4QIJA

Crystal structure of menb from mycobacteria tuberculosis in complex with 1-hna-coa
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
301
Chain Sequence
ALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-dependent active-site closure revealed in the crystal structure of Mycobacterium tuberculosis MenB complexed with product analogues
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 116
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2014-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 4qijA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4qijA01
4U18A 3TRRA 5G1SA 4ZDEA 3H0SA 3I47A 2DEOA 1N6DA 1DUBA 1HNOA 4GHNA 4GM2A 1NZYB 5DZKA 4ZDCA 3KTGA 5DU6A 4JOTA 1DCIA 1W2XA 3RSTA 2QQ3A 3T8AA 4HNKA 5E0SH 5KJPA 5INFA 4FN7A 3T88A 3IBBA 1UIYA 3GF3A 3TT6A 3ISAA 2A81A 4FZWA 2VX2A 2ZL2A 2F9IA 2UZFA 3ZWCA 3TVWA 4ZDFA 4Q1IA 2WTBA 3R9QA 4ASIA 5JBWA 2F6QA 4RCNA 4FNBA 3U9TB 2VSSA 1ON9A 3FF6A 4JFCA 1SZOA 2C8TA 1NZYA 5DU4A 2J5GD 3U9SB 3MFMA 3P2LA 5MGBA 3H02A 3T8BA 3SWXA 2FBMA 4I4ZA 4FJWD 3R9TA 4JCQA 2EJ5A 3H0JA 3N6RB 4U0HA 4L8KA 3HLN1 1J7XA 5IKLB 1Q52A 1UYVA 1Q51A 1UYTA 1WZ8A 4ELSA 5DZKH 2J5GA 2VSSF 3ZW8A 4ELWA 1TG6A 3BF0A 3QWDA 5KDRA 2BZRA 4Q0GA 3BPPA 2F6IA 4YLHA 2Q2XA 2ZL4A 3QKAA 4ELXA 4JSBA 4K29A 3G64A 3IB9A 4ZDDA 4NEKA 3T3WA 4L6WA 3P5MA 5INIA 5KDRB 3QMJA 3H0QA 4MI2A 2Q35A 1X0UA 2ZL0A 4FB8A 2VSSE 3TLFA 5DUCA 4FZWC 1FCFA 5DTWA 3HRXA 3KTIA 1EY3A 4ZDBA 3BEZA 1Y7OA 5DTPA 4QIIA 1WDLA 5E0SA 4WYOB 3K50A 4JCTA 3H0UA 3KTKA 3GKBA 1HZDA 1OD4A 3QK8A 2FW2A 4JJTA 1PIXA 3IAVA 1N6EA 3DJAA 1EF9A 3GF7A 1PJHA 3HP0A 5CTBA 3WG5A 1HNUA 3QXIA 4U0GH 4OLQA 4IZBA 5CTCA 5C90A 3SLLA 3H81A 3ZWAA 1WDKA 4DI1A 3KTHA 3TZ3A 4B3IA 3RRVA 4KNPA 4MOUA 3Q0GA 1XNWA 5G1RA 2J5IA 3R6HA 3TT7A 3LAOA 3L3SA 3P85A 1OD2A 2W3PA 1MJ3A 3TVUA 4B3HA 3T89A 4I52A 3TV5A 3KTJA 2GTRA 3MT6A 1RJMA 1RJNA 3KQFA 3OMEA 3TDCA 3NJBA 5FIFA 1EF8A 5JBXA 1XNYA 1FC6A 1YG6A 2VSUE 3OC7A 5DUFA 3VIVA 1N6FA 4I42A 1FC9A 4U0GA 4JCSA 5FUSA 4U1AA 2Q34A 4U19A 1K39A 2A7SA 3U9RB 2VREA 1FC7A 2ZQRA 3PGQA 2VSUC 3PEAA 4EMMA 3QREA 4EMPA 5INGA 3HE2A 4RYFA 2VSUA 3RSIA 5G1QA 2VSUF 1K32A 2X24A 5E0NX 4KD6A 4K2NA 2F9YA 1WDMA 3MYBA 2PG8A 1SG4A 3PZKA 3Q7HA 3M6MA 4FNDA 4FN8A 4WZ8B 1YG8A 3OT6A 2F9IB 2DUBA 2HW5A 1O8UA 4MXIA 1ON3A 3DORA 4NNQA 2A7KA 4B3JA 2IEXA 3HINA 1XO6A 5DKPA 3LKEA 2X58A 4LK5A 3K8XA 2J5II 5DL1A 3GLMA 4JYLA 5DU8A 3QXZA 3NJDA 1VRGA 3MOYA 2PPYA 3Q0JA 4QIJA 4JVTA 2CE3A 2ZL3A 4F47A 1XX4A 4WCZA 2PBPA 4IZCA 3V5EA 3ZW9A 2J5SA 3JU1A 2CBYA 3M6NA 1TYFA 1XNVA 4KWBA 3PE8A 4IZDA 3R0OA 3GMAA 2F9YB 4Z0MA 3R9SA 4G2RA 2FZSA 1UYRA 3ZWBA 3QYRA 4KPKA 2J5IB 4RYFH 4EMLA 4K3WA 4JCRA 3STAA 3FDUA 4QFEA 4OMRA 3Q1TA 2NP9A 2ZQQA 3V5IA 4JYJA 5C9GA 1UYSA 4JWVA 4OG1A 4ZU2A 4HC8A 2D3TA 3ST9A 1JXZA
chains in the Genus database with same CATH superfamily
4U18A 3TRRA 5G1SA 4ZDEA 3H0SA 3I47A 4J2UA 2DEOA 1N6DA 1DUBA 1HNOA 4GHNA 4GM2A 3AJMA 1NZYB 5DZKA 4ZDCA 3KTGA 3ADBA 5DU6A 4JOTA 1DCIA 1W2XA 3RSTA 2QQ3A 3T8AA 4HNKA 5E0SH 5KJPA 3W8IB 5INFA 4FN7A 3RQEA 3T88A 3IBBA 1UIYA 3GF3A 3TT6A 3ISAA 2A81A 3RQFA 1UX5A 4FZWA 2VX2A 3ADCA 2ZL2A 2F9IA 5HUQA 2UZFA 3A4MA 3ZWCA 3TVWA 4ZDFA 3O4XE 4Q1IA 2WTBA 3R9QA 4ASIA 3RQGA 5JBWA 2F6QA 4RCNA 4FNBA 3U9TB 2VSSA 1ON9A 3FF6A 4JFCA 1SZOA 2C8TA 1NZYA 4NARA 5DU4A 2J5GD 3U9SB 3MFMA 3P2LA 5MGBA 3H02A 3T8BA 3SWXA 4HDTA 2FBMA 4I4ZA 4FJWD 3R9TA 4JCQA 2EJ5A 3H0JA 3N6RB 4U0HA 4L8KA 3HLN1 1J7XA 5IKLB 1Q52A 1UYVA 1Q51A 1UYTA 1WZ8A 4ELSA 5DZKH 2P63A 2J5GA 3A4NA 2VSSF 3ZW8A 4ELWA 1TG6A 3BF0A 3QWDA 5KDRA 2BZRA 4Q0GA 3BPPA 2F6IA 4YLHA 3A4LA 2Q2XA 2ZL4A 3QKAA 4ELXA 4JSBA 4K29A 3G64A 3IB9A 4ZDDA 4NEKA 3T3WA 4L6WA 3P5MA 5INIA 1Y64B 5KDRB 3QMJA 3H0QA 4MI2A 2Q35A 1X0UA 2ZL0A 4FB8A 2VSSE 3TLFA 5DUCA 4FZWC 1FCFA 5DTWA 3HRXA 3KTIA 1EY3A 4ZDBA 3BEZA 1Y7OA 5DTPA 4QIIA 1WDLA 5E0SA 4WYOB 3K50A 4JCTA 3H0UA 3KTKA 3GKBA 1HZDA 1OD4A 3QK8A 2FW2A 4JJTA 3L8IA 1PIXA 3IAVA 1N6EA 3DJAA 1EF9A 3GF7A 1PJHA 3HP0A 5CTBA 3WG5A 1HNUA 3QXIA 4U0GH 4OLQA 4IZBA 5CTCA 5C90A 3SLLA 3H81A 3ZWAA 1WDKA 4DI1A 3KTHA 3AM1A 3TZ3A 4B3IA 2YJGA 3RRVA 4KNPA 3W8HB 4MOUA 3Q0GA 1XNWA 5G1RA 2J5IA 3R6HA 3TT7A 3LAOA 3L3SA 3ADDA 3P85A 1OD2A 3IRBA 2W3PA 1MJ3A 3TVUA 4B3HA 3T89A 4I52A 3TV5A 3KTJA 2GTRA 3MT6A 1RJMA 1RJNA 3KQFA 3OMEA 3TDCA 3NJBA 5FIFA 1EF8A 5JBXA 1XNYA 1FC6A 1UX4A 1YG6A 2VSUE 3OC7A 5DUFA 3VIVA 1N6FA 4I42A 1FC9A 4U0GA 4JCSA 5FUSA 4U1AA 2Q34A 4U19A 1K39A 2A7SA 3U9RB 2VREA 1FC7A 2ZQRA 3PGQA 2VSUC 3PEAA 4EMMA 3QREA 4EMPA 5INGA 3HE2A 4RYFA 3L8JA 2VSUA 3RSIA 5G1QA 2VSUF 1K32A 2X24A 5E0NX 4KD6A 4K2NA 2F9YA 1WDMA 3MYBA 2PG8A 1SG4A 3PZKA 3Q7HA 3M6MA 4FNDA 4FN8A 4WZ8B 1YG8A 3OT6A 2F9IB 2DUBA 2HW5A 1O8UA 4MXIA 1ON3A 3DORA 4NNQA 2A7KA 4B3JA 2IEXA 3HINA 1XO6A 5DKPA 3LKEA 2X58A 4LK5A 3K8XA 2J5II 5DL1A 3GLMA 4JYLA 5DU8A 3QXZA 3NJDA 1VRGA 3MOYA 2PPYA 3Q0JA 4QIJA 4JVTA 4GEHB 2CE3A 2ZL3A 4F47A 1XX4A 4WCZA 2PBPA 4IZCA 3V5EA 3ZW9A 2J5SA 3JU1A 2CBYA 3M6NA 1TYFA 1XNVA 4KWBA 3PE8A 4IZDA 3R0OA 3GMAA 2F9YB 4Z0MA 3R9SA 4G2RA 2FZSA 1UYRA 3ZWBA 3QYRA 4KPKA 2J5IB 4RYFH 4EMLA 4K3WA 4JCRA 3STAA 3FDUA 4QFEA 4OMRA 3Q1TA 2NP9A 2ZQQA 3V5IA 4JYJA 5C9GA 1UYSA 4JWVA 3BPTA 4OG1A 4ZU2A 4HC8A 2D3TA 3ST9A 1JXZA
chains in the Genus database with same CATH topology
4U18A 3TRRA 5G1SA 4ZDEA 3H0SA 3I47A 4J2UA 2DEOA 1N6DA 1DUBA 1HNOA 4GHNA 4GM2A 1NZYB 5DZKA 4ZDCA 3KTGA 5DU6A 4JOTA 1DCIA 1W2XA 3RSTA 2QQ3A 3T8AA 4HNKA 5E0SH 5KJPA 5INFA 4FN7A 3T88A 3IBBA 1UIYA 3GF3A 3TT6A 3ISAA 2A81A 4FZWA 2VX2A 2ZL2A 2F9IA 5HUQA 2UZFA 3ZWCA 3TVWA 4ZDFA 4Q1IA 2WTBA 3R9QA 4ASIA 5JBWA 2F6QA 4RCNA 4FNBA 3U9TB 2VSSA 1ON9A 3FF6A 4JFCA 1SZOA 2C8TA 1NZYA 4NARA 5DU4A 2J5GD 3U9SB 3MFMA 3P2LA 5MGBA 3H02A 3T8BA 3SWXA 4HDTA 2FBMA 4I4ZA 4FJWD 3R9TA 4JCQA 2EJ5A 3H0JA 3N6RB 4U0HA 4L8KA 3HLN1 1J7XA 5IKLB 1Q52A 1UYVA 1Q51A 1UYTA 1WZ8A 4ELSA 5DZKH 2J5GA 2VSSF 3ZW8A 4ELWA 1TG6A 3BF0A 3QWDA 5KDRA 2BZRA 4Q0GA 3BPPA 2F6IA 4YLHA 2Q2XA 2ZL4A 3QKAA 4ELXA 4JSBA 4K29A 3G64A 3IB9A 4ZDDA 4NEKA 3T3WA 4L6WA 3P5MA 5INIA 5KDRB 3QMJA 3H0QA 4MI2A 2Q35A 1X0UA 2ZL0A 4FB8A 2VSSE 3TLFA 5DUCA 4FZWC 1FCFA 5DTWA 3HRXA 3KTIA 1EY3A 4ZDBA 3BEZA 1Y7OA 5DTPA 4QIIA 1WDLA 5E0SA 4WYOB 3K50A 4JCTA 3H0UA 3KTKA 3GKBA 1HZDA 1OD4A 3QK8A 2FW2A 4JJTA 1PIXA 3IAVA 1N6EA 3DJAA 1EF9A 3GF7A 1PJHA 3HP0A 5CTBA 3WG5A 1HNUA 3QXIA 4U0GH 4OLQA 4IZBA 5CTCA 5C90A 3SLLA 3H81A 3ZWAA 1WDKA 4DI1A 3KTHA 3TZ3A 4B3IA 2YJGA 3RRVA 4KNPA 4MOUA 3Q0GA 1XNWA 5G1RA 2J5IA 3R6HA 3TT7A 3LAOA 3L3SA 3P85A 1OD2A 2W3PA 1MJ3A 3TVUA 4B3HA 3T89A 4I52A 3TV5A 3KTJA 2GTRA 3MT6A 1RJMA 1RJNA 3KQFA 3OMEA 3TDCA 3NJBA 5FIFA 1EF8A 5JBXA 1XNYA 1FC6A 1YG6A 2VSUE 3OC7A 5DUFA 3VIVA 1N6FA 4I42A 1FC9A 4U0GA 4JCSA 5FUSA 4U1AA 2Q34A 4U19A 1K39A 2A7SA 3U9RB 2VREA 1FC7A 2ZQRA 3PGQA 2VSUC 3PEAA 4EMMA 3QREA 4EMPA 5INGA 3HE2A 4RYFA 2VSUA 3RSIA 5G1QA 2VSUF 1K32A 2X24A 5E0NX 4KD6A 4K2NA 2F9YA 1WDMA 3MYBA 2PG8A 1SG4A 3PZKA 3Q7HA 3M6MA 4FNDA 4FN8A 4WZ8B 1YG8A 3OT6A 2F9IB 2DUBA 2HW5A 1O8UA 4MXIA 1ON3A 3DORA 4NNQA 2A7KA 4B3JA 2IEXA 3HINA 1XO6A 5DKPA 3LKEA 2X58A 4LK5A 3K8XA 2J5II 5DL1A 3GLMA 4JYLA 5DU8A 3QXZA 3NJDA 1VRGA 3MOYA 2PPYA 3Q0JA 4QIJA 4JVTA 2CE3A 2ZL3A 4F47A 1XX4A 4WCZA 2PBPA 4IZCA 3V5EA 3ZW9A 2J5SA 3JU1A 2CBYA 3M6NA 1TYFA 1XNVA 4KWBA 3PE8A 4IZDA 3R0OA 3GMAA 2F9YB 4Z0MA 3R9SA 4G2RA 2FZSA 1UYRA 3ZWBA 3QYRA 4KPKA 2J5IB 4RYFH 4EMLA 4K3WA 4JCRA 3STAA 3FDUA 4QFEA 4OMRA 3Q1TA 2NP9A 2ZQQA 3V5IA 4JYJA 5C9GA 1UYSA 4JWVA 3BPTA 4OG1A 4ZU2A 4HC8A 2D3TA 3ST9A 1JXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U18 A;  3TRR A;  5G1S A;  4ZDE A;  3H0S A;  3I47 A;  2DEO A;  1N6D A;  1DUB A;  1HNO A;  4GHN A;  4GM2 A;  1NZY B;  5DZK A;  4ZDC A;  3KTG A;  5DU6 A;  4JOT A;  1DCI A;  1W2X A;  3RST A;  2QQ3 A;  3T8A A;  4HNK A;  5E0S H;  5KJP A;  5INF A;  4FN7 A;  3T88 A;  3IBB A;  1UIY A;  3GF3 A;  3TT6 A;  3ISA A;  2A81 A;  4FZW A;  2VX2 A;  2ZL2 A;  2F9I A;  2UZF A;  3ZWC A;  3TVW A;  4ZDF A;  4Q1I A;  2WTB A;  3R9Q A;  4ASI A;  5JBW A;  2F6Q A;  4RCN A;  4FNB A;  3U9T B;  2VSS A;  1ON9 A;  3FF6 A;  4JFC A;  1SZO A;  2C8T A;  1NZY A;  5DU4 A;  2J5G D;  3U9S B;  3MFM A;  3P2L A;  5MGB A;  3H02 A;  3T8B A;  3SWX A;  2FBM A;  4I4Z A;  4FJW D;  3R9T A;  4JCQ A;  2EJ5 A;  3H0J A;  3N6R B;  4U0H A;  4L8K A;  3HLN 1;  1J7X A;  5IKL B;  1Q52 A;  1UYV A;  1Q51 A;  1UYT A;  1WZ8 A;  4ELS A;  5DZK H;  2J5G A;  2VSS F;  3ZW8 A;  4ELW A;  1TG6 A;  3BF0 A;  3QWD A;  5KDR A;  2BZR A;  4Q0G A;  3BPP A;  2F6I A;  4YLH A;  2Q2X A;  2ZL4 A;  3QKA A;  4ELX A;  4JSB A;  4K29 A;  3G64 A;  3IB9 A;  4ZDD A;  4NEK A;  3T3W A;  4L6W A;  3P5M A;  5INI A;  5KDR B;  3QMJ A;  3H0Q A;  4MI2 A;  2Q35 A;  1X0U A;  2ZL0 A;  4FB8 A;  2VSS E;  3TLF A;  5DUC A;  4FZW C;  1FCF A;  5DTW A;  3HRX A;  3KTI A;  1EY3 A;  4ZDB A;  3BEZ A;  1Y7O A;  5DTP A;  4QII A;  1WDL A;  5E0S A;  4WYO B;  3K50 A;  4JCT A;  3H0U A;  3KTK A;  3GKB A;  1HZD A;  1OD4 A;  3QK8 A;  2FW2 A;  4JJT A;  1PIX A;  3IAV A;  1N6E A;  3DJA A;  1EF9 A;  3GF7 A;  1PJH A;  3HP0 A;  5CTB A;  3WG5 A;  1HNU A;  3QXI A;  4U0G H;  4OLQ A;  4IZB A;  5CTC A;  5C90 A;  3SLL A;  3H81 A;  3ZWA A;  1WDK A;  4DI1 A;  3KTH A;  3TZ3 A;  4B3I A;  3RRV A;  4KNP A;  4MOU A;  3Q0G A;  1XNW A;  5G1R A;  2J5I A;  3R6H A;  3TT7 A;  3LAO A;  3L3S A;  3P85 A;  1OD2 A;  2W3P A;  1MJ3 A;  3TVU A;  4B3H A;  3T89 A;  4I52 A;  3TV5 A;  3KTJ A;  2GTR A;  3MT6 A;  1RJM A;  1RJN A;  3KQF A;  3OME A;  3TDC A;  3NJB A;  5FIF A;  1EF8 A;  5JBX A;  1XNY A;  1FC6 A;  1YG6 A;  2VSU E;  3OC7 A;  5DUF A;  3VIV A;  1N6F A;  4I42 A;  1FC9 A;  4U0G A;  4JCS A;  5FUS A;  4U1A A;  2Q34 A;  4U19 A;  1K39 A;  2A7S A;  3U9R B;  2VRE A;  1FC7 A;  2ZQR A;  3PGQ A;  2VSU C;  3PEA A;  4EMM A;  3QRE A;  4EMP A;  5ING A;  3HE2 A;  4RYF A;  2VSU A;  3RSI A;  5G1Q A;  2VSU F;  1K32 A;  2X24 A;  5E0N X;  4KD6 A;  4K2N A;  2F9Y A;  1WDM A;  3MYB A;  2PG8 A;  1SG4 A;  3PZK A;  3Q7H A;  3M6M A;  4FND A;  4FN8 A;  4WZ8 B;  1YG8 A;  3OT6 A;  2F9I B;  2DUB A;  2HW5 A;  1O8U A;  4MXI A;  1ON3 A;  3DOR A;  4NNQ A;  2A7K A;  4B3J A;  2IEX A;  3HIN A;  1XO6 A;  5DKP A;  3LKE A;  2X58 A;  4LK5 A;  3K8X A;  2J5I I;  5DL1 A;  3GLM A;  4JYL A;  5DU8 A;  3QXZ A;  3NJD A;  1VRG A;  3MOY A;  2PPY A;  3Q0J A;  4QIJ A;  4JVT A;  2CE3 A;  2ZL3 A;  4F47 A;  1XX4 A;  4WCZ A;  2PBP A;  4IZC A;  3V5E A;  3ZW9 A;  2J5S A;  3JU1 A;  2CBY A;  3M6N A;  1TYF A;  1XNV A;  4KWB A;  3PE8 A;  4IZD A;  3R0O A;  3GMA A;  2F9Y B;  4Z0M A;  3R9S A;  4G2R A;  2FZS A;  1UYR A;  3ZWB A;  3QYR A;  4KPK A;  2J5I B;  4RYF H;  4EML A;  4K3W A;  4JCR A;  3STA A;  3FDU A;  4QFE A;  4OMR A;  3Q1T A;  2NP9 A;  2ZQQ A;  3V5I A;  4JYJ A;  5C9G A;  1UYS A;  4JWV A;  4OG1 A;  4ZU2 A;  4HC8 A;  2D3T A;  3ST9 A;  1JXZ A; 
#chains in the Genus database with same CATH topology
 4U18 A;  3TRR A;  5G1S A;  4ZDE A;  3H0S A;  3I47 A;  4J2U A;  2DEO A;  1N6D A;  1DUB A;  1HNO A;  4GHN A;  4GM2 A;  3AJM A;  1NZY B;  5DZK A;  4ZDC A;  3KTG A;  3ADB A;  5DU6 A;  4JOT A;  1DCI A;  1W2X A;  3RST A;  2QQ3 A;  3T8A A;  4HNK A;  5E0S H;  5KJP A;  3W8I B;  5INF A;  4FN7 A;  3RQE A;  3T88 A;  3IBB A;  1UIY A;  3GF3 A;  3TT6 A;  3ISA A;  2A81 A;  3RQF A;  1UX5 A;  4FZW A;  2VX2 A;  3ADC A;  2ZL2 A;  2F9I A;  5HUQ A;  2UZF A;  3A4M A;  3ZWC A;  3TVW A;  4ZDF A;  3O4X E;  4Q1I A;  2WTB A;  3R9Q A;  4ASI A;  3RQG A;  5JBW A;  2F6Q A;  4RCN A;  4FNB A;  3U9T B;  2VSS A;  1ON9 A;  3FF6 A;  4JFC A;  1SZO A;  2C8T A;  1NZY A;  4NAR A;  5DU4 A;  2J5G D;  3U9S B;  3MFM A;  3P2L A;  5MGB A;  3H02 A;  3T8B A;  3SWX A;  4HDT A;  2FBM A;  4I4Z A;  4FJW D;  3R9T A;  4JCQ A;  2EJ5 A;  3H0J A;  3N6R B;  4U0H A;  4L8K A;  3HLN 1;  1J7X A;  5IKL B;  1Q52 A;  1UYV A;  1Q51 A;  1UYT A;  1WZ8 A;  4ELS A;  5DZK H;  2P63 A;  2J5G A;  3A4N A;  2VSS F;  3ZW8 A;  4ELW A;  1TG6 A;  3BF0 A;  3QWD A;  5KDR A;  2BZR A;  4Q0G A;  3BPP A;  2F6I A;  4YLH A;  3A4L A;  2Q2X A;  2ZL4 A;  3QKA A;  4ELX A;  4JSB A;  4K29 A;  3G64 A;  3IB9 A;  4ZDD A;  4NEK A;  3T3W A;  4L6W A;  3P5M A;  5INI A;  1Y64 B;  5KDR B;  3QMJ A;  3H0Q A;  4MI2 A;  2Q35 A;  1X0U A;  2ZL0 A;  4FB8 A;  2VSS E;  3TLF A;  5DUC A;  4FZW C;  1FCF A;  5DTW A;  3HRX A;  3KTI A;  1EY3 A;  4ZDB A;  3BEZ A;  1Y7O A;  5DTP A;  4QII A;  1WDL A;  5E0S A;  4WYO B;  3K50 A;  4JCT A;  3H0U A;  3KTK A;  3GKB A;  1HZD A;  1OD4 A;  3QK8 A;  2FW2 A;  4JJT A;  3L8I A;  1PIX A;  3IAV A;  1N6E A;  3DJA A;  1EF9 A;  3GF7 A;  1PJH A;  3HP0 A;  5CTB A;  3WG5 A;  1HNU A;  3QXI A;  4U0G H;  4OLQ A;  4IZB A;  5CTC A;  5C90 A;  3SLL A;  3H81 A;  3ZWA A;  1WDK A;  4DI1 A;  3KTH A;  3AM1 A;  3TZ3 A;  4B3I A;  2YJG A;  3RRV A;  4KNP A;  3W8H B;  4MOU A;  3Q0G A;  1XNW A;  5G1R A;  2J5I A;  3R6H A;  3TT7 A;  3LAO A;  3L3S A;  3ADD A;  3P85 A;  1OD2 A;  3IRB A;  2W3P A;  1MJ3 A;  3TVU A;  4B3H A;  3T89 A;  4I52 A;  3TV5 A;  3KTJ A;  2GTR A;  3MT6 A;  1RJM A;  1RJN A;  3KQF A;  3OME A;  3TDC A;  3NJB A;  5FIF A;  1EF8 A;  5JBX A;  1XNY A;  1FC6 A;  1UX4 A;  1YG6 A;  2VSU E;  3OC7 A;  5DUF A;  3VIV A;  1N6F A;  4I42 A;  1FC9 A;  4U0G A;  4JCS A;  5FUS A;  4U1A A;  2Q34 A;  4U19 A;  1K39 A;  2A7S A;  3U9R B;  2VRE A;  1FC7 A;  2ZQR A;  3PGQ A;  2VSU C;  3PEA A;  4EMM A;  3QRE A;  4EMP A;  5ING A;  3HE2 A;  4RYF A;  3L8J A;  2VSU A;  3RSI A;  5G1Q A;  2VSU F;  1K32 A;  2X24 A;  5E0N X;  4KD6 A;  4K2N A;  2F9Y A;  1WDM A;  3MYB A;  2PG8 A;  1SG4 A;  3PZK A;  3Q7H A;  3M6M A;  4FND A;  4FN8 A;  4WZ8 B;  1YG8 A;  3OT6 A;  2F9I B;  2DUB A;  2HW5 A;  1O8U A;  4MXI A;  1ON3 A;  3DOR A;  4NNQ A;  2A7K A;  4B3J A;  2IEX A;  3HIN A;  1XO6 A;  5DKP A;  3LKE A;  2X58 A;  4LK5 A;  3K8X A;  2J5I I;  5DL1 A;  3GLM A;  4JYL A;  5DU8 A;  3QXZ A;  3NJD A;  1VRG A;  3MOY A;  2PPY A;  3Q0J A;  4QIJ A;  4JVT A;  4GEH B;  2CE3 A;  2ZL3 A;  4F47 A;  1XX4 A;  4WCZ A;  2PBP A;  4IZC A;  3V5E A;  3ZW9 A;  2J5S A;  3JU1 A;  2CBY A;  3M6N A;  1TYF A;  1XNV A;  4KWB A;  3PE8 A;  4IZD A;  3R0O A;  3GMA A;  2F9Y B;  4Z0M A;  3R9S A;  4G2R A;  2FZS A;  1UYR A;  3ZWB A;  3QYR A;  4KPK A;  2J5I B;  4RYF H;  4EML A;  4K3W A;  4JCR A;  3STA A;  3FDU A;  4QFE A;  4OMR A;  3Q1T A;  2NP9 A;  2ZQQ A;  3V5I A;  4JYJ A;  5C9G A;  1UYS A;  4JWV A;  3BPT A;  4OG1 A;  4ZU2 A;  4HC8 A;  2D3T A;  3ST9 A;  1JXZ A; 
#chains in the Genus database with same CATH homology
 4U18 A;  3TRR A;  5G1S A;  4ZDE A;  3H0S A;  3I47 A;  4J2U A;  2DEO A;  1N6D A;  1DUB A;  1HNO A;  4GHN A;  4GM2 A;  1NZY B;  5DZK A;  4ZDC A;  3KTG A;  5DU6 A;  4JOT A;  1DCI A;  1W2X A;  3RST A;  2QQ3 A;  3T8A A;  4HNK A;  5E0S H;  5KJP A;  5INF A;  4FN7 A;  3T88 A;  3IBB A;  1UIY A;  3GF3 A;  3TT6 A;  3ISA A;  2A81 A;  4FZW A;  2VX2 A;  2ZL2 A;  2F9I A;  5HUQ A;  2UZF A;  3ZWC A;  3TVW A;  4ZDF A;  4Q1I A;  2WTB A;  3R9Q A;  4ASI A;  5JBW A;  2F6Q A;  4RCN A;  4FNB A;  3U9T B;  2VSS A;  1ON9 A;  3FF6 A;  4JFC A;  1SZO A;  2C8T A;  1NZY A;  4NAR A;  5DU4 A;  2J5G D;  3U9S B;  3MFM A;  3P2L A;  5MGB A;  3H02 A;  3T8B A;  3SWX A;  4HDT A;  2FBM A;  4I4Z A;  4FJW D;  3R9T A;  4JCQ A;  2EJ5 A;  3H0J A;  3N6R B;  4U0H A;  4L8K A;  3HLN 1;  1J7X A;  5IKL B;  1Q52 A;  1UYV A;  1Q51 A;  1UYT A;  1WZ8 A;  4ELS A;  5DZK H;  2J5G A;  2VSS F;  3ZW8 A;  4ELW A;  1TG6 A;  3BF0 A;  3QWD A;  5KDR A;  2BZR A;  4Q0G A;  3BPP A;  2F6I A;  4YLH A;  2Q2X A;  2ZL4 A;  3QKA A;  4ELX A;  4JSB A;  4K29 A;  3G64 A;  3IB9 A;  4ZDD A;  4NEK A;  3T3W A;  4L6W A;  3P5M A;  5INI A;  5KDR B;  3QMJ A;  3H0Q A;  4MI2 A;  2Q35 A;  1X0U A;  2ZL0 A;  4FB8 A;  2VSS E;  3TLF A;  5DUC A;  4FZW C;  1FCF A;  5DTW A;  3HRX A;  3KTI A;  1EY3 A;  4ZDB A;  3BEZ A;  1Y7O A;  5DTP A;  4QII A;  1WDL A;  5E0S A;  4WYO B;  3K50 A;  4JCT A;  3H0U A;  3KTK A;  3GKB A;  1HZD A;  1OD4 A;  3QK8 A;  2FW2 A;  4JJT A;  1PIX A;  3IAV A;  1N6E A;  3DJA A;  1EF9 A;  3GF7 A;  1PJH A;  3HP0 A;  5CTB A;  3WG5 A;  1HNU A;  3QXI A;  4U0G H;  4OLQ A;  4IZB A;  5CTC A;  5C90 A;  3SLL A;  3H81 A;  3ZWA A;  1WDK A;  4DI1 A;  3KTH A;  3TZ3 A;  4B3I A;  2YJG A;  3RRV A;  4KNP A;  4MOU A;  3Q0G A;  1XNW A;  5G1R A;  2J5I A;  3R6H A;  3TT7 A;  3LAO A;  3L3S A;  3P85 A;  1OD2 A;  2W3P A;  1MJ3 A;  3TVU A;  4B3H A;  3T89 A;  4I52 A;  3TV5 A;  3KTJ A;  2GTR A;  3MT6 A;  1RJM A;  1RJN A;  3KQF A;  3OME A;  3TDC A;  3NJB A;  5FIF A;  1EF8 A;  5JBX A;  1XNY A;  1FC6 A;  1YG6 A;  2VSU E;  3OC7 A;  5DUF A;  3VIV A;  1N6F A;  4I42 A;  1FC9 A;  4U0G A;  4JCS A;  5FUS A;  4U1A A;  2Q34 A;  4U19 A;  1K39 A;  2A7S A;  3U9R B;  2VRE A;  1FC7 A;  2ZQR A;  3PGQ A;  2VSU C;  3PEA A;  4EMM A;  3QRE A;  4EMP A;  5ING A;  3HE2 A;  4RYF A;  2VSU A;  3RSI A;  5G1Q A;  2VSU F;  1K32 A;  2X24 A;  5E0N X;  4KD6 A;  4K2N A;  2F9Y A;  1WDM A;  3MYB A;  2PG8 A;  1SG4 A;  3PZK A;  3Q7H A;  3M6M A;  4FND A;  4FN8 A;  4WZ8 B;  1YG8 A;  3OT6 A;  2F9I B;  2DUB A;  2HW5 A;  1O8U A;  4MXI A;  1ON3 A;  3DOR A;  4NNQ A;  2A7K A;  4B3J A;  2IEX A;  3HIN A;  1XO6 A;  5DKP A;  3LKE A;  2X58 A;  4LK5 A;  3K8X A;  2J5I I;  5DL1 A;  3GLM A;  4JYL A;  5DU8 A;  3QXZ A;  3NJD A;  1VRG A;  3MOY A;  2PPY A;  3Q0J A;  4QIJ A;  4JVT A;  2CE3 A;  2ZL3 A;  4F47 A;  1XX4 A;  4WCZ A;  2PBP A;  4IZC A;  3V5E A;  3ZW9 A;  2J5S A;  3JU1 A;  2CBY A;  3M6N A;  1TYF A;  1XNV A;  4KWB A;  3PE8 A;  4IZD A;  3R0O A;  3GMA A;  2F9Y B;  4Z0M A;  3R9S A;  4G2R A;  2FZS A;  1UYR A;  3ZWB A;  3QYR A;  4KPK A;  2J5I B;  4RYF H;  4EML A;  4K3W A;  4JCR A;  3STA A;  3FDU A;  4QFE A;  4OMR A;  3Q1T A;  2NP9 A;  2ZQQ A;  3V5I A;  4JYJ A;  5C9G A;  1UYS A;  4JWV A;  3BPT A;  4OG1 A;  4ZU2 A;  4HC8 A;  2D3T A;  3ST9 A;  1JXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...