4QIJA

Crystal structure of menb from mycobacteria tuberculosis in complex with 1-hna-coa
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
301
Chain Sequence
ALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-dependent active-site closure revealed in the crystal structure of Mycobacterium tuberculosis MenB complexed with product analogues
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 116
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4qijA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4qijA01
3RRVA 2J5IA 2CE3A 2PPYA 3MOYA 4JCRA 2VSUC 3T8AA 1RJMA 1MJ3A 3GLMA 4K29A 5DTWA 5INGA 2EJ5A 2VSSE 3G64A 3P5MA 3N6RB 3M6MA 1N6FA 2VSUE 1HZDA 5FUSA 3P2LA 3GF7A 4ZU2A 2J5GA 1UYSA 2FW2A 1OD2A 3GMAA 3PE8A 2VX2A 1UIYA 5JBXA 3P85A 1VRGA 4EMPA 4JYLA 2Q34A 3SLLA 3FDUA 4L6WA 4WCZA 5DZKA 4KNPA 3KTIA 1PIXA 4ZDBA 1FC7A 3QYRA 4JCSA 5E0SA 4NNQA 4JYJA 5C90A 2BZRA 2WTBA 4OLQA 4K3WA 2PBPA 5CTBA 4FZWC 1WDLA 3NJDA 3MYBA 3Q0JA 2NP9A 1FC6A 2CBYA 3H0SA 3TLFA 5G1RA 5DUFA 3IAVA 5DUCA 3PEAA 2ZL0A 4B3JA 1HNOA 1WDMA 3QREA 3GF3A 3HP0A 4MOUA 4QIIA 2VSUF 4I52A 3HRXA 5DU4A 1EF9A 1XO6A 2ZQQA 3MT6A 1UYTA 3OT6A 4OMRA 3V5EA 1XNWA 4KD6A 4DI1A 4U18A 4FZWA 2F9IA 1HNUA 5CTCA 5G1QA 2VSUA 1YG8A 3MFMA 4ZDEA 1ON9A 3TV5A 4EMMA 4U0HA 2FBMA 3TRRA 2VSSF 1N6DA 4L8KA 4LK5A 3M6NA 2D3TA 3ZWAA 3ST9A 3K8XA 1N6EA 4QFEA 3QXZA 2X24A 5G1SA 4JFCA 4NEKA 3JU1A 4RYFH 2F6QA 1DUBA 1UYVA 5JBWA 3ZWCA 3QMJA 3GKBA 3L3SA 3U9TB 1UYRA 2ZL3A 1TYFA 2ZL4A 3RSIA 4FNDA 1JXZA 3OMEA 2QQ3A 4MI2A 4JCQA 4FN8A 3QXIA 1K32A 4IZDA 5C9GA 3IB9A 3Q1TA 2DEOA 2VSSA 3HE2A 3TT7A 1Y7OA 2F6IA 3PZKA 5E0SH 4JVTA 5INIA 3KTKA 4RYFA 3ZWBA 4ELXA 3T8BA 4GM2A 4Q0GA 3R9SA 1EF8A 5KDRA 2GTRA 3TVWA 3H81A 2F9YA 4HC8A 3QKAA 4HNKA 4ZDCA 1TG6A 3K50A 2J5IB 3FF6A 3DJAA 3H0JA 4KWBA 5DKPA 5DU6A 1O8UA 3T88A 4JJTA 1WZ8A 2Q2XA 3TDCA 3STAA 1K39A 2DUBA 1NZYB 3ZW9A 2A7SA 3H0QA 4FNBA 4WYOB 5INFA 3BEZA 4JWVA 3BF0A 4U0GA 1SZOA 4WZ8B 4Q1IA 2W3PA 3VIVA 3IBBA 4GHNA 1ON3A 2PG8A 1OD4A 3ZW8A 4U1AA 3HINA 4ELWA 3LAOA 4RCNA 4JSBA 5DTPA 1WDKA 1NZYA 3I47A 1PJHA 2IEXA 5IKLB 3R0OA 3R6HA 4K2NA 1FCFA 1YG6A 4KPKA 2F9YB 4ZDDA 4ZDFA 5DZKH 2J5GD 4I4ZA 2A81A 3H02A 1XNYA 4B3IA 3NJBA 3RSTA 3TZ3A 3QWDA 3WG5A 1X0UA 4YLHA 3V5IA 4ELSA 5KJPA 3HLN1 5FIFA 3SWXA 1XNVA 2J5II 3R9QA 4G2RA 4IZBA 4ASIA 1DCIA 3U9SB 2F9IB 3T3WA 1XX4A 3T89A 5E0NX 1EY3A 2X58A 4FB8A 4QIJA 2C8TA 2A7KA 2Q35A 4EMLA 1Q52A 2HW5A 3KQFA 3DORA 3PGQA 1Q51A 5DL1A 3KTGA 3Q7HA 1RJNA 4U19A 2ZQRA 3H0UA 3KTJA 3R9TA 3TVUA 3U9RB 4U0GH 4IZCA 4I42A 3BPPA 4JCTA 3QK8A 4FN7A 3Q0GA 5KDRB 2UZFA 2ZL2A 4MXIA 3OC7A 3ISAA 1J7XA 1FC9A 5DU8A 2VREA 3LKEA 1W2XA 4JOTA 4OG1A 3KTHA 1SG4A 4FJWD 4B3HA 5MGBA 2J5SA 2FZSA 3TT6A 4Z0MA 4F47A
chains in the Genus database with same CATH superfamily
4GEHB 3RRVA 3AJMA 2J5IA 2CE3A 2PPYA 3MOYA 4JCRA 2VSUC 3T8AA 1RJMA 1MJ3A 3GLMA 4K29A 5DTWA 5INGA 2EJ5A 2VSSE 3G64A 3P5MA 3N6RB 3M6MA 1N6FA 2VSUE 1HZDA 5FUSA 3P2LA 3GF7A 4ZU2A 2J5GA 2YJGA 1UYSA 1Y64B 2FW2A 1OD2A 3GMAA 3PE8A 2VX2A 1UIYA 5JBXA 3P85A 1VRGA 4EMPA 4JYLA 2Q34A 3SLLA 3FDUA 4L6WA 4WCZA 5DZKA 4KNPA 3KTIA 1PIXA 4ZDBA 1FC7A 3A4LA 3QYRA 4JCSA 5E0SA 4NNQA 4JYJA 5C90A 2BZRA 2WTBA 3IRBA 4OLQA 4NARA 4K3WA 2PBPA 5CTBA 4FZWC 1WDLA 3NJDA 4HDTA 3MYBA 3O4XE 3Q0JA 2NP9A 1FC6A 2CBYA 3H0SA 3TLFA 5G1RA 5DUFA 3IAVA 5DUCA 3PEAA 2ZL0A 4B3JA 1HNOA 1WDMA 3QREA 3GF3A 3HP0A 4MOUA 4QIIA 2VSUF 4I52A 3HRXA 5DU4A 1EF9A 1XO6A 3A4NA 2ZQQA 3MT6A 1UYTA 3OT6A 4OMRA 3V5EA 1XNWA 4KD6A 4DI1A 4U18A 4FZWA 2F9IA 1HNUA 5G1QA 5CTCA 2VSUA 1YG8A 3MFMA 4ZDEA 1ON9A 3TV5A 4EMMA 4U0HA 2FBMA 3TRRA 2VSSF 1N6DA 4L8KA 4LK5A 3M6NA 2D3TA 3ZWAA 3ST9A 3K8XA 1N6EA 4QFEA 3QXZA 2X24A 5G1SA 4JFCA 4NEKA 3JU1A 4RYFH 2F6QA 1DUBA 1UX5A 1UYVA 5JBWA 3ZWCA 3QMJA 3GKBA 3W8HB 3L3SA 3U9TB 1UYRA 2ZL3A 1TYFA 2ZL4A 3RSIA 4FNDA 1JXZA 3OMEA 2QQ3A 4MI2A 4JCQA 4FN8A 3QXIA 1K32A 4IZDA 5C9GA 3IB9A 3Q1TA 2DEOA 2VSSA 3HE2A 3TT7A 1Y7OA 2F6IA 3PZKA 5E0SH 4JVTA 5INIA 3KTKA 4RYFA 3ZWBA 4ELXA 3T8BA 4GM2A 4Q0GA 3R9SA 1EF8A 5KDRA 2GTRA 3TVWA 3H81A 2F9YA 4HC8A 3QKAA 4HNKA 4ZDCA 1TG6A 3K50A 2J5IB 3FF6A 3DJAA 3H0JA 4KWBA 3L8JA 5DKPA 5DU6A 1O8UA 3T88A 4JJTA 1WZ8A 2Q2XA 3ADBA 5HUQA 3ADCA 3TDCA 3STAA 1K39A 2DUBA 1NZYB 3ZW9A 3W8IB 2A7SA 3RQGA 3H0QA 4FNBA 4WYOB 5INFA 3BEZA 4JWVA 3BF0A 4U0GA 1SZOA 4WZ8B 4Q1IA 2W3PA 3VIVA 3IBBA 4GHNA 1ON3A 2PG8A 3RQFA 1OD4A 3ZW8A 4U1AA 3HINA 3L8IA 4ELWA 3RQEA 3LAOA 4RCNA 4JSBA 5DTPA 1WDKA 1NZYA 3I47A 1PJHA 2IEXA 5IKLB 3R0OA 3R6HA 4K2NA 1FCFA 1YG6A 4KPKA 2F9YB 4ZDDA 4ZDFA 5DZKH 2J5GD 4I4ZA 2A81A 3H02A 1XNYA 4B3IA 3NJBA 3RSTA 3TZ3A 3QWDA 3WG5A 3A4MA 1X0UA 4YLHA 3V5IA 4ELSA 5KJPA 3HLN1 5FIFA 3SWXA 1XNVA 2J5II 3R9QA 4G2RA 4IZBA 4ASIA 1DCIA 3U9SB 2F9IB 3T3WA 1XX4A 3AM1A 3T89A 5E0NX 1EY3A 2X58A 3BPTA 4FB8A 4QIJA 2C8TA 3ADDA 2A7KA 1UX4A 2Q35A 4EMLA 1Q52A 2HW5A 3KQFA 3DORA 3PGQA 4J2UA 1Q51A 5DL1A 3KTGA 3Q7HA 2P63A 1RJNA 4U19A 2ZQRA 3H0UA 3KTJA 3R9TA 3TVUA 3U9RB 4U0GH 4IZCA 4I42A 3BPPA 4JCTA 3QK8A 4FN7A 3Q0GA 5KDRB 2UZFA 2ZL2A 4MXIA 3OC7A 3ISAA 1J7XA 1FC9A 5DU8A 2VREA 3LKEA 1W2XA 4JOTA 4OG1A 3KTHA 1SG4A 4FJWD 4B3HA 5MGBA 2J5SA 2FZSA 3TT6A 4Z0MA 4F47A
chains in the Genus database with same CATH topology
3RRVA 2J5IA 2CE3A 2PPYA 3MOYA 4JCRA 2VSUC 3T8AA 1RJMA 1MJ3A 3GLMA 4K29A 5DTWA 5INGA 2EJ5A 2VSSE 3G64A 3P5MA 3N6RB 3M6MA 1N6FA 2VSUE 1HZDA 5FUSA 3P2LA 3GF7A 4ZU2A 2J5GA 2YJGA 1UYSA 2FW2A 1OD2A 3GMAA 3PE8A 2VX2A 1UIYA 5JBXA 3P85A 1VRGA 4EMPA 4JYLA 2Q34A 3SLLA 3FDUA 4L6WA 4WCZA 5DZKA 4KNPA 3KTIA 1PIXA 4ZDBA 1FC7A 3QYRA 4JCSA 5E0SA 4NNQA 4JYJA 5C90A 2BZRA 2WTBA 4OLQA 4NARA 4K3WA 2PBPA 5CTBA 4FZWC 1WDLA 3NJDA 4HDTA 3MYBA 3Q0JA 2NP9A 1FC6A 2CBYA 3H0SA 3TLFA 5G1RA 5DUFA 3IAVA 5DUCA 3PEAA 2ZL0A 4B3JA 1HNOA 1WDMA 3QREA 3GF3A 3HP0A 4MOUA 4QIIA 2VSUF 4I52A 3HRXA 5DU4A 1EF9A 1XO6A 2ZQQA 3MT6A 1UYTA 3OT6A 4OMRA 3V5EA 1XNWA 4KD6A 4DI1A 4U18A 4FZWA 2F9IA 1HNUA 5CTCA 5G1QA 2VSUA 1YG8A 3MFMA 4ZDEA 1ON9A 3TV5A 4EMMA 4U0HA 2FBMA 3TRRA 2VSSF 1N6DA 4L8KA 4LK5A 3M6NA 2D3TA 3ZWAA 3ST9A 3K8XA 1N6EA 4QFEA 3QXZA 2X24A 5G1SA 4JFCA 4NEKA 3JU1A 4RYFH 2F6QA 1DUBA 1UYVA 5JBWA 3ZWCA 3QMJA 3GKBA 3L3SA 3U9TB 1UYRA 2ZL3A 1TYFA 2ZL4A 3RSIA 4FNDA 1JXZA 3OMEA 2QQ3A 4MI2A 4JCQA 4FN8A 3QXIA 1K32A 4IZDA 5C9GA 3IB9A 3Q1TA 2DEOA 2VSSA 3HE2A 3TT7A 1Y7OA 2F6IA 3PZKA 5E0SH 4JVTA 5INIA 3KTKA 4RYFA 3ZWBA 4ELXA 3T8BA 4GM2A 4Q0GA 3R9SA 1EF8A 5KDRA 2GTRA 3TVWA 3H81A 2F9YA 4HC8A 3QKAA 4HNKA 4ZDCA 1TG6A 3K50A 2J5IB 3FF6A 3DJAA 3H0JA 4KWBA 5DKPA 5DU6A 1O8UA 3T88A 4JJTA 1WZ8A 2Q2XA 5HUQA 3TDCA 3STAA 1K39A 2DUBA 1NZYB 3ZW9A 2A7SA 3H0QA 4FNBA 4WYOB 5INFA 3BEZA 4JWVA 3BF0A 4U0GA 1SZOA 4WZ8B 4Q1IA 2W3PA 3VIVA 3IBBA 4GHNA 1ON3A 2PG8A 1OD4A 3ZW8A 4U1AA 3HINA 4ELWA 3LAOA 4RCNA 4JSBA 5DTPA 1WDKA 1NZYA 3I47A 1PJHA 2IEXA 5IKLB 3R0OA 3R6HA 4K2NA 1FCFA 1YG6A 4KPKA 2F9YB 4ZDDA 4ZDFA 5DZKH 2J5GD 4I4ZA 2A81A 3H02A 1XNYA 4B3IA 3NJBA 3RSTA 3TZ3A 3QWDA 3WG5A 1X0UA 4YLHA 3V5IA 4ELSA 5KJPA 3HLN1 5FIFA 3SWXA 1XNVA 2J5II 3R9QA 4G2RA 4IZBA 4ASIA 1DCIA 3U9SB 2F9IB 3T3WA 1XX4A 3T89A 5E0NX 1EY3A 2X58A 3BPTA 4FB8A 4QIJA 2C8TA 2A7KA 2Q35A 4EMLA 1Q52A 2HW5A 3KQFA 3DORA 3PGQA 4J2UA 1Q51A 5DL1A 3KTGA 3Q7HA 1RJNA 4U19A 2ZQRA 3H0UA 3KTJA 3R9TA 3TVUA 3U9RB 4U0GH 4IZCA 4I42A 3BPPA 4JCTA 3QK8A 4FN7A 3Q0GA 5KDRB 2UZFA 2ZL2A 4MXIA 3OC7A 3ISAA 1J7XA 1FC9A 5DU8A 2VREA 3LKEA 1W2XA 4JOTA 4OG1A 3KTHA 1SG4A 4FJWD 4B3HA 5MGBA 2J5SA 2FZSA 3TT6A 4Z0MA 4F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRV A;  2J5I A;  2CE3 A;  2PPY A;  3MOY A;  4JCR A;  2VSU C;  3T8A A;  1RJM A;  1MJ3 A;  3GLM A;  4K29 A;  5DTW A;  5ING A;  2EJ5 A;  2VSS E;  3G64 A;  3P5M A;  3N6R B;  3M6M A;  1N6F A;  2VSU E;  1HZD A;  5FUS A;  3P2L A;  3GF7 A;  4ZU2 A;  2J5G A;  1UYS A;  2FW2 A;  1OD2 A;  3GMA A;  3PE8 A;  2VX2 A;  1UIY A;  5JBX A;  3P85 A;  1VRG A;  4EMP A;  4JYL A;  2Q34 A;  3SLL A;  3FDU A;  4L6W A;  4WCZ A;  5DZK A;  4KNP A;  3KTI A;  1PIX A;  4ZDB A;  1FC7 A;  3QYR A;  4JCS A;  5E0S A;  4NNQ A;  4JYJ A;  5C90 A;  2BZR A;  2WTB A;  4OLQ A;  4K3W A;  2PBP A;  5CTB A;  4FZW C;  1WDL A;  3NJD A;  3MYB A;  3Q0J A;  2NP9 A;  1FC6 A;  2CBY A;  3H0S A;  3TLF A;  5G1R A;  5DUF A;  3IAV A;  5DUC A;  3PEA A;  2ZL0 A;  4B3J A;  1HNO A;  1WDM A;  3QRE A;  3GF3 A;  3HP0 A;  4MOU A;  4QII A;  2VSU F;  4I52 A;  3HRX A;  5DU4 A;  1EF9 A;  1XO6 A;  2ZQQ A;  3MT6 A;  1UYT A;  3OT6 A;  4OMR A;  3V5E A;  1XNW A;  4KD6 A;  4DI1 A;  4U18 A;  4FZW A;  2F9I A;  1HNU A;  5CTC A;  5G1Q A;  2VSU A;  1YG8 A;  3MFM A;  4ZDE A;  1ON9 A;  3TV5 A;  4EMM A;  4U0H A;  2FBM A;  3TRR A;  2VSS F;  1N6D A;  4L8K A;  4LK5 A;  3M6N A;  2D3T A;  3ZWA A;  3ST9 A;  3K8X A;  1N6E A;  4QFE A;  3QXZ A;  2X24 A;  5G1S A;  4JFC A;  4NEK A;  3JU1 A;  4RYF H;  2F6Q A;  1DUB A;  1UYV A;  5JBW A;  3ZWC A;  3QMJ A;  3GKB A;  3L3S A;  3U9T B;  1UYR A;  2ZL3 A;  1TYF A;  2ZL4 A;  3RSI A;  4FND A;  1JXZ A;  3OME A;  2QQ3 A;  4MI2 A;  4JCQ A;  4FN8 A;  3QXI A;  1K32 A;  4IZD A;  5C9G A;  3IB9 A;  3Q1T A;  2DEO A;  2VSS A;  3HE2 A;  3TT7 A;  1Y7O A;  2F6I A;  3PZK A;  5E0S H;  4JVT A;  5INI A;  3KTK A;  4RYF A;  3ZWB A;  4ELX A;  3T8B A;  4GM2 A;  4Q0G A;  3R9S A;  1EF8 A;  5KDR A;  2GTR A;  3TVW A;  3H81 A;  2F9Y A;  4HC8 A;  3QKA A;  4HNK A;  4ZDC A;  1TG6 A;  3K50 A;  2J5I B;  3FF6 A;  3DJA A;  3H0J A;  4KWB A;  5DKP A;  5DU6 A;  1O8U A;  3T88 A;  4JJT A;  1WZ8 A;  2Q2X A;  3TDC A;  3STA A;  1K39 A;  2DUB A;  1NZY B;  3ZW9 A;  2A7S A;  3H0Q A;  4FNB A;  4WYO B;  5INF A;  3BEZ A;  4JWV A;  3BF0 A;  4U0G A;  1SZO A;  4WZ8 B;  4Q1I A;  2W3P A;  3VIV A;  3IBB A;  4GHN A;  1ON3 A;  2PG8 A;  1OD4 A;  3ZW8 A;  4U1A A;  3HIN A;  4ELW A;  3LAO A;  4RCN A;  4JSB A;  5DTP A;  1WDK A;  1NZY A;  3I47 A;  1PJH A;  2IEX A;  5IKL B;  3R0O A;  3R6H A;  4K2N A;  1FCF A;  1YG6 A;  4KPK A;  2F9Y B;  4ZDD A;  4ZDF A;  5DZK H;  2J5G D;  4I4Z A;  2A81 A;  3H02 A;  1XNY A;  4B3I A;  3NJB A;  3RST A;  3TZ3 A;  3QWD A;  3WG5 A;  1X0U A;  4YLH A;  3V5I A;  4ELS A;  5KJP A;  3HLN 1;  5FIF A;  3SWX A;  1XNV A;  2J5I I;  3R9Q A;  4G2R A;  4IZB A;  4ASI A;  1DCI A;  3U9S B;  2F9I B;  3T3W A;  1XX4 A;  3T89 A;  5E0N X;  1EY3 A;  2X58 A;  4FB8 A;  4QIJ A;  2C8T A;  2A7K A;  2Q35 A;  4EML A;  1Q52 A;  2HW5 A;  3KQF A;  3DOR A;  3PGQ A;  1Q51 A;  5DL1 A;  3KTG A;  3Q7H A;  1RJN A;  4U19 A;  2ZQR A;  3H0U A;  3KTJ A;  3R9T A;  3TVU A;  3U9R B;  4U0G H;  4IZC A;  4I42 A;  3BPP A;  4JCT A;  3QK8 A;  4FN7 A;  3Q0G A;  5KDR B;  2UZF A;  2ZL2 A;  4MXI A;  3OC7 A;  3ISA A;  1J7X A;  1FC9 A;  5DU8 A;  2VRE A;  3LKE A;  1W2X A;  4JOT A;  4OG1 A;  3KTH A;  1SG4 A;  4FJW D;  4B3H A;  5MGB A;  2J5S A;  2FZS A;  3TT6 A;  4Z0M A;  4F47 A; 
#chains in the Genus database with same CATH topology
 4GEH B;  3RRV A;  3AJM A;  2J5I A;  2CE3 A;  2PPY A;  3MOY A;  4JCR A;  2VSU C;  3T8A A;  1RJM A;  1MJ3 A;  3GLM A;  4K29 A;  5DTW A;  5ING A;  2EJ5 A;  2VSS E;  3G64 A;  3P5M A;  3N6R B;  3M6M A;  1N6F A;  2VSU E;  1HZD A;  5FUS A;  3P2L A;  3GF7 A;  4ZU2 A;  2J5G A;  2YJG A;  1UYS A;  1Y64 B;  2FW2 A;  1OD2 A;  3GMA A;  3PE8 A;  2VX2 A;  1UIY A;  5JBX A;  3P85 A;  1VRG A;  4EMP A;  4JYL A;  2Q34 A;  3SLL A;  3FDU A;  4L6W A;  4WCZ A;  5DZK A;  4KNP A;  3KTI A;  1PIX A;  4ZDB A;  1FC7 A;  3A4L A;  3QYR A;  4JCS A;  5E0S A;  4NNQ A;  4JYJ A;  5C90 A;  2BZR A;  2WTB A;  3IRB A;  4OLQ A;  4NAR A;  4K3W A;  2PBP A;  5CTB A;  4FZW C;  1WDL A;  3NJD A;  4HDT A;  3MYB A;  3O4X E;  3Q0J A;  2NP9 A;  1FC6 A;  2CBY A;  3H0S A;  3TLF A;  5G1R A;  5DUF A;  3IAV A;  5DUC A;  3PEA A;  2ZL0 A;  4B3J A;  1HNO A;  1WDM A;  3QRE A;  3GF3 A;  3HP0 A;  4MOU A;  4QII A;  2VSU F;  4I52 A;  3HRX A;  5DU4 A;  1EF9 A;  1XO6 A;  3A4N A;  2ZQQ A;  3MT6 A;  1UYT A;  3OT6 A;  4OMR A;  3V5E A;  1XNW A;  4KD6 A;  4DI1 A;  4U18 A;  4FZW A;  2F9I A;  1HNU A;  5G1Q A;  5CTC A;  2VSU A;  1YG8 A;  3MFM A;  4ZDE A;  1ON9 A;  3TV5 A;  4EMM A;  4U0H A;  2FBM A;  3TRR A;  2VSS F;  1N6D A;  4L8K A;  4LK5 A;  3M6N A;  2D3T A;  3ZWA A;  3ST9 A;  3K8X A;  1N6E A;  4QFE A;  3QXZ A;  2X24 A;  5G1S A;  4JFC A;  4NEK A;  3JU1 A;  4RYF H;  2F6Q A;  1DUB A;  1UX5 A;  1UYV A;  5JBW A;  3ZWC A;  3QMJ A;  3GKB A;  3W8H B;  3L3S A;  3U9T B;  1UYR A;  2ZL3 A;  1TYF A;  2ZL4 A;  3RSI A;  4FND A;  1JXZ A;  3OME A;  2QQ3 A;  4MI2 A;  4JCQ A;  4FN8 A;  3QXI A;  1K32 A;  4IZD A;  5C9G A;  3IB9 A;  3Q1T A;  2DEO A;  2VSS A;  3HE2 A;  3TT7 A;  1Y7O A;  2F6I A;  3PZK A;  5E0S H;  4JVT A;  5INI A;  3KTK A;  4RYF A;  3ZWB A;  4ELX A;  3T8B A;  4GM2 A;  4Q0G A;  3R9S A;  1EF8 A;  5KDR A;  2GTR A;  3TVW A;  3H81 A;  2F9Y A;  4HC8 A;  3QKA A;  4HNK A;  4ZDC A;  1TG6 A;  3K50 A;  2J5I B;  3FF6 A;  3DJA A;  3H0J A;  4KWB A;  3L8J A;  5DKP A;  5DU6 A;  1O8U A;  3T88 A;  4JJT A;  1WZ8 A;  2Q2X A;  3ADB A;  5HUQ A;  3ADC A;  3TDC A;  3STA A;  1K39 A;  2DUB A;  1NZY B;  3ZW9 A;  3W8I B;  2A7S A;  3RQG A;  3H0Q A;  4FNB A;  4WYO B;  5INF A;  3BEZ A;  4JWV A;  3BF0 A;  4U0G A;  1SZO A;  4WZ8 B;  4Q1I A;  2W3P A;  3VIV A;  3IBB A;  4GHN A;  1ON3 A;  2PG8 A;  3RQF A;  1OD4 A;  3ZW8 A;  4U1A A;  3HIN A;  3L8I A;  4ELW A;  3RQE A;  3LAO A;  4RCN A;  4JSB A;  5DTP A;  1WDK A;  1NZY A;  3I47 A;  1PJH A;  2IEX A;  5IKL B;  3R0O A;  3R6H A;  4K2N A;  1FCF A;  1YG6 A;  4KPK A;  2F9Y B;  4ZDD A;  4ZDF A;  5DZK H;  2J5G D;  4I4Z A;  2A81 A;  3H02 A;  1XNY A;  4B3I A;  3NJB A;  3RST A;  3TZ3 A;  3QWD A;  3WG5 A;  3A4M A;  1X0U A;  4YLH A;  3V5I A;  4ELS A;  5KJP A;  3HLN 1;  5FIF A;  3SWX A;  1XNV A;  2J5I I;  3R9Q A;  4G2R A;  4IZB A;  4ASI A;  1DCI A;  3U9S B;  2F9I B;  3T3W A;  1XX4 A;  3AM1 A;  3T89 A;  5E0N X;  1EY3 A;  2X58 A;  3BPT A;  4FB8 A;  4QIJ A;  2C8T A;  3ADD A;  2A7K A;  1UX4 A;  2Q35 A;  4EML A;  1Q52 A;  2HW5 A;  3KQF A;  3DOR A;  3PGQ A;  4J2U A;  1Q51 A;  5DL1 A;  3KTG A;  3Q7H A;  2P63 A;  1RJN A;  4U19 A;  2ZQR A;  3H0U A;  3KTJ A;  3R9T A;  3TVU A;  3U9R B;  4U0G H;  4IZC A;  4I42 A;  3BPP A;  4JCT A;  3QK8 A;  4FN7 A;  3Q0G A;  5KDR B;  2UZF A;  2ZL2 A;  4MXI A;  3OC7 A;  3ISA A;  1J7X A;  1FC9 A;  5DU8 A;  2VRE A;  3LKE A;  1W2X A;  4JOT A;  4OG1 A;  3KTH A;  1SG4 A;  4FJW D;  4B3H A;  5MGB A;  2J5S A;  2FZS A;  3TT6 A;  4Z0M A;  4F47 A; 
#chains in the Genus database with same CATH homology
 3RRV A;  2J5I A;  2CE3 A;  2PPY A;  3MOY A;  4JCR A;  2VSU C;  3T8A A;  1RJM A;  1MJ3 A;  3GLM A;  4K29 A;  5DTW A;  5ING A;  2EJ5 A;  2VSS E;  3G64 A;  3P5M A;  3N6R B;  3M6M A;  1N6F A;  2VSU E;  1HZD A;  5FUS A;  3P2L A;  3GF7 A;  4ZU2 A;  2J5G A;  2YJG A;  1UYS A;  2FW2 A;  1OD2 A;  3GMA A;  3PE8 A;  2VX2 A;  1UIY A;  5JBX A;  3P85 A;  1VRG A;  4EMP A;  4JYL A;  2Q34 A;  3SLL A;  3FDU A;  4L6W A;  4WCZ A;  5DZK A;  4KNP A;  3KTI A;  1PIX A;  4ZDB A;  1FC7 A;  3QYR A;  4JCS A;  5E0S A;  4NNQ A;  4JYJ A;  5C90 A;  2BZR A;  2WTB A;  4OLQ A;  4NAR A;  4K3W A;  2PBP A;  5CTB A;  4FZW C;  1WDL A;  3NJD A;  4HDT A;  3MYB A;  3Q0J A;  2NP9 A;  1FC6 A;  2CBY A;  3H0S A;  3TLF A;  5G1R A;  5DUF A;  3IAV A;  5DUC A;  3PEA A;  2ZL0 A;  4B3J A;  1HNO A;  1WDM A;  3QRE A;  3GF3 A;  3HP0 A;  4MOU A;  4QII A;  2VSU F;  4I52 A;  3HRX A;  5DU4 A;  1EF9 A;  1XO6 A;  2ZQQ A;  3MT6 A;  1UYT A;  3OT6 A;  4OMR A;  3V5E A;  1XNW A;  4KD6 A;  4DI1 A;  4U18 A;  4FZW A;  2F9I A;  1HNU A;  5CTC A;  5G1Q A;  2VSU A;  1YG8 A;  3MFM A;  4ZDE A;  1ON9 A;  3TV5 A;  4EMM A;  4U0H A;  2FBM A;  3TRR A;  2VSS F;  1N6D A;  4L8K A;  4LK5 A;  3M6N A;  2D3T A;  3ZWA A;  3ST9 A;  3K8X A;  1N6E A;  4QFE A;  3QXZ A;  2X24 A;  5G1S A;  4JFC A;  4NEK A;  3JU1 A;  4RYF H;  2F6Q A;  1DUB A;  1UYV A;  5JBW A;  3ZWC A;  3QMJ A;  3GKB A;  3L3S A;  3U9T B;  1UYR A;  2ZL3 A;  1TYF A;  2ZL4 A;  3RSI A;  4FND A;  1JXZ A;  3OME A;  2QQ3 A;  4MI2 A;  4JCQ A;  4FN8 A;  3QXI A;  1K32 A;  4IZD A;  5C9G A;  3IB9 A;  3Q1T A;  2DEO A;  2VSS A;  3HE2 A;  3TT7 A;  1Y7O A;  2F6I A;  3PZK A;  5E0S H;  4JVT A;  5INI A;  3KTK A;  4RYF A;  3ZWB A;  4ELX A;  3T8B A;  4GM2 A;  4Q0G A;  3R9S A;  1EF8 A;  5KDR A;  2GTR A;  3TVW A;  3H81 A;  2F9Y A;  4HC8 A;  3QKA A;  4HNK A;  4ZDC A;  1TG6 A;  3K50 A;  2J5I B;  3FF6 A;  3DJA A;  3H0J A;  4KWB A;  5DKP A;  5DU6 A;  1O8U A;  3T88 A;  4JJT A;  1WZ8 A;  2Q2X A;  5HUQ A;  3TDC A;  3STA A;  1K39 A;  2DUB A;  1NZY B;  3ZW9 A;  2A7S A;  3H0Q A;  4FNB A;  4WYO B;  5INF A;  3BEZ A;  4JWV A;  3BF0 A;  4U0G A;  1SZO A;  4WZ8 B;  4Q1I A;  2W3P A;  3VIV A;  3IBB A;  4GHN A;  1ON3 A;  2PG8 A;  1OD4 A;  3ZW8 A;  4U1A A;  3HIN A;  4ELW A;  3LAO A;  4RCN A;  4JSB A;  5DTP A;  1WDK A;  1NZY A;  3I47 A;  1PJH A;  2IEX A;  5IKL B;  3R0O A;  3R6H A;  4K2N A;  1FCF A;  1YG6 A;  4KPK A;  2F9Y B;  4ZDD A;  4ZDF A;  5DZK H;  2J5G D;  4I4Z A;  2A81 A;  3H02 A;  1XNY A;  4B3I A;  3NJB A;  3RST A;  3TZ3 A;  3QWD A;  3WG5 A;  1X0U A;  4YLH A;  3V5I A;  4ELS A;  5KJP A;  3HLN 1;  5FIF A;  3SWX A;  1XNV A;  2J5I I;  3R9Q A;  4G2R A;  4IZB A;  4ASI A;  1DCI A;  3U9S B;  2F9I B;  3T3W A;  1XX4 A;  3T89 A;  5E0N X;  1EY3 A;  2X58 A;  3BPT A;  4FB8 A;  4QIJ A;  2C8T A;  2A7K A;  2Q35 A;  4EML A;  1Q52 A;  2HW5 A;  3KQF A;  3DOR A;  3PGQ A;  4J2U A;  1Q51 A;  5DL1 A;  3KTG A;  3Q7H A;  1RJN A;  4U19 A;  2ZQR A;  3H0U A;  3KTJ A;  3R9T A;  3TVU A;  3U9R B;  4U0G H;  4IZC A;  4I42 A;  3BPP A;  4JCT A;  3QK8 A;  4FN7 A;  3Q0G A;  5KDR B;  2UZF A;  2ZL2 A;  4MXI A;  3OC7 A;  3ISA A;  1J7X A;  1FC9 A;  5DU8 A;  2VRE A;  3LKE A;  1W2X A;  4JOT A;  4OG1 A;  3KTH A;  1SG4 A;  4FJW D;  4B3H A;  5MGB A;  2J5S A;  2FZS A;  3TT6 A;  4Z0M A;  4F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...