV8A 2IC3A 1AZSB 1WKKA 5ETVA 1IR0A 2LXIA 3NNCA 2DNMA 2Z0GA 4K2JA 4ILLA 3AD8C 4MAKA 3TI0A 3M6VA 5J2QA 4DV1F 3KK3A 5HMYA 2R7RA 3DLLQ 3DRRA 4WZMA 2AEFA 1FCAA 3I0SB 3MCMA 1ZAXA 5LSRA 5AT1B 4PUOB 2YKOA 2HZAA 1CJTB 1UVNA 4LT6A 4RW7A 3JSYA 4ILMA 1HNVA 1RTZA 3RRHA 5D8HB 1KOOA 2VFUA 1N5TA 1HBNB 1UZHA 2Q43A 3SI8A 2W2PP 3LTOA 1MROB 2HVIA 4QYRA 1WTFA 3NS5A 1ZYQA 1R3NA 2XLJA 2OELA 4A4JA 4DOZA 4K5SA 4F4KA 4JYAF 2FD2A 1NDKA 3RR7A 1KS2A 1NHUA 4QWEA 1U1OA 4CLFA 4CIOA 1WHWA 3H4BA 2GIRA 4O4GB 3G2XA 2ZE2B 2YWWA 2KKHA 4NLOA 4QR2A 4DQSA 3UE2A 2L9WA 2HNYB 1IWGA 1EQMA 3CDBA 1RADB 5HAOA 2VDHA 3LH2S 4Q8EA 1S7HA 3M9MB 1YRXA 4OV1A 3OJSA 1X9SA 5E2QA 3L7PA 5C2GA 4USMA 5D0EA 3CCWA 3W2WB 5HROA 2R2TA 2J8SA 1M5HA 2YWEA 2ZHOA 3DRXA 1WEYA 4P52A 1R0CB 2DKOB 4C6AA 1YJ7A 2RD5C 1U02A 4A8XA 2M88A 1SKSA 3OTCA 5EWFA 3CJTA 2RIJA 2ZVSA 1R0AB 1GFWB 2HG4A 3W65A 3ZO7A 3C8YA 4C48A 3BGUA 4NXMJ 1N5QA 4B9LA 1S9EA 2W4PA 4K5RA 2YPYA 4A8QA 4CNZA 3AQPA 5CD4H 1C4AA 4MKAA 1TUGB 1F6TA 3UCUP 1P8GA 1PILA 3NGDA 2ERRA 3ZTOA 4TKTA 4IG3A 5KOWA 2KU7A 3WX4A 4NLXA 3NY0A 1HQEA 4USTA 1QTMA 4CLYA 4ZKAA 2A2CA 5HN0A 2N4CA 1KQFB 3RAMA 2BE9B 2NPFA 3ILJA 3RBXA 2HFVA 3CJ0A 2O01C 2CKWA 2EKNA 2HBYB 1RABB 4NA2A 5B08A 4OI4A 5H9EK 4I6YA 3FK4A 3KK1B 2W1BA 1FJGF 1IBKF 3KLIA 3PG9A 5C24B 3G4SS 3R7SB 3LUYA 3JXOA 3IRXA 4N77A 4C8NA 4QU6A 5F8LA 4KGKA 4DEZA 3VZHA 3TJAA 3RG6A 2P9GA 1YVFA 4PCQA 4BWJA 3AFGA 3UDCA 3HT3A 1S0VA 4CLSA 3GFXA 1Y5NB 4CT8A 5H9FK 3A3OB 5IT9U 4ZPDA 2QMXA 2HLUA 5HO4A 4KC5A 4P2MA 1HQUB 4RBVA 1X0PA 4H4MB 1A9NB 1WHVA 2PMWA 4DCPB 4K59A 4Z7CA 5H9EJ 2AZ1A 3LP1B 3UCGA 3Q2TC 2HWHA 4ERDA 3MHYA 2OGUA 3F56A 1S76D 4J91A 4OZ0A 1KVJA 5A2QY 3RZAA 3KJVA 3OLBA 2DGOA 2KFZA 5DETA 4DV5J 4OZJA 3L95X 1IKYA 1M5VC 1H6KX 5H9FJ 4BWMA 2RAQA 1HW9A 4OZ5A 2GIFA 5E5NA 3S7RA 2B6AB 5K8OA 3OL6A 4X65J 3P3DA 1N56A 2WK4A 4MMOA 4P72A 3SIPB 1F9EB 2AP6A 5GAHU 2GAGC 1FJ7A 4X4OA 3TAMA 4B9NA 3FBFA 5HANA 2XLKA 4UF4A 1RAOA 2ILYA 2CZ4A 2X51A 2A3JA 3C16B 3LP0A 2JEGA 2DISA 1FRHA 1X4FA 2DHAA 3MEDA 2HURA 3IG1A 2ZC3A 5HL7Q 1I51B 4MIWA 3H5YA 2WSCC 2W9BB 2WONA 4OZ3A 2CJXB 2VC1A 3QIPB 2IM1A 4Q45A 3HJFA 3IWLA 1RAJA 1Q5YA 2HMIA 5J1EA 2DT9A 2J5AA 3PR5B 3MMCB 4QW9A 4V1Ak 3EGVA 1HBOB 2PI5A 3GIJA 1NZAA 1MW7A 3ZTSA 2GQQA 3HFZB 1JIHA 3MEEA 2HBZB 5KT5A 4JI5F 3KHHA 2FVPA 4WPAA 1JNZB 4PYAA 3MEGA 3CD7A 3D7SB 3ZZRA 3CCVS 4JI8J 3PFEA 3NOCA 1JLCA 4PQUA 1TL7A 2KM8B 3IN5A 3HHNB 2E5GA 1JLFB 1TVRA 3VGTA 1FEEA 2N3OA 3PY8A 4M5KA 2HS3A 4UW2A 2CZVC 5KT6A 4PEOA 1CQMA 1ZZFA 4IDKA 2VFTA 3DLBA 4P6QA 1YBAA 1KHWA 5IWAF 4ED6A 2QLBB 1S10A 4MKYA 4J9QA 2HS0A 1HA1A 2OPSA 4IRKA 4X4SA 2QYGA 1TL5A 4FS1A 2HNDB 3EXCX 3W1YC 3DOMB 3OFEA 4HACA 2CAJA 3DYAA 2HHXA 4J9RA 5GADU 2P9EA 3KXDA 1QAIA 2VUGA 2ADBA 1RWKB 4S0MA 4DQRA 3D1OA 2DGXA 1RWMB 2DBBA 2DIUA 2X3DA 2C3MA 1SJ1A 2L9DA 1Z1ZA 2NXUA 4ETXA 4DR7J 1PAEX 4DR4F 1B7YB 5B0GA 2KXHA 1ZM9A 4Y2CA 1N8RT 1VRTB 2C2NA 5KFTA 4C0HA 3D6HB 3VGSA 4GC7A 2KG1A 2KI2A 3NMRA 4NI2B 4DPWA 1HR0F 2MQ8A 2OPQB 1RT7B 2FGOA 1BQNA 1U1NA 3SQGB 1DHMA 4BC9A 2FQQB 2R7VA 4DV2F 3M8PA 1T02A 4ED4A 1JKHA 3QATA 2VKRA 4AQYJ 4FF1A 1F5CA 1S59A 2EFVA 3HDSA 4P75A 2FYXA 3BO3A 2XY6A 1U8SA 2CPFA 1U1MA 2M4MA 2OKQA 2APOA 1B0TA 1KBRA 3B6BA 1XMBA 2MKIA 3T5HA 3L3CA 1UVMA 3RB0A 1RISA 1X4CA 2NZCA 4C8MA 3CCRS 2FJEB 2UV8A 3CULA 5ETSA 1QAYA 2CQ2A 1FO1A 1MMNA 4I68A 1X8DA 2ZUAA 3LAKA 2C3OA 3TJ9A 2V67A 3R7NB 2HHUA 4TY9A 1B64A 5KFZA 2ZBCA 1TELA 1U0HA 2XMJA 2G9OA 2E1MC 4NCGB 1NSQA 2XBPA 3OR2B 3G9CA 1S1TB 3HPOA 3I32A 1P9YA 2HHTA 2GW8A 4MYTA 3HX9A 1L3KA 1DRZA 3T9NA 2XM3A 1U6ZA 2LU2A 4UZCA 4OZLA 2EFGA 1HHSA 2XGQA 2AWZA 5K8MA 3RW7A 2C22A 2YKNB 4HEA9 1PGZA 3Q8UA 3R9LA 3LP2B 1RB0A 2DRDA 4M95A 4F50A 3MAAA 2B8QA 3SXLA 2M9KA 4CLZA 3H98A 4PPDA 1KHVA 3NP5A 3JSBA 5KT3A 4B3SF 3DLGB 4JV1A 2WTFA 2ZITA 4B3OB 2KO1A 4QQBA 5HI7A 3OTEA 1YJTA 4PAAA 5IXUA 2CPYA 1XMOF 3EZ5A 1NJYA 3V6DA 4C11B 3NGUA 5D77A 3P6YC 1OQ3A 5A6PA 5GAGI 5A0YB 2Y0SD 4NWBA 2E5LJ 1I5OB 1UAWA 4LF4J 4DR6J 4LSNA 4IRCA 2DGUA 1UFLA 1U1LA 3LPEA 2J9CA 4UOHA 4AFFA 3IAS9 2PFFB 2FVSA 1UWBB 3MM9A 3GJTB 1DTQB 3BN7A 3NNAA 3GJSB 3M6WA 4LQ3A 4HKQA 4X66J 1FNOA 3TA1A 3UR0A 5D4OA 4QPTA 1R43A 4YMEA 3MR5A 4P2SA 2HQGA 4DFPA 3M30A 4NCBA 4LVNP 1IXKA 2VHGA 1FRMA 4GKKJ 1WJ9A 2VL1A 2B5JA 2Q66A 3SCLE 4DU7A 5A8KB 1RP5A 1RHRB 2F8EX 3B82A 3V6HA 1Q8BA 1S6QB 1NJIT 1M5KC 1RTDA 4WP9A 4Y00A 4CYUA 1N6QB 1RAGB 1FRKA 3PCOB 1NBEB 1FK9A 4NX9A 1MU2B 5J2MB 1U2CA 4DQQA 3QLHA 4KSEB 3GB0A 3ENQA 1KVKA 1XR5A 2YKQA 1KN6A 1DZ5A 4DF8A 1DLOB 3NNHA 1WG4A 5JUMA 1CS4B 1Y5IB 3CIZA 3HD1A 3DLEA 4P10A 5AJ3J 4QR1A 4ED8A 2FIUA 3JB9k 2YVSA 5DLGA 1SJFA 2V8PA 2BQUA 2YY3A 3JTNA 1I1GA 4OL8A 2U2FA 1UP1A 2AJFE 1MWQA 3KWMA 3OTOJ 2XHWA 4USIA 5DRKA 1B99A 2NUUG 3M2VB 1M1HA 5IOLA 4AUKA 3KTQA 1IWAA 3QYYA 5J1NA 2ZBPA 3KMQA 3CIMA 3EYZA 3D4JA 3P5TL 5FIIA 4KO0A 1JLEB 1SVDA 3MF5A 3D0GE 1Z2ZA 2M52A 1TUWA 3OL8A 4OI2A 4LFCJ 1MSWD 2MQOA 4YR0A 1MROA 3DHXA 2BDPA 1SUQB 5IM0B 4ZVQB 3U1NA 3CCJS 3CJRA 2ZVIA 4YR3A 2XO7A 2I1RA 4WCEQ 2RF2B 1BHNA 3ILOA 1QVGR 2JLFA 2UVVA 1X4BA 1OO0B 1D8YA 2DNYA 1N88A 2ZM6F 4RW8B 2EFQA 4OYOA 1NJWA 3GIKA 2FUG9 2HAIA 2MDAA 4O4GA 4BS2A 2ZE2A 5F8NA 3I87A 4WWSA 3RRGA 3BF4A 2CFXA 2JVOA 3E51A 3ULHA 2UUWA 3TUJC 2VOOA 5KG4A 2VBWA 2F4VJ 3ZZYA 2G0IA 3DDNA 4HHHA 4FDFA 3HF5A 2EFNA 1H98A 1HD1A 5C7PA 2JL9A 1I3OB 5L38A 1HKAA 4F26A 4OHVA 3CDWA 1VBZA 1IKVB 4KR0B 2QZ8A 3W9HA 2XTJP 1TMJA 2QV6A 1UVIA 5A2QU 3RAQA 4WF9Q 4NRUA 3AXKA 3A1YG 2CQCA 2EPIA 4C9DA 4AXIA 3T1HF 3FCVA 4M63A 1HMVA 2D7SA 1RWOB 4IFYB 1U1PA 4MK9A 3KJQB 4CCHA 3H59A 1HNIB 3KG4A 5ETMA 4ZA1A 4ZPVR 2B7CB 4IQXA 1YITS 3IMQJ 1Q4RA 3R5DA 2A10A 3CMES 3HHLD 5D4LA 4F3MA 1QUPA 3QQCD 4ZCLA 3VGVA 5G0RB 5A76A 3CCZA 4ZVOB 2P5VA 1DFDA 2H48B 4CH7A 4DLEA 1FKAF 3O6QA 3PX6A 4I7FB 3HCXA 5D3GB 4ZK7M 2CVEA 1WC4A 4LFAJ 5KFMA 2GA7A 2BA9A 1N52B 4ELTA 2GIQA 2H5IB 1JMTA 1IUJA 3NG8A 1U4BA 1REVA 3TARA 2DNZA 4P71A 4JI6J 2XYPB 4IOCQ 5DG8A 1VRQC 4YY3F 5C24A 2BKNA 2J9EA 1EQ0A 1A0OB 3GU0A 3MM8B 1TAUA 1IBLJ 3K8VA 2NCKL 4HH1A 3T5JA 3HKWA 3HHLA 2J0QD 2V4JB 2HIQA 3H2UB 2KG0A 4DU8A 1XNQJ 4DL3A 2YNFA 3PKMA 4MFBA 4UY8T 2CVIA 2BQ3A 3TZZA 4IKAA 2DVIA 3CJ8A 2MQNA 1XMQJ 4H4MA 3FBEA 3BDEA 4F02A 2ZFHA 2V8DA 3KLHA 4WFNQ 4OX9J 1PC4A 1U2FA 2R8HA 2OEMA 1RU1A 4N56A 4W90B 3MM7B 3ZTRA 1Q78A 2HVZA 4DV3F 3CEDA 5D6GA 2Z56B 4ZCKA 1UA1A 2KYZA 4JI0F 1RXOB 3ZZZA 5IC6B 1RWXB 1RTIB 1SKWA 2CG4A 1R6YA 4FN5A 2CQGA 1LOUA 4PG4A 3BSAA 5LT5A 2HFUA 4K4WA 2QLXA 2W24A 3WZ0A 4LF6F 4V19X 2IIHA 5E3PA 1NPPA 2KHCA 3D66A 3A8IA 2DJWA 4DR3F 3U1MA 5DGBA 3OUYA 2QTWA 1FWLA 3DI6A 2POKA 2LFVA 4RNOA 4DL7A 3BQ2A 4AXJA 3ZTPA 1C2PA 1JLGB 5LSOA 4C8LA 2Y1IA 1YI2S 1FFSB 5KFVA 3GWCA 3UD4P 4LUBA 2KFNA 2D3ZA 3EICA 4JV2A 5JVHQ 4O3NA 4DQPA 2QT7A 3I4HX 4JI7F 3D6TB 3MURP 2OPRB 3JAMY 2MSSA 2C3UA 3AH6A 2KRBA 2H9ZA 4Y3CA 3ICLA 2BBEA 1S6OA 1TKXB 3NCPA 4A46A 4F4ZA 4TLQA 4ZIWA 2WZ1A 1S72S 1HHQA 1T9UA 4NXNJ 3TZWA 2IA6A 1PKUA 3DN9A 4EFAC 4X62J 1HNWJ 1SJ3P 2K7KA 4RLEA 2FY1A 5KFXA 3OHAA 4CDIA 4ENOA 2GJFA 1RT3B 1KTQA 4G65A 3BBCA 5ETRA 3AA9A 3BSNA 1KDNA 5LL6d 3MR2A 3N01A 3MM6A 1BQMB 2PO4A 4NLTA 1RHMB 4GVBB 4ID5B 4LJMA 4DV1J 5ETQA 4ECSA 3OSNA 3T6JA 3RR8A 1RHJB 1EARA 1YJRA 3POTA 1EHWA 5F41A 2LU1A 1H7XA 2M5YA 1CJKA 1ZA1B 3DM2A 1U26A 3O1LA 5ETPA 3F41A 2VG6A 4GKJF 3OTDA 3AOCA 1CVJA 3BYPA 4DSJA 3UVJA 1WC1A 1LWEA 4QYZK 3EM1A 2VD3A 4ZVSB 1UPPA 2V50A 5LJ3Y 2WVCA 4ETZA 3SSSA 4R5PB 4U7UD 3SCKE 1S0OA 1RZMA 5E3QA 2DR8A 3T6BA 4DPTA 1GXTA 3NWRA 3M2UA 4WFBQ 2RSQA 4EZ9A 1GK8A 4YB7A 4BHQA 4JYAJ 2CNKB 2AX1A 2F65A 2PSZA 2JJ4D 1WI6A 2BZ2A 2MXYA 2HQIA 2CPEA 1RT7A 3MECB 1S7IA 3VWSA 2D1CA 2H4WB 3HFKA 4OFZA 1HBUA 5MAOA 3MPDA 3PO5A 3C2PA 2NXEA 1UVLA 1RBOB 3KJNB 4KBIA 2YBVA 3K2YA 5IT4A 4P7TA 4EU0A 4QYZJ 2FJDB 4HL9A 1ZA2B 2DCLA 2H5JB 4HHUA 4NLVA 1UW9A 1DQ8A 4LSLB 3V4IA 4DSIA 1WNEA 3EGWB 5KFAA 1N0VC 4ZCMA 4X64F 2YNHA 4AT1B 4QZVB 2ZBQA 3TO8A 3UCZP 3BBFA 1MLAA 1T8EA 4NLUA 5GVQA 2RH3A 3M7VA 3FQKA 4ES1A 3WC2A 1F9FA 2AZ3A 2FC9A 4KE5A 3VALA 3M1VB 2PA3A 1TP7A 4A8MP 1WI8A 4AE5A 3UR3C 2MTLA 5IV4A 3DOLB 4PABA 5LMUF 1CPZA 4RNFA 3NXZA 4NEYA 4NCGA 3OR2A 5C2CA 3W66A 1XTZA 2VFSA 3K89A 3LA0A 3TAPA 5HVGA 1TL4A 3I5BA 3FSIA 4CTAA 1V5IB 3WIUA 5LJ5Y 3CMAS 1T9YA 4OYMA 4ZCIA 3G6ES 2HSEB 3OFHA 2Y3YA 1NHVA 5L9NA 1F2GA 2YXLA 1NKEA 1TKDA 3KG0A 4A48A 1WC3A 4ZHRB 1FJGJ 4DMZA 3GG1A 4ID8A 1KLNA 4F67A 1YBUA 2XEXA 3VAKA 1FRLA 3T3FA 1VK3A 1RT1A 3DLGA 2ZD1B 3EVWA 3DOKA 5CH7B 1SKUB 1AYEA 1SL2A 1FKPA 4IR1A 3N5BA 3G82B 4O0NA 2ZJQQ 2CQBA 2K3IA 3C6TA 2XGPA 3E01B 2IAJA 4C11A 5HVFA 1FA0A 3T5KA 5FDLA 2BYCA 3C6UB 3AJ1A 1ZH5A 3TRGA 1FWPA 2JFDA 2AYEA 2VB6A 1AROP 1CEZA 3D28A 2HHSA 2HHPA 1TL3B 1WHXA 4NRTA 1QSSA 1M1KT 4B9SA 4O44A 1N34F 2WB1D 1S1WB 3QO9A 3NRBA 3MUVP 1WKLA 4FS2A 1FKOB 2HQDA 3BEGB 3R2CJ 4ECRA 4OI6A 1R0BG 3CCTA 1JJCB 2F4FA 1BGXT 3NS6A 3EPGA 2MYFA 3Q22A 4ZP6A 2AGOA 1Q79A 4OLOA 1D0EA 2G2YA 3V6KA 3TA2A 4H4OB 3TWZA 3GJQB 2NLWA 7FD1A 1IKXB 1S6QA 4KIAA 4WFXA 4U96A 5KFLA 4LMZA 5HQLA 4WE1B 2Y1LB 4OHYA 3S6EA 1VJQA 5KG1A 4E98A 1D8ZA 5CXTA 3GIIA 1OMSA 4DZDA 1QM9A 3OXGA 3CJQA 2WVEA 3HSJA 1N48A 1HQ2A 1TV6B 3MR6A 4UOGA 1YG0A 3FZ2A 3P49B 1CS4A 3UI3A 3SEOA 1SH2A 4L75A 2J0WA 2ASYA 2BRLA 3MPUB 2DPJA 3B4DA 4ECTA 4LRCA 4U8YA 3DMJB 4B9TA 1M90T 2OD6A 1RHKB 4CLPA 3K8WA 2QFJA 4DV6F 2GO8A 3HVTB 3D3CJ 1UVJA 4JI5J 3D3BJ 2UV8G 1SL1A 3F73A 1ZM3A 4M5LA 3WC0A 2ZOGA 5J2QB 3BSCA 4PXDA 3KK3B 2UXDF 2BJ1A 4F4XA 3DRRB 2C2EA 1SIZA 3GONA 4GRSA 1MMDA 2D3UA 3CC4S 1VDHA 1SQGA 3SYZA 1OY9A 4I6AA 2FZCB 3R3TA 1LXJA 4RW7B 5THWA 2GVDA 1HNVB 3C66A 2W4CA 3D9BA 3GYXB 1SUQA 2XY5A 2DH9A 3J7AN 2YQ3A 1AFJA 4J9LA 2BE2B 2G0JA 5D0GA 1HFEL 2LA4A 3MOJB 1FFWB 2IRYA 3OFFA 3PM9A 1FJCA 3LQVA 6FD1A 3PO4A 2OJ3A 4RW8A 4LFBF 2KL8A 3N5FA 4RL1A 1WUUA 5KFYA 4KJIA 1SJQA 4CO3A 1ULRA 2HBQB 2QGFB 3OV7A 3ISND 2SXLA 3NS7B 2BOAA 3PJWA 3Q23A 1U09A 3UQSA 2CZ9A 4FYXB 2RDJA 3OR1A 2ATLA 4DR4J 5IQ6A 3ZZ0A 4EO6A 3W3SA 1R89A 2QMUB 1BQXA 4YUDA 4DV7F 5F0WA 2AYGA 3VAFA 3MCNA 1S1UB 2ZKTA 3R97A 3TX0A 5HROB 4EYIB 3TJ8A 1VLYA 4ZPTR 3MMAB 1M5SA 1HR0J 4F4WA 2ASLA 2LYVA 4IFYA 5LXRA 3FFIA 2MHEA 2WCXA 4FYVB 2VV5A 2DRBA 2V63A 2UVUA 1B3TA 1CULB 2CADA 1X4EA 3D54A 1PYOB 1G1XA 2ZZMA 1NK5A 1TL1A 4U9RA 4XAKA 1S9EB 5G0RA 3FBCA 5CYQA 2CRLA 8ATCB 4JI2F 5E3AA 1S0NA 3CGIA 4JUZA 5CCLA 4DL2A 3Q83A 4I7FA 5DLFA 5DQIA 4LRDA 3SSRA 3BN4A 4DSKA 4IG3B 3OSPA 2ZC4A 4A47A 4AL5A 4KPYA 1NK6A 4USHA 2OPPB 4UUXA 4OHWA 2B3TB 3PTWA 2W2NP 1DTTB 3FC9A 3G6XA 4ECQA 4ED7A 3EGZA 1XNRF 3K5LA 3JAMU 2J6TA 2KRRA 1NB2A 3KLIB 2XZDB 2BJ3A 3IRXB 2BABA 4PPZA 4JI3J 1N33F 2F40A 2GJ2A 4FVMA 1NKCA 4C8KA 2NREA 4LF2A 1HNXJ 3K5MA 2CQ0A 3BO4A 4CO0A 4KB7A 4DPUA 3VAIA 3A8EA 2V2ZA 2B4PA 1YSJA 3IBFB 2H65B 3MEKA 2NYHA 4N7TA 1OSCA 1T7PA 4WZQA 2F1FA 2KT2A 4ZP9A 3KLFA 4RUBA 5HLFB 4MJKA 2GHVC 1TK5A 1QJHA 3CB4A 1N5YB 5KFGA 2DXEA 4FBTA 2VDIA 4DUZJ 1VQ6S 3SCJE 1OPZA 3SDEA 5HATA 1P6TA 1F5AA 2F3JA 5RUBA 2V2QA 8RUCA 3MM5A 1XMOJ 2FVQA 2HQCA 3Q8VA 4DSEA 5SUHA 4ECWA 1MNEA 3CWJA 1KONA 1GXUA 3TEHB 1WHYA 3ZTQA 3KJVB 1RTIA 1RHQB 4DFJA 2JC1A 3SSQA 2OMOA 4DSFA 2VA3A 1IKYB 2QL9B 4ZPCA 1NK7A 4LF8J 1KR4A 1RT2A 3NBPB 2WHOA 2Q3PA 4M94A 4UY85 2K8GA 1IN0A 3HM9A 3GCXP 3TAMB 4YR2A 2YPZA 5HJYA 2NXJA 1NJZA 1R8BA 3Q8PB 4OYIA 3MEDB 1GEHA 3HSDA 5KT2A 1PC5A 3IG1B 3DXBA 1LK7A 2E9RX 4K0KF 1NK8A 1LFPA 4KGXB 3OL9A 4RUCA 2IVYA 3M8WA 4ZJOA 2WVFA 4B08A 5D15A 2CJYB 2IM0A 4OIXA 4J90A 2XMKA 2IHR1 1A7GE 1R8AA 5HBMA 1AFIA 1TR0A 2HNZA 1JJHA 2N3LA 5KTQA 3G8SA 3MEEB 1HPZA 1RBAA 4Y28C 3IM9A 3MFIA 3QFWA 2DITA 1O6XA 5I4MA 1QUVA 1LXNA 4ZLLA 5J2NA 4Y65A 3MEGB 1RWPB 2PE8A 5GAGU 1S79A 3D68A 2N7CA 1SCJB 2YWFA 3T9ZA 2BJDA 3H4DA 1JLCB 1TL7B 4PQUB 2LXUA 1TVRB 3WBZA 2Z2MA 4FVCA 4OZNA 2FLNA 2Q1LA 5EHHA 1YRTA 3MCOA 3MR7A 3IP0A 2AV5A 2DNQA 4IDKB 1KQGB 1MWZA 3BM7A 4NYZA 1LW2B 4FF4A 2N82B 3HJVA 3MCSA 4R0JA 3GFHA 2HK3A 3NAIA 2VFRA 2OPSB 2EK6A 4WTYA 3DXSX 3DFEA 3S8SA 9ATCB 4WKRA 2IBOA 4HACB 4F3OA 1EJ7L 3VHQA 3DYAB 5GMKa 4XPCA 3QIDA 2VOPA 4EBCA 3L7UA 3G6YA 2VPZB 2ZJPQ 3PW0A 2R2RA 1YGYA 1LWXA 1IKWA 3IO1A 3H5UA 2HS4A 2MQLA 2ZH7A 4B02A 3K5OA 1WG1A 3FRYA 4KHPF 2AGPA 1JXEA 2ZM6J 3DGPA 2UXBF 1SQFA 3QZ8A 4L74A 3ZFVA 1K73T 1NDLA 2KJWA 1OPIA 2KH9A 1LFWA 3IR7B 2QSWA 3U02A 3UPFA 3A3NB 4YDXA 2QLWA 4DR5F 1RKIA 4M5JA 2E1PA 2EVZA 1BQNB 3PX4A 1G3OA 3M8PB 1EX8A 3F44A 3K58A 1JKHB 5LSLA 3PIOQ 4USWA 2RILA 3HVWA 3MI7X 4CO5A 4X4NA 4LBIA 4HI1A 1W2BR 1RGVA 4K4ZA 1WD6A 1XERA 2XULA 4AL7A 3T1HJ 3A3PB 1H2TZ 4C3KA 2MB0B 1WACA 1T9TA 1KLMB 4ZITA 3GQCA 3CDAA 1YBTA 4RNMA 1IVZA 1FHTA 3K0JA 1QAXA 3ITHA 4L6V3 5K5MA 4JB8B 2KZMA 2CDQA 3NOGA 2OO4A 2HRTA 2VFVA 2C2RA 2NZ4A 5B0AA 4OJ1A 3KDOA 4LF5J 1XN9A 2RRBA 2Z4PA 4DQIA 3V81B 4FZVA 1U0HB 2C2DA 3LWLA 4F3QA 2WSFC 2C2MB 3PW7A 4ITSA 2DNLA 1X31C 2XMVA 5ETLA 4OMFG 2O3DA 4YY3J 2K3KA 2HYIB 3PW2A 4PWWA 3TNVA 5F3TA 1U1RA 1FX4A 3CUNA 2IJNA 1ZOTA 3AOBA 2ALYB 3TVZA 2KTQA 3HSZA 1WEZA 2ZBIA 4NZ0A 3DU6A 2BKOA 1NH8A 3IM8A 1Z2LA 2AD9A 1TFWA 3V2UC 3M8ZA 2WBRA 4DLGA 2VASA 2RQCA 3BJYA 3JYTA 3V6DB 1S77D 2ROEA 4NXMF 3CF5Q 1N5SA 2AJ0A 3RW6A 1Y00A 3HZEA 2DO4A 2VODA 1NCLA 3KDNA 4USJC 2JDJA 4TYAA 2ILZA 2BM0A 2AEJA 2GCFA 2J76E 5D4NA 2Q79A 2EEYA 2U1AA 2CQPA 4ZJLA 3B8HA 1KSPA 3P96A 4G1QA 4DCJB 4NLQA 4DV3J 1OYDA 4IR9A 1T05A 3MM9B 3FVYA 1WG5A 1EZZB 5DDQC 4WU3A 1KKHA 4YHHF 2ZH9A 2GV1A 1XEZA 4I4BA 1OY6A 4CZCA 4R0EA 3KNAA 3UN3A 4F0KA 3FMBA 4ZP8A 4LF6J 4V19J 5CD4A 3GPAA 4MK8A 2B5JB 5E33A 4RBUA 4IH7A 3QAUA 1RWWB 5DG7A 3X1LB 2MSTA 4DR3J 3KHRA 3JS9A 3GYNA 2MKHA 3GMGA 2RJZA 2MQQA 3DLJA 1Y4ZB 1RTDB 4IQMA 2CPIA 2JC0A 1PIEA 4CYUB 1UA0A 1RBLA 5CYMB 3L4BC 3PRDA 4DR1F 2LMIA 1B4SA 4KRWA 5B0BA 1J5EJ 4XTTA 3RAXA 3C3LA 2ZH3A 4DN9A 2W01A 3QLHB 4YOEA 4JP8A 2ZDPA 1SC6A 3OTBA 3C15A 4JI7J 4QWCA 4X4VA 4BCAA 3RRKA 1PBAA 2AW0A 3DLEB 1T95A 2EI5A 2EG1A 5ADZA 3DU5A 1YJVA 1SIWB 3CCUS 3HVTA 2AJ1A 3KNGA 4HDGA 2DB1A 2VZ9A 3ZZPA 3R1HA 2V6AA 2H4YB 1NK0A 2QA2A 3GE9A 3H5XA 5KT7A 4FXVA 3OT9A 1S12A 2VG7A 1IM4A 2W7OA 4Q5VA 3CDEA 4B3TF 2HAFA 1WELA 4KO0B 1MWYA 2AMCB 3PJ9A 2BE2A 1KD1T 4LIWA 5DDPC 1S4EA 2XS7A 2YWHA 4ZVRB 4DX8H 3J7YI 5BYRA 3UDLA 3PVXA 4OYPA 3BKTA 3SV4A 5ETTA 2G13A 1FD2A 3AHPA 3GFYA 3BSOA 4GKJJ 4KGMA 4QIVA 2MJNA 5G4DA 3QFHA 4PXEA 4R8UB 1RCOB 1S48A 4HDHA 3UW1A 3EZOA 4NLWA 4FBUA 4ZVGA 3CJKA 3HI9A 1S99A 1H38A 4DCOB 3H8YA 3D1QA 2MKJA 1FRJA 3H7HB 4ES2A 4FYWB 1D9AA 2YTCA 2CQ4A 2YH1A 1S6PA 3C14A 1H74A 1H2UX 1S1UA 3QMQA 3O44A 3W5XA 3MMAA 4HLBA 1HMVB 1CULA 5B0EA 2DHSA 4WP3A 1S5ZA 4LR8A 2I38A 1VQ4S 2E7WA 4WFAQ 5EGYA 3QGGA 1PJ6A 4DL6A 3CNQP 4WYWA 4NLSA 2AQ4A 1Y7PA 4MKBA 4X64J 5EWEA 4DZ6A 4WFZA 2E7XA 3KHLA 3PDNA 2OPPA 2QIFA 1O51A 1J27A 5K14B 1DTTA 4IG0A 4K8RA 2HFNA 4Z37A 3IBWA 1VBKA 1GTHA 4F04B 1ICEB 2PDAA 2UUBJ 4ILRA 1REVB 3Q2SC 4OX6A 2UU9F 2J7WA 2K1RA 3QT5A 1R31A 2QLFB 1H72C 3BREA 5LMUJ 4Q0BB 1UMJA 1IR1A 1KFSA 1CBKA 3J7ZT 2JEIA 1P1TA 2PI4A 5JJBA 3KLVA 2DGSA 1RT4B 3HHLB 1LK5A 2KJVA 2ZKUA 3AAWB 2ACMA 4QBUA 2FVRA 1V3RA 2XG8A 5EWGA 3NMAA 3VAHA 2YNFB 5HLFA 4MFBB 4TXSA 1GMUA 3ILLA 1SKRA 2BVZA 1N5YA 2WVBA 2RE1A 1HI0P 5D0HA 3IBCB 2V2VA 1Q7LB 5E0OA 3KLHB 3UDVA 3AODA 3OHBA 3DLKA 4Y34A 3FDSA 1RAFB 1UJ4A 2QL7B 2XMUA 4FPRA 4H4KC 2X1GA 2MZ1A 5EX3A 1MMLA 2B51A 3OQ2A 3BH6B 2FJAB 1FTRA 5CZVA 4P9SA 1YDLA 3M32A 4JI4J 1IBMF 3VTIA 3MMBA 3I56S 2CQ3A 1SL0A 4NL5A 5GAEI 3NBPA 2X1BA 1N34J 2GHWA 2YX1A 1YHQS 3HO1A 4KYZA 1R27B 1X5PA 4ECVA 3Q0AA 2VIHA 1XIQA 1RSCA 2KVIA 1LW0B 2MZJA 3GV8B 2IM3A 4OYWA 3UN5A 2BOPA 1M5PC 3A8JA 3OUYB 2I5JA 3NGRA 4ECZA 3DI6B 2OLWA 2R8KA 2BX6A 5AXKA 4J9OA 4TYBA 2G0CA 4WBFA 3LGHA 4NZ6A 4EYHB 3MD3A 1VQKS 3I9ZA 2IRXA 3AD9C 1UETA 1WC6A 2FHJD 2AKWB 5J2PB 3N0VA 3MMJA 4DBQA 2DNOA 2QLJB 1FVQA 2RQKA 4K4YA 1T11A 1QAJA 3CMQA 3BV8A 3W62A 2LDIA 2BE7D 3CCLS 2D69A 2EK1A 1RKJA 3QAEA 1S1VA 1WF0A 5KFWA 1Q86T 3I4PA 5L8RC 3WIVA 5M2UA 1DARA 1G7CB 4C7QA 3RU0A 3A4TA 4GO7X 4FF3A 1REGX 4L3NA 4IFVA 2YH0A 4DR6F 2DD8S 5A8RA 5I42A 4F8RA 2NQPA 3CD6S 5HMWA 3TP2A 4TU9A 2FHJA 2UZAA 2VC0A 4K4UA 2RRAA 1SC3B 3MM6B 4F7VA 4TN2A 1LW2A 1SI9A 5CZXA 5B0DA 2G4BA 3BQ0A 3PYFA 3GIRA 3UWTA 1Q82T 5DO2A 3POTB 2M8HA 1U0SA 1WDDA 5KG6A 1CJKB 3DM2B 2XMAA 2GHPA 2VG6B 5CHCB 2XNRA 1RWNB 3M6UA 2DXDA 1JB0C 2UXCJ 4JV0A 3UVJB 2CPHA 1LWEB 1RTHB 2C2KB 3I0RB 4RBTA 1Q53A 2P6SA 3EXYA 1JWWA 3GSDA 2QN6B 3M2UB 1C0TA 2CQIA 2ZJRQ 5IZHA 3AXMA 2JRSA 4LFBJ 4O3SA 3BGFA 2LDYA 3ADAC 3PYGA 3EPIA 2BJ9A 1R7IA 2DNGA 4DUYF 4DS5A 3BPSP 2IBKA 1TKTA 4LBPA 1K1QA 4ECXA 3M4XA 3GSIA 2WW8A 1HBUB 1YJ9S 5C25B 3EVOA 2JX2A 5D78A 5JVGQ 2Z2YB 4MKVA 2FC8A 2FZGB 3OTOF 4DV7J 4G3IA 4P2FA 2MZQA 3V4IB 4RW6A 2RQ4A 4P7VA 3MPWA 2VQFF 2EBGA 1RQ0A 3AJ2A 1SQEA 1N5VA 2YNHB 1KLMA 5EN1A 3I96A 3LOUA 2CXEA 2GX8A 3NGKA 4C8OA 3ZZOA 4M5NA 3GR1A 5F3ZA 2DGTA 4CP5A 1N32F 3LANA 1Y11A 4JI2J 2JWNA 3BPDA 4J9PA 2R7UA 3OJUA 5C42A 4WIIA 4QCLA 3V81A 4FF2A 5L39A 3RUBL 4NYOA 1ITPA 1X7VA 1VLOA 3CW2C 3NWGA 2XWYA 3RYLA 2N7YA 4F4AA 3SCIE 5IT0A 2CIMA 1RAEB 1T03A 4GVLA 4CTAB 4OHZA 1VIOA 2LVWA 5DDOC 3BGOP 3HFVA 3CJSA 1SC4B 2F4VF 1XNRJ 1FE0A 2QRRA 2IMWP 1YQHA 4GC6A 2XYGB 1M1GA 3GLJA 2K06A 2AT1B 2KT5A 3GCWP 4J7CA 1N33J 1Q16B 4EZ6A 1RT1B 4EGLA 3DOKB 4PWUA 2R4FA 1NK4A 1FKPB 3JTOA 2HVHA 1TUVA 4QWBA 4LRAA 4KV8A 1JLBA 2XY7A 2BJ7A 3C6TB 2IAJB 4NLPA 3CCES 1X4HA 2Y1RI 3DGVA 2ZWPA 5FDLB 1EKSA 2ZNYA 3BZQA 2MZTA 2LKZA 2OH2A 2QSFA 5KFFA 1VOMA 4K2XA 2RRNA 3QSYB 3GG0A 2HFSA 2BUNA 2QEXS 4JV5J 3IS9A 3TQEA 4O44B 4KTQA 4MK7A 1UEVA 4EUVA 3TUPA 2VF3A 2W7AA 1L3UA 1OQ6A 2D74B 5E3RA 2AF6A 2V94A 4LFAF 2V68A 5JXSA 3QO9B 1D09B 3RBDA 3M8RA 4OV6A 2MZRA 3CJ4A 1AW0A 3QWUA 4I2PA 4OJGA 3VAMA 5KOXA 1LV5A 2JEJA 2FLPA 2MGZA 2CNOB 5I3PA 2E44A 1BXNA 2GO9A 2W2MP 3M6XA 1TQLA 3LGMA 2H1YA 4QWDA 4M8LA 4LBHA 3G71S 3M8QA 4BDPA 1JXLA 1I94F 1X5TA 4DL4A 5CYMA 3MPVA 3AD7C 1VBXA 1FD8A 4FKYA 1X4GA 2RUSA 1W25A 4OJHA 1EETA 3B4MA 1KOHA 2D41A 4ZVEA 1X0FA 2B7BB 4CO1A 3CTRA 3GV5B 1T3NA 1GQEA 3R6LB 5CYJA 2R7TA 2DY1A 1H0HB 4KPCA 4I64A 1NM2A 1WC5A 2GS8A 3I5AA 1HWJA 4Y6IA 3CCQS 2PN6A 4U8VA 1C1CA 1UEUA 1D1UA 1T3OA 3LW5C 2XZWA 2ZH6A 2RKIB 3UD3P 4MYUA 2JHEA 3K7RA 4HI2A 1FXLA 3RB3A 2Z58B 3S01A 1NO8A 4U95A 3D5MA 2ZZNA 4NLRA 1RU2A 4PG5A 4ANEA 1VC6A 2HHHF 2GVDB 1Q95G 2FJXA 4K4XA 2JLEA 3HULA 3LO3A 2R7XA 4G6VB 1Y0HA 3CC2S 4M5DA 3JTPA 2EW9A 2R3VA 2YNGB 1CG2A 2VA2A 3FJ2A 1I6JA 2UUAF 3WX8A 3SMZA 2OFHX 4TU8A 1EP4B 4PRFA 2MQPA 5IS2A 1XJWB 4DV4J 3FGVA 1NZ8A 1U6FA 1LKZA 1M5OC 3LAMA 1UFWA 3H40A 3VQSA 4J9NA 4R8UA 5KFDA 4JOUA 1UVKA 4N5SA 1IQTA 4PG8A 3MZIA 4ZVTB 3QRQA 4RU2A 1TFYA 2BXJA 4F25A 3EDRB 4PYDA 3DHWC 3FCHA 3A8KA 2CPDA 3OR1B 1U8WA 3EJMA 4M5HA 3T5LA 1YJWS 2OTJS 2HWTA 4KHPJ 4HYKA 5B09A 2E5HA 1BLUA 4RWWA 1HWKA 1YX2A 1N36J 2F9JA 4DV0F 4X62F 2DTJA 4DR5J 2E1RA 1F3VA 4ELUA 4ZLNA 3FFIB 4DXLA 1S9GB 4LF9J 5E41A 2DCUB 2B4VA 3I82A 1GXLA 1TL1B 4CLLA 2RDIA 5CYQB 4QW8A 3JQKA 5DGAA 5KFEA 3BKFA 1YJUA 2RDDA 4OJ3A 2CWXA 1TKZA 4F2SA 1K0TA 2WW4A 4TQRA 1OWXA 4FXWA 1RYSA 1HI1A 5K14A 4ZPBA 1SB6A 3QPIA 4L72B 2HFZA 2JNJA 4NEZA 4OX7A 4OZ2A 2J9DE 4F0HA 1F0XA 4ES3A 4MIBA 3BQ1A 3CJ2A 2HRUA 4RKUC 2W9AA 3X3UA 1TMMA 4Q0BA 5L1JA 1UCNA 5M2PA 3GFZA 4NLYA 4I0WA 1CJUB 3QZ7A 2GZOA 1RT4A 1T9VA 1CLFA 3D0IE 3NAHA 4IRDA 5HP1A 3TANA 5E3CA 2FJBB 1JK9B 3T1YF 4LR7A 2MMYA 2X3GA 3MXHP 3KLFB 5I3UA 2MLYA 3K5NA 3R27A 1UFKA 2F8HA 2RVJA 2MLXA 2R8JA 5DM6Q 2VICA 4P74A 5DM7Q 1SV5A 1F3FA 2VKZG 2EWHA 4RWXA 4J37A 3SDEB 4W92B 3KUEA 4HVZA 3SBMA 3TYTA 1TU0B 3AA8A 2FLLA 1EB0A 3DCAA 2W7PA 5ITHA 3TVYA 1RHUB 1NMEB 3MM5B 4YEAA 1RWVB 4W4MA 3VVTA 1FXDA 2H3EB 5AXLA 2F5GA 1RK8A 3J7Z5 2R7SA 2UP1A 2XHCA 5C5JA 3SFGA 1H7WA 2VPYB 4DSLA 2CJQA 2AX0A 2XZTB 3LGNA 3RGIA 3IAM9 1YJNS 3DLHA 1RT2B 1GT8A 1HARA 2P9CA 1FT8A 4YB6A 1LW0A 6AT1B 1U7LA 1D9FA 3O5TB 3UO0A 1QSLA 4LRFA 4KT0C 2FTRA 3PYDA 4YHHJ 2CPXA 2GQCA 2E1CA 2PFDA 1RTJA 4J9MA 2ZH4A 1VC5A 3CC7S 2CNNB 2E9TA 3R5AA 1DAXA 5J2PA 1GH8A 2QA4G 1X4DA 2J9DA 4O3QA 4O23A 3CXCR 4H54A 3JSRA 1RYRA 2EKYA 2G2OA 1TAQA 3W9IA 4CH0S 4DR1J 2KXFA 1NSKL 1GMVA 5HBMB 4ZVUB 1WOSA 2HNZB 3S1TA 3DC2A 2CJ9A 4F2RA 1HPZB 5GMEA 4ED5A 4RW4A 3DRSA 4A8YA 2NSCA 3D2WA 2ZH2A 2W4DA 4DN0A 4RR5A 4ZVFA 2HHVA 4ZPAA 5J2NB 1RJJA 1BD6A 1F9HA 2Y1JA 5BR8J 4UQGA 4W98A 4BLGA 5B7WA 4RX6A 4XDCA 2FJWA 4OZ1A 2UUCF 2OI2A 2DK2A 1Q5VA 4CH1A 1ZTWA 3MR3A 2W9CB 4NA3A 2LA6A 1VJWA 4Y0FA 4X4UA 5DJBA 4XDDA 3KUGA 1KP6A 1LWCA 2YX7A 3NKYA 1Y10A 4KKOA 4B3TJ 4DDFA 2XQCA 2XS2A 4DG1A 4QIEA 2LEPA 1TZ0A 2GQ2A 4ZVPB 2W8KA 4UQTA 3MTJA 2BRKA 1W2IA 1RTHA 1AT1B 3I0RA 4WXOA 4ZLJA 4B3MF 1K1SA 1VQ7S 7FDRA 2HQ3A 1S97A 4ICLA 2ZUGA 2RQMA 1IKWB 4TY8A 3KLEB 3FEYB 3BB5A 4M5IA 2FDNA 1PYSB 3C19A 1FFGB 2B9WA 3DGPB 1NDCA 2HBRB 2CQDA 4B9UA 1BWEA 4HHJA 4EEYA 3ZZTA 5SZTA 1S0MA 3GYGA 2OEKA 4USUA 3TR5A 5C25A 3SFUA 3N79A 3KLGA 4WXWA 3R2DJ 3I5CA 3W60A 4EK2A 4PG7A 5HVHA 4XO0A 4ZVHA 1WKJA 4N8OA 1KTVA 1E6YB 4URQU 1PJ5A 4WK3A 4KGZB 6FDRA 4EI2A 1T0TV 5IQQA 2BJEA 5HJXA 2FHOB 3ENVA 2BEFA 3EX7B 4CQ1A 2D9OA 3BH7B 3KKFA 1JLQA 2KVQE 2PD1A 2F63A 3H20A 3G87A 2H5EA 1HBMA 2VPXB 1VHFA 3K59A 5T7LA 2B0GA 1MG7A 3ITHB 2R2UA 5GMDA 1CQNA 3SV3A 3PR4A 3J7YU 2DNPA 1QD1A 4MH8A 2R2SA 4CM2A 4WJBA 3CCSS 3ISZA 4A8WA 2V2KA 2ZH5A 1YZ6A 1ZTTA 2KDOA 2RU9A 1VI7A 2RMLA 2IY5B 1DY3A 2QL5B 3OBIA 4IH5A 2QMWA
chains in the Genus database with same CATH topology
4MK9A 4CCHA 2FHKA 4GKKF 2E5JA 3H59A 1HWUA 1HNIB 4YOEA 3KG4A 1LWCB 4ZA1A 4ZPVR 2ZDPA 4OI0A 2B7CB 1SC6A 4I2QA 3AB2B 4IQXA 4KKOB 1ZETA 1YITS 1P27B 3OTBA 1UW4A 3FQLA 3H5SA 1Q4RA 4I1TA 4DG1B 2BANB 2LQBA 4QWCA 4IOBA 3R5DA 2A10A 4BCAA 3HHLD 5D4LA 4F3MA 3RRKA 3CMES 1N0UA 1QUPA 2AW0A 3DLEB 1T95A 4EBEA 2EI5A 5BYSA 4WKYA 4HH0A 2CQ1A 2EG1A 4ZCLA 4YDDB 2N4DA 3GIMA 4U67Q 3PZPA 5ADZA 5G0RB 3W7BA 3CCZA 2MKKA 2YKMA 3DU5A 1YJVA 1SIWB 2P5VA 3CCUS 1S9FA 1DFDA 3HVTA 4K4SA 3V5RA 3M8SA 3QJLA 4CH7A 4BC7A 3I55S 4DLEA 1FKAF 3O6QA 3PX6A 4I7FB 2VONA 3G86A 2AJ1A 1JLGA 4ICLB 2XCPA 5D3GB 3KNGA 4ZK7M 2CVEA 4HDGA 2DB1A 3LP0B 1X5SA 4TY8B 2VZ9A 3ZZPA 5KFMA 2GA7A 2BA9A 3R1HA 1N52B 4ELTA 2GIQA 1N54B 1U25A 2A2DA 3CVKA 1NK0A 2C3YA 3QGPA 2QA2A 1JMTA 3GE9A 2KHDA 3H5XA 3TUIC 1DRZA 2QA4S 1IUJA 3O8WA 5KT7A 4FXVA 2QA1A 4PQAA 3NG8A 3THTA 1S1XA 5KFOA 2VG7A 1REVA 1IM4A 1JLAA 3TARA 1U4BA 2DNZA 4Q5VA 2W7OA 3NCRA 3JYTB 5FJ4A 3CDEA 4B3TF 2WONB 4IOCQ 3TVKA 5CCMA 5DG8A 1WELA 4KO0B 4N41A 5KFPA 2PT0A 1FERA 3KK2A 4YY3F 2OPRA 5C24A 2YKPA 4RZRA 5AJ3F 3K5PA 1VQ9S 2DPIA 2HMIB 2J9EA 1MWYA 5J1EB 1QY7A 5KFUA 4PXBA 2BV3A 2E1AA 5KFKA 3MM8B 1TAUA 1RI7A 2BE2A 3K8VA 1TKXA 1KD1T 2FHMA 4HH1A 3T5JA 3KLGB 2JVRA 3HKWA 4LIWA 3AQOA 1DQ9A 2M0GB 1NH7A 2QYCA 5DDPC 2XS7A 2YWHA 3HHLA 3TAQA 4DX8H 3J7YI 2LXFA 3KYLA 2J0QD 3VAJA 5BYRA 2V4JB 3UDLA 1NRKA 3TA0A 1HYSA 2HIQA 4G1QB 3H2UB 3PVXA 2KG0A 1DJ0A 4DS4A 4X4RA 3SV4A 1T05B 4DL3A 2LEBA 1IQZA 2G13A 1FD2A 5I3QA 2YNFA 3PKMA 5HMZA 2R9LA 2LEAA 3AHPA 4MFBA 4UY8T 2CVIA 3GFYA 3M9NB 2Z2LA 2BQ3A 1Y5LB 4PQUA 3BSOA 4IKAA 2DVIA 5IT9Y 1KC8T 4KGMA 1RT3A 2MJNA 4QIVA 5M2RA 5G4DA 4C2MA 3OVBA 1UL3A 2MQNA 1FVSA 4E0DA 3FRZA 4PXEA 2V9KA 4R8UB 1PO6A 4H4MA 1URNA 1Q8IA 1S48A 4HDHA 3UW1A 4NLWA 1JLQB 2DRAA 4FBUA 3E2EA 3BDEA 4ZVGA 4F02A 2ZFHA 4LFCF 4I6WA 1BQMA 2V8DA 3KLHA 3CJKA 5DQGA 3J7A1 3HI9A 1S99A 1FDAA 1FESA 4WFNQ 5F9LA 1PC4A 2ZH8A 1H38A 1U2FA 1LWFA 3H8YA 2R8HA 3D1QA 1HBMB 4ID5A 2MKJA 5T7LB 4JI3F 1FRJA 2WOMA 5H1SV 4ES2A 5K8NA 1D9AA 3JSMA 2YTCA 2CQ4A 2YH1A 4J9SA 4RW9B 1S6PA 2M2BA 3OFGA 4Q2MA 3D1HA 2XMTA 5F8JA 4N56A 4W90B 3MM7B 3DRYA 2ZHBA 1H2UX 1HNXF 2FGCA 1Q78A 4X4PA 1S1UA 3QMQA 2HVZA 4DV3F 3W2VA 1Y9OA 3CEDA 4FYDA 1KNZA 3O44A 4DV4F 2DR5A 2E66A 2Z8QA 5D6GA 2MY7A 4NZ7A 4ZCKA 1Q7YT 3MMAA 4B17A 1UA1A 3MUTP 2KYZA 4DFKA 4FNIA 4JI0F 2CJBA 5A8WB 4HLBA 1UJ6A 4DFMA 4BBYA 3ZZZA 2IA0A 1RT6B 1RTIB 1V3SA 4WK1A 1SKWA 4ED2A 2CG4A 1JNRB 1HMVB 1R6YA 4FN5A 3HHDA 2CQGA 1LOUA 4PG4A 3BSAA 5LT5A 4K4WA 2QLXA 3BDPA 1VQOS 2J7UA 5B0EA 1K8AT 1RA6A 2DHSA 2W24A 4DR2F 3WZ0A 4LF6F 4R5PA 1VS3A 4DUZF 4V19X 1QE1A 2I38A 5E3PA 3FEXB 1VQ4S 2KHCA 2E7WA 3HHLC 1HWIA 4QJVA 2O66A 3H2LA 4WFAQ 2DJWA 5EGYA 2MY8A 3QGGA 4DR3F 4GMKA 3U1MA 3IC1A 1CC8A 2VG5B 4DL6A 3MTKA 4WYWA 5DGBA 2YKMB 3VF0B 3OUYA 4NLSA 2AQ4A 3GV7B 1Y7PA 1BC6A 4MKBA 1FDBA 2E5IA 1R8PA 1UJ5A 3DI6A 3DRPA 4ZMMA 2POKA 2O67A 2RUGA 3EZUA 5EWEA 1U2RA 4RNOA 4WFZA 4DL7A 1L3SA 2WRMA 4NOHA 3BQ2A 4AXJA 2E7XA 1C2PA 3CD5A 1JLGB 3MECA 5KG3A 3KHLA 1C1BA 1N36F 5LSOA 2RKIA 4C8LA 3PDNA 4NLDA 2XC9A 4C3LA 3IRWP 1E6VA 2Y1IA 2DHGA 4N8NA 1YI2S 2OPPA 4QR0A 2QIFA 5KFVA 1O51A 2ZNZA 4QWAA 3GWCA 3M9OB 5K14B 2PA8D 3UD4P 4LUBA 4Q2LA 1DTTA 4IG0A 2KFNA 4H4KA 1FF2A 2HFNA 4Z37A 3IBWA 1GTHA 5BJRA 2D3OR 4LIRA 2D3ZA 5L1IA 2PDAA 4JV2A 2E9ZA 5JVHQ 4O3NA 1J5OB 1S1XB 4DQPA 4ILRA 2VG7B 1REVB 1U45A 1JLAB 4LF9F 4FXDA 4LF8F 2QT7A 1K9MT 5GAEU 2JSXA 3I4HX 2GNKA 3Q2SC 4JI7F 4OX6A 2UU9F 2J7WA 2K1RA 1R31A 3RBEA 4LSLA 4A8OA 3MURP 4RUHA 2OPRB 3BREA 2NS1B 3JAMY 2MSSA 2OMLA 4Q0BB 2C3UA 3AH6A 1UMJA 2KRBA 2YNGA 2H9ZA 2HW3A 4Y3CA 4CT9A 1KFSA 3ICLA 2R8IA 1VQLS 3US5A 3KMSA 2BBEA 2EC0A 1S6OA 2PC6A 3ZC4A 1TKXB 1SH0A 3NCPA 3J7ZT 2JEIA 1EP4A 2YWKA 3KOAA 4A46A 1P1TA 4F4ZA 2PI4A 2VH7A 4TLQA 5JJBA 3KLVA 2DGSA 1RT4B 4TNOA 2BR0A 1SJRA 2AGQA 2P6TA 5AE1A 3HHLB 1FRIA 3QJPA 5KFJA 1LK5A 3M2RA 2VPWB 1KVIA 1S72S 2DGVA 1HYSB 3OPKA 2KJVA 2ZKUA 3AAWB 1M0SA 3FSXA 4C3MA 2XI3A 2IA6A 3IWNC 1VFJA 4QBUA 4RNNA 3DN9A 2FVRA 2O1PA 2WSEC 1V3RA 2IFXA 2XG8A 5EWGA 3CPWR 4EFAC 3NMAA 1RT5A 3VAHA 2YNFB 4C0OC 1SJ3P 1JX4A 5HLFA 1J2VA 4KQZA 4MFBB 2K7KA 4RLEA 1SBRA 2G1DA 5KFXA 4IO9Q 3OHAA 2FY1A 4TXSA 4JI6F 3M1VA 2ADCA 1SKRA 1RT3B 2BVZA 1KTQA 1VBYA 2X1FA 1N5YA 1HWLA 3BGLA 1ZBTA 3MFHA 2RE1A 3CJ5A 2FB0A 4F4YA 2M70A 3AA9A 3LPYA 4HT7A 2OIHA 3BSNA 1XK8A 3DOLA 3J81Y 1HI0P 3PJXA 4YB5A 5LL6d 4ED3A 1VQ5S 4C8ZA 3MR2A 2LECA 1KEKA 3N01A 5K8PA 2NR0A 2LLZA 1Q7LB 2VBZA 5E0OA 4A8FA 1AUDA 3MM6A 1BQMB 2PO4A 3KLHB 3CJKB 1FNMA 1IBLF 4NLTA 4ZP7A 3OHBA 3DLKA 4Y34A 2ZOFA 4ID5B 4LJMA 4ECSA 3FDSA 4KAIA 2WOMB 3OSNA 3JSMB 4FP9A 2GGPB 1UJ4A 1S6PB 1VRUB 3T6JA 3RR8A 2XMUA 4FPRA 4H4KC 1YJRA 2X1GA 3LF0A 3POTA 2DR7A 5KG7A 3W2VB 2V0NA 5F41A 5AE2A 2LU1A 5KG0A 1XNQF 2MZ1A 1H7XA 2M5YA 1FRXA 1HW8A 2XSJB 1X4AA 2V5HG 3DM2A 4C4WA 1U26A 3O1LA 1HL6A 3F41A 2R8GA 2VG6A 5EX3A 2DIVA 1MMLA 3HVRA 2NSBA 2B51A 3OQ2A 4ZHRA 2XS5A 3OTDA 4GKJF 2FJAB 4DPOA 1FTRA 5CZVA 4Y2AA 1CVJA 3M32A 1IBMF 3VTIA 3MMBA 2JOQA 3I56S 2R7WA 1XMQF 4DSJA 1S9GA 2CQ3A 1ZAVA 2M7SA 1LWEA 4YQWA 2VD3A 5DQHA 4NA1A 1SL0A 1U24A 3IR5B 4JI1F 3ZZUA 4NL5A 2A18A 4B9VA 5LJ3Y 4ETZA 1CSJA 5GAEI 3SSSA 3NBPA 2CQHA 2XMMA 2X1BA 1X9MA 4R5PB 2ZD1A 3QWPA 2GHWA 2YX1A 4OX9F 3SCKE 1X5OA 1FDNA 1YHQS 1S0OA 1HNZF 3HO1A 1WF1A 5E3QA 2DR8A 3T6BA 1GXTA 1R27B 1X5PA 3PEHA 4ECVA 2MKCA 3M2UA 4X4QA 3Q0AA 4WFBQ 2RSQA 2V4QA 4EZ9A 4YB7A 4BHQA 5L1LA 4YFUA 2KVIA 2OP5A 1LW0B 2MZJA 4O0IA 3GV8B 2IM3A 2GC8A 4G1IA 3PW5A 3I0SA 2BOPA 1M5PC 2AX1A 3HHKA 3OUYB 2I5JA 2PSZA 3E01A 2JJ4D 1FDDA 2KM8C 4DHVA 4ECZA 3DI6B 2OLWA 1WI6A 2BZ2A 3DRPB 2MXYA 4ED1A 2R8KA 4PUOA 3N6MA 5AXKA 4J9OA 3NL0A 4TYBA 2HQIA 2CPEA 2G0CA 3IGVA 3C6UA 1SH3A 2EBEA 4NZ6A 4J9KA 1RT7A 2V8VA 3MECB 4EYHB 3MD3A 1C1BB 4AYBD 1VQKS 2CYYA 3I9ZA 3VWSA 2IRXA 1E6VB 2D1CA 2I9SA 1UETA 2OTLS 2KB2A 1HBNA 3HFKA 4URSA 3HK2A 1TL3A 2DNHA 4OFZA 4IG0B 3FSYA 2FHJD 1HBUA 5J2PB 2CPJA 5MAOA 2ASJA 3N0VA 3PO5A 3C2PA 1ZZNA 1UVLA 3MMJA 3V6JA 4KBIA 4NPOA 4LSNB 1QVFR 4PKDB 4DBQA 1VQ8S 2ZDOA 2DNOA 3K2YA 5IT4A 4P7TA 4ZDNA 4WYLA 4LF7F 5AXMA 3VQTA 4PXCA 4EU0A 2V8HA 3C46A 1FVQA 1ZPWX 4QYZJ 1S1WA 2FJDB 4HL9A 2DCLA 2RQKA 2K1RB 4K4YA 4NLVA 4DSIA 1DQ8A 4LSLB 4OLPA 4Y2MA 3V4IA 1QAJA 3Q24A 1WNEA 3EGWB 5KFAA 5FLXY 1FKOA 3PKYA 4K50A 3OVAA 1N0VC 2LDIA 2W25A 4RUAA 4ZCMA 2YNIB 1U1KA 3HVAA 1Z4UA 3CCLS 4X64F 2EFPA 4I69A 4IYQA 2F7VA 2RS8A 2YNHA 2EK1A 3RB4A 3QAEA 4QZVB 1RKJA 1NKBA 1S1VA 1WF0A 1O8BA 5KFHA 5KFWA 4DJBA 3NCQA 1L5UA 2OD4A 4RNHA 1Q86T 4K4VA 3TO8A 3UCZP 3I4PA 4QIGA 5L8RC 1T8EA 1QLNA 3M30B 2J7KA 5M2UA 1DARA 4NLUA 5GVQA 1G7CB 4O3PA 3RU0A 4C7QA 1JJ2R 3CSKA 2RH3A 2AU0A 1FEHA 3FQKA 4FF3A 4GO7X 5KFBA 4ES1A 2HNYA 3WC2A 4L3NA 1F9FA 4IFVA 3UNGC 2YH0A 2L48A 1RT5B 4H4OA 3CT9A 5KFSA 4DR6F 2DD8S 1UKUA 2FC9A 1TK0A 5A8RA 1RDRA 3CE8A 3T19A 2VBYA 5I42A 2UVWA 4F8RA 1IJFB 2E29A 1IKXA 4KE5A 3VALA 1LQ9A 2NQPA 3M1VB 5DG9A 3CD6S 2IJFA 2PA3A 4PR6A 1TP7A 4WE1A 4A8MP 2CJAA 2NPIA 1WI8A 4AE5A 3FMWA 3UR3C 1OS5A 3PHEA 2W8LA 5HMWA 3AY0A 3DOLB 5CQGA 3TP2A 3W2WA 5KFNA 4TU9A 4K4TA 5LMUF 2FHJA 2OAUA 2VC0A 2MJUA 2UZAA 3FZBA 5E7OB 4RNFA 1CPZA 4K4UA 2AYBA 2RRAA 4NCGA 4Y2KA 2LQ5A 3MM6B 3QJJA 3OR2A 3MPYA 4ED0A 2CPZA 2IYGA 4Q8FA 4TN2A 3DLKB 3R5BA 1XTZA 2VFSA 3BR9A 1LW2A 2YWGA 1FK9B 1SI9A 5CZXA 5B0DA 3PX0A 1OSDA 3TAPA 2G4BA 2OSQA 3I31A 1TV6A 3BQ0A 5T14A 1TL4A 3I5BA 5F8HA 3FSIA 4CTAA 1R0AA 3BGRA 2GJIA 3UWTA 5LJ5Y 3CMAS 4NXNF 1Q82T 4ZCIA 3G6ES 5DO2A 3OFHA 3HHEA 3POTB 5F8GA 2VQEF 2M8HA 2CJKA 4MTPA 3T1AA 1NHVA 5L9NA 3O3LA 5KG6A 1F2GA 3N9UC 1NKEA 1TKDA 3DM2B 3KG0A 5MLCV 3U1LA 1L3VA 4A48A 1RA7A 2XMWA 2GHPA 2DNKA 3E8OA 1HNWF 5CA5A 2VG6B 2JEFA 3THPA 5CHCB 2XNRA 1T94A 4ZHRB 5BR8F 1URRA 4AL6A 3G6VA 4DMZA 3GG1A 3M6UA 1YIJS 5DS7A 3DMJA 3PV8A 2IC3A 1JB0C 3M32B 4ID8A 4D3GA 1KLNA 3MMBB 4F67A 4JV0A 2XEXA 3TQ1A 2CPHA 1LWEB 3VAKA 1RTHB 1FRLA 1IR0A 2LXIA 3T3FA 4KFBB 3I0RB 4LF5F 5A6WA 3NNCA 2DNMA 2Z0GA 4RBTA 1VK3A 2MQMA 4ILLA 1RT1A 1Q53A 2P6SA 2ZD1B 3DLGA 4MAKA 3DOKA 3EXYA 5CH7B 3TI0A 3MWBA 3QGHA 1JWWA 3GSDA 1SL2A 3M6VA 5J2QA 4DV1F 1FKPA 3M2UB 4IR1A 1C0TA 3SZ2A 2CQIA 3KK3A 5HMYA 3OXFA 3N5BA 2ZJRQ 5IZHA 2R7RA 3DLLQ 3DRRA 2JRSA 3ENWA 4WZMA 1FCAA 2RB7A 3I0SB 2ZJQQ 4O3SA 3BGFA 2LDYA 3J80Y 2CQBA 2I5JB 2K3IA 1ZAXA 3C6TA 2XGPA 3E01B 2IAJA 3EPIA 4C11A 5LSRA 1R7IA 4PUOB 1FA0A 2YKOA 3T5KA 5FDLA 1UVNA 2BYCA 4LT6A 4RW7A 4QIWD 3C6UB 2DNGA 2V8GA 3AJ1A 3JSYA 1HNVA 2KXNB 3Q8SB 4DUYF 3CJ3A 3TRGA 3KK1A 3RRHA 1ZH5A 4DS5A 2JFDA 2AYEA