4QIFA

Crystal structure of pdua with edge mutation k26a and pore mutation s40h
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
b'QQEALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGHGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propanediol utilization protein PduA
molecule tags Structural protein
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title Selective molecular transport through the protein shell of a bacterial microcompartment organelle.
pubmed doi rcsb
total genus 21
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qifA00
3MPYA 3MPWA 2A1BA 3DN9A 3PACA 4P7VA 4RBVA 3SSQA 4QIGA 5DJBA 4PPDA 4AXJA 3VCDA 3DNCA 2G13A 5L38A 3CGIA 4P2SA 4QIEA 4OX8A 3NWGA 4OX7A 2A10A 2A18A 3H8YA 4OLPA 4LIWA 4OX6A 3BN4A 3NGKA 3I96A 3IA0A 3SSRA 3I6PA 4QIVA 4RBTA 3CIMA 4RBUA 4OLOA 4AXIA 4DDFA 4QIFA 4P7TA 2EWHA 3SSSA 3N79A
chains in the Genus database with same CATH superfamily
3H5YA 1AB8A 4K2XA 2YKOA 3DLHA 4UZCA 4WFZA 5H9FJ 2FQQB 4N56A 4ECXA 4DSLA 2Y0SD 4WE1B 5G4DA 4ECSA 2FJDB 1BLUA 3R1HA 1UTAA 3SI8A 2IYIA 3JAMY 2CJYB 4RW8B 3LP2A 3WX8A 3CDEA 4M5IA 4HDGA 3VAFA 3MPVA 3EPIA 2FY1A 4MKAA 3CPWR 4DL3A 2LDIA 2BE7D 3EXYA 3CW2C 4FZVA 3VZIA 3W2WB 4QWAA 2AJFE 3DMJA 4ED2A 2EFOA 2IBOA 2ZDOA 1NJWA 2CAJA 2UV8A 1NHVA 1NSAA 4C0OC 3OXFA 2ZH1A 2DRBA 1D9AA 5IS2A 2WSFC 3QJLA 5IWAJ 2V2QA 2DNOA 3KK3B 1NDCA 1UP1A 5GADI 1ZPWX 3DGPB 3Q8UA 1KS2A 4HH1A 3SFGA 3QIPB 1TL4A 2J6SA 1RHMB 3SCJE 2IM0A 5F8HA 2KZZA 2RKIA 2F8MA 5KAKA 3TYTA 2KDOA 4DCJB 1RTJB 4DG1A 4QR0A 3BGRB 1U1LA 3KLEB 2QEXS 1G4CA 2DGWA 2X3DA 3M32A 4DS5A 1IBKJ 4L76A 4BC9A 3VAJA 5THWA 5KTQA 1AFIA 3N5FA 4QPTA 3AD7C 2J6UA 1GTHA 3VZHA 2BKOA 2G1DA 2YX1A 5KFJA 3LP1B 5J1EB 1N5QA 3CGIA 2DK2A 1RTDA 2Y1IA 4EZ6A 2CNLB 3EGNA 1FRJA 4U7UK 3HPOA 3I5BA 1XQIA 1FI4A 2CYYA 3I9ZA 2AW0A 2W8LA 2XWYA 1UVLA 2DGOA 4C3LA 2J0QD 1KQFB 2DHHA 5JMNA 4LSZB 3MM8B 5AXKA 1JQGA 5B0DA 5DLGA 3B78A 4JI8J 4HTJA 3CJ2A 4WXWA 4HDHA 1S10A 1REGX 4ZPDA 1LWEA 1KSPA 1TZ0A 1WF1A 3RBDA 1WEYA 5KFXA 4DR1J 4Q0BB 3AD8C 4ZVSB 4C6AA 5J2PA 2E9RX 2V6AA 4MAKA 4QYZJ 3BBCA 4MJKA 1DAXA 1ROFA 5H9EK 2E5JA 4PCQA 1RAGB 1KC8T 1CSJA 3BQ2A 3DOMB 4KKOA 1NSQA 4Z7CA 2LKZA 1FVSA 3NBPB 4ZPVR 1LQ9A 3CJQA 3DRRA 1LNQA 1P27B 4KGXB 3M8SA 4DV5J 1BXNA 3NRBA 1F3VA 3H2UB 1SUQA 4DL4A 1U1KA 1T9XA 5CH7B 1K9MT 4YFUA 4NCGA 1WKKA 4MYUA 5GAEU 3DRPA 1VQ7S 1FF2A 2CVEA 1IBKF 1QM9A 3BDEA 4LFCF 1T95A 1SH2A 3TX8A 2V69A 2VQFF 3M8ZA 2BA9A 4QIFA 2VV5A 3H2VE 4TY8A 2V68A 1JJHA 1NH7A 2AJQA 2DNHA 2CJAA 4Z7YA 4JI2F 4K4TA 2Q66A 5I3UA 3ILLA 1HNIA 4OQJA 3MCNA 1KLMA 5HLFB 4USKA 1LW0B 1HQUA 1RAOA 3EVOA 4KYZA 1TKXB 2MKCA 2C28A 1C1BB 1LW2A 2ZOMA 4WWSA 5BYSA 1EJ7L 4X65J 3TZXA 1FTCA 3A4TA 2Q6CA 3OFEA 4M5DA 1F9FA 2LU1A 2NYHA 1W25A 2YNHB 4I2QA 4PAAA 2R8GA 2XO7A 4BS2A 1U25A 4KV8A 3HXMA 3EPGA 4D3GA 3NGKA 3LANA 2J0XA 3OTBA 1S6UA 5EX3A 1QUVA 1L3KA 3Q8VA 3G96A 3MUTP 1C0TB 4WJBA 4G1PA 2GJFA 3VAMA 4B9NA 1B64A 1AYEA 3AY0A 3PNIA 4CYUB 2UXCJ 3IBWA 1JLEB 4NA2A 4X4OA 3MR6A 4H4KA 1OSCA 2BABA 1S7HA 2CQCA 2EFGA 1C2PA 4WBFA 2LA4A 4P71A 4QWCA 4EBCA 2JLGA 1K8AT 5KFCA 2HIQA 1GX5A 3TX0A 4NLOA 4F3QA 1D0EA 2GIFA 2QLBB 5IFMA 1LOUA 2AYMA 1XIQA 5DDOC 2UU9F 5ETSA 4WP3A 3NS6A 5LMUF 3MPUB 2DNQA 3UVJB 4CZCA 4X4RA 2QYGA 5ETNA 5ADZA 3OL9A 1MSWD 3G6ES 3V6DB 3JQKA 2Y8WA 3P3DA 1VHFA 3K0JA 1WOSA 2FZKB 1N56A 2XSJA 4W4MA 1ZS6A 2CPXA 1YWXA 1IJFB 2QFIA 3HI9A 4PXEA 2EFPA 4ZS6A 5B0BA 4Q43A 1HWIA 3DOKA 1S1WB 3TQEA 4UY8T 3W5ZA 3EZUA 4M8LA 3WQPA 4X64F 2C2EA 4XDDA 3MM7A 1JLAB 5ETPA 5C42B 1RTIA 1FDNA 2J76E 1YRTA 4USTA 2HFOA 1NPPA 5CYQB 5BYRA 1S1WA 2RDDA 3PRBA 4NE9C 4RNMA 2OTJS 2GZOA 4A8YA 2WVDA 4DV7J 2CQDA 1HNVA 3M6VA 1UWAA 4O4GB 1HI8A 1S9FA 4TYBA 4M5MA 4ZN3A 2GJIA 2YQ0A 2B43A 4QW9A 4PG6A 2HVEA 1U1MA 2JEFA 4B9TA 4DV3F 4RR5A 2RRBA 3FBFA 3RGIA 3ADAC 1A0OB 4DV3J 2P5VA 2NPIA 3ZFVA 1MROB 2XBPA 4CLZA 1OS5A 4OHZA 3GJRB 3DXSX 3VWSA 4L72B 1U1QA 2V4JA 2KM8C 3C2PA 1EKRA 1S9GB 3C19A 4XO0A 1VK3A 2B9WA 2G1HA 2PA8D 2YWKA 3I0RB 3FSXA 2MZSA 4RNOA 1RAFB 4CO3A 3VAGA 2RKIB 5DO2A 5AE1A 1KQGB 5F8GA 1Y3JA 2CQHA 2IDEA 1TL1A 3QATA 5GAGI 1FFSB 4KY3A 2K2PA 1JXVA 4IFVB 4ECVA 2DIUA 3SMZA 2CJXB 3D1HA 3HHLC 5MLCV 1VLOA 2XCPA 1U1NA 1IVZA 2J6TA 3LOUA 3DDKA 3HSJA 2XY6A 2LQ9A 2F1FA 2F4FA 1DFDA 2KVQE 4IOCQ 2FPHX 4RW9A 2QC3A 3IS9A 4DN9A 4ZVOB 3OFFA 2R7SA 3QFHA 4Y00A 1W2BR 2WHOA 1BE4A 3Q8PB 1IKYB 2BQ3A 1Q82T 4K4UA 3THPA 4DR5J 2A6MA 5KOWA 3IM9A 1RHQB 2UUCF 3SCLE 3TQ1A 5HBMB 2GA7A 2V8DA 1N5VA 4UZBA 2FHJA 2GVDA 2VB6A 4WCEQ 2KHDA 1HHTP 4F4KA 5EWFA 2KT5A 4LF9F 3PYFA 2QA4G 1WC5A 1RISA 4DZDA 2N82B 4LMZA 1B7FA 2UXCF 4J9VA 2A2CA 1EB0A 1YG0A 2XMMA 1YKWA 3D67A 3GJSB 5F8LA 2RF2A 1R8HA 1YBUA 5ETVA 2K06A 3DRRB 1M1KT 3D1QA 3DOLA 5BR8J 1PCAA 3QAEA 2HHSA 1XMQF 3Q2SC 2CG8A 2OPPB 1FRMA 1RA6A 2RQ4A 3D0HE 2M4MA 4MIWA 3HCXA 3KOAA 2OPQA 3WC0A 5DDPC 4FBUA 2L3MA 5HVHA 3G86A 2MKYA 3OTOJ 4WK1A 5CYQA 5KG7A 2RRAA 4ZK7M 3Q86A 2NZCA 3PACA 2R8HA 5IC4B 1ZZNA 2HLUA 4ALZA 3PM9A 4L3KA 2E1CA 4YR0A 2XYHB 1RT2A 4IG3A 3FRZA 5HMXA 4RW6A 3KHGA 2BOAA 3IN5A 3W3SA 2EBGA 2OFGX 1DQ9A 3E01A 3MMBA 2KRBA 3QAUA 4ERDA 1U6FA 3JTPA 4QJVA 3GU0A 1YI2S 4W90B 3FEXB 2YPYA 4OX8A 1HBUA 1XEZA 2RDJA 2CJQA 3O8WA 1QSLA 4CYUA 1O5JA 2XNQA 3MOJB 3BN4A 2GIRA 2W01A 3K59A 1KHVA 3TP2A 3VQTA 2R7WA 2YNGA 1H2UX 1MNEA 3E2EA 3I9V9 2CXEA 5DGAA 1S9GA 1SC6A 2K7JA 4LREA 4IO9Q 2ZNZA 4CWBA 2HS0A 2D9PA 4OZ5A 4TLQA 2R7QA 5KFYA 3W1YC 4DLEA 4ECTA 1VQOS 1R0BG 1M1HA 1N0UA 1TKTA 3MD1A 2V34A 2WCXA 3FUYA 4QIGA 4YB5A 4ZHRB 3HD1A 3KLGB 2QFJA 3GYNA 4DFJA 1IBLF 2DHSA 3KJFB 3GB0A 3H59A 4NYOA 5HANA 1RYRA 3DYAB 4L3NA 3MTKA 3ILOA 5SZTA 4YEAA 4LRBA 2OJ3A 2BJ8A 2XB2D 1FXDA 2NQPA 2J9EA 3OTOF 4TY9A 1WHWA 4UUWA 2Z2MA 4YR3A 8AT1B 3VVTA 1B3TA 2ZKUA 2UV8G 2JFDA 1SI9A 1FXRA 2ROEA 2WVBA 5L8RC 3EVWA 1AZSB 4A8XA 3RRHA 2B4VA 2DIVA 1X4HA 4PXDA 1RWKB 4ED8A 4FN5A 1VRTA 3KLFB 1K47A 2Y1JA 1O8BA 1SJ1A 4PUOB 4M94A 2YNFA 1Y4ZB 5CCMA 1RACB 3A8EA 1U2CA 4C11A 5KT2A 2E5GA 1UMJA 2YWEA 3HJVA 1HMVA 3GQCA 1CJVB 1YHQS 2FLPA 3KNAA 2JC0A 2XWXA 3SZ2A 1XK8A 3UD4P 3ET6A 3HHLD 3V81A 2CQ2A 2X7IA 4NZ6A 2B5JA 3UDVA 2F9DA 1T11A 4TQRA 3TZYA 4IUFA 2YX7A 3A3PB 3MXHP 2OGUA 5IWAF 2C2OB 3HHEA 2AIRB 3HZEA 4RZRA 4Y65A 3GV8B 1Q1KA 2G2YA 5A6PA 2Q1LA 1TFYA 2AYEA 2JWNA 3ZZ0A 4UQGA 1RT6A 4OZJA 2X1FA 3C14B 3H2LA 1IWGA 1WG5A 3B6BA 4A8WA 2NXJA 3C3LA 2OKQA 4OX9F 1J27A 2JVOA 3F0NA 3NAHA 1L5UA 3ENQA 3DLGA 2VPWB 5I3PA 4YB1P 1CPZA 1SQFA 5D4NA 1RT7A 4P52A 4I2QB 4C3KA 1VBYA 4CQ1A 2W4CA 2CQGA 4LQ9A 4NRTA 1FTRA 2B51A 4N5SA 4GKKF 4DV4F 2QG9B 3BH7B 1PKUA 2IC3A 4F50A 3V6HA 5G0RA 2GQQA 3TJ9A 1WG1A 1HBNA 5A0YB 4JI3F 1DJ0A 1F9HA 2LU2A 3I55S 3J7AN 4QYRA 1HYSA 3AXKA 2XZDB 4GKJJ 2IC3B 4ED7A 1GXLA 4K7QA 4KJIA 1FKPA 1F1BB 1VBXA 2WTFA 1IKYA 3CIZA 3MPWA 1RHUB 4N8OA 3Q89A 4KFBA 5T7LB 3IO1A 2ZH6A 4NZ7A 4NA1A 2JEIA 3KDNA 1RYSA 1W26A 3PX4A 5E3PA 3P49B 2ZNYA 1U48A 1N88A 2GAHC 3QSIA 4X62F 3EZ5A 4WYWA 3GR1A 1F2GA 4NYPA 4IR9A 4QU7A 1JKHB 4PQUA 3HFZB 2C1EB 3BSCA 5F3TA 4WKYA 3PYEA 2ZBPA 3EE3A 3RR8A 1T05B 2ATCB 1OYEA 3A12A 1D3WA 3TJAA 3THVA 4LF9J 4CLLA 2HK2A 4OJHA 4OI0A 1QAYA 3CIMA 2MPUA 2VDIA 3NS7B 1FK9B 2YNFB 3CC4S 2NXUA 3GFHA 3MUMP 3CF5Q 3OV7A 2LP4A 1CS4A 3A8IA 1FXLA 4DPXA 3IWLA 3VQSA 1TUVA 2OHDA 2CZ9A 1TL7A 4HI2A 2MLYA 4O4GA 4WFBQ 3HP6A 2W7OA 4IG0A 2JL9A 2A6OA 1RABB 2O1PA 2ADCA 1RAIB 1X60A 4RL1A 1HBMA 3M2UA 3TAPA 2LDYA 2Z2YB 3I5AA 4LF1A 3CSKA 4DR2J 4KGZB 1TVRB 4P2SA 2BVZA 3A3OB 3UWTA 3D68A 2DVIA 2CPZA 3AHPA 4DUYF 3ISZA 2KHCA 3KK1A 2YX4A 1J5OB 1NHUA 2CWKA 1HA1A 3DDNA 3VTIA 4ZHRA 3VHQA 5A2QY 4GVBB 3KJVB 4YMEA 1BD6A 2ASDA 3Q0AA 4Y34A 1C0UA 1M90T 1VFJA 4ANDA 1J5OA 3RTVA 1ELOA 1BMQB 4JV5F 4P7VA 2KFZA 3GLJA 5K5MA 2FTRA 4FDFA 8RUCA 3CB4A 1RWOB 2UVUA 5H1SV 2FVQA 5DGBA 1FA0A 1H6KX 3RB0A 1D8ZA 5KFNA 1N5YB 2CQBA 4QYZK 1PIEA 1EETA 1T9TA 4LF4F 3IS9B 4NCAA 4BDPA 3NGDA 2HHUA 2B0GA 5HAOA 2AEMA 2N4CA 4QR1A 1PILA 4O3QA 4N8NA 1VQPS 3BGFA 2QO3A 4PWWA 4ER8A 2CPDA 2FHKA 4LBIA 2AF6A 2WVCA 1TFWA 1KP6A 5J2PB 2BXJA 2CZVC 1B0TA 4IO1A 4LRAA 4PYDA 3WIUA 3N6LA 3IC1A 4MKBA 4ZIWA 2J0WA 2EG1A 1NNDA 4Y2KA 1QY7A 3ZXWA 2MQOA 4YHHJ 3SV3A 4P74A 4J9NA 2AGOA 4LIRA 4WXOA 4DQQA 1RCXB 3DOMA 2XM3A 1MU2B 5DLFA 2AD9A 1X9WA 2VG5B 2GMJA 3ET6B 2VPYB 3MUVP 1EAYC 4ZCIA 4DFMA 1M5KC 1PAEX 4J9PA 2XNRA 1U0HB 2Y8YA 2V2ZA 1MG7A 4FKYA 1Y10A 4FXWA 3SCKE 3DRYA 4CO2A 4ECRA 2MKSA 3OTDA 4CT8A 4Z37A 2Y0BB 3DXBA 1JIHA 1VIXA 4NLDA 5IXUA 4DV2F 2Z8QA 7FD1A 2V8GA 1XBWA 2M9KA 4DPYA 1U8WA 1S0OA 2MEWA 2WZ1A 3CJ3A 2VH7A 3QIDA 2HKEA 5IM0A 1Q7LB 2AJ2A 3N01A 1WTBA 2HZCA 3CULA 2AYBA 1FE0A 5LMNF 4DR5F 5K14B 3V6JA 1PYSB 1RP5A 2CJKA 1UETA 1YGYA 2ZH4A 2KJVA 5HJYA 3FCHA 4O3SA 4V19X 1T7PA 2R7OA 1OY9A 2O67A 3NXZA 3UN5A 2GIQA 2D1CA 3HZGA 2RS8A 2QLJB 4M5GA 1SC1B 5L46A 4JI6J 9ATCB 3O3LA 4MK9A 2YKPA 4K0KJ 1T9YA 3UO0A 3P96A 1N36J 2KTQA 5F9LA 3AAWB 5FDLB 4CCHA 2XGQA 2FIUA 2ZBCA 3D4JA 1NU4A 4S0MA 1X5TA 2FLOA 3T9ZA 2MZ1A 1WTFA 4EBEA 3B4MA 5IQ6A 1SKUB 1HNZF 2DCUB 3QT6A 5HQMA 2CQ0A 1UJ6A 3T1YF 1F60B 1ZETA 3K5OA 3I56S 4C48A 2V8VA 4I1TA 4ZPAA 1WORA 4RUAA 3KLGA 1SVDA 4Y2MA 1WKLA 1LK7A 3CC2S 4GVLA 1TV6A 2HNDB 2E66A 3H5XA 4O0IA 3D1OA 1JMTA 1FRIA 1PYOB 5HMZA 3DLBA 3NAIA 1EX8A 2QRRA 3R7NB 4BLGA 2ZFHA 2PD1A 1QAJA 3V2UC 1JX4A 4KR0B 3UNYA 3AOBA 3D28A 2YWWA 3JYTB 3M8QB 5L1IA 5K9FA 2C22A 3EICA 2ZHOA 1OIAA 2HQGA 5FIIA 4DQSA 4TQSA 2KM8B 1HQEA 4DV5F 2JVRA 2GNKA 2FUG9 1SXLA 2IY5B 2HG4A 3C6TA 3CD5A 4KAIA 4I64A 1IM4A 1LK5A 3P8BB 1LEOA 3PRVA 3CT9A 4WK3A 3TVKA 5CYJA 3GIJA 3I96A 4DLGA 4P9SA 2RUSA 1RTIB 1QE1A 1DZ5A 3PRDA 2BM1A 2HURA 3KUGA 4KHPF 5DETA 5L9NA 1VI7A 1H2TZ 2ROGA 3EMTA 1HBMB 2JX2A 3M2UB 4QQBA 2P9GA 2N7CA 2KG0A 2YNHA 3HM9A 3BQ1A 2OMOA 3EGZA 1R31A 2EVZA 2BMBA 1VQLS 3CJ5A 2O66A 3MI7X 2ABYA 2VKRA 4MYTA 1N8RT 4KH1B 2QE5A 3MR3A 2CADA 3BYPA 2HHWA 3MEGB 2DGVA 4OIXA 3GILA 3FEZA 2U1AA 4NLSA 3TARA 2LCWA 1F5BA 5KG3A 3I32A 2QL5B 2HVHA 3X1LB 2K7KA 5IT4A 1MW7A 1JK9B 4EGLA 3GSIA 4E0DA 1H0HB 1KD1T 5E3CA 5KFKA 1YZ7A 2Y3YA 2CPEA 5E2QA 5HMYA 2YKQA 1AXQA 3G8QA 4K2JA 4RW7B 2JRSA 2BZ2A 4WFNQ 2V4RA 2XMWA 3FDSA 1NKEA 1RHRB 4HHUA 3MECB 3POTB 4A8OA 4R0JA 5HO4A 3U1MA 4RBVA 2G0JA 3EDQB 5AXLA 1JXLA 1ZM4A 2OP5A 2WAQD 1YJ7A 3ELHA 4DR1F 1RJJA 2B6AB 4H4KC 1KEKA 4DSFA 2NS1B 4ED0A 2C2MB 5CD4H 2G13A 4TN2A 4I69A 3ULHA 3T19A 3OFGA 3N5BA 2H65B 2HHPA 2MKKA 2GGPB 3T1HF 4HVZA 6FDRA 4ED4A 1RBOB 3PW0A 1XC9A 2W9BB 3LGNA 2AP6A 1JLAA 4PYAA 2RAQA 3VGSA 2ZDPA 4DQRA 4TU8A 4GKKJ 3D7SB 3BO2A 1XMQJ 4XTTA 3HFKA 2RHSB 1T9VA 4LF8J 1HBOA 1S5ZA 1GMWA 2VG5A 4LSLB 4KFBB 3H4BA 2W2MP 2NYIA 4OYBA 4MKYA 4P2FA 1R8CA 3AJ1A 4OX9J 5D4LA 4DL2A 1OPZA 4PXBA 1AUSL 5J1PA 4CTAA 2HVZA 2MZTA 4RU2A 2HRUA 3CMAS 3A8JA 2ASLA 2EI5A 2V0NA 4FVMA 2KU7A 4CLKA 3THTA 4F4AA 4JI5J 2V8HA 3LWLA 3QJPA 2RD5C 1OY8A 4ZVEA 5FJ4A 2PI4A 1YBTA 3ZO7A 4BWMA 1XWLA 2BANA 4AFFA 4M63A 2R8IA 1FFGB 3A1YG 2FHMA 4G3IA 5A8RB 3M8YA 1FERA 2H4YB 5GMEA 5ITHA 2OUGA 2BDPA 4IFYB 1XR7A 4U9RA 4RBTA 1LWFB 4W98A 2EXUA 2HQIA 2F3JA 1EP4B 3GZ7A 4IH7A 3ZZYA 1UW9A 3FCVA 2VJVA 2AYGA 3QT7A 2FB0A 3TWZA 4DR6F 3D9BA 2GX8A 3LAMA 3PVXA 4FYYB 2BRKA 4G6VB 3FRYA 2XMTA 4KGMA 1GK8A 4ES2A 1X4CA 4OI6A 4Q8FA 3H7HB 5J2NB 1FT8A 3NWRA 1BQNB 2NUUG 4NRUA 1WACA 4P10A 1N32J 1G3OA 2R8JA 2DNYA 3MR2A 1OSDA 2IFXA 5M2UA 2U2FA 2P9EA 4FPIA 4YS2A 1SV5B 4ILMA 1H7WA 3SFUA 2VBWA 4USIA 1P1TA 2YNIA 2BE2A 3C46A 4QIEA 4R8UA 3MCOA 1IKWB 1URNA 3R2CJ 3H8YA 5EN1A 1Q86T 2RSQA 3OHAA 3QT8A 1FJGF 2IRYA 4B3RF 2DEJA 2RQKA 1WKJA 2ZH3A 4I7FB 4NL5A 1IBLJ 2HHHJ 2XHCA 3PG9A 3WDOA 2HMIA 5IV3A 2ZJRQ 1VJQA 3ETMA 2VKZG 4ELUA 1PJ6A 4KB7A 2OO4A 3TA1A 1SJQA 4J37A 1JWWA 2HNYA 1D9DA 3OVAA 2VF3A 5F41A 4I7FA 1VQNS 5KFPA 5F8NA 3ZTPA 3H20A 3DOLB 2ZVIA 2EPIA 2D69A 4YY3J 2MY8A 5HI7A 4U67Q 2J9DA 4OHXA 5ETQA 2W4PA 5IQQA 1QVFR 3A13A 2IMOA 1Q78A 5HROA 1ITPA 2B9EA 1VISA 4IH6A 1NZ8A 3DOKB 1O0PA 1Z2ZA 2G2ZA 1RAHB 4Y2IA 2I5JB 5D0EA 1JLBA 3GIRA 2A18A 1S1XA 1O51A 3D5MA 3UI3A 4DV1J 2C3OA 1N34J 1RI7A 4ZLNA 3M7VA 4ECUA 4ZJLA 3W8PA 1ZTTA 1U24A 3UFCX 3PW4A 1NSPA 2J5AA 3FNNA 5JJBA 3K17A 4ZOSA 4C11B 4C8NA 4DQPA 3OPKA 3TO8A 5A8KB 2DRDA 5CZXA 3UQSA 4R5PB 3PJWA 1ZPVA 4AT1B 3SDEA 4V19J 1P9QC 3WHIA 4MFBA 1BQXA 2E7XA 4JV5J 4U7CA 3ISND 2DPJA 1UA1A 3FFIA 2BANB 2DHXA 3OVBA 2C2RA 1P1LA 2AJ1A 1PC4A 2VL1A 4FYXB 2W9AA 2CQ1A 3KK2B 4F0KA 2MXYA 1L3UA 1E6YB 1M1GA 4I56A 2EK1A 1S79A 2EFVA 2UUBF 4ITSA 1S0NA 3DU5A 1UJ4A 1X7VA 2DH9A 3BGRA 2MJUA 1VRUB 1R43A 3MEGA 3CTRA 3MMAB 4IFYA 2KFYA 3KHLA 1UA0A 4ZP7A 4DCPB 1ZH5A 3JSBA 4PQAA 4G65A 3EUNA 2BJEA 1JLFB 3L7PA 4MK7A 1CG2A 1T0TV 1MMNA 1ZM2A 3AQOA 2MY7A 3EWGA 4YDXA 3J80Y 2LMIA 4AQYJ 2UUTA 3RZAA 4X65F 3BQ0A 1DARA 2ZM6F 3AT1B 2WONB 3H0PA 1GFWB 3PW5A 4DQIA 1YJRA 3C66A 4NXNJ 4Y28C 4HHHA 1FO1A 2WW4A 4KO0B 4RW9B 1UJ5A 3GJTB 3UD5A 1Q7YT 1T03A 3GR0A 3RB3A 1PBAA 5CHCB 1MWYA 3L9ZA 2YQ1A 4CM0A 4U8YA 1JLQA 3MR7A 4O0NA 2GGPA 4L6V3 5HBMA 3VV2B 4KGVB 4F4ZA 1OJ4A 1VQKS 5DDQC 1MN7A 1Q8LA 3MGJA 1SKWA 2EC0A 3GYGA 3IA0A 3TUIC 1RT4A 2XMUA 1HNWJ 2D9OA 2HZAA 3CDUA 4M5KA 3S6EA 1J5EJ 3I4PA 2YVSA 5KFGA 4B3SJ 3QZ7A 4ZVPB 2WVFA 2YPZA 4FYVB 2DH8A 5KFRA 4ID5B 3JSMB 3TUZC 1HNXJ 5HSPA 3NNAA 3ZZPA 1HR0J 1Y00A 3BREA 2CQPA 3US5A 2HHHF 4W92B 4DX7A 2KKHA 4B3MF 3L09A 2VFRA 4A47A 2HVDA 4YP3A 1U1PA 4U7UD 1JJCB 1F9EB 3C15A 1YSJA 2MKHA 2OEJA 1QD1A 2I5JA 5D0RA 2GQCA 1OY6A 3CCZA 1H74A 1TR0A 3PEHA 1G7CB 2BQRA 4UOGA 2J0SD 1EP4A 4OJGA 3CC7S 3DLEA 2VBYA 1YDLA 5KG0A 3NNHA 2OI2A 5ETRA 3SQGB 2AMCB 5K8OA 1KLMB 5D8HB 3GV5B 3PJ9A 3MFIA 2OIHA 4OHYA 1TELA 1ZBTA 3EM1A 4B3OB 3IBFB 4CRJA 1N0VC 5FDLA 4Q45A 1YRXA 4IG0B 4USWA 2CUYA 3CNQP 3DI6B 3SQOP 4AL7A 3HFVA 4WU3A 2B56A 2FD2A 3CWJA 1JLGA 4LBPA 3W8GA 1R7IA 4DMZA 5I3QA 4B3OA 3NNCA 3BGUA 4DR6J 3MWBA 4M1KA 3OXLA 4DUZJ 3UNGC 2HYIB 1BGXT 1E6YA 3VGUA 5GAEI 5C24B 5I42B 3BR8A 2PE8A 3HHLB 1JLGB 1SQEA 4OYWA 1Y0HA 3VVUA 3M8RA 3PR4A 1M5OC 4JV1A 2XS2A 3T6BA 3PYDA 3TEGA 4PWDB 1YVFA 4X84A 4C98A 4CH7A 5F0UA 4J90A 3GYXB 3OQ2A 2UXDF 2KT3A 4NLGA 3RBEA 4QWBA 2YNIB 1KVIA 1FDAA 3KWMA 3G8TA 4NCBA 2ERRA 4USJC 3N6MA 3IR5B 3BKTA 2H9ZA 4OZ3A 1Q53A 4PWUA 2JJ4D 1MMDA 2AQ4A 3CMES 1UVNA 3UVJA 3W61A 2B6AA 5KFWA 3Q23A 1HWUA 2IAJA 5AJ3F 1SL1A 1LFWA 4JI4J 2BEFA 2VUGA 5ETOA 1FJ7A 2AZ1A 1F3FA 3PFOA 1FCAA 2AX1A 4KE5A 2E44A 1CC8A 3V6KA 1NRKA 4N76A 2AU0A 2BQUA 4ZVGA 3MMJA 1VIOA 1S48A 3RYLA 4A46A 3EYZA 3LALA 3I0SB 1JLQB 2EFQA 4DJBA 4FXVA 5KG5A 4Q44A 4IRKA 4ZCLA 2GHWA 4X2BA 4WE1A 2FVPA 3TUPA 2F65A 2J9DE 1MMLA 5I4MA 1VRTB 4LIWA 4HEA9 5L9XA 1GTEA 3NY0A 2YKMA 2DR6A 5SUHA 1V3RA 1YJVA 4RUBA 3D3CJ 1WEZA 2UXDJ 2B3TB 4OYIA 4X4QA 4ZVUB 2DR7A 4M5NA 1TMJA 5HL7Q 4NLWA 4IH5A 2GVZB 2LFVA 4NLUA 4JI1J 1P8GA 3DCAA 4M5LA 2D7SA 3MM9B 2GJ2A 5M2PA 2ZE2B 2IDLA 1CULA 3M8WA 3S8SA 2MLXA 2QGFB 1V5IB 4IR1A 1I5OB 1WC6A 3EDRB 5HN0A 3ENAA 3JSYA 3QFWA 2QMUB 1K73T 4DCOB 5KT3A 3OL6A 3KK2A 2UZAA 5B0GA 3ZTRA 4Q8EA 4K4WA 9RUBA 1RT1A 3VALA 3GE9A 1VOMA 3CDWA 4RW4A 4RWWA 4YOEA 1NDPA 3MM5B 3BYRA 1AROP 1Y9OA 3V6DA 1SJFA 5DRKA 1FFWB 2DJWA 3HO1A 5EWGA 4H4MB 1CJTA 1KTVA 3OXGA 1CVJA 2Y1RI 3UCGA 1GMWD 4ZJOA 1VBZA 3QBCA 3T5LA 3Q8SB 1RWVB 2Q79A 1U2RA 1CJTB 2ALZA 1AZSA 2V8PA 4AD6A 5DZ6A 1R27B 4DR7J 3FJ2A 2H3EB 1MLAA 1LWEB 2XCAA 2VA2A 1FRXA 1RT4B 2WW8A 3MDFA 1HNXF 1NLKL 2O01C 2ZBRA 5DDRC 1PO6A 1I6JA 1Q8IA 1N48A 3R7BB 3R27A 5K8NA 1J5EF 3ZZZA 1N52B 4I6YA 2Q43A 2Z30B 3MF5A 4TU9A 2L9NA 2LLZA 3KJNB 5KFZA 2HFUA 2H51B 4ENOA 4RNNA 4PG5A 3IGNA 3ZZOA 4EK2A 3UW1A 4KGKA 2IHR1 5ETKA 2XYGB 1VJWA 1X0FA 1NJZA 3ENVA 1B4SA 1NMEB 4DI6A 4KHMA 2EWHA 3UDCA 2HFNA 1UVJA 1JNZB 1P9YA 1SB6A 4ZVTB 5KFLA 5HROB 4A8MP 1W7WA 5ETMA 3O1LA 1YJWS 1SQGA 5DM7Q 4AL6A 3K2YA 1YJTA 3K57A 1SCJB 2B7BB 2J7UA 1PJ7A 2KYXA 1OO0B 2HS3A 2C2ZB 3T1YJ 4ZPWR 1NK0A 2GMHA 1QE1B 3HVTB 2UXBF 3RBZA 3QPIA 4WFAQ 1I1GA 3DHWC 2QYCA 5I3UB 5CYMB 4LRCA 4OX7A 3D6FB 2EK6A 3CJRA 2Q3PA 3JS9A 2CA9A 4RO0A 5A8KA 1FKOB 3KUHA 1SH0A 4C8OA 1TL7B 2HQDA 2DXFA 1U09A 2QV6A 3R5GA 1KQKA 1RTHB 2MQ8A 1VQ4S 1VLYA 2BACA 3GP9A 1IR0A 1CJKA 2WOMA 2DNPA 2BJ1A 2DO0A 4UTGA 4JI6F 1SV5A 3M9NB 5L1JA 1YITS 3SSSA 3MPYA 4P75A 4UQTA 4HACA 2GO9A 4RX6A 2HFVA 4C8MA 1LV5A 1NH8A 1XNQJ 1B0PA 2BJ7A 2RB7A 2OTLS 1Y5LB 4NEYA 3JSRA 3V4IA 1SKSA 2V2VA 4DF8A 5LMNJ 2FDNA 2ZH2A 3HSZA 4G1QB 3MM6A 4JB8B 3QZ8A 2DNMA 5CZVA 2BUNA 4DF4A 1WOOA 1N33J 2R7RA 4C8LA 3KNGA 1F2HA 4GO7X 3MECA 4PWDA 3H4DA 3LTOA 2R7UA 3G6XA 4ED5A 4XPEA 1YJ9S 4ZDNA 2IRUA 3CE8A 4CNYA 1HW8A 1JB0C 2BOPA 3G4SS 3WC2A 2PI5A 2RF2B 3J7A1 3OLBA 3CD7A 3C16B 4LR9A 4KO0A 3SCIE 1S12A 4X4SA 1A9NB 3J7ZT 2QLWA 1FX4A 2GS8A 5ETTA 4FF1A 4C3MA 5F8MA 3T1AA 3M9OB 1SBRA 2AT1B 2FHOB 2E5LJ 2B8PA 2PMWA 1K0TA 2M70A 1WC4A 3CCWA 1EQMA 4M5HA 4BC7A 3KTQA 3QO9A 1S0VA 4F2RA 4RWXA 1Q5YA 2Z58B 2Z4PA 3PX0A 4USHA 3VAKA 4KPCA 4CO1A 1DTQB 1KLNA 2YKAA 2FC8A 3W9JA 4OYXA 3KK3A 2LQ8A 2OLWA 2KG1A 3O5TB 2LEAA 3BO3A 2KFNA 3GCXP 4AUKA 4CI0B 2AKWB 3QRPA 1VC0A 3QT5A 4NMXA 1YIJS 1T05A 2QL7B 1N33F 2VG6B 1N54B 2WB4A 3AB2B 3K5PA 2FZGB 2W4DA 4DFKA 4B3MJ 1NZAA 4F25A 4BBYA 1VMBA 2POKA 3N79A 3WIVA 2HZVA 1VRUA 1LXJA 3U27A 4DWIA 4LF7F 4NZ0A 4UUXA 1DLOA 3W65A 4O3RA 3NMAA 3IG1B 2W2OP 2P8IA 4PG7A 4H4OA 3TA0A 2MDAA 3ICLA 5EWEA 2IVYA 5CYMA 2V2KA 1HNWF 3ISNC 1S77D 1RWUA 2KYZA 3FC9A 3CJKB 2XLKA 4NA3A 3HVAA 2EEYA 2M8DB 3CCMS 1G1XA 4QR2A 1WC0A 4FF4A 5B08A 4FBTA 2CJBA 5F8IA 1HHQA 4OLPA 3K89A 2W8KA 3RU0A 1N5YA 3DI6A 4UY85 2R9LA 3K5NA 1M5PC 5DS7A 1IKXA 4WIQA 2VPXB 4HI1A 2CQ3A 3J81U 1LWXA 3CJ4A 3QLHB 3UR0A 4EBDA 4DPUA 4LRDA 1K1QA 1KBRA 4USVA 3RW7A 4DR4F 3ZTSA 4WIIA 4D3HA 2X1AA 1BY9A 2R2RA 3LQVA 4JI0J 4DUTA 2BBEA 3UN3A 2QLXA 1TL5A 2BE2B 1BUXA 1GT8A 3CCSS 1ZA2B 3MAAB 3D2WA 2DGXA 2K3IA 1S99A 3TEHB 4OZ2A 2RRNA 1RB0A 1RBLA 1UW4A 2MKIA 1YTYA 3ZZRA 2W9CB 2GC8A 1NB7A 2OEMA 4ZCMA 4U6PA 2HMIB 1IQZA 2XG8A 1UCNA 3OTCA 3O6QA 4DL0C 3OR2B 2BYCA 2HNZB 2P6SA 3D0IE 1ACMB 4Q7AA 3QYYA 3ZTQA 4PR6A 1M5SA 4AE5A 2RJZA 4R0EA 5DM6Q 3UN2A 2N3OA 1IR2A 5KFSA 5D6GA 4P6QA 3RAMA 4TXSA 4DXLA 3QRQA 5E3QA 1Q4RA 2FGOA 3M8QA 1X8DA 4LFAJ 2SXLA 3CJTA 4WPAA 4DL7A 3HHKA 1YK9A 3ZZUA 2R7TA 1HQEB 1XERA 2HFZA 1XR6A 3Q2TC 1VQ6S 1R8PA 3I0SA 3UDEA 3T5KA 3IAM9 5DG7A 4YN3B 1N4LA 2ZC4A 1NK5A 2VBXA 2L08A 1S1XB 3E01B 3MMBB 4NEZA 3W60A 3H90A 3FZ2A 3OVSA 3W2WA 2J7WA 2NXEA 1ZAXA 3DC2A 3PZPA 1S0MA 5KT4A 3OJUA 2V4QA 2C2NA 4RUHA 4DSEA 4IFVA 2DNKA 1RHKB 2YNGB 4K59A 2DY9A 4J9QA 1RT2B 4F67A 3VAHA 3UCZP 2E1RA 1QSSA 3QJJA 3GWCA 5KOXA 3P5TL 1Q5VA 5DQGA 1ULRA 2PGCA 2GVZA 3KHHA 5AE3A 2LQ5A 3KG1A 3CMQA 2YWGA 4LF5J 4HLBA 4OYOA 2RU3A 3M6UA 2NR0A 3KMQA 5DQIA 4X62J 3B4DA 2HQ3A 3F56A 3NCPA 1CULB 2CPJA 2ZKTA 1M5HA 2RQMA 2F4VF 2K3KA 1PYTA 1V6HA 1XN9A 3IRXB 1IUJA 5A6WA 3H5SA 1DTTA 4DN0A 1WDDA 2RU9A 5CXTA 3GV7B 1S6PB 4JV2A 1V3SA 5HK4A 1WF2A 3HSDA 5GVQA 3M05A 3NGUA 1NXIA 1Y5IB 2IYGA 4WYLA 4ECYA 2I6WA 1TL3A 2LEPA 3OUYB 4KQZA 4LQ3A 2E1AA 4JV0A 5GAHI 3JYTA 4KHPJ 2MGZB 1NUEA 1U0SA 1B70B 1QUPA 2QIFA 2QA1A 2YXLA 3JQJA 4RUCA 2XMVA 2FLLA 4DR3F 2HHVA 5C42A 1RK8A 4DL6A 3HK2A 2V9KA 3QGIA 3WZ0A 4F7VA 1RKIA 2DNNA 3H40A 1RWNB 2J7KA 2PMHA 3DLKB 4PABA 3TAQA 1IBMF 2X1GA 1TQLA 1QJHA 1WJ9A 1WELA 4RW8A 4OI1A 1X4AA 3QWUA 3R2DJ 4PZVA 3CJ0A 3RW6A 1HARA 2V50A 3T3FA 1YJNS 3DLKA 2VA3A 4IYQA 5KG4A 1XR5A 2HAIA 2NSBA 3MD3A 2R2TA 3FVYA 2BJDA 2OSRA 4TU7A 5AJ3J 2Z0GA 2DO4A 4WF9Q 3CCQS 1PBUA 2HW3A 1C4AA 5D15A 1Q79A 4NLRA 4PXCA 3W9HA 5AE2A 2BJ3A 5JVGQ 4CLUA 5LSOA 1S4EA 4JI1F 3EGVA 4PUOA 4RW6B 3KXDA 3V5RA 3LP2B 1MROA 2FJBB 4DSJA 1TKZA 4C7QA 3R5BA 1RAJA 3FCWA 1RU1A 1HFEL 5RUBA 3QNWB 1S1TB 1DTQA 3IBCB 1IN0A 2B9XA 3FFIB 3R6LB 2VHGA 2HHQA 4OI2A 1T3OA 5KFBA 2PFDA 5F3ZA 2VU5A 2W7PA 2BE9B 4DEZA 3IFEA 4CO5A 4FVCA 1ZTWA 4L73A 4WTYA 2KXFA 3FBEA 2APOA 2PC6A 3I31A 3GFYA 1HNIB 1VGYA 4LVNP 3W2VA 4DU7A 3KLHA 3KJQB 2BRLA 2HPUA 3MCMA 3NGTA 4HTIA 1QVGR 2VOPA 1KDNA 2LXIA 2F7VA 4DFPA 2WVEA 2RMLA 1NPKA 5C25B 1KVJA 4DX5A 5J1NA 3W62A 3FK4A 1CQNA 2HRYA 1W2IA 1FE4A 3GIMA 3GIKA 2MHNA 4LF8F 1FKOA 1D9FA 4FYDA 2GAGC 2GFFA 2PO4A 3FKBA 4I2PA 4MKVA 2XI3A 4KV8B 4P2MA 2DGTA 5DQHA 4IRDA 2X51A 2JOQA 4Y3CA 2IVFB 1KFSA 2ZBIA 1HYSB 1VYAA 2XZTB 2MHEA 4QWEA 2CPFA 4DBQA 2LEBA 1FWPA 1OQ3A 4DR7F 3BM7A 4I2PB 2G0CA 2CRLA 3HULA 3D6TB 3IP0A 5HMWA 2MKJA 3IAS9 3FQLA 3L7UA 2I2YA 3D3BJ 3R7SB 1X9MA 2L48A 3N6NA 3BR9A 2D41A 2F5GA 2RIJA 3P4UB 4ZA1A 4XPCA 4DX8H 4LVOP 1HLWA 1EKSA 3H42A 1CQMA 2CFXA 3K8WA 4DSIA 3AOAA 5A0YA 2DTJA 2C3YA 3BN7A 3R97A 3UE2A 4DPWA 1GH8A 4R8UB 4Y0FA 1DTTB 2EFNA 3MM6B 4DV2J 1FKAF 3TANA 1CLFA 1M0SA 2F4VJ 2DD8S 5E0OA 3VGTA 5MAOA 4X4VA 5KG6A 3WBZA 2IVMA 4DUZF 2ATLA 3PX6A 4C8KA 3M1VB 4LSNA 3NP5A 3J81Y 3M30A 2RQCA 1H7XA 1VQ9S 3K8VA 5JXSA 5FD1A 3J7YI 4LF6F 2YY3A 3EGWB 3PIOQ 2DR5A 2HLTA 2IIHA 1KTQA 4BCAA 2H54B 1RBAA 4FS1A 4K4ZA 1XJWB 5AXMA 3BSAA 3CDAA 3LUYA 3HDSA 2L41A 2B4UA 1H73A 2M3DA 2ZH7A 4AXIA 4PQUB 3R5JB 2COLA 1RAAB 4UF4A 2OH2A 4IQXA 2AGQA 2R2SA 5IT9U 2JDJA 1UZHA 5A8RA 4J9KA 2CJ9A 4ES1A 3NCQA 4F4WA 5KFTA 4QIWD 4WTOB 1Y7PA 1FESA 2V63A 5AXNA 5EDWA 1TK8A 3L3CA 4O3OA 4HYKA 3JAMU 4ANCA 5KFHA 4A8QA 4J7CA 1T8EA 3RRGA 5KT7A 1YJUA 4ED3A 2H1YA 1LW0A 2MTLA 3BF4A 3LPYA 4TVAB 5M2RA 4QBUA 5IZHA 1KQSR 3FZBA 4OHWA 1GEHA 1C1BA 1QLNA 4CDIA 2ZOGA 5BR8F 1KVKA 4R25A 4B3SF 5E3AA 1V3ZA 2GHPA 2YTCA 3HKWA 3M2VA 1PGZA 2MLZA 2P9CA 3DDIA 5KT6A 3KKFA 4DG1B 3OW2R 2UUAF 2LA6A 1RDRA 3CJ8A 1OYDA 1HD0A 3DRXA 4RBUA 1KONA 1DLOB 1RLDA 4CLTA 6FD1A 4DUYJ 1PSDA 3PYGA 4B9UA 2RUGA 3HHDA 2XS7A 2FZCB 4DR2F 2QA2A 2A2DA 3W9IA 4EYHB 1QTMA 1R3NA 2CVIA 4LFBF 1TV6B 2HNDA 4NWBA 1RTZA 1TKTB 5D0GA 1R89A 3FBBA 3FSIA 3G71S 3HJFA 3R1LA 3P6YC 2ZITA 3J80U 3ITHA 3ENWA 3MM8A 3S7RA 3NL0A 2A10A 4EO6A 3NGSA 1KR4A 1WUUA 4JUZA 1KRPA 1JKHA 3F73A 4DV7F 4OZLA 4IOAQ 2M8HA 2FVSA 1S76D 2OD6A 1UPPA 3VR1A 3W63A 1VRQC 2CG4A 2E7VA 3D66A 5D3GB 4Q0BA 2KXNB 2XS5A 2DH7A 3CCJS 2E5IA 4LT6A 3QRRA 4X4UA 1RUSA 2WSEC 1XMOF 2RHQB 4N7TA 2ZC3A 1CJVA 1RWMB 4C9DA 3PCOB 4YY3F 3BSOA 3EJMA 2PT0A 4LR8A 4P2XA 1P6TA 3NCRA 2QLFB 1R0CB 2HNZA 2J8AA 2WK4A 4TNOA 1VC6A 3KLFA 3IRWP 2DR8A 2IRXA 1HHSA 2LQJA 4JI7F 3OL8A 4F2SA 4EMDA 2Z56B 1WI6A 1FJCA 4NX9A 2HGMA 4NI2A 2MZQA 2EG2A 3GJQB 2DY1A 4B3TF 3TOQA 3DFEA 1RTJA 1V5VA 3E8OA 4Z2XA 1B99A 1TVRA 1GXTA 5F8JA 4FKXA 3C14A 4GKJF 2W2QP 5KFMA 2FLNA 2AJ0A 2HFSA 1HR0F 3NS5A 1KKHA 2Y1LB 3GSDA 4UOHA 5IOLA 3DHXA 5HQ8A 4ELVA 3EX7B 1EHWA 5IM0B 2JSXA 1WC3A 2XEXA 3CDBA 4IOBA 4QW8A 4F3OA 1T3NA 2ZZMA 1CEZA 3BBBA 1KHWA 1N34F 4YR2A 1Y11A 3M6XA 4Y2CA 4E2FB 2FJVA 1X5PA 2LXUA 3DLEB 3L95X 2C2KB 1ICEB 2CNNB 3Q8RB 2DGQA 5L1KA 2C3PA 4CM2A 3KLIA 3NG8A 3FSYA 1T9WA 1IKXB 3BB5A 4YDDB 5KFEA 2ZJPQ 1Q81T 4WZQA 1OPIA 2ROPA 4B08A 2KN4A 1CC7A 1DBDA 2HRTA 3LO3A 5C2CA 5L39A 4LF6J 2D3UA 3PV8A 1CJKB 4GRSA 3JQMA 3KFWX 1S1UB 3TA2A 3J7YU 2ZH8A 1LWCA 1ZA1B 5J2QA 1BQNA 3R5AA 3PIPQ 3DU6A 1NK8A 2EC2A 2W1BA 4NLXA 1S1UA 5I42A 1FJGJ 1F5AA 4J9RA 2HHTA 2QX0A 4OV6A 1VQYA 3W64A 1REVA 2CDRB 2GO8A 3NBPA 3SBMA 3AOCA 2ZUGA 3DN9A 1NDLA 1WDTA 3AJ2A 3OR2A 4O44B 4TLRA 4EWTA 2G0IA 4AXJA 1MWZA 4DL5A 4F4YA 1FKPB 3DNCA 3T5HA 3PXGa 4YQWA 1QAXA 3W5YA 2N7YA 1WD6A 1NO8A 2HS4A 5B09A 2KB2A 3M8PB 2MGZA 5BXIA 2DHAA 3QMQA 4IQMA 3HT3A 4CLWA 2F9JA 2W7AA 4HT7A 4OZ0A 3KHRA 2YWHA 2K8GA 3HF5A 4OZ1A 4OL8A 1SJ3P 4DS4A 1S1VB 2ZOFA 3W5XA 3MCSA 5E41A 4JYAJ 5IT0A 5L1LA 4QCLA 1S7IA 4ZLPA 5LT5A 4OYZA 4J9OA 4NLQA 1TKXA 2CKWA 5HJXA 3C6TB 5K14A 2NUHA 3LPEA 4DSKA 2NXNA 4GC6A 3T1HJ 4A8KA 1S49A 3E51A 2VBZA 2ZVSA 2LYVA 2FJWA 2XZWA 2JHEA 2OEKA 5T41A 3HHNB 1UKUA 4CNZA 4KHRA 2OAUA 2B4OA 3IM8A 3TVYA 5FLXY 1URRA 1BWEA 2O3DA 3U02A 1FWKA 2ZJQQ 5J2NA 4OI4A 4ZP9A 4LFCJ 2VG6A 2I0XA 3DGPA 5T14A 3T5JA 1RT5B 3L4BC 1TMMA 5KFOA 1L3SA 2DT9A 4HR2A 1NDKA 1RADB 3V4IB 1RAEB 2RILA 1HI1A 4PPZA 3MZIA 4NXMF 1YBAA 3AODA 4O3PA 4EEYA 4HKQA 3NKYA 1RT5A 2YH0A 2D3ZA 4NLTA 3POTA 4CT9A 3CCVS 4I67A 4OLOA 3BS9A 4DV6F 2MB0B 1AT1B 1S4FA 2AHOB 4EO8A 1BWVA 2R4FA 3FMWA 2A1BA 3N0VA 4ZVQB 3W7BA 2CQ4A 4ZJQA 4QOTA 4HH0A 4PPDA 4J9SA 2DXDA 4F4XA 1F6TA 1U8SA 3GG1A 4LBHA 3J7Z5 1QAIA 4FS2A 3NMRA 4MT1A 3MM5A 4JOUA 3NOCA 2ZHBA 3H98A 3R6GB 1VC5A 1HBNB 4H4MA 4GC7A 3KLVA 3P5BP 2RS2A 3QLHA 3CCRS 4C0BA 1DHMA 1CJUA 2W24A 3UDLA 2FVCA 5A8WA 2ZHAA 1X5SA 2PEHA 3BV8A 3TZZA 4ELTA 1TK5A 4U8VA 4LFAF 4JYAF 1FNXH 1XMBA 1T02A 1ZZFA 3JXOA 3I6PA 2OPRA 1VCTA 1DQ8A 3AQPA 3E3XA 3G87A 3MAAA 4ATNA 2BKPA 4CTAB 4I6WA 3EVMA 3MPDA 1RZMA 2VFVA 3DMJB 4A8FA 5D3GA 2DB1A 2PDAA 5HVFA 3QSYB 5AT1B 4JI4F 1ZM3A 4LSLA 4DR3J 1CBKA 4PRFA 2PSZA 2LVWA 4K4XA 2YH1A 2VFTA 3M8PA 2MYFA 1Z4UA 2VG7A 4JBCA 3RBXA 3K5LA 3OL7A 2NZ4A 1MU2A 4XK8C 3ZNUA 4ECWA 4A4JA 1JJ4A 4E8UA 2HQCA 3RUBL 1YX2A 4N77A 2DKOB 4ID5A 3JSMA 3MMCA 3T6JA 1AFJA 1GAOA 2C3UA 4DR4J 2K1RA 4TY8B 4J9UE 3LH2S 4I0WA 5CA5A 3D6HB 2YKNA 1HNZJ 1FD8A 4K50A 3MMCB 1NBEB 2MSSA 1TL1B 1H38A 1UFKA 4DPTA 3DLJA 3U1NA 4UT4A 1NB2A 1UAWA 3HVTA 3OSNA 4WZMA 1RWPB 4NLPA 1XNRF 1OWXA 2AEFA 3Q24A 1ZYQA 4UOCA 2EBEA 2JLEA 2R42A 3GFXA 2HBQB 5IV4A 2XO6A 2FJEB 1FDBA 2DISA 4L75A 3DRSB 4CLYA 3MAHA 3NGRA 5L38A 3MURP 2UP1A 1UL3A 3ZNJ1 2M0GB 5KFIA 3CXCR 3KK1B 4F26A 2HIYA 1UEVA 1WOPA 3IR7B 2BR0A 3NWGA 4MH8A 2YBVA 5BJRA 6AT1B 4I68A 2PMZD 3KJVA 3K5MA 1R0AB 1KNZA 4ZLJA 1GX6A 3CJSA 1PJ5A 3HT0A 1C0UB 3LF0A 3FEYB 5G0RB 3HHLA 2IA6A 3MAQA 1R8AA 1ZAVA 2O5DA 3F44A 4A8SA 4WU2A 2R2UA 1GNKA 1HBOB 2FJAB 1R6VA 3G6VA 1NJXA 1U49A 4B02A 1XTZA 1S6PA 4B17A 3DYAA 4ECZA 2VQEJ 2RVJA 2QZ8A 1VDHA 5D4OA 4IKAA 4OV1A 2R8KA 2ZZNA 4K5SA 4LUBA 4NCGB 1E6VA 4CLPA 1Y3KA 3SV4A 4CIOA 3U1LA 1S6QA 1UWBB 2Z2ZA 3CCTA 4O44A 1UEUA 2FC9A 2ZD1B 3AXMA 5KFUA 3CD6S 4RJVA 2QMXA 3HX9A 4CH1A 1XMOJ 3MEEA 1I94J 2R7XA 2CDQA 4NOHA 2BJ9A 2KZMA 1TUGB 1NJYA 3M2RB 2XY7A 3UR3C 1SC3B 2KL8A 2ZD1A 4KRWA 1Q0NA 2WRMA 4WP8A 2VONA 4ILLA 5HVGA 2FJXA 3HMJG 1SPBP 1D8YA 4EYIB 3IMQJ 3SSRA 4ES3A 1WEXA 5K20B 3PJXA 1RU2A 4X66F 4IG3B 4X4PA 3G9CA 4FXDA 2CQIA 3GPAA 3GIIA 3RR7A 4Q2LA 1JNRB 2IM1A 2PFFB 3RG6A 3MFHA 3BBFA 4NXNF 3GG0A 1HMVB 5LMUJ 3LWMA 1KWMA 2OPSA 1I3OB 5K8MA 4ICLB 2VC0A 3AA8A 3I5CA 5FLXU 1A6LA 4ED6A 4RLEA 3PHTA 4AQYF 4K4VA 1IQTA 3OLAA 2OFHX 4BHQA 3KMSA 2DITA 5H9EJ 1HD1A 3QWPA 2AV5A 2M2BA 3BGLA 3QGPA 2CWXA 2RDIA 1X9SA 1SJ4P 2XULA 5KFQA 4F3MA 1IR1A 1VK8A 2H5JB 1X4BA 3JTOA 4OYMA 5C24A 1JLFA 3W2VB 4J9LA 2V4JB 4XIUA 2D74B 3ZC4A 2R3VA 3M32B 3MOZA 3MR5A 2MZRA 5LXYA 2F8EX 4V1Ak 4LF7J 2DBBA 2UVRA 4QIVA 2QL9B 2G2OA 1I51B 2WSCC 2XLIA 1FWLA 4F02A 2BX6A 3H5UA 3DLGB 4WKRA 3M4XA 5CCLA 3LP1A 5J1EA 2DEIA 2CPYA 2PIIA 1X4FA 1QDUB 1Z1ZA 2LQBA 1IM6A 3G82A 2C3MA 1X0PA 1HWJA 1SIWB 3C16A 3DM2A 1HWLA 3N4WA 5E3RA 1RT3B 3GONA 4U96A 2P2CB 5IC6B 2N3LA 4M5JA 2CZ4A 1B0VA 2VIHA 5JVHQ 5C5JA 1U4BA 4YUDA 1K0VA 3ZTOA 1LFPA 3D6MB 2BW7A 4O23A 4FNHA 1U1OA 1AW0A 2E9ZA 4ILRA 2JLFA 3OTEA 3G6YA 1N36F 1REVB 2DRAA 4G1IA 2W9BA 1T94A 2E5LF 5T7LA 3RB4A 5C7PA 2MQQA 5D77A 4ETZA 4U95A 2E5HA 2UVWA 2IA0A 2P6TA 4I6AA 1JJ2R 3TAMB 1LXNA 1C1CB 3R3TA 2MQMA 1Q95G 4ZVFA 2OPRB 1TKZB 1WHVA 1GXUA 4IRCA 3C6UA 4HL9A 4NMLA 3TAMA 1KN6A 8ATCB 5D4PA 3MEEB 4O4RA 3X3UA 2MZJA 1APSA 5JUMA 4GMKA 1NAQA 3LP0B 3UD3P 3M2RA 1G6BA 1BQMA 1LKZA 1WG4A 4FP9A 1C4CA 2DXEA 1BHNA 1SC4B 1YRUA 2OPQB 3O2IA 5C2GA 2FY8A 1TK0A 2ZE2A 4DZ6A 4OJ3A 5BYQA 5KT5A 3CCES 3A8KA 4JI8F 4CO4A 2DGUA 4ZIVA 5CABA 2F40A 1FEHA 1XNQF 2NCKL 1FD2A 4N47A 1RT7B 2CIMA 1RA7A 5GADU 2ZZTA 1K1SA 5K8PA 5EUHA 1EARA 5D0HA 5DG9A 4ICLA 3Q8QB 2E9TA 3IGVA 4LFBJ 1Y5NB 2QSFA 1U1RA 3R8YA 2VODA 2MQLA 4M5DB 2E7WA 2VFUA 2WONA 4K0KF 1FRKA 3EZOA 4RPFA 2Z2LA 5B7WA 2ACMA 2L9WA 4OMFG 4CLSA 1R0AA 3CO0P 2FHJD 3IXQA 3OJSA 1NJIT 3M6WA 4OYAA 4RKUC 3Q22A 2EKYA 4YB6A 1HKAA 1IBCB 2HBRB 2KJWA 3NEKA 4TYAA 3ONQA 1RE1B 4RNHA 2UXBJ 1Q8BA 2CPIA 1VQMS 3BJYA 1VQ8S 2D3OR 3AFGA 3IRXA 2UU9J 4UW2A 4QZVB 5F0WA 2F8HA 1S59A 2MQNA 1HPZA 1RKJA 1N6QA 4JI5F 1GMUA 2ALYB 2BW2A 3AD9C 2Q6BA 4ZP8A 4ZPBA 3TUJC 1EETB 2CNKB 1HPZB 3O44A 3DGVA 2H48B 4A48A 3ITHB 5LXRA 1NK7A 1N32F 2LXFA 2M52A 4NPOA 4BWJA 4B9LA 2G4BA 2ADBA 3U7JA 3I4HX 3GCWP 1VQ5S 1JLBB 1UVMA 1U02A 3W66A 1U6BA 1RSCA 1S6QB 1UWBA 4OYPA 4ZVHA 1XNRJ 1UVIA 1IBMJ 4F36A 2EKNA 3MTJA 2ZUAA 4NYZA 4LF5F 1HQUB 2XHWA 4OX6A 1RCOB 1TAQA 1FX2A 2AX0A 4EU0A 5DG8A 3LAKA 4NLVA 2MQPA 1LW2B 3SQGA 1DURA 4KC5A 4F0HA 1H2VZ 3G8SA 4CLFA 3JB9k 1WSRA 2IJRA 2V67A 4ZP6A 4UOFA 4JI2J 1KFDA 1RQ0A 1MN9A 2M5YA 2C2DA 4K4SA 3K58A 2VFSA 3PHEA 5F9NA 3N28A 2YKMB 5DJBA 1IXKA 4NI2B 1WSVA 2JNJA 1IJEB 3M2VB 4FYWB 3NLCA 1S1TA 4ID8A 1BQMB 2WBMA 1G2EA 4ZPCA 3MEDB 4ZMMA 2HHXA 2DHGA 4DV6J 3SDEB 2XGPA 5GMDA 3OFHA 4MIAA 4KPYA 2I9SA 4KH0B 5HP1A 4ETXA 2MMYA 2OSQA 3DKDA 1RT6B 2LECA 3CVKA 3KLEA 2ASYA 2HWHA 4LR7A 1UVKA 1RWXB 3TJ8A 1S9EB 3HD2A 3Q83A 5J2MB 2DCLA 2XLJA 3PKMA 2YQ3A 4G1QA 5C25A 2XMAA 2KH9A 4IDKA 1AA1B 2DNLA 1KOHA 2VDHA 3T41A 4C97A 1TP7A 4CP5A 4AL5A 4J9MA 2ZBQA 1VQSA 3OSPA 3KLIB 2JEGA 1NHKL 5KFAA 3BPSP 2NREA 3FQKA 4KTQA 1RT1B 4J5OA 2B8QA 4URQU 3SEOA 1FJEB 4ZPTR 3SSQA 1FNOA 5HATA 1VR6A 3D0GE 1RHJB 3RB6A 3HVWA 1IWAA 1YQHA 2I8EA 4LJMA 2JZ5A 3VCDA 3M9MB 3CCUS 2V9WA 2Y9HA 3RAQA 2ASJA 2IPOB 2KRRA 3TRGA 2HBZB 4HHJA 4O3NA 1VHIA 4K8RA 4PKDB 3LGMA 3PEJA 4XDCA 3DM2B 1VBKA 2IM2A 3CO9A 2EW9A 4K4YA 2ZH9A 3TI0A 3VAIA 2DGSA 1M5VC 1L3TA 4NASA 4RU9A 1YLXA 1T03B 2HGNA 1NK9A 2HSEB 2DNRA 3TR5A 1N6QB 5E5NA 1X4EA 2GVDB 2B4PA 2J8SA 4ECQA 1HNVB 2ILZA 2VOOA 1JLCA 1WHYA 4NXMJ 1Q16B 5CQGA 2B9YA 2VG7B 1HQ2A 2HNYB 3KYLA 1WF0A 2H5EA 1WC1A 2XMJA 2WBRA 4OFZA 3SIPB 5CD4A 3J81j 1V9OA 4M95A 4MTPA 1IKVA 3CD0A 4B9SA 3TNVA 2NXCA 3CEDA 2GHVC 2WB1D 4USMA 2KT2A 1TUWA 4ZVRB 3C8YA 4B9MA 1FEEA 3QIPA 4X4TA 3D54A 2IM3A 2VPZB 1S1VA 2DYAA 3C6UB 3FMBA 4PEOA 2XSFA 3P45B 1NPRA 3GMGA 5DZ7A 2NLWA 3WX4A 3KLHB 5IT9Y 2JEJA 2OD4A 3PO4A 1OMSA 2L9DA 4P73A 5B0EA 1RLCL 2Z57B 3I82A 2CPHA 1U7LA 2B7CB 3LP0A 1DY3A 3QGHA 4GO5X 3C15B 4I4BA 5HQLA 4C2MA 2ZM6J 1U45A 5LL6d 3RJMB 1PG5B 3VGVA 5HLFA 3CJKA 4QWDA 2VD3A 2M88A 4DV0F 2J9CA 2OPSB 4DU8A 1UEKA 3DRSA 5KFDA 4EUVA 2ZEJA 1F5CA 2DNGA 3IR6B 1UFLA 3S1TA 3ILJA 2GQ2A 3KG4A 1T9UA 5J2QB 1LWCB 1FNMA 2AZ3A 1QSYA 4ED1A 2E1PA 1HBUB 2HWTA 1VS3A 3MEDA 4QU6A 3FGVA 4DPOA 4C4WA 3SYZA 1MWQA 3PW7A 2QTWA 4ZKAA 2VICA 1X4DA 1PAUB 1UZDA 2BM0A 2G9OA 2WOMB 2HK3A 2KVIA 3LW5C 4EZ9A 1SL2A 2JFKA 3IWXA 1Z2LA 1ZM9A 4CH0S 3OR1B 2DNZA 3VF0B 4B9VA 1K44A 1ZOTA 2ZWOA 3GTYX 4C8YA 4FNIA 4PG4A 4LRFA 4EI2A 4ZITA 1HI0P 5H9FK 1A7GE 4NLYA 2RNEA 4MMOA 2UUCJ 2R7VA 1S57A 4E98A 2IAJB 5GAHU 1E6VB 3H25A 4F04B 3R9LA 1HIYA 4MIBA 2KI2A 3BEGB 5LSRA 4Q5VA 2AEJA 4JI7J 4URSA 4X4NA 3MEKA 5EGYA 3N9UC 4WFXA 3G82B 2QJ3A 2HWIA 4K5RA 2IMWP 4DV1F 2QA4S 1TL3B 3ZZTA 3OUYA 1Q8KA 4YB7A 1HW9A 5E33A 3TZWA 3QO9B 2OPPA 2W25A 2XSJB 2FGCA 2XYPB 3LA0A 4ANEA 5LSLA 3TW0A 5U47A 5B0CA 5D78A 3PDNA 5GMKa 1NSKL 4WP9A 4Q2MA 1F0XA 2AJ4A 1FK9A 4JP8A 1TTHB 3MHYA 4DX6A 1CS4B 1U47A 5A2QU 3IWNC 1C1CA 1PC5A 1J2VA 1TKDA 1GQEA 4LF4J 4MFBB 2W2PP 3S01A 3HSGA 3ILIA 4B3RJ 3F41A 3QGGA 5B0AA 3PO5A 2XQCA 4FF2A 3BO4A 2V5HG 4B3TJ 3OT9A 2C42A 4EFAC 3BGOP 3R5CA 7FDRA 1L3VA 2OELA 4L74A 5LJ3Y 3DLLQ 1TAUA 2B5JB 1UFWA 2BV3A 2I1RA 4DOZA 4AYBD 4R5PA 4F8RA 2MSTA 3FBCA 2HQFA 2XMKA 4WFYA 4ZLLA 1S97A 1S9EA 3Q8YA 5J2MA 2K1RB 2M7SA 1UPMB 3KDOA 1EZZB 1NK4A 4P72A 5LM7E 3B8HA 1HL6A 4IDKB 2HBYB 4KBIA 1NM2A 4KSEB 4RW4B 2ILYA 1NEEA 4RW7A 2AGPA 4YHHF 1RGVA 2UUBJ 1LWFA 1X5OA 4X64J 1SL0A 4H4OB 2VJUA 5KG1A 1JXEA 4MK8A 3V4MA 3OHBA 2IBKA 4DV0J 3PKYA 1SIZA 3GFZA 3PTWA 2RE1A 3HLUA 1SH3A 2RH3A 7AT1B 1RT3A 1R8BA 3NOGA 2NSCA 1FVQA 5KFFA 3BKFA 1HWKA 2ZH5A 3RAXA 4JI0F 2KXHA 1FHTA 1U2FA 5CAAA 4TKTA 1CJUB 4C8ZA 5A8WB 2UVVA 2N4DA 1SJRA 2AWZA 4ZCKA 1GMVA 3QQCD 4XAKA 3HKZD 1NKCA 4X66J 2W9CA 3B54A 3OR1A 3PW2A 4FF3A 2HVIA 1FRHA 2ACYA 2CNOB 3MM7B 1N5SA 2QN6B 1JLCB 1AUDA 4Y2AA 2ZWPA 4F0MA 4C0HA 2D3O1 1DRZA 1R6YA 1OQ6A 2A0FB 2JC1A 2VC1A 3BKUA 3OBIA 3BDPA 1IKVB 2KO1A 1U0HA 2HAFA 3I87A 4KT0C 2UUAJ 1FRLA 1S6OA 4KIAA 1KOOA 3SXLA 4KKOB 4URGA 3BPDA 1TU0B 2RT3A 1WWHA 2BKNA 3V81B 2XC9A 1DQAA 1YZ6A 3M30B 5GAGU 2NPFA 5E7OB 4QPXA 2VQEF 2GW8A 2X3GA 4J91A 3R5DA 4N41A 2IJFA 2VASA 3PR5B 2X1BA 1H72C 4OJ1A 5EX0A 1WHXA 3HVRA 3JTNA 3DRPB 1WNEA 2YKNB 1X4GA 1U26A 3AA9A 2PA3A 1EQ0A 2GMLA 1D09B 4ZN1A 3PY8A 3TVZA 5A76A 3I0RA 2GV1A 5KG2A 3IG1A 4LF2A 2MJNA 5KFVA 3L7OA 4DHVA 3LGHA 2V94A 5B0FA 4JI3J 1D1UA 2VZ9A 1H98A 1B7YB 1RXOB 1RTDB 2E1MC 2I38A 1ZAWA 2JH3A 3CUNA 1C0TA 3KG0A 4CO0A 2VQFJ 2XTJP 1X31C 4HACB 3G2XA 4PG8A 1JLEA 1H3DA 1QTNB 1FDDA 2YWFA 3UPFA 1I94F 2H5IB 2QT7A 2DPIA 5ETLA 3T9NA 1RTHA 2PEBA 2FVRA 3MM9A 1IKWA 3UCUP 1NCLA 4USUA 2OMLA 2A3JA 1NKBA 3PFEA 4HT5A 1N5TA 4OHVA 4Y6IA 3BH6B 3KUEA 2QSWA 4H54A 4RNFA 5HP1B 2HGLA 3A3NB 2IJNA 3MMAA 2GCFA 3RRKA 4GVBA 1RWWB 2XY5A 1NK6A 1WI8A 3BZQA 2UUWA 3CCLS 1BC6A 2E29A 5LJ5Y 3AH6A 2FYXA 2W2NP 2HEKA 3EXCX 3K7RA 1S72S 3ETOA 3AJDA 3OD2A 2F63A 2XI2A 1SKRA 3M1VA 3AB4B 2PN6A 3B82A 4LSNB 4OI3A 3BSNA 1SUQB 2DR9A 5LOQA 1U6ZA 2QMWA 4OZNA 2H4WB 4FPRA 1O6XA 5EHHA 4DV4J 4DDFA 1EIYB 4P7TA
chains in the Genus database with same CATH topology
3H5YA 3DLHA 4K2XA 2YKOA 4WFZA 5H9FJ 4ECXA 4N56A 4DSLA 2Y0SD 4WE1B 5G4DA 4ECSA 2FJDB 1BLUA 3R1HA 3SI8A 2IYIA 3JAMY 4RW8B 3LP2A 3CDEA 4HDGA 3VAFA 3MPVA 3EPIA 2FY1A 4MKAA 3CPWR 4DL3A 2LDIA 4FZVA 3EXYA 3W2WB 3VZIA 4QWAA 4ED2A 1T05B 2AJFE 3DMJA 4QU7A 2EFOA 2IBOA 2ZDOA 1NJWA 2UV8A 1NHVA 4C0OC 2ZH1A 3OXFA 2DRBA 1D9AA 5IS2A 2WSFC 3QJLA 2DNOA 3KK3B 5GADI 1UP1A 1ZPWX 4HH1A 1KS2A 3SFGA 3QIPB 1TL4A 2J6SA 3SCJE 2IM0A 5F8HA 2KZZA 2RKIA 2F8MA 5KAKA 3TYTA 2KDOA 1RTJB 4DG1A 4QR0A 3BGRB 1U1LA 3KLEB 2QEXS 4DS5A 2DGWA 3M32A 4BC9A 3VAJA 5THWA 5KTQA 1AFIA 3N5FA 4QPTA 2J6UA 1GTHA 3VZHA 2G1DA 2YX1A 5KFJA 3LP1B 5J1EB 1N5QA 3CGIA 2DK2A 1RTDA 2Y1IA 4EZ6A 3EGNA 4U7UK 1FRJA 2W8LA 3HPOA 3I5BA 2CYYA 4IOAQ 3I9ZA 2AW0A 2XWYA 1UVLA 2DGOA 4C3LA 2J0QD 1KQFB 3MM8B 5AXKA 5B0DA 5DLGA 3B78A 4HTJA 3CJ2A 4WXWA 4HDHA 1S10A 4ZPDA 1LWEA 1KSPA 1TZ0A 1WF1A 3RBDA 1WEYA 5KFXA 4Q0BB 5J2PA 2E9RX 4MAKA 4MJKA 1DAXA 1ROFA 2E5JA 4PCQA 1KC8T 1CSJA 3BQ2A 4KKOA 2LKZA 1FVSA 3NBPB 4ZPVR 1LQ9A 3DRRA 3M8SA 1P27B 3VAGA 3NRBA 3H2UB 1SUQA 4DL4A 1U1KA 5CH7B 1K9MT 4YFUA 4NCGA 5GAEU 4MYUA 3DRPA 1VQ7S 1FF2A 2CVEA 1IBKF 1QM9A 3BDEA 4LFCF 1T95A 1SH2A 3TX8A 2VQFF 2BA9A 4QIFA 2VV5A 3H2VE 4TY8A 1JJHA 1NH7A 2AJQA 2DNHA 2CJAA 4JI2F 4K4TA 2Q66A 5I3UA 1HNIA 4OQJA 1KLMA 5HLFB 1LW0B 1HQUA 1TKXB 2MKCA 2C28A 1C1BB 1LW2A 2ZOMA 5BYSA 1FTCA 2Q6CA 3OFEA 4M5DA 1F9FA 2LU1A 4I2QA 1W25A 2YNHB 2R8GA 2XO7A 4BS2A 1U25A 4KV8A 3HXMA 3EPGA 4D3GA 3NGKA 3LANA 2J0XA 3OTBA 1S6UA 5EX3A 1QUVA 1L3KA 3G96A 3MUTP 1C0TB 4WJBA 4G1PA 3VAMA 1B64A 4B9NA 3AY0A 3PNIA 3IBWA 1JLEB 4NA2A 4X4OA 3MR6A 4H4KA 1OSCA 2BABA 1S7HA 2CQCA 2EFGA 1C2PA 4QWCA 2LA4A 4EBCA 1K8AT 2EC0A 2JLGA 5KFCA 2HIQA 1GX5A 4NLOA 4F3QA 1D0EA 5IFMA 1LOUA 2AYMA 5DDOC 2UU9F 3NS6A 5LMUF 2DNQA 4CZCA 4X4RA 5ADZA 3OL9A 1MSWD 3G6ES 3V6DB 3P3DA 1VHFA 3K0JA 1N56A 2XSJA 2CPXA 1YWXA 1IJFB 3HI9A 4PXEA 4ZS6A 2EFPA 5B0BA 4Q43A 1HWIA 3DOKA 1S1WB 4UY8T 3EZUA 4M8LA 4X64F 2C2EA 4XDDA 3MM7A 1JLAB 5C42B 1RTIA 1FDNA 2J76E 1YRTA 2HFOA 5BYRA 5CYQB 1S1WA 3PRBA 4RNMA 4A8YA 2CQDA 1HNVA 3M6VA 4O4GB 1HI8A 1S9FA 4TYBA 2JEFA 2GJIA 4B9TA 2B43A 4QW9A 4PG6A 1U1MA 4DV3F 2RRBA 2P5VA 2NPIA 3ZFVA 1MROB 2XBPA 1OS5A 4OHZA 3DXSX 3VWSA 4L72B 1U1QA 2V4JA 2KM8C 3C2PA 1S9GB 4XO0A 1VK3A 2B9WA 2PA8D 2YWKA 3I0RB 2J6TA 3FSXA 2MZSA 4RNOA 4CO3A 2RKIB 5DO2A 5AE1A 1KQGB 5F8GA 1Y3JA 2CQHA 1TL1A 5GAGI 2K2PA 4IFVB 4ECVA 2DIUA 3SMZA 3D1HA 3HHLC 5MLCV 2XCPA 1U1NA 3LOUA 3DDKA 2XY6A 2LQ9A 2F1FA 1DFDA 4IOCQ 2FPHX 4RW9A 3IS9A 4DN9A 3OFFA 2R7SA 4Y00A 1W2BR 2WHOA 3Q8PB 1IKYB 2BQ3A 1Q82T 4K4UA 3THPA 5KOWA 2UUCF 3SCLE 3TQ1A 5HBMB 2GA7A 2V8DA 1N5VA 2FHJA 2VB6A 4WCEQ 2KHDA 1HHTP 4F4KA 5EWFA 2KT5A 2QA4G 1RISA 2N82B 1B7FA 4LMZA 2UXCF 2A2CA 1YG0A 2XMMA 5F8LA 2RF2A 1R8HA 1M1KT 3DRRB 3D1QA 3DOLA 3QAEA 2HHSA 1XMQF 3Q2SC 3D0HE 2OPPB 1FRMA 1RA6A 2RQ4A 2M4MA 4MIWA 3KOAA 2OPQA 3WC0A 5DDPC 4FBUA 2L3MA 3G86A 4WK1A 5CYQA 5KG7A 2RRAA 4ZK7M 3PACA 2R8HA 1ZZNA 2HLUA 4ALZA 3PM9A 2E1CA 4YR0A 1RT2A 4IG3A 3FRZA 5HMXA 4RW6A 3KHGA 3IN5A 3W3SA 2EBGA 2OFGX 1DQ9A 3E01A 3MMBA 2KRBA 3QAUA 4ERDA 1U6FA 3JTPA 4QJVA 1YI2S 4W90B 3FEXB 4OX8A 1HBUA 1XEZA 2RDJA 2CJQA 3O8WA 1QSLA 1O5JA 2XNQA 3MOJB 3BN4A 2GIRA 3K59A 1KHVA 3TP2A 3VQTA 2R7WA 2YNGA 1H2UX 1MNEA 3E2EA 3I9V9 5DGAA 1S9GA 1SC6A 2K7JA 4IO9Q 2ZNZA 2HS0A 2D9PA 4OZ5A 4TLQA 2R7QA 5KFYA 4DLEA 1VQOS 4ECTA 3MD1A 1N0UA 1TKTA 2WCXA 4YB5A 3KLGB 4QIGA 4ZHRB 2QFJA 3GYNA 4DFJA 1IBLF 2DHSA 3GB0A 3H59A 4NYOA 1RYRA 3DYAB 4L3NA 3MTKA 5SZTA 4YEAA 2OJ3A 2XB2D 1FXDA 2NQPA 2J9EA 3OTOF 4TY9A 1WHWA 4UUWA 2Z2MA 4YR3A 2ZKUA 2UV8G 2JFDA 1SI9A 1FXRA 2ROEA 5L8RC 4A8XA 3RRHA 2B4VA 2DIVA 1X4HA 4PXDA 4ED8A 4FN5A 1VRTA 3KLFB 2Y1JA 1O8BA 1SJ1A 4PUOB 4M94A 2YNFA 1Y4ZB 5CCMA 3A8EA 4C11A 5KT2A 2YWEA 2E5GA 1UMJA 1HMVA 3GQCA 1YHQS 2FLPA 3KNAA 2JC0A 2XWXA 3SZ2A 1XK8A 3UD4P 3HHLD 3V81A 2CQ2A 4IUFA 4NZ6A 2B5JA 4NCBA 2F9DA 4TQRA 3MXHP 2YX7A 5IWAF 3HHEA 3HZEA 4RZRA 4Y65A 3GV8B 1Q1KA 5A6PA 2Q1LA 1TFYA 2AYEA 2JWNA 3ZZ0A 4UQGA 1RT6A 4OZJA 2X1FA 3H2LA 4A8WA 1WG5A 3C3LA 2OKQA 4OX9F 2JVOA 3NAHA 1L5UA 3ENQA 3DLGA 2VPWB 5I3PA 4YB1P 1CPZA 5D4NA 1RT7A 4I2QB 4C3KA 1VBYA 4CQ1A 2W4CA 2CQGA 4LQ9A 4NRTA 1FTRA 2B51A 4N5SA 4GKKF 4DV4F 2IC3A 4F50A 3V6HA 5G0RA 2GQQA 1WG1A 1HBNA 5A0YB 4JI3F 1DJ0A 2LU2A 3I55S 4QYRA 1HYSA 2IC3B 4ED7A 1GXLA 4KJIA 1FKPA 1VBXA 2WTFA 1IKYA 3CIZA 3MPWA 4N8OA 5T7LB 4KFBA 3IO1A 2ZH6A 4NZ7A 4NA1A 2JEIA 1RYSA 3PX4A 5E3PA 3P49B 2ZNYA 1U48A 1N88A 4X62F 3EZ5A 4WYWA 3GR1A 1F2GA 4NYPA 4IR9A 1JKHB 4PQUA 3BSCA 5F3TA 4WKYA 3RR8A 1D3WA 4OI0A 3THVA 4OJHA 1QAYA 3CIMA 2MPUA 1FK9B 2YNFB 3CC4S 2NXUA 3GFHA 3MUMP 3OV7A 1FXLA 3IWLA 3VQSA 1TUVA 4HI2A 4O4GA 4WFBQ 3HP6A 2W7OA 4IG0A 2JL9A 2O1PA 2ADCA 1HBMA 3M2UA 3TAPA 2LDYA 3I5AA 3CSKA 1TVRB 4P2SA 2BVZA 3UWTA 2DVIA 2CPZA 3AHPA 4DUYF 3ISZA 2KHCA 3KK1A 2YX4A 1J5OB 1NHUA 3VTIA 1HA1A 3DDNA 4ZHRA 5A2QY 3KJVB 4YMEA 1BD6A 2ASDA 3Q0AA 4Y34A 1C0UA 1M90T 1VFJA 1J5OA 3RTVA 1ELOA 4JV5F 4P7VA 2KFZA 5K5MA 2FTRA 3CB4A 2UVUA 5H1SV 2FVQA 5DGBA 1FA0A 1H6KX 3RB0A 1D8ZA 5KFNA 1N5YB 2CQBA 1EETA 4LF4F 3IS9B 4NCAA 4BDPA 3NGDA 2HHUA 2B0GA 2N4CA 4QR1A 1PILA 4O3QA 4N8NA 1VQPS 3BGFA 2QO3A 2CPDA 2FHKA 2AF6A 1TFWA 5J2PB 2BXJA 2CZVC 1B0TA 4IO1A 3N6LA 3IC1A 4MKBA 2EG1A 2J0WA 1NNDA 4Y2KA 1QY7A 2MQOA 3SV3A 2AGOA 4J9NA 4LIRA 4WXOA 4DQQA 3DOMA 1MU2B 5DLFA 2AD9A 1X9WA 2VG5B 2GMJA 3MUVP 2VPYB 4DFMA 4ZCIA 1M5KC 2XNRA 4J9PA 4FXWA 3SCKE 3DRYA 4CO2A 4ECRA 2MKSA 3OTDA 4CT8A 4Z37A 5IXUA 3DXBA 1JIHA 1VIXA 4NLDA 4DV2F 1SL1A 2Z8QA 7FD1A 2V8GA 1XBWA 2M9KA 1S0OA 3CJ3A 3QIDA 5IM0A 2VH7A 1WTBA 2PFFB 1Q7LB 3N01A 2HZCA 3CULA 2AYBA 1FE0A 5LMNF 4DR5F 5K14B 3V6JA 1RP5A 2CJKA 1UETA 1YGYA 2ZH4A 2KJVA 3FCHA 4O3SA 4V19X 1T7PA 2R7OA 2O67A 2GIQA 2D1CA 3HZGA 2RS8A 3O3LA 4MK9A 2YKPA 3P96A 2KTQA 5F9LA 3AAWB 5FDLB 4CCHA 2XGQA 2FIUA 2ZBCA 1NU4A 3T9ZA 1X5TA 2FLOA 2MZ1A 1WTFA 4EBEA 3B4MA 5IQ6A 1HNZF 2DCUB 2CQ0A 1UJ6A 3T1YF 1F60B 1ZETA 3K5OA 3I56S 2V8VA 4I1TA 4ZPAA 4RUAA 3KLGA 4Y2MA 1LK7A 3CC2S 3H5XA 1TV6A 2HNDB 2E66A 4O0IA 3D1OA 1JMTA 1FRIA 5HMZA 3DLBA 3NAIA 2QRRA 2ZFHA 2PD1A 1QAJA 3V2UC 4KR0B 3D28A 3JYTB 3M8QB 5L1IA 5K9FA 2C22A 2ZHOA 1OIAA 5FIIA 4DQSA 4TQSA 2KM8B 1HQEA 4DV5F 2JVRA 2GNKA 2FUG9 1SXLA 2HG4A 3C6TA 3CD5A 4KAIA 4I64A 1IM4A 1LK5A 3GIJA 3CT9A 4WK3A 3TVKA 5CYJA 4DLGA 3I96A 1RTIB 1QE1A 1DZ5A 3PRDA 2BM1A 4KHPF 5DETA 5L9NA 1VI7A 1H2TZ 2ROGA 3HM9A 1HBMB 2JX2A 3M2UB 4QQBA 2P9GA 2N7CA 2KG0A 2YNHA 3BQ1A 2OMOA 3EGZA 1R31A 2EVZA 1VQLS 3CJ5A 2O66A 3MI7X 2ABYA 2VKRA 4MYTA 1N8RT 2QE5A 3MR3A 2HHWA 3MEGB 2DGVA 4OIXA 3GILA 3FEZA 2U1AA 4NLSA 3TARA 2LCWA 1F5BA 5KG3A 3I32A 2HVHA 3X1LB 2K7KA 5IT4A 1MW7A 1JK9B 4EGLA 4E0DA 1H0HB 1KD1T 5E3CA 5KFKA 2CPEA 5E2QA 5HMYA 2YKQA 1AXQA 3G8QA 4RW7B 2JRSA 2BZ2A 4WFNQ 2V4RA 2XMWA 3FDSA 1NKEA 3MECB 3POTB 4A8OA 4R0JA 5HO4A 3U1MA 4RBVA 5AXLA 1JXLA 1ZM4A 2OP5A 2WAQD 4DR1F 4ED0A 1RJJA 2B6AB 4H4KC 1KEKA 4DSFA 2NS1B 5CD4H 2G13A 4TN2A 4I69A 3ULHA 3T19A 3OFGA 3N5BA 2MKKA 2HHPA 3T1HF 2GGPB 1JX4A 4HVZA 6FDRA 3PW0A 1XC9A 2W9BB 3LGNA 2AP6A 1JLAA 2ZDPA 4DQRA 4TU8A 3BO2A 3HFKA 1HBOA 2VG5A 4LSLB 4KFBB 3H4BA 2NYIA 4MKYA 1R8CA 3AJ1A 5D4LA 4DL2A 1OPZA 4PXBA 5J1PA 4CTAA 2HVZA 2MZTA 4RU2A 2HRUA 3CMAS 2ASLA 2EI5A 2V0NA 4FVMA 2KU7A 3THTA 2V8HA 3LWLA 2RD5C 4ZVEA 5FJ4A 2PI4A 4BWMA 1XWLA 2BANA 4AFFA 4M63A 2R8IA 3A1YG 2FHMA 4G3IA 5A8RB 1FERA 5ITHA 2BDPA 4IFYB 1XR7A 4U9RA 4RBTA 1LWFB 2HQIA 2F3JA 1EP4B 3GZ7A 4IH7A 3ZZYA 2AYGA 1FHTA 4DR6F 2FB0A 2GX8A 3LAMA 3PVXA 4G6VB 2BRKA 3FRYA 2XMTA 4KGMA 4ES2A 1X4CA 4OI6A 5J2NB 1FT8A 1BQNB 2NUUG 4NRUA 1WACA 1G3OA 2R8JA 2DNYA 3MR2A 1OSDA 2IFXA 5M2UA 2U2FA 2P9EA 1SV5B 4ILMA 1H7WA 3SFUA 2VBWA 4USIA 1P1TA 2YNIA 2BE2A 3C46A 4QIEA 4R8UA 1IKWB 3H8YA 5EN1A 1Q86T 2RSQA 3OHAA 1FJGF 2IRYA 4B3RF 2RQKA 2ZH3A 4I7FB 4NL5A 2HMIA 3WDOA 2ZJRQ 4ELUA 2VKZG 4KB7A 2OO4A 3TA1A 1SJQA 4J37A 1JWWA 2HNYA 1D9DA 3OVAA 5F41A 1VQNS 4I7FA 5KFPA 5F8NA 3H20A 3DOLB 2EPIA 4U67Q 2MY8A 5HI7A 2J9DA 4OHXA 2W4PA 5IQQA 1QVFR 2IMOA 1Q78A 5HROA 4IH6A 3DOKB 1O0PA 1Z2ZA 4Y2IA 2I5JB 1JLBA 1URNA 2A18A 1S1XA 1O51A 3D5MA 3UI3A 2C3OA 1RI7A 4ECUA 1ZTTA 1U24A 3UFCX 3PW4A 5JJBA 2J5AA 3FNNA 4ZOSA 4C11B 4C8NA 4DQPA 3OPKA 3TO8A 5A8KB 5CZXA 3UQSA 4R5PB 3PJWA 1ZPVA 3SDEA 4V19J 1P9QC 4MFBA 1BQXA 2E7XA 4U7CA 3ISND 2DPJA 1UA1A 3FFIA 2BANB 2DHXA 3OVBA 2C2RA 1P1LA 2AJ1A 1PC4A 2VL1A 2W9AA 2CQ1A 3KK2B 2MXYA 1L3UA 1E6YB 4I56A 2UUBF 2EK1A 1S79A 2EFVA 4ITSA 1S0NA 3DU5A 1UJ4A 1X7VA 2DH9A 3BGRA 2MJUA 1VRUB 1R43A