4QIIA

Crystal structure of type ii menb from mycobacteria tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
300
Chain Sequence
LSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-dependent active-site closure revealed in the crystal structure of Mycobacterium tuberculosis MenB complexed with product analogues
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 114
structure length 300
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4qiiA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4qiiA01
5G1QA 1EF9A 3KQFA 5E0SA 3TVWA 1UYVA 5KJPA 4U18A 4NEKA 3OT6A 2Q2XA 3H0QA 3HE2A 4JYLA 3MT6A 3LAOA 4IZDA 5DZKA 5JBWA 3T3WA 4ASIA 3Q1TA 4U0GH 2J5IA 3U9RB 3TZ3A 4JSBA 4KNPA 1EF8A 1OD4A 2ZL2A 3MOYA 4K2NA 3T8BA 3VIVA 3V5IA 3T88A 4FNBA 2IEXA 2QQ3A 4ELWA 3G64A 1RJNA 4KWBA 3BF0A 1PIXA 5DUCA 4ELSA 2J5II 2F6QA 4K29A 4HC8A 2DUBA 1WDLA 4YLHA 1JXZA 3M6NA 1XO6A 3RSTA 2X58A 3ZWCA 4I4ZA 1N6DA 3FDUA 4EMLA 2Q34A 3HP0A 1ON9A 4LK5A 3R0OA 3MYBA 4MI2A 3TRRA 2FBMA 2UZFA 2F9YB 4QIIA 4IZBA 1NZYA 3SLLA 3QXZA 1FC7A 4L6WA 5C9GA 2VSUC 4OLQA 1O8UA 4KD6A 1XNVA 3KTJA 4JWVA 2ZL0A 1Q52A 1YG6A 4JCTA 4FN8A 4HNKA 3P85A 1WZ8A 4B3JA 4JCSA 5DKPA 4ZDBA 3GF7A 4Q1IA 3GLMA 1UIYA 3H02A 3TVUA 4F47A 2GTRA 2FZSA 4G2RA 3M6MA 5FUSA 3OMEA 4OG1A 2F9YA 4OMRA 1YG8A 3QKAA 1UYRA 1K39A 4NNQA 3RSIA 4ZDEA 3JU1A 5INGA 4FNDA 1SZOA 2X24A 3BEZA 5MGBA 3L3SA 4JCQA 3NJDA 4U0GA 3T89A 2VSUE 3QWDA 3FF6A 4JFCA 5FIFA 1Q51A 2PPYA 2DEOA 1Y7OA 2W3PA 1XNYA 4JJTA 2CE3A 3TT7A 4IZCA 1NZYB 4QFEA 2ZL4A 3U9SB 3ISAA 4EMMA 5E0SH 3Q7HA 3PZKA 1X0UA 3P5MA 4B3IA 1PJHA 5E0NX 1WDKA 2VX2A 3HRXA 4WYOB 4I52A 3R6HA 5DU6A 4WZ8B 1K32A 4ZDCA 3QK8A 3H0UA 4ZDFA 3KTGA 3V5EA 4FZWC 2D3TA 4MOUA 4FN7A 3NJBA 3WG5A 5INIA 3IBBA 3H81A 5C90A 2J5IB 4I42A 2VSUF 3ZWBA 2BZRA 5DL1A 1RJMA 3QMJA 3OC7A 4EMPA 4Q0GA 5DUFA 1TYFA 4GHNA 3PE8A 3I47A 3MFMA 3Q0GA 2VSSA 4JOTA 2FW2A 4L8KA 3R9TA 5IKLB 2VSSF 4RCNA 3HINA 2NP9A 3ST9A 4JVTA 1J7XA 4U0HA 4RYFH 5KDRA 5G1SA 2HW5A 2ZL3A 3KTKA 5INFA 3K8XA 5CTCA 2EJ5A 2VSUA 5KDRB 3HLN1 3TT6A 3ZW9A 5CTBA 2A7KA 2VSSE 1W2XA 1FCFA 1MJ3A 3PGQA 4GM2A 2A7SA 3GF3A 4ELXA 4U1AA 4B3HA 2Q35A 4FB8A 4QIJA 3R9SA 2F6IA 2PG8A 3TDCA 1XNWA 1XX4A 3LKEA 3KTIA 3T8AA 4K3WA 1FC9A 2F9IA 1VRGA 3N6RB 2J5GD 3QXIA 3P2LA 1UYTA 1WDMA 1N6EA 1N6FA 1SG4A 1TG6A 4JYJA 4Z0MA 3ZW8A 3TV5A 1HNOA 3SWXA 4ZDDA 3TLFA 2J5SA 5G1RA 3ZWAA 3IB9A 2WTBA 1OD2A 3H0SA 4RYFA 4JCRA 2CBYA 1ON3A 5JBXA 2F9IB 3GMAA 3GKBA 4FZWA 1HNUA 5DU8A 3KTHA 5DZKH 2VREA 4U19A 3QYRA 3Q0JA 4MXIA 3K50A 5DTPA 1HZDA 1EY3A 2A81A 4KPKA 4ZU2A 3U9TB 3DORA 5DTWA 1DUBA 3PEAA 2PBPA 3DJAA 2ZQRA 3IAVA 5DU4A 3R9QA 3RRVA 3STAA 2ZQQA 2C8TA 1DCIA 4FJWD 1FC6A 4DI1A 3QREA 1UYSA 4WCZA 3H0JA 3BPPA 2J5GA
chains in the Genus database with same CATH superfamily
5G1QA 1EF9A 3KQFA 5E0SA 3TVWA 1UYVA 5KJPA 4U18A 4NEKA 3OT6A 1UX4A 1UX5A 2Q2XA 3H0QA 3HE2A 4JYLA 3MT6A 3LAOA 4IZDA 5DZKA 5JBWA 3T3WA 4ASIA 3L8JA 3Q1TA 4U0GH 2J5IA 3U9RB 3TZ3A 4JSBA 4KNPA 1EF8A 1OD4A 2ZL2A 3MOYA 4K2NA 3T8BA 3VIVA 3V5IA 3A4MA 3T88A 4FNBA 2IEXA 2QQ3A 4ELWA 3G64A 1RJNA 4KWBA 3BF0A 1PIXA 5DUCA 3A4LA 4ELSA 2J5II 2F6QA 4K29A 4HC8A 2DUBA 1WDLA 4YLHA 1JXZA 3M6NA 3RSTA 1XO6A 3AJMA 2X58A 3ZWCA 4I4ZA 1N6DA 3FDUA 4EMLA 2Q34A 3HP0A 1ON9A 4LK5A 3R0OA 3ADCA 3MYBA 4MI2A 3TRRA 2FBMA 2UZFA 2F9YB 4QIIA 4IZBA 1NZYA 4J2UA 3SLLA 3QXZA 1FC7A 4L6WA 3RQFA 5C9GA 2VSUC 4OLQA 1O8UA 4KD6A 1XNVA 3KTJA 3O4XE 4JWVA 2ZL0A 1Q52A 1YG6A 4JCTA 4FN8A 4HNKA 3P85A 1WZ8A 4B3JA 4JCSA 5DKPA 4ZDBA 3GF7A 4Q1IA 3GLMA 1UIYA 3H02A 3TVUA 3IRBA 4F47A 2GTRA 2FZSA 4G2RA 3M6MA 5FUSA 3OMEA 4HDTA 4OG1A 2F9YA 4OMRA 1YG8A 3QKAA 1UYRA 1K39A 4NNQA 3RSIA 4ZDEA 3A4NA 3JU1A 5INGA 4FNDA 1SZOA 2X24A 3BEZA 5MGBA 3L3SA 4JCQA 3NJDA 4U0GA 1Y64B 3T89A 2VSUE 3QWDA 3FF6A 4JFCA 5FIFA 1Q51A 2PPYA 2DEOA 1Y7OA 2W3PA 1XNYA 4JJTA 2CE3A 3TT7A 4IZCA 1NZYB 4QFEA 2ZL4A 4NARA 3RQEA 3U9SB 3ISAA 4EMMA 5E0SH 3Q7HA 3PZKA 1X0UA 3BPTA 3P5MA 4B3IA 1PJHA 5E0NX 1WDKA 2VX2A 3HRXA 4WYOB 4I52A 3R6HA 3AM1A 5DU6A 4WZ8B 1K32A 4ZDCA 3QK8A 3H0UA 4ZDFA 3KTGA 3V5EA 4FZWC 2D3TA 4MOUA 4FN7A 2P63A 3NJBA 3WG5A 5INIA 3IBBA 3H81A 5C90A 2J5IB 4GEHB 4I42A 2VSUF 3ZWBA 2BZRA 5DL1A 1RJMA 3QMJA 3OC7A 4EMPA 4Q0GA 5DUFA 1TYFA 4GHNA 3PE8A 3I47A 3MFMA 3Q0GA 2VSSA 4JOTA 2FW2A 4L8KA 3R9TA 5IKLB 2VSSF 4RCNA 3HINA 2NP9A 3ST9A 4JVTA 1J7XA 4U0HA 4RYFH 5KDRA 5G1SA 2HW5A 2ZL3A 3KTKA 5INFA 3K8XA 5CTCA 2EJ5A 2VSUA 3W8HB 3HLN1 5KDRB 3TT6A 3ZW9A 5CTBA 2A7KA 2VSSE 1W2XA 1FCFA 1MJ3A 3PGQA 4GM2A 2A7SA 3GF3A 4ELXA 4U1AA 4B3HA 2Q35A 4FB8A 4QIJA 3L8IA 3R9SA 2F6IA 2PG8A 3TDCA 1XNWA 1XX4A 3LKEA 3KTIA 3T8AA 4K3WA 1FC9A 2F9IA 1VRGA 3N6RB 2J5GD 3QXIA 2YJGA 3P2LA 3ADBA 1UYTA 1WDMA 1N6EA 1N6FA 1SG4A 1TG6A 4JYJA 4Z0MA 3ZW8A 3TV5A 1HNOA 3SWXA 4ZDDA 3TLFA 2J5SA 5G1RA 3ZWAA 3IB9A 2WTBA 1OD2A 3H0SA 4RYFA 4JCRA 2CBYA 1ON3A 5JBXA 2F9IB 3GMAA 3GKBA 5HUQA 4FZWA 3W8IB 1HNUA 3KTHA 5DU8A 5DZKH 2VREA 4U19A 3QYRA 3Q0JA 4MXIA 3K50A 5DTPA 1HZDA 1EY3A 2A81A 4KPKA 4ZU2A 3U9TB 3DORA 5DTWA 1DUBA 3PEAA 3RQGA 2PBPA 3DJAA 2ZQRA 3ADDA 3IAVA 5DU4A 3R9QA 3RRVA 3STAA 2ZQQA 2C8TA 1DCIA 4FJWD 1FC6A 4DI1A 3QREA 1UYSA 4WCZA 3H0JA 3BPPA 2J5GA
chains in the Genus database with same CATH topology
5G1QA 1EF9A 3KQFA 5E0SA 3TVWA 1UYVA 5KJPA 4U18A 4NEKA 3OT6A 2Q2XA 3H0QA 3HE2A 4JYLA 3MT6A 3LAOA 4IZDA 5DZKA 5JBWA 3T3WA 4ASIA 3Q1TA 4U0GH 2J5IA 3U9RB 3TZ3A 4JSBA 4KNPA 1EF8A 1OD4A 2ZL2A 3MOYA 4K2NA 3T8BA 3VIVA 3V5IA 3T88A 4FNBA 2IEXA 2QQ3A 4ELWA 3G64A 1RJNA 4KWBA 3BF0A 1PIXA 5DUCA 4ELSA 2J5II 2F6QA 4K29A 4HC8A 2DUBA 1WDLA 4YLHA 1JXZA 3M6NA 1XO6A 3RSTA 2X58A 3ZWCA 4I4ZA 1N6DA 3FDUA 4EMLA 2Q34A 3HP0A 1ON9A 4LK5A 3R0OA 3MYBA 4MI2A 3TRRA 2FBMA 2UZFA 2F9YB 4QIIA 4IZBA 1NZYA 4J2UA 3SLLA 3QXZA 1FC7A 4L6WA 5C9GA 2VSUC 4OLQA 1O8UA 4KD6A 1XNVA 3KTJA 4JWVA 2ZL0A 1Q52A 1YG6A 4JCTA 4FN8A 4HNKA 3P85A 1WZ8A 4B3JA 4JCSA 5DKPA 4ZDBA 3GF7A 4Q1IA 3GLMA 1UIYA 3H02A 3TVUA 4F47A 2GTRA 2FZSA 4G2RA 3M6MA 5FUSA 3OMEA 4HDTA 4OG1A 2F9YA 4OMRA 1YG8A 3QKAA 1UYRA 1K39A 4NNQA 3RSIA 4ZDEA 3JU1A 5INGA 4FNDA 1SZOA 2X24A 3BEZA 5MGBA 3L3SA 4JCQA 3NJDA 4U0GA 3T89A 2VSUE 3QWDA 3FF6A 4JFCA 5FIFA 1Q51A 2PPYA 2DEOA 1Y7OA 2W3PA 1XNYA 4JJTA 2CE3A 3TT7A 4IZCA 1NZYB 4QFEA 2ZL4A 4NARA 3U9SB 3ISAA 4EMMA 5E0SH 3Q7HA 3PZKA 1X0UA 3BPTA 3P5MA 4B3IA 1PJHA 5E0NX 1WDKA 2VX2A 3HRXA 4WYOB 4I52A 3R6HA 5DU6A 4WZ8B 1K32A 4ZDCA 3QK8A 3H0UA 4ZDFA 3KTGA 3V5EA 4FZWC 2D3TA 4MOUA 4FN7A 3NJBA 3WG5A 5INIA 3IBBA 3H81A 5C90A 2J5IB 4I42A 2VSUF 3ZWBA 2BZRA 5DL1A 1RJMA 3QMJA 3OC7A 4EMPA 4Q0GA 5DUFA 1TYFA 4GHNA 3PE8A 3I47A 3MFMA 3Q0GA 2VSSA 4JOTA 2FW2A 4L8KA 3R9TA 5IKLB 2VSSF 4RCNA 3HINA 2NP9A 3ST9A 4JVTA 1J7XA 4U0HA 4RYFH 5KDRA 5G1SA 2HW5A 2ZL3A 3KTKA 5INFA 3K8XA 5CTCA 2EJ5A 2VSUA 3HLN1 5KDRB 3TT6A 3ZW9A 5CTBA 2A7KA 2VSSE 1W2XA 1FCFA 1MJ3A 3PGQA 4GM2A 2A7SA 3GF3A 4ELXA 4U1AA 4B3HA 2Q35A 4FB8A 4QIJA 3R9SA 2F6IA 2PG8A 3TDCA 1XNWA 1XX4A 3LKEA 3KTIA 3T8AA 4K3WA 1FC9A 2F9IA 1VRGA 3N6RB 2J5GD 3QXIA 2YJGA 3P2LA 1UYTA 1WDMA 1N6EA 1N6FA 1SG4A 1TG6A 4JYJA 4Z0MA 3ZW8A 3TV5A 1HNOA 3SWXA 4ZDDA 3TLFA 2J5SA 5G1RA 3ZWAA 3IB9A 2WTBA 1OD2A 3H0SA 4RYFA 4JCRA 2CBYA 1ON3A 5JBXA 2F9IB 3GMAA 3GKBA 5HUQA 4FZWA 1HNUA 5DU8A 3KTHA 5DZKH 2VREA 4U19A 3QYRA 3Q0JA 4MXIA 3K50A 5DTPA 1HZDA 1EY3A 2A81A 4KPKA 4ZU2A 3U9TB 3DORA 5DTWA 1DUBA 3PEAA 2PBPA 3DJAA 2ZQRA 3IAVA 5DU4A 3R9QA 3RRVA 3STAA 2ZQQA 2C8TA 1DCIA 4FJWD 1FC6A 4DI1A 3QREA 1UYSA 4WCZA 3H0JA 3BPPA 2J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G1Q A;  1EF9 A;  3KQF A;  5E0S A;  3TVW A;  1UYV A;  5KJP A;  4U18 A;  4NEK A;  3OT6 A;  2Q2X A;  3H0Q A;  3HE2 A;  4JYL A;  3MT6 A;  3LAO A;  4IZD A;  5DZK A;  5JBW A;  3T3W A;  4ASI A;  3Q1T A;  4U0G H;  2J5I A;  3U9R B;  3TZ3 A;  4JSB A;  4KNP A;  1EF8 A;  1OD4 A;  2ZL2 A;  3MOY A;  4K2N A;  3T8B A;  3VIV A;  3V5I A;  3T88 A;  4FNB A;  2IEX A;  2QQ3 A;  4ELW A;  3G64 A;  1RJN A;  4KWB A;  3BF0 A;  1PIX A;  5DUC A;  4ELS A;  2J5I I;  2F6Q A;  4K29 A;  4HC8 A;  2DUB A;  1WDL A;  4YLH A;  1JXZ A;  3M6N A;  1XO6 A;  3RST A;  2X58 A;  3ZWC A;  4I4Z A;  1N6D A;  3FDU A;  4EML A;  2Q34 A;  3HP0 A;  1ON9 A;  4LK5 A;  3R0O A;  3MYB A;  4MI2 A;  3TRR A;  2FBM A;  2UZF A;  2F9Y B;  4QII A;  4IZB A;  1NZY A;  3SLL A;  3QXZ A;  1FC7 A;  4L6W A;  5C9G A;  2VSU C;  4OLQ A;  1O8U A;  4KD6 A;  1XNV A;  3KTJ A;  4JWV A;  2ZL0 A;  1Q52 A;  1YG6 A;  4JCT A;  4FN8 A;  4HNK A;  3P85 A;  1WZ8 A;  4B3J A;  4JCS A;  5DKP A;  4ZDB A;  3GF7 A;  4Q1I A;  3GLM A;  1UIY A;  3H02 A;  3TVU A;  4F47 A;  2GTR A;  2FZS A;  4G2R A;  3M6M A;  5FUS A;  3OME A;  4OG1 A;  2F9Y A;  4OMR A;  1YG8 A;  3QKA A;  1UYR A;  1K39 A;  4NNQ A;  3RSI A;  4ZDE A;  3JU1 A;  5ING A;  4FND A;  1SZO A;  2X24 A;  3BEZ A;  5MGB A;  3L3S A;  4JCQ A;  3NJD A;  4U0G A;  3T89 A;  2VSU E;  3QWD A;  3FF6 A;  4JFC A;  5FIF A;  1Q51 A;  2PPY A;  2DEO A;  1Y7O A;  2W3P A;  1XNY A;  4JJT A;  2CE3 A;  3TT7 A;  4IZC A;  1NZY B;  4QFE A;  2ZL4 A;  3U9S B;  3ISA A;  4EMM A;  5E0S H;  3Q7H A;  3PZK A;  1X0U A;  3P5M A;  4B3I A;  1PJH A;  5E0N X;  1WDK A;  2VX2 A;  3HRX A;  4WYO B;  4I52 A;  3R6H A;  5DU6 A;  4WZ8 B;  1K32 A;  4ZDC A;  3QK8 A;  3H0U A;  4ZDF A;  3KTG A;  3V5E A;  4FZW C;  2D3T A;  4MOU A;  4FN7 A;  3NJB A;  3WG5 A;  5INI A;  3IBB A;  3H81 A;  5C90 A;  2J5I B;  4I42 A;  2VSU F;  3ZWB A;  2BZR A;  5DL1 A;  1RJM A;  3QMJ A;  3OC7 A;  4EMP A;  4Q0G A;  5DUF A;  1TYF A;  4GHN A;  3PE8 A;  3I47 A;  3MFM A;  3Q0G A;  2VSS A;  4JOT A;  2FW2 A;  4L8K A;  3R9T A;  5IKL B;  2VSS F;  4RCN A;  3HIN A;  2NP9 A;  3ST9 A;  4JVT A;  1J7X A;  4U0H A;  4RYF H;  5KDR A;  5G1S A;  2HW5 A;  2ZL3 A;  3KTK A;  5INF A;  3K8X A;  5CTC A;  2EJ5 A;  2VSU A;  5KDR B;  3HLN 1;  3TT6 A;  3ZW9 A;  5CTB A;  2A7K A;  2VSS E;  1W2X A;  1FCF A;  1MJ3 A;  3PGQ A;  4GM2 A;  2A7S A;  3GF3 A;  4ELX A;  4U1A A;  4B3H A;  2Q35 A;  4FB8 A;  4QIJ A;  3R9S A;  2F6I A;  2PG8 A;  3TDC A;  1XNW A;  1XX4 A;  3LKE A;  3KTI A;  3T8A A;  4K3W A;  1FC9 A;  2F9I A;  1VRG A;  3N6R B;  2J5G D;  3QXI A;  3P2L A;  1UYT A;  1WDM A;  1N6E A;  1N6F A;  1SG4 A;  1TG6 A;  4JYJ A;  4Z0M A;  3ZW8 A;  3TV5 A;  1HNO A;  3SWX A;  4ZDD A;  3TLF A;  2J5S A;  5G1R A;  3ZWA A;  3IB9 A;  2WTB A;  1OD2 A;  3H0S A;  4RYF A;  4JCR A;  2CBY A;  1ON3 A;  5JBX A;  2F9I B;  3GMA A;  3GKB A;  4FZW A;  1HNU A;  5DU8 A;  3KTH A;  5DZK H;  2VRE A;  4U19 A;  3QYR A;  3Q0J A;  4MXI A;  3K50 A;  5DTP A;  1HZD A;  1EY3 A;  2A81 A;  4KPK A;  4ZU2 A;  3U9T B;  3DOR A;  5DTW A;  1DUB A;  3PEA A;  2PBP A;  3DJA A;  2ZQR A;  3IAV A;  5DU4 A;  3R9Q A;  3RRV A;  3STA A;  2ZQQ A;  2C8T A;  1DCI A;  4FJW D;  1FC6 A;  4DI1 A;  3QRE A;  1UYS A;  4WCZ A;  3H0J A;  3BPP A;  2J5G A; 
#chains in the Genus database with same CATH topology
 5G1Q A;  1EF9 A;  3KQF A;  5E0S A;  3TVW A;  1UYV A;  5KJP A;  4U18 A;  4NEK A;  3OT6 A;  1UX4 A;  1UX5 A;  2Q2X A;  3H0Q A;  3HE2 A;  4JYL A;  3MT6 A;  3LAO A;  4IZD A;  5DZK A;  5JBW A;  3T3W A;  4ASI A;  3L8J A;  3Q1T A;  4U0G H;  2J5I A;  3U9R B;  3TZ3 A;  4JSB A;  4KNP A;  1EF8 A;  1OD4 A;  2ZL2 A;  3MOY A;  4K2N A;  3T8B A;  3VIV A;  3V5I A;  3A4M A;  3T88 A;  4FNB A;  2IEX A;  2QQ3 A;  4ELW A;  3G64 A;  1RJN A;  4KWB A;  3BF0 A;  1PIX A;  5DUC A;  3A4L A;  4ELS A;  2J5I I;  2F6Q A;  4K29 A;  4HC8 A;  2DUB A;  1WDL A;  4YLH A;  1JXZ A;  3M6N A;  3RST A;  1XO6 A;  3AJM A;  2X58 A;  3ZWC A;  4I4Z A;  1N6D A;  3FDU A;  4EML A;  2Q34 A;  3HP0 A;  1ON9 A;  4LK5 A;  3R0O A;  3ADC A;  3MYB A;  4MI2 A;  3TRR A;  2FBM A;  2UZF A;  2F9Y B;  4QII A;  4IZB A;  1NZY A;  4J2U A;  3SLL A;  3QXZ A;  1FC7 A;  4L6W A;  3RQF A;  5C9G A;  2VSU C;  4OLQ A;  1O8U A;  4KD6 A;  1XNV A;  3KTJ A;  3O4X E;  4JWV A;  2ZL0 A;  1Q52 A;  1YG6 A;  4JCT A;  4FN8 A;  4HNK A;  3P85 A;  1WZ8 A;  4B3J A;  4JCS A;  5DKP A;  4ZDB A;  3GF7 A;  4Q1I A;  3GLM A;  1UIY A;  3H02 A;  3TVU A;  3IRB A;  4F47 A;  2GTR A;  2FZS A;  4G2R A;  3M6M A;  5FUS A;  3OME A;  4HDT A;  4OG1 A;  2F9Y A;  4OMR A;  1YG8 A;  3QKA A;  1UYR A;  1K39 A;  4NNQ A;  3RSI A;  4ZDE A;  3A4N A;  3JU1 A;  5ING A;  4FND A;  1SZO A;  2X24 A;  3BEZ A;  5MGB A;  3L3S A;  4JCQ A;  3NJD A;  4U0G A;  1Y64 B;  3T89 A;  2VSU E;  3QWD A;  3FF6 A;  4JFC A;  5FIF A;  1Q51 A;  2PPY A;  2DEO A;  1Y7O A;  2W3P A;  1XNY A;  4JJT A;  2CE3 A;  3TT7 A;  4IZC A;  1NZY B;  4QFE A;  2ZL4 A;  4NAR A;  3RQE A;  3U9S B;  3ISA A;  4EMM A;  5E0S H;  3Q7H A;  3PZK A;  1X0U A;  3BPT A;  3P5M A;  4B3I A;  1PJH A;  5E0N X;  1WDK A;  2VX2 A;  3HRX A;  4WYO B;  4I52 A;  3R6H A;  3AM1 A;  5DU6 A;  4WZ8 B;  1K32 A;  4ZDC A;  3QK8 A;  3H0U A;  4ZDF A;  3KTG A;  3V5E A;  4FZW C;  2D3T A;  4MOU A;  4FN7 A;  2P63 A;  3NJB A;  3WG5 A;  5INI A;  3IBB A;  3H81 A;  5C90 A;  2J5I B;  4GEH B;  4I42 A;  2VSU F;  3ZWB A;  2BZR A;  5DL1 A;  1RJM A;  3QMJ A;  3OC7 A;  4EMP A;  4Q0G A;  5DUF A;  1TYF A;  4GHN A;  3PE8 A;  3I47 A;  3MFM A;  3Q0G A;  2VSS A;  4JOT A;  2FW2 A;  4L8K A;  3R9T A;  5IKL B;  2VSS F;  4RCN A;  3HIN A;  2NP9 A;  3ST9 A;  4JVT A;  1J7X A;  4U0H A;  4RYF H;  5KDR A;  5G1S A;  2HW5 A;  2ZL3 A;  3KTK A;  5INF A;  3K8X A;  5CTC A;  2EJ5 A;  2VSU A;  3W8H B;  3HLN 1;  5KDR B;  3TT6 A;  3ZW9 A;  5CTB A;  2A7K A;  2VSS E;  1W2X A;  1FCF A;  1MJ3 A;  3PGQ A;  4GM2 A;  2A7S A;  3GF3 A;  4ELX A;  4U1A A;  4B3H A;  2Q35 A;  4FB8 A;  4QIJ A;  3L8I A;  3R9S A;  2F6I A;  2PG8 A;  3TDC A;  1XNW A;  1XX4 A;  3LKE A;  3KTI A;  3T8A A;  4K3W A;  1FC9 A;  2F9I A;  1VRG A;  3N6R B;  2J5G D;  3QXI A;  2YJG A;  3P2L A;  3ADB A;  1UYT A;  1WDM A;  1N6E A;  1N6F A;  1SG4 A;  1TG6 A;  4JYJ A;  4Z0M A;  3ZW8 A;  3TV5 A;  1HNO A;  3SWX A;  4ZDD A;  3TLF A;  2J5S A;  5G1R A;  3ZWA A;  3IB9 A;  2WTB A;  1OD2 A;  3H0S A;  4RYF A;  4JCR A;  2CBY A;  1ON3 A;  5JBX A;  2F9I B;  3GMA A;  3GKB A;  5HUQ A;  4FZW A;  3W8I B;  1HNU A;  3KTH A;  5DU8 A;  5DZK H;  2VRE A;  4U19 A;  3QYR A;  3Q0J A;  4MXI A;  3K50 A;  5DTP A;  1HZD A;  1EY3 A;  2A81 A;  4KPK A;  4ZU2 A;  3U9T B;  3DOR A;  5DTW A;  1DUB A;  3PEA A;  3RQG A;  2PBP A;  3DJA A;  2ZQR A;  3ADD A;  3IAV A;  5DU4 A;  3R9Q A;  3RRV A;  3STA A;  2ZQQ A;  2C8T A;  1DCI A;  4FJW D;  1FC6 A;  4DI1 A;  3QRE A;  1UYS A;  4WCZ A;  3H0J A;  3BPP A;  2J5G A; 
#chains in the Genus database with same CATH homology
 5G1Q A;  1EF9 A;  3KQF A;  5E0S A;  3TVW A;  1UYV A;  5KJP A;  4U18 A;  4NEK A;  3OT6 A;  2Q2X A;  3H0Q A;  3HE2 A;  4JYL A;  3MT6 A;  3LAO A;  4IZD A;  5DZK A;  5JBW A;  3T3W A;  4ASI A;  3Q1T A;  4U0G H;  2J5I A;  3U9R B;  3TZ3 A;  4JSB A;  4KNP A;  1EF8 A;  1OD4 A;  2ZL2 A;  3MOY A;  4K2N A;  3T8B A;  3VIV A;  3V5I A;  3T88 A;  4FNB A;  2IEX A;  2QQ3 A;  4ELW A;  3G64 A;  1RJN A;  4KWB A;  3BF0 A;  1PIX A;  5DUC A;  4ELS A;  2J5I I;  2F6Q A;  4K29 A;  4HC8 A;  2DUB A;  1WDL A;  4YLH A;  1JXZ A;  3M6N A;  1XO6 A;  3RST A;  2X58 A;  3ZWC A;  4I4Z A;  1N6D A;  3FDU A;  4EML A;  2Q34 A;  3HP0 A;  1ON9 A;  4LK5 A;  3R0O A;  3MYB A;  4MI2 A;  3TRR A;  2FBM A;  2UZF A;  2F9Y B;  4QII A;  4IZB A;  1NZY A;  4J2U A;  3SLL A;  3QXZ A;  1FC7 A;  4L6W A;  5C9G A;  2VSU C;  4OLQ A;  1O8U A;  4KD6 A;  1XNV A;  3KTJ A;  4JWV A;  2ZL0 A;  1Q52 A;  1YG6 A;  4JCT A;  4FN8 A;  4HNK A;  3P85 A;  1WZ8 A;  4B3J A;  4JCS A;  5DKP A;  4ZDB A;  3GF7 A;  4Q1I A;  3GLM A;  1UIY A;  3H02 A;  3TVU A;  4F47 A;  2GTR A;  2FZS A;  4G2R A;  3M6M A;  5FUS A;  3OME A;  4HDT A;  4OG1 A;  2F9Y A;  4OMR A;  1YG8 A;  3QKA A;  1UYR A;  1K39 A;  4NNQ A;  3RSI A;  4ZDE A;  3JU1 A;  5ING A;  4FND A;  1SZO A;  2X24 A;  3BEZ A;  5MGB A;  3L3S A;  4JCQ A;  3NJD A;  4U0G A;  3T89 A;  2VSU E;  3QWD A;  3FF6 A;  4JFC A;  5FIF A;  1Q51 A;  2PPY A;  2DEO A;  1Y7O A;  2W3P A;  1XNY A;  4JJT A;  2CE3 A;  3TT7 A;  4IZC A;  1NZY B;  4QFE A;  2ZL4 A;  4NAR A;  3U9S B;  3ISA A;  4EMM A;  5E0S H;  3Q7H A;  3PZK A;  1X0U A;  3BPT A;  3P5M A;  4B3I A;  1PJH A;  5E0N X;  1WDK A;  2VX2 A;  3HRX A;  4WYO B;  4I52 A;  3R6H A;  5DU6 A;  4WZ8 B;  1K32 A;  4ZDC A;  3QK8 A;  3H0U A;  4ZDF A;  3KTG A;  3V5E A;  4FZW C;  2D3T A;  4MOU A;  4FN7 A;  3NJB A;  3WG5 A;  5INI A;  3IBB A;  3H81 A;  5C90 A;  2J5I B;  4I42 A;  2VSU F;  3ZWB A;  2BZR A;  5DL1 A;  1RJM A;  3QMJ A;  3OC7 A;  4EMP A;  4Q0G A;  5DUF A;  1TYF A;  4GHN A;  3PE8 A;  3I47 A;  3MFM A;  3Q0G A;  2VSS A;  4JOT A;  2FW2 A;  4L8K A;  3R9T A;  5IKL B;  2VSS F;  4RCN A;  3HIN A;  2NP9 A;  3ST9 A;  4JVT A;  1J7X A;  4U0H A;  4RYF H;  5KDR A;  5G1S A;  2HW5 A;  2ZL3 A;  3KTK A;  5INF A;  3K8X A;  5CTC A;  2EJ5 A;  2VSU A;  3HLN 1;  5KDR B;  3TT6 A;  3ZW9 A;  5CTB A;  2A7K A;  2VSS E;  1W2X A;  1FCF A;  1MJ3 A;  3PGQ A;  4GM2 A;  2A7S A;  3GF3 A;  4ELX A;  4U1A A;  4B3H A;  2Q35 A;  4FB8 A;  4QIJ A;  3R9S A;  2F6I A;  2PG8 A;  3TDC A;  1XNW A;  1XX4 A;  3LKE A;  3KTI A;  3T8A A;  4K3W A;  1FC9 A;  2F9I A;  1VRG A;  3N6R B;  2J5G D;  3QXI A;  2YJG A;  3P2L A;  1UYT A;  1WDM A;  1N6E A;  1N6F A;  1SG4 A;  1TG6 A;  4JYJ A;  4Z0M A;  3ZW8 A;  3TV5 A;  1HNO A;  3SWX A;  4ZDD A;  3TLF A;  2J5S A;  5G1R A;  3ZWA A;  3IB9 A;  2WTB A;  1OD2 A;  3H0S A;  4RYF A;  4JCR A;  2CBY A;  1ON3 A;  5JBX A;  2F9I B;  3GMA A;  3GKB A;  5HUQ A;  4FZW A;  1HNU A;  5DU8 A;  3KTH A;  5DZK H;  2VRE A;  4U19 A;  3QYR A;  3Q0J A;  4MXI A;  3K50 A;  5DTP A;  1HZD A;  1EY3 A;  2A81 A;  4KPK A;  4ZU2 A;  3U9T B;  3DOR A;  5DTW A;  1DUB A;  3PEA A;  2PBP A;  3DJA A;  2ZQR A;  3IAV A;  5DU4 A;  3R9Q A;  3RRV A;  3STA A;  2ZQQ A;  2C8T A;  1DCI A;  4FJW D;  1FC6 A;  4DI1 A;  3QRE A;  1UYS A;  4WCZ A;  3H0J A;  3BPP A;  2J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...