4QIIA

Crystal structure of type ii menb from mycobacteria tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
300
Chain Sequence
b'LSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
publication title Ligand-dependent active-site closure revealed in the crystal structure of Mycobacterium tuberculosis MenB complexed with product analogues
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
total genus 114
structure length 300
sequence length 300
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4qiiA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4qiiA01
4IZBA 4I4ZA 4B3JA 4JOTA 2F9IA 4JYLA 3DORA 3IAVA 5MGBA 1DCIA 3HRXA 4FN7A 4RCNA 4WCZA 3OMEA 3PE8A 2FW2A 2PBPA 2X24A 3TLFA 1TYFA 5DKPA 1XNVA 1HZDA 5DTPA 4U19A 3MT6A 2ZL0A 1EF8A 4FNDA 3KTHA 4ELSA 3WG5A 3T89A 4F47A 1EF9A 3HE2A 4K29A 3RSTA 3GKBA 3U9RB 2D3TA 5DU8A 4KWBA 3TRRA 1NZYA 3R6HA 2F6IA 1UYRA 1FCFA 2UZFA 4KD6A 4KNPA 4GM2A 4Z0MA 1ON9A 1N6DA 4ZDEA 3NJDA 4MXIA 3P5MA 1UIYA 2VSSF 3KTJA 3IB9A 2F9YA 4WYOB 2EJ5A 2WTBA 4EMMA 2J5IA 2CBYA 5CTCA 4QIJA 2BZRA 3U9SB 3HP0A 4K2NA 1XNWA 1PIXA 2VSUE 4B3HA 4FB8A 4G2RA 5KDRA 2FBMA 4Q0GA 3N6RB 4K3WA 2IEXA 3QKAA 3HINA 4JCQA 3QK8A 4QFEA 2HW5A 3I47A 3STAA 1PJHA 3QYRA 3KTIA 4QIIA 3QXZA 1DUBA 2ZQRA 5IKLB 1Q51A 2NP9A 3KTKA 3GF3A 4U1AA 2ZL2A 3TT6A 1MJ3A 5FIFA 4U18A 3QXIA 3H0QA 1JXZA 2J5SA 2X58A 4OLQA 5DTWA 5FUSA 2DEOA 3GMAA 5C9GA 1HNUA 2Q34A 3Q0GA 1OD4A 1WDKA 1WDMA 3RSIA 3ZWAA 2J5GD 4EMLA 4ELXA 1VRGA 2F6QA 3ST9A 4NNQA 4FJWD 3GLMA 1W2XA 5INIA 3P85A 2F9IB 4MOUA 4Q1IA 4LK5A 3H81A 3Q1TA 5DU4A 3V5IA 3QWDA 4OMRA 3ZWBA 4JSBA 2QQ3A 3PEAA 3R9TA 4DI1A 4ZU2A 4JCTA 3OT6A 3TT7A 2VSUF 3QMJA 5DUFA 5E0SA 3KQFA 3H02A 2W3PA 3GF7A 3T8BA 2PG8A 1J7XA 5DUCA 3BEZA 1NZYB 4ZDCA 5JBXA 4OG1A 1FC9A 1UYTA 5CTBA 4HC8A 2VSSA 2VX2A 1OD2A 2DUBA 5DU6A 3M6NA 3QREA 2F9YB 4IZCA 4ZDFA 5E0SH 5C90A 4MI2A 2J5IB 4JCRA 4U0GA 1X0UA 1YG6A 3LAOA 4GHNA 3IBBA 1WZ8A 4L8KA 3MYBA 5KDRB 4WZ8B 2VREA 1TG6A 3P2LA 3ZW8A 3BPPA 4U0HA 3FF6A 4FNBA 5E0NX 3VIVA 3L3SA 4HNKA 1N6EA 5G1QA 4U0GH 1FC6A 4JWVA 3T8AA 4JFCA 3H0SA 3TV5A 1RJNA 4FZWA 2FZSA 3M6MA 4NEKA 3BF0A 1XO6A 3T88A 4I52A 4B3IA 3MFMA 5DL1A 5DZKA 4ELWA 2ZL3A 4L6WA 2ZL4A 3HLN1 2A7SA 3R9SA 3T3WA 1EY3A 1O8UA 3TVWA 1SZOA 4ZDDA 3SWXA 2PPYA 1XNYA 4YLHA 5G1RA 3JU1A 3K50A 4FZWC 5JBWA 3V5EA 3ZWCA 1ON3A 5G1SA 3H0UA 4IZDA 3Q0JA 1XX4A 3U9TB 5INFA 2ZQQA 5DZKH 3NJBA 3MOYA 4RYFA 3FDUA 2GTRA 3DJAA 1K39A 3R9QA 1Q52A 3ISAA 2VSUA 3PGQA 3ZW9A 3OC7A 2J5GA 1SG4A 1WDLA 4ASIA 1K32A 4EMPA 2VSSE 3SLLA 3K8XA 2CE3A 2Q2XA 4KPKA 3R0OA 2A81A 1YG8A 3G64A 4JJTA 4JCSA 3TZ3A 4RYFH 4JYJA 3LKEA 3Q7HA 5INGA 3TDCA 3H0JA 4FN8A 2Q35A 2C8TA 2J5II 3TVUA 1UYSA 1RJMA 4ZDBA 2VSUC 4I42A 1N6FA 4JVTA 3PZKA 1UYVA 2A7KA 1HNOA 1FC7A 3RRVA 5KJPA 3KTGA 1Y7OA
chains in the Genus database with same CATH superfamily
4IZBA 4I4ZA 4B3JA 4JOTA 2F9IA 4JYLA 3DORA 3IAVA 5MGBA 1DCIA 3HRXA 4FN7A 4RCNA 4WCZA 3OMEA 3PE8A 2FW2A 2PBPA 2X24A 3A4LA 3TLFA 1TYFA 2P63A 5DKPA 1XNVA 1HZDA 5DTPA 4U19A 3MT6A 2ZL0A 1EF8A 4FNDA 3KTHA 4ELSA 3WG5A 3T89A 4F47A 1EF9A 3HE2A 4K29A 3RSTA 3GKBA 3U9RB 2D3TA 5DU8A 3AM1A 4KWBA 3TRRA 1NZYA 3R6HA 2F6IA 1UYRA 1FCFA 2UZFA 4KD6A 4KNPA 4GM2A 4Z0MA 3O4XE 1ON9A 1N6DA 4ZDEA 3NJDA 4MXIA 3P5MA 1UIYA 2VSSF 3KTJA 3IB9A 2F9YA 4WYOB 2YJGA 2EJ5A 2WTBA 4EMMA 2J5IA 2CBYA 5CTCA 3A4MA 4QIJA 2BZRA 3U9SB 3HP0A 4K2NA 1XNWA 1PIXA 2VSUE 4B3HA 4FB8A 4G2RA 5KDRA 2FBMA 4Q0GA 3N6RB 4K3WA 2IEXA 3QKAA 3HINA 4JCQA 3QK8A 4QFEA 2HW5A 3I47A 3STAA 1PJHA 3QYRA 5HUQA 3KTIA 4QIIA 3QXZA 1DUBA 2ZQRA 5IKLB 1Q51A 2NP9A 3KTKA 3GF3A 3AJMA 4U1AA 2ZL2A 3TT6A 1MJ3A 5FIFA 4U18A 3QXIA 3IRBA 3H0QA 1JXZA 2J5SA 2X58A 4OLQA 5DTWA 5FUSA 2DEOA 3GMAA 5C9GA 1HNUA 2Q34A 3Q0GA 4HDTA 1OD4A 1WDKA 1WDMA 3RSIA 3ZWAA 2J5GD 4EMLA 4ELXA 1VRGA 2F6QA 3ST9A 4NNQA 4FJWD 3GLMA 1W2XA 5INIA 3P85A 2F9IB 4MOUA 4Q1IA 4LK5A 3RQFA 3H81A 3Q1TA 5DU4A 3V5IA 3QWDA 4OMRA 3ZWBA 4JSBA 2QQ3A 3PEAA 3R9TA 4DI1A 4ZU2A 4JCTA 3OT6A 3TT7A 2VSUF 3QMJA 5DUFA 5E0SA 3KQFA 3H02A 2W3PA 3W8HB 3GF7A 3T8BA 4NARA 2PG8A 1J7XA 5DUCA 3BEZA 1NZYB 4ZDCA 4GEHB 5JBXA 4OG1A 3A4NA 1FC9A 1UYTA 5CTBA 4HC8A 2VSSA 2VX2A 1OD2A 2DUBA 5DU6A 3M6NA 3QREA 2F9YB 4IZCA 4ZDFA 5E0SH 3ADBA 5C90A 4MI2A 2J5IB 4JCRA 4U0GA 1X0UA 1YG6A 3LAOA 4GHNA 3IBBA 1WZ8A 4L8KA 3MYBA 5KDRB 4WZ8B 2VREA 1TG6A 3P2LA 3ZW8A 3BPPA 4U0HA 3FF6A 4FNBA 5E0NX 3VIVA 3L3SA 4HNKA 1Y64B 1N6EA 5G1QA 4U0GH 1FC6A 4JWVA 3T8AA 4JFCA 3H0SA 3TV5A 1RJNA 4FZWA 2FZSA 4J2UA 3M6MA 4NEKA 3RQEA 3BF0A 1XO6A 3T88A 4I52A 4B3IA 3MFMA 3ADCA 5DL1A 5DZKA 4ELWA 2ZL3A 4L6WA 2ZL4A 3HLN1 2A7SA 3R9SA 3T3WA 1EY3A 1O8UA 3TVWA 1SZOA 4ZDDA 3SWXA 2PPYA 1XNYA 4YLHA 5G1RA 3JU1A 3K50A 4FZWC 5JBWA 3V5EA 3ZWCA 1ON3A 5G1SA 3H0UA 4IZDA 3Q0JA 1XX4A 3U9TB 5INFA 2ZQQA 5DZKH 3NJBA 3MOYA 4RYFA 3FDUA 2GTRA 1UX5A 3DJAA 1K39A 3R9QA 1Q52A 3ISAA 2VSUA 3PGQA 3ADDA 3ZW9A 3OC7A 2J5GA 1SG4A 1WDLA 4ASIA 3L8IA 1K32A 4EMPA 2VSSE 3SLLA 3K8XA 2CE3A 3W8IB 2Q2XA 4KPKA 3R0OA 2A81A 1YG8A 3G64A 4JJTA 4JCSA 3TZ3A 4RYFH 4JYJA 3LKEA 3Q7HA 5INGA 3TDCA 3H0JA 4FN8A 2Q35A 2C8TA 2J5II 3TVUA 1UYSA 1UX4A 1RJMA 4ZDBA 2VSUC 4I42A 3BPTA 1N6FA 4JVTA 3PZKA 1UYVA 2A7KA 1HNOA 1FC7A 3RRVA 5KJPA 3RQGA 3KTGA 1Y7OA 3L8JA
chains in the Genus database with same CATH topology
4IZBA 4I4ZA 4B3JA 4JOTA 2F9IA 4JYLA 3DORA 3IAVA 5MGBA 1DCIA 3HRXA 4FN7A 4RCNA 4WCZA 3OMEA 3PE8A 2FW2A 2PBPA 2X24A 3TLFA 1TYFA 5DKPA 1XNVA 1HZDA 5DTPA 4U19A 3MT6A 2ZL0A 1EF8A 4FNDA 3KTHA 4ELSA 3WG5A 3T89A 4F47A 1EF9A 3HE2A 4K29A 3RSTA 3GKBA 3U9RB 2D3TA 5DU8A 4KWBA 3TRRA 1NZYA 3R6HA 2F6IA 1UYRA 1FCFA 2UZFA 4KD6A 4KNPA 4GM2A 4Z0MA 1ON9A 1N6DA 4ZDEA 3NJDA 4MXIA 3P5MA 1UIYA 2VSSF 3KTJA 3IB9A 2F9YA 4WYOB 2YJGA 2EJ5A 2WTBA 4EMMA 2J5IA 2CBYA 5CTCA 4QIJA 2BZRA 3U9SB 3HP0A 4K2NA 1XNWA 1PIXA 2VSUE 4B3HA 4FB8A 4G2RA 5KDRA 2FBMA 4Q0GA 3N6RB 4K3WA 2IEXA 3QKAA 3HINA 4JCQA 3QK8A 4QFEA 2HW5A 3I47A 3STAA 1PJHA 3QYRA 5HUQA 3KTIA 4QIIA 3QXZA 1DUBA 2ZQRA 5IKLB 1Q51A 2NP9A 3KTKA 3GF3A 4U1AA 2ZL2A 3TT6A 1MJ3A 5FIFA 4U18A 3QXIA 3H0QA 1JXZA 2J5SA 2X58A 4OLQA 5DTWA 5FUSA 2DEOA 3GMAA 5C9GA 1HNUA 2Q34A 3Q0GA 4HDTA 1OD4A 1WDKA 1WDMA 3RSIA 3ZWAA 2J5GD 4EMLA 4ELXA 1VRGA 2F6QA 3ST9A 4NNQA 4FJWD 3GLMA 1W2XA 5INIA 3P85A 2F9IB 4MOUA 4Q1IA 4LK5A 3H81A 3Q1TA 5DU4A 3V5IA 3QWDA 4OMRA 3ZWBA 4JSBA 2QQ3A 3PEAA 3R9TA 4DI1A 4ZU2A 4JCTA 3OT6A 3TT7A 2VSUF 3QMJA 5DUFA 5E0SA 3KQFA 3H02A 2W3PA 3GF7A 3T8BA 4NARA 2PG8A 1J7XA 5DUCA 3BEZA 1NZYB 4ZDCA 5JBXA 4OG1A 1FC9A 1UYTA 5CTBA 4HC8A 2VSSA 2VX2A 1OD2A 2DUBA 5DU6A 3M6NA 3QREA 2F9YB 4IZCA 4ZDFA 5E0SH 5C90A 4MI2A 2J5IB 4JCRA 4U0GA 1X0UA 1YG6A 3LAOA 4GHNA 3IBBA 1WZ8A 4L8KA 3MYBA 5KDRB 4WZ8B 2VREA 1TG6A 3P2LA 3ZW8A 3BPPA 4U0HA 3FF6A 4FNBA 5E0NX 3VIVA 3L3SA 4HNKA 1N6EA 5G1QA 4U0GH 1FC6A 4JWVA 3T8AA 4JFCA 3H0SA 3TV5A 1RJNA 4FZWA 2FZSA 4J2UA 3M6MA 4NEKA 3BF0A 1XO6A 3T88A 4I52A 4B3IA 3MFMA 5DL1A 5DZKA 4ELWA 2ZL3A 4L6WA 2ZL4A 3HLN1 2A7SA 3R9SA 3T3WA 1EY3A 1O8UA 3TVWA 1SZOA 4ZDDA 3SWXA 2PPYA 1XNYA 4YLHA 5G1RA 3JU1A 3K50A 4FZWC 5JBWA 3V5EA 3ZWCA 1ON3A 5G1SA 3H0UA 4IZDA 3Q0JA 1XX4A 3U9TB 5INFA 2ZQQA 5DZKH 3NJBA 3MOYA 4RYFA 3FDUA 2GTRA 3DJAA 1K39A 3R9QA 1Q52A 3ISAA 2VSUA 3PGQA 3ZW9A 3OC7A 2J5GA 1SG4A 1WDLA 4ASIA 1K32A 4EMPA 2VSSE 3SLLA 3K8XA 2CE3A 2Q2XA 4KPKA 3R0OA 2A81A 1YG8A 3G64A 4JJTA 4JCSA 3TZ3A 4RYFH 4JYJA 3LKEA 3Q7HA 5INGA 3TDCA 3H0JA 4FN8A 2Q35A 2C8TA 2J5II 3TVUA 1UYSA 1RJMA 4ZDBA 2VSUC 4I42A 3BPTA 1N6FA 4JVTA 3PZKA 1UYVA 2A7KA 1HNOA 1FC7A 3RRVA 5KJPA 3KTGA 1Y7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZB A;  4I4Z A;  4B3J A;  4JOT A;  2F9I A;  4JYL A;  3DOR A;  3IAV A;  5MGB A;  1DCI A;  3HRX A;  4FN7 A;  4RCN A;  4WCZ A;  3OME A;  3PE8 A;  2FW2 A;  2PBP A;  2X24 A;  3TLF A;  1TYF A;  5DKP A;  1XNV A;  1HZD A;  5DTP A;  4U19 A;  3MT6 A;  2ZL0 A;  1EF8 A;  4FND A;  3KTH A;  4ELS A;  3WG5 A;  3T89 A;  4F47 A;  1EF9 A;  3HE2 A;  4K29 A;  3RST A;  3GKB A;  3U9R B;  2D3T A;  5DU8 A;  4KWB A;  3TRR A;  1NZY A;  3R6H A;  2F6I A;  1UYR A;  1FCF A;  2UZF A;  4KD6 A;  4KNP A;  4GM2 A;  4Z0M A;  1ON9 A;  1N6D A;  4ZDE A;  3NJD A;  4MXI A;  3P5M A;  1UIY A;  2VSS F;  3KTJ A;  3IB9 A;  2F9Y A;  4WYO B;  2EJ5 A;  2WTB A;  4EMM A;  2J5I A;  2CBY A;  5CTC A;  4QIJ A;  2BZR A;  3U9S B;  3HP0 A;  4K2N A;  1XNW A;  1PIX A;  2VSU E;  4B3H A;  4FB8 A;  4G2R A;  5KDR A;  2FBM A;  4Q0G A;  3N6R B;  4K3W A;  2IEX A;  3QKA A;  3HIN A;  4JCQ A;  3QK8 A;  4QFE A;  2HW5 A;  3I47 A;  3STA A;  1PJH A;  3QYR A;  3KTI A;  4QII A;  3QXZ A;  1DUB A;  2ZQR A;  5IKL B;  1Q51 A;  2NP9 A;  3KTK A;  3GF3 A;  4U1A A;  2ZL2 A;  3TT6 A;  1MJ3 A;  5FIF A;  4U18 A;  3QXI A;  3H0Q A;  1JXZ A;  2J5S A;  2X58 A;  4OLQ A;  5DTW A;  5FUS A;  2DEO A;  3GMA A;  5C9G A;  1HNU A;  2Q34 A;  3Q0G A;  1OD4 A;  1WDK A;  1WDM A;  3RSI A;  3ZWA A;  2J5G D;  4EML A;  4ELX A;  1VRG A;  2F6Q A;  3ST9 A;  4NNQ A;  4FJW D;  3GLM A;  1W2X A;  5INI A;  3P85 A;  2F9I B;  4MOU A;  4Q1I A;  4LK5 A;  3H81 A;  3Q1T A;  5DU4 A;  3V5I A;  3QWD A;  4OMR A;  3ZWB A;  4JSB A;  2QQ3 A;  3PEA A;  3R9T A;  4DI1 A;  4ZU2 A;  4JCT A;  3OT6 A;  3TT7 A;  2VSU F;  3QMJ A;  5DUF A;  5E0S A;  3KQF A;  3H02 A;  2W3P A;  3GF7 A;  3T8B A;  2PG8 A;  1J7X A;  5DUC A;  3BEZ A;  1NZY B;  4ZDC A;  5JBX A;  4OG1 A;  1FC9 A;  1UYT A;  5CTB A;  4HC8 A;  2VSS A;  2VX2 A;  1OD2 A;  2DUB A;  5DU6 A;  3M6N A;  3QRE A;  2F9Y B;  4IZC A;  4ZDF A;  5E0S H;  5C90 A;  4MI2 A;  2J5I B;  4JCR A;  4U0G A;  1X0U A;  1YG6 A;  3LAO A;  4GHN A;  3IBB A;  1WZ8 A;  4L8K A;  3MYB A;  5KDR B;  4WZ8 B;  2VRE A;  1TG6 A;  3P2L A;  3ZW8 A;  3BPP A;  4U0H A;  3FF6 A;  4FNB A;  5E0N X;  3VIV A;  3L3S A;  4HNK A;  1N6E A;  5G1Q A;  4U0G H;  1FC6 A;  4JWV A;  3T8A A;  4JFC A;  3H0S A;  3TV5 A;  1RJN A;  4FZW A;  2FZS A;  3M6M A;  4NEK A;  3BF0 A;  1XO6 A;  3T88 A;  4I52 A;  4B3I A;  3MFM A;  5DL1 A;  5DZK A;  4ELW A;  2ZL3 A;  4L6W A;  2ZL4 A;  3HLN 1;  2A7S A;  3R9S A;  3T3W A;  1EY3 A;  1O8U A;  3TVW A;  1SZO A;  4ZDD A;  3SWX A;  2PPY A;  1XNY A;  4YLH A;  5G1R A;  3JU1 A;  3K50 A;  4FZW C;  5JBW A;  3V5E A;  3ZWC A;  1ON3 A;  5G1S A;  3H0U A;  4IZD A;  3Q0J A;  1XX4 A;  3U9T B;  5INF A;  2ZQQ A;  5DZK H;  3NJB A;  3MOY A;  4RYF A;  3FDU A;  2GTR A;  3DJA A;  1K39 A;  3R9Q A;  1Q52 A;  3ISA A;  2VSU A;  3PGQ A;  3ZW9 A;  3OC7 A;  2J5G A;  1SG4 A;  1WDL A;  4ASI A;  1K32 A;  4EMP A;  2VSS E;  3SLL A;  3K8X A;  2CE3 A;  2Q2X A;  4KPK A;  3R0O A;  2A81 A;  1YG8 A;  3G64 A;  4JJT A;  4JCS A;  3TZ3 A;  4RYF H;  4JYJ A;  3LKE A;  3Q7H A;  5ING A;  3TDC A;  3H0J A;  4FN8 A;  2Q35 A;  2C8T A;  2J5I I;  3TVU A;  1UYS A;  1RJM A;  4ZDB A;  2VSU C;  4I42 A;  1N6F A;  4JVT A;  3PZK A;  1UYV A;  2A7K A;  1HNO A;  1FC7 A;  3RRV A;  5KJP A;  3KTG A;  1Y7O A; 
#chains in the Genus database with same CATH topology
 4IZB A;  4I4Z A;  4B3J A;  4JOT A;  2F9I A;  4JYL A;  3DOR A;  3IAV A;  5MGB A;  1DCI A;  3HRX A;  4FN7 A;  4RCN A;  4WCZ A;  3OME A;  3PE8 A;  2FW2 A;  2PBP A;  2X24 A;  3A4L A;  3TLF A;  1TYF A;  2P63 A;  5DKP A;  1XNV A;  1HZD A;  5DTP A;  4U19 A;  3MT6 A;  2ZL0 A;  1EF8 A;  4FND A;  3KTH A;  4ELS A;  3WG5 A;  3T89 A;  4F47 A;  1EF9 A;  3HE2 A;  4K29 A;  3RST A;  3GKB A;  3U9R B;  2D3T A;  5DU8 A;  3AM1 A;  4KWB A;  3TRR A;  1NZY A;  3R6H A;  2F6I A;  1UYR A;  1FCF A;  2UZF A;  4KD6 A;  4KNP A;  4GM2 A;  4Z0M A;  3O4X E;  1ON9 A;  1N6D A;  4ZDE A;  3NJD A;  4MXI A;  3P5M A;  1UIY A;  2VSS F;  3KTJ A;  3IB9 A;  2F9Y A;  4WYO B;  2YJG A;  2EJ5 A;  2WTB A;  4EMM A;  2J5I A;  2CBY A;  5CTC A;  3A4M A;  4QIJ A;  2BZR A;  3U9S B;  3HP0 A;  4K2N A;  1XNW A;  1PIX A;  2VSU E;  4B3H A;  4FB8 A;  4G2R A;  5KDR A;  2FBM A;  4Q0G A;  3N6R B;  4K3W A;  2IEX A;  3QKA A;  3HIN A;  4JCQ A;  3QK8 A;  4QFE A;  2HW5 A;  3I47 A;  3STA A;  1PJH A;  3QYR A;  5HUQ A;  3KTI A;  4QII A;  3QXZ A;  1DUB A;  2ZQR A;  5IKL B;  1Q51 A;  2NP9 A;  3KTK A;  3GF3 A;  3AJM A;  4U1A A;  2ZL2 A;  3TT6 A;  1MJ3 A;  5FIF A;  4U18 A;  3QXI A;  3IRB A;  3H0Q A;  1JXZ A;  2J5S A;  2X58 A;  4OLQ A;  5DTW A;  5FUS A;  2DEO A;  3GMA A;  5C9G A;  1HNU A;  2Q34 A;  3Q0G A;  4HDT A;  1OD4 A;  1WDK A;  1WDM A;  3RSI A;  3ZWA A;  2J5G D;  4EML A;  4ELX A;  1VRG A;  2F6Q A;  3ST9 A;  4NNQ A;  4FJW D;  3GLM A;  1W2X A;  5INI A;  3P85 A;  2F9I B;  4MOU A;  4Q1I A;  4LK5 A;  3RQF A;  3H81 A;  3Q1T A;  5DU4 A;  3V5I A;  3QWD A;  4OMR A;  3ZWB A;  4JSB A;  2QQ3 A;  3PEA A;  3R9T A;  4DI1 A;  4ZU2 A;  4JCT A;  3OT6 A;  3TT7 A;  2VSU F;  3QMJ A;  5DUF A;  5E0S A;  3KQF A;  3H02 A;  2W3P A;  3W8H B;  3GF7 A;  3T8B A;  4NAR A;  2PG8 A;  1J7X A;  5DUC A;  3BEZ A;  1NZY B;  4ZDC A;  4GEH B;  5JBX A;  4OG1 A;  3A4N A;  1FC9 A;  1UYT A;  5CTB A;  4HC8 A;  2VSS A;  2VX2 A;  1OD2 A;  2DUB A;  5DU6 A;  3M6N A;  3QRE A;  2F9Y B;  4IZC A;  4ZDF A;  5E0S H;  3ADB A;  5C90 A;  4MI2 A;  2J5I B;  4JCR A;  4U0G A;  1X0U A;  1YG6 A;  3LAO A;  4GHN A;  3IBB A;  1WZ8 A;  4L8K A;  3MYB A;  5KDR B;  4WZ8 B;  2VRE A;  1TG6 A;  3P2L A;  3ZW8 A;  3BPP A;  4U0H A;  3FF6 A;  4FNB A;  5E0N X;  3VIV A;  3L3S A;  4HNK A;  1Y64 B;  1N6E A;  5G1Q A;  4U0G H;  1FC6 A;  4JWV A;  3T8A A;  4JFC A;  3H0S A;  3TV5 A;  1RJN A;  4FZW A;  2FZS A;  4J2U A;  3M6M A;  4NEK A;  3RQE A;  3BF0 A;  1XO6 A;  3T88 A;  4I52 A;  4B3I A;  3MFM A;  3ADC A;  5DL1 A;  5DZK A;  4ELW A;  2ZL3 A;  4L6W A;  2ZL4 A;  3HLN 1;  2A7S A;  3R9S A;  3T3W A;  1EY3 A;  1O8U A;  3TVW A;  1SZO A;  4ZDD A;  3SWX A;  2PPY A;  1XNY A;  4YLH A;  5G1R A;  3JU1 A;  3K50 A;  4FZW C;  5JBW A;  3V5E A;  3ZWC A;  1ON3 A;  5G1S A;  3H0U A;  4IZD A;  3Q0J A;  1XX4 A;  3U9T B;  5INF A;  2ZQQ A;  5DZK H;  3NJB A;  3MOY A;  4RYF A;  3FDU A;  2GTR A;  1UX5 A;  3DJA A;  1K39 A;  3R9Q A;  1Q52 A;  3ISA A;  2VSU A;  3PGQ A;  3ADD A;  3ZW9 A;  3OC7 A;  2J5G A;  1SG4 A;  1WDL A;  4ASI A;  3L8I A;  1K32 A;  4EMP A;  2VSS E;  3SLL A;  3K8X A;  2CE3 A;  3W8I B;  2Q2X A;  4KPK A;  3R0O A;  2A81 A;  1YG8 A;  3G64 A;  4JJT A;  4JCS A;  3TZ3 A;  4RYF H;  4JYJ A;  3LKE A;  3Q7H A;  5ING A;  3TDC A;  3H0J A;  4FN8 A;  2Q35 A;  2C8T A;  2J5I I;  3TVU A;  1UYS A;  1UX4 A;  1RJM A;  4ZDB A;  2VSU C;  4I42 A;  3BPT A;  1N6F A;  4JVT A;  3PZK A;  1UYV A;  2A7K A;  1HNO A;  1FC7 A;  3RRV A;  5KJP A;  3RQG A;  3KTG A;  1Y7O A;  3L8J A; 
#chains in the Genus database with same CATH homology
 4IZB A;  4I4Z A;  4B3J A;  4JOT A;  2F9I A;  4JYL A;  3DOR A;  3IAV A;  5MGB A;  1DCI A;  3HRX A;  4FN7 A;  4RCN A;  4WCZ A;  3OME A;  3PE8 A;  2FW2 A;  2PBP A;  2X24 A;  3TLF A;  1TYF A;  5DKP A;  1XNV A;  1HZD A;  5DTP A;  4U19 A;  3MT6 A;  2ZL0 A;  1EF8 A;  4FND A;  3KTH A;  4ELS A;  3WG5 A;  3T89 A;  4F47 A;  1EF9 A;  3HE2 A;  4K29 A;  3RST A;  3GKB A;  3U9R B;  2D3T A;  5DU8 A;  4KWB A;  3TRR A;  1NZY A;  3R6H A;  2F6I A;  1UYR A;  1FCF A;  2UZF A;  4KD6 A;  4KNP A;  4GM2 A;  4Z0M A;  1ON9 A;  1N6D A;  4ZDE A;  3NJD A;  4MXI A;  3P5M A;  1UIY A;  2VSS F;  3KTJ A;  3IB9 A;  2F9Y A;  4WYO B;  2YJG A;  2EJ5 A;  2WTB A;  4EMM A;  2J5I A;  2CBY A;  5CTC A;  4QIJ A;  2BZR A;  3U9S B;  3HP0 A;  4K2N A;  1XNW A;  1PIX A;  2VSU E;  4B3H A;  4FB8 A;  4G2R A;  5KDR A;  2FBM A;  4Q0G A;  3N6R B;  4K3W A;  2IEX A;  3QKA A;  3HIN A;  4JCQ A;  3QK8 A;  4QFE A;  2HW5 A;  3I47 A;  3STA A;  1PJH A;  3QYR A;  5HUQ A;  3KTI A;  4QII A;  3QXZ A;  1DUB A;  2ZQR A;  5IKL B;  1Q51 A;  2NP9 A;  3KTK A;  3GF3 A;  4U1A A;  2ZL2 A;  3TT6 A;  1MJ3 A;  5FIF A;  4U18 A;  3QXI A;  3H0Q A;  1JXZ A;  2J5S A;  2X58 A;  4OLQ A;  5DTW A;  5FUS A;  2DEO A;  3GMA A;  5C9G A;  1HNU A;  2Q34 A;  3Q0G A;  4HDT A;  1OD4 A;  1WDK A;  1WDM A;  3RSI A;  3ZWA A;  2J5G D;  4EML A;  4ELX A;  1VRG A;  2F6Q A;  3ST9 A;  4NNQ A;  4FJW D;  3GLM A;  1W2X A;  5INI A;  3P85 A;  2F9I B;  4MOU A;  4Q1I A;  4LK5 A;  3H81 A;  3Q1T A;  5DU4 A;  3V5I A;  3QWD A;  4OMR A;  3ZWB A;  4JSB A;  2QQ3 A;  3PEA A;  3R9T A;  4DI1 A;  4ZU2 A;  4JCT A;  3OT6 A;  3TT7 A;  2VSU F;  3QMJ A;  5DUF A;  5E0S A;  3KQF A;  3H02 A;  2W3P A;  3GF7 A;  3T8B A;  4NAR A;  2PG8 A;  1J7X A;  5DUC A;  3BEZ A;  1NZY B;  4ZDC A;  5JBX A;  4OG1 A;  1FC9 A;  1UYT A;  5CTB A;  4HC8 A;  2VSS A;  2VX2 A;  1OD2 A;  2DUB A;  5DU6 A;  3M6N A;  3QRE A;  2F9Y B;  4IZC A;  4ZDF A;  5E0S H;  5C90 A;  4MI2 A;  2J5I B;  4JCR A;  4U0G A;  1X0U A;  1YG6 A;  3LAO A;  4GHN A;  3IBB A;  1WZ8 A;  4L8K A;  3MYB A;  5KDR B;  4WZ8 B;  2VRE A;  1TG6 A;  3P2L A;  3ZW8 A;  3BPP A;  4U0H A;  3FF6 A;  4FNB A;  5E0N X;  3VIV A;  3L3S A;  4HNK A;  1N6E A;  5G1Q A;  4U0G H;  1FC6 A;  4JWV A;  3T8A A;  4JFC A;  3H0S A;  3TV5 A;  1RJN A;  4FZW A;  2FZS A;  4J2U A;  3M6M A;  4NEK A;  3BF0 A;  1XO6 A;  3T88 A;  4I52 A;  4B3I A;  3MFM A;  5DL1 A;  5DZK A;  4ELW A;  2ZL3 A;  4L6W A;  2ZL4 A;  3HLN 1;  2A7S A;  3R9S A;  3T3W A;  1EY3 A;  1O8U A;  3TVW A;  1SZO A;  4ZDD A;  3SWX A;  2PPY A;  1XNY A;  4YLH A;  5G1R A;  3JU1 A;  3K50 A;  4FZW C;  5JBW A;  3V5E A;  3ZWC A;  1ON3 A;  5G1S A;  3H0U A;  4IZD A;  3Q0J A;  1XX4 A;  3U9T B;  5INF A;  2ZQQ A;  5DZK H;  3NJB A;  3MOY A;  4RYF A;  3FDU A;  2GTR A;  3DJA A;  1K39 A;  3R9Q A;  1Q52 A;  3ISA A;  2VSU A;  3PGQ A;  3ZW9 A;  3OC7 A;  2J5G A;  1SG4 A;  1WDL A;  4ASI A;  1K32 A;  4EMP A;  2VSS E;  3SLL A;  3K8X A;  2CE3 A;  2Q2X A;  4KPK A;  3R0O A;  2A81 A;  1YG8 A;  3G64 A;  4JJT A;  4JCS A;  3TZ3 A;  4RYF H;  4JYJ A;  3LKE A;  3Q7H A;  5ING A;  3TDC A;  3H0J A;  4FN8 A;  2Q35 A;  2C8T A;  2J5I I;  3TVU A;  1UYS A;  1RJM A;  4ZDB A;  2VSU C;  4I42 A;  3BPT A;  1N6F A;  4JVT A;  3PZK A;  1UYV A;  2A7K A;  1HNO A;  1FC7 A;  3RRV A;  5KJP A;  3KTG A;  1Y7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...