4QJ4A

Structure of a fragment of human phospholipase c-beta3 delta472-569, bound to ip3 and in complex with galphaq
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
318
Chain Sequence
DARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of phospholipase C beta 3 autoinhibition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(q) subunit alpha
total genus 112
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4qj4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qj4A01
1S3GA 1W0KA 1WE2A 2ANBA 4BFZA 1JALA 4M2LA 3KKMA 4UKDA 3ZIAA 2XZOA 2F43A 2FGKA 3KJEA 4IKEA 1U8ZA 1AQUA 4L16A 4Q4AA 1XWIA 3R8CA 3RS7A 4CEIB 2J59A 1KO1A 1K5GA 5KUTA 4TLEA 3H0KA 2VTKA 1F2TA 3K0FA 1QHXA 4IOKA 5FBWB 1Q0UA 1I4DD 3ZLJA 2XNDA 1RVDA 2V8OA 1R10A 3B1ZA 2D2FA 2C03A 2NIPA 3WBJA 2A5FA 3TVTA 2W2TA 4XSHA 1F60A 2DBYA 2QP9X 3KTAA 4DCVA 1UEJA 4CF7A 2FF7A 2DYKA 3KKQA 4AWXA 2QNRA 4LYFA 4XD7D 4DLYA 1GRNA 1VG9B 2ZTSA 3T12A 2IYSA 1IXZA 1LF5A 2HT1A 5IRCD 2LWIA 1RRFA 1NP6A 2HYDA 3O47A 5EZ6B 5B64A 2IYZA 4HLUA 1N0UA 3MG9A 4ARZA 1R5OA 1UM8A 3HPQA 5FR1A 2IF0A 4LBZA 1ZNWA 4CZ2A 2ZS7A 3EASA 3LBHA 3KL4A 4AURA 1S1MA 2BWJA 5DGXA 2MMGA 1AM4D 1ZD9A 4WZ6A 3LQQA 1S9HA 3U4QA 3EC2A 2WAXA 4OK3A 4AD8A 4GMDA 3T5DA 3THOA 2HJGA 4A15A 2FPLA 1LY1A 2ZRNA 3K9HA 4PFSA 5DHAA 2ZVPX 1P9RA 4GI7A 2GCNA 4TQUS 3UG7A 1FMJA 4C0SA 1NF3A 4CEIA 1YE8A 4JLAA 4BFTA 3B13B 4JLKA 4YDSA 1LNZA 3R9IA 5BN5A 2H57A 2C98A 1N3BA 4FIDA 2N46A 1JXMA 4FI3C 4IDPA 2DWQA 4B73A 4HDCA 1MO3A 3TAUA 2CLCX 2Q3MA 1COWD 3HJNA 3LD9A 3PEWA 3MJHA 1KK1A 4NDZA 4JZKA 4US2R 3WNCA 4QBHA 2ZSEA 2R44A 1Z0DA 4KFRA 4YLGA 1G8FA 1XZQA 4C30A 1VCOA 4XSGA 1KSJA 3WHKA 4C2TA 3AVVA 3ADCA 2CVFA 4C0QC 2EYQA 3QIAA 4Q48A 1E3MA 3B60A 1E1QA 1GAJA 1XEWX 2YOGA 3CZPA 4QBIA 4TSFD 4URUR 1KHTA 2ZSAA 2IYTA 3O8RA 5H70A 3Q9LA 4JT4A 2B8TA 3VNUA 221PA 1KIMA 2F43B 2WJHA 4LOAA 3VAAA 4NCHA 4YMWA 5C1BA 3MWJA 4MH0R 1H8EA 3VHXA 2WKRA 3MWKA 3U4QB 3P4YA 1NLYA 2WWXA 4R98A 4EQ6A 4BLRA 4MGKR 2WSSD 5E7IA 3F8TA 3U61B 2FFAA 2BBTA 5JI2E 3J81k 2ATXA 3FHOA 1G5PA 4MYTA 4A2QA 1G291 1FUUA 2OILA 1XCMA 4A0RA 3AVTA 2O8DB 2FOLA 2FPMA 2IYQA 2IYWA 5FPTA 1ZUIA 1E2FA 2RGXA 2EFGA 1OXVA 2C77A 2GHIA 1E2NA 3SJAA 4F4IA 2H16A 4RFSB 1ZINA 2JLYA 3KXIA 5FOTA 3C7KA 1GVNB 2V4ZA 3DZDA 3RC8A 4NCIA 4QBFA 4PHFA 4LJ5A 5TVKA 5SZJA 4DCTA 1ZUHA 4YONB 1J70A 1JECA 3VU9A 4TZ6A 4QGHA 3QXXA 2NOAA 3BIFA 1UKEA 3P4XA 4BECA 1GUAA 4TTQA 1P62B 2QAGB 4AYTA 3WXMA 2R2AA 3U3JA 4OI2A 2OT3B 2OAP1 2G0NA 4HAYA 3E5HA 1HV8A 2J0UB 4E22A 1OT3A 1XTRA 5KHOC 3R8FA 2OHFA 1OW3B 4Q9IA 1OYYA 1JQJC 1F3OA 2IYRA 1P75A 4HI0E 4O3MA 4FD2A 1WRBA 3AF1A 1W4RA 2NGRA 3IO5A 4P4UA 5GVRA 2XOKA 4IXNA 4MITA 2YC2C 1CULC 1MABA 2O8DA 1S0UA 2VIIA 2XTNA 4A1FA 1F5NA 1ZU5A 3EAQA 4PPGA 3E70C 5JWHA 3B5JA 1OSNA 2ZI5A 3TAHA 3Q5EA 1IN5A 4IFBA 4LJ9A 2GJ9A 5FTNA 3WYFA 3HDTA 4D26A 4LK2A 4MRRA 1JAIA 4NE2A 3OE7A 4Q66C 1S2MA 4M1YA 2OV2A 3QY0A 3JVVA 1E0SA 3WP1B 4MUBA 2HLDA 2H5EA 5DYIA 3I4LA 3NTUA 3W6OA 3GEEA 1KJYA 4PHHA 2GZHA 3AKEA 3BBPA 4B47A 2PJRA 1S3SA 3CNNA 3CR8A 4Z8YA 4JS0A 2NTYC 2EU8A 1ZC3A 4IXMA 1Z83A 5C4GB 3IHLA 2R6CA 4PO9A 2RGEA 4U7DA 1E1RD 3RC3A 3FPAA 4Q4LA 4DLSA 2J0SA 4LJYA 2MSDB 4KBFA 3SS8A 2IYLD 5KDDA 2GXAA 1BS1A 5B2ZA 2HDNB 3CWQA 1ZM3A 1VPLA 1LVGA 4P33A 4Q7KA 4ACAA 4AKGA 2IL1A 3I62A 2V3CC 2ZI3A 1RC8A 3PFIA 4RFSA 1G20E 1ZIOA 2CEAA 1G41A 3D6TB 5KTYA 1GTVA 2BBSA 4OI0A 4JT2A 3BGWA 4C7OA 3NVAA 4ASUA 3BFKA 4NZYA 4BPBA 2HEIA 5L3RA 2FNAA 3WMFA 1EX7A 1XNJA 3QPVA 2AFHE 2QAGA 2EQBA 2OBMA 2BBOA 4R2IA 1U2RA 2WBLC 4G5SA 1NMXA 3PXGA 2FSFA 2EWVA 4ZDJA 3PG5A 4FMCF 5HZKA 4ESVA 1ZM2A 1WP9A 3CF6R 2X2EA 4LPKA 5EP3A 4ZKEA 1XD2B 2OSBA 1R7RA 3QKRB 4LV6A 4RKEA 1RIFA 3A1TA 2G3YA 2OO7A 4QGFA 2LKCA 3CKLA 1J8MF 2JAQA 3AF0A 4Q00A 4Z1MA 3ICQB 1T3HA 1G3RA 3C41J 4OK5A 4Q4JB 2ONKA 2GEVA 4DIDA 2ZRCA 4NCJA 1U90A 5JEEA 2EW1A 2V6IA 3ZVMA 2UVQA 4V0NA 1IY0A 2J9RA 4DSUA 1ZJ6A 2VBCA 3FGNA 2R6FA 4X8LA 2ZRIA 4I1OA 1X1SA 1XEXA 4HAVA 4TMWA 1L4YA 1V43A 2EYUA 2OEPA 2HV8A 5HKKA 1QF9A 2ZITA 3B2EA 3P26A 1M7GA 2IT1A 5LDDC 2ZU6A 3KB1A 3NBXX 2V54A 2G6BA 2Q0HA 1KNXA 3OIUA 2WIAA 1OIXA 3C8UA 3M4YA 3KKNA 2BKEA 5BYJA 3K70C 1MH1A 2CMKA 4Z8XA 1TUEA 1YHNA 4OI1A 3C5CA 3SQXA 4AKHA 1ZM7A 2HT6A 5FOSA 3T1VA 4F7WA 4QL3A 3GLFB 3IEVA 3AVWA 3BH7A 1GL6A 3NHBA 3BFXA 1G3QA 4QHTA 3RSOA 4JL8A 2GTPA 2ZS9A 4OQLA 5J4YA 3KQNA 4PAMA 3RWMB 1NY6A 3PUWA 4PQRA 3TH5A 2VHTA 4U02A 5A0FA 3CR7A 4BZPA 3T5GA 3PJRA 1UBFA 1DAKA 2RMKA 1F6BA 4LHWA 1ZD8A 3PEYA 2FDCA 2WWYA 1OLOA 2IS6A 2EVWX 3UXMA 2W2VA 2EWWA 2ZRFA 2UZ3A 1Z0FA 3LBNA 4MUAA 1KGDA 3NDBB 1CR1A 3OAAA 1IXSB 3DKVA 2W0SA 1GL7A 5H68A 3K70B 1KOFA 3ZD7A 1EXMA 4L4UA 5TMPA 1XCPA 4EFMA 1G3MA 1SGWA 2PT7A 2G9NA 1MOZA 1JEEA 2PX0A 3AVQA 2ZIAA 1CJKC 3B9PA 4GOJA 3UPUA 2WJGA 3QKRA 1Z47A 4Q47A 1D5CA 1CIPA 2QSYA 2FN4A 3QKSA 2YJTD 2GF9A 1OH6A 4Q9JA 2QG6A 3AH8A 2WMNB 5FFMA 1NJFA 2DFKB 4K8OA 5LBIA 1KJWA 4BRUA 2Q3HA 1K8RA 1S96A 1KZ7B 1XMVA 2AL7A 3DEFA 2X2FA 1IONA 3DPUA 4YMSA 4LV8B 1KO5A 4G5QA 3AP1A 1LFDB 5GVSA 4RZ2A 5HE9A 4CYMA 5FBVB 1I4TD 3KX2A 2O0KA 4C0LA 1E69A 3H1TA 4XJXA 4DDUA 1HQYE 3IHWA 3SHWA 4XVUA 2R6GA 3NG1A 1OXUA 3K0EA 4ZKDA 3B78A 1XXHB 2J7PD 3RHFA 2NZ8A 2D4HA 1AGRA 6Q21A 1UEIA 1X8JA 5CLQA 1DAMA 1EK0A 2H1LA 2UKDA 1VIYA 1KI2A 3AB3A 1NIPA 2VL7A 2DFTA 4DT1A 1AGPA 1FNMA 3WYAA 1UDXA 5AWFC 2TMKA 1WQ1R 4NCNA 3ONWA 3BORA 1YZLA 4PZYA 2A3RA 1A82A 2PCJA 1N6HA 1KKMA 1N5KA 1K6MA 5DYGA 4PPNA 3RS4A 1E9EA 3EIEA 3QEOA 1GKYA 1DAGA 3OIYA 2F1RA 4WW0A 3E1SA 1NLZA 3CH5A 3QQ5A 2D74A 2ZE5A 4B32A 2GDJA 1R4AA 4C0AC 3R20A 5G3ZA 3LW7A 3GLGB 4N3NA 4LBWA 1S4QA 2DWOA 4BZQA 1RYHA 4FWIB 3B8HA 1W2GA 5JS7A 3W3AA 1G7CA 2NO9A 3GD7A 1BMFD 4FINA 1XZPA 1RRPA 3N5CA 5KPJA 4QXAA 4HB4A 3W8NA 2NO7A 1DG3A 2ORIA 3X1YA 4LPSA 4NYIQ 3EPKA 1KO8A 1M74A 2PBRA 4WAUA 4URYR 3W5IA 2KBEA 2Q9BA 5JRZA 3GEIA 1E0AA 3VNVA 3ZS8A 4PO1A 2JIZD 2AN9A 1PUJA 2B92A 2REBA 1NLFA 3UG6A 1JXOA 1VMAA 2F1IA 2ZRPA 4DJTA 1BH2A 4WOPA 4AYWA 4LHXA 4DSOA 3UMSA 2JLVA 1P4SA 2J1LA 1VCIA 1E9RA 1E2KA 2AKAB 2OBNA 3KQUA 3GQBA 2ODEA 1E79A 4I4LA 4TYPA 5EP1A 2VYFA 4XWAA 2OBLA 3VU9B 5B30A 2C04A 4JYCA 4TQ9A 2VF7A 3DM5A 3THWA 1EX6A 1EG7A 1ZC4A 2ZJAA 2HJVA 4ZO4A 1P73A 5HE8A 4DCUA 5LD2C 1H65A 1XXHA 4P4SB 3JZMA 1WXQA 2D62A 3W34A 1E2MA 1PVOA 4B3CA 1EESA 4KYUA 4WXRA 4DBLC 1JPNA 2BOVA 2RGGA 3GJ8A 5FBQB 1G6HA 4MRNA 3GJXC 2PCLA 1WDTA 4A0HA 1YR7A 2AWNA 3K09A 3C5HA 3GFPA 1NI3A 5JS8A 4HLQB 2EFDB 2YV5A 3NBYC 4IOJA 3IQWA 2RGCA 4E03A 3TJZA 3A1WA 5SZKB 3CPJB 3NKVA 421PA 3ECCA 3PENA 1KZGB 2H18A 2J5XA 4M1TA 3RYTC 4DLXA 3BH0A 3QXJA 3U6KA 5EE9A 2C5LA 4TN1A 5G3YA 1U94A 1OKKA 3ASYA 3FTQA 2XITA 5HKKD 1QHHA 2CCGA 4G5GA 2N42A 2D7CA 4RD3A 5KU1A 2XXAB 2MSCB 4JLVA 1AZTA 2AXNA 3B1WA 3GJ3A 2VA8A 3CPEA 4HEJA 1G64A 2WICA 3W8RA 4LYHA 4IOMA 4P32A 1TQ4A 2J0VA 5AUQA 2YWHA 2X19A 4TMXA 4Q1EA 2GRJA 4GT1A 4QKQA 3KQKA 1KK2A 2GXUA 1TL7C 3SZRA 4BGDA 1MKYA 2BEJA 3X1XA 1KI1A 2WKPA 1A7JA 1NVWQ 3B85A 121PA 1DELA 4DLVA 2BKUA 4U00A 1VYVA 3EG5A 2QBYA 2NZJA 2ORVA 4A8JB 4LX0A 4OQXA 5AUNB 4EFLA 3R7WB 3EWSA 1NN3A 4DDVA 2A30A 2CLDX 4YDHB 2KJQA 4C0KA 2PJZA 5FTKA 4B2PA 1PZNA 3KZ1E 2BJWA 1XMIA 1YJ5A 2WJYA 2N1BA 3T15A 3TSZA 4LHVA 5FTJA 3SYKA 2G77B 4A9AA 1JPJA 2QTHA 4TMVA 1SXJC 1HT2E 3WYGA 3BC1A 2XEXA 2HCJB 2V55B 3OESA 1GNRA 3LXRA 2GJKA 1YKSA 4IVQA 2ZETA 4F93B 1Z5ZA 5BWMA 1FZQA 1Q3TA 5FL7D 1NN1A 4DUGD 2IYXA 3TUJC 4ZV4A 2XSZD 2JLUA 4MRPA 3U60B 2ZRAA 1CP2A 4II7A 4DHEA 4TYNA 1E2EA 2KBFA 4O0MA 4M9SA 2IS1A 2JIZA 4NTZA 1XTQA 2BCGY 2WWIA 1X8KA 2BV3A 5DHFA 4R7ZA 3RRNA 3CWZA 1FW6A 3AKCA 1W4CA 3ETLA 3AP2A 3NEYA 2PT5A 2C99A 3WRYC 5AJYA 2VP4A 4IVRA 4KI0A 4B3DA 1NMYA 1KI7A 3W3ZB 5JZVA 3EX7C 2DR3A 4EUNA 2XNDD 2HYIC 2FEMA 1E9AA 2NQ2C 2ZUCA 4TTPA 1AIPA 4HDOB 1KI8A 4UNQA 5KNDA 1XMSA 4Q1BA 2O5VA 1VHLA 2W0MA 1GP2A 1SXJE 1Q22A 3OE7D 8OHMA 3OEEA 2FPKA 2OCYC 1I2MA 2IF2A 3TR0A 5JHGB 2CLSA 2R62A 4IRUB 4R9UC 1IBRA 4LDJA 4D4LA 1QHIA 2C78A 2OXRA 1OE0A 4MKHA 3SE0A 1M6NA 4W5WA 4NYJQ 4G5OA 1VKJA 2OFOA 3CPHA 2VP9A 3RRYA 4AY2A 3O8BA 2QMOA 4IW3B 2G83A 5JHHB 3WMGA 3I61A 4YMVA 1ODFA 1YZUA 5KO2A 1XPRA 4WZAE 3X1DA 1IHUA 3UKDA 4Q4JA 3VR6A 4EPRA 3D31A 3PEVA 2JASA 1TUIA 4KODA 2FSGA 1COWA 5CLLA 4CDGA 2V1UA 3ZQJA 1J90A 3A4NA 2QMUA 4PAOA 2P2LA 4RD0A 2FJUA 1P60A 3TSWA 1ZVQA 1Q44A 4H1VA 4IFEA 2PEYA 4HDQB 4NMMA 4DLRA 2QN6A 1EFCA 3A36A 2ZJZA 4URXR 5CM9C 2FWRA 4CEHB 2IW3A 1SXJD 2ZPTX 4TMZA 4OHYA 5JJKA 1EFHA 4OI4A 3AM1A 4DLUA 3PUXA 2JLRA 4XVQA 2J0UA 4G01B 1E2JA 1CXZA 1Z2CA 2QE7A 4QNRA 3KFXA 4QJ4A 1QHGA 4BQSA 2O8BA 3B1YA 4OL0A 1G17A 2P67A 2KSQA 3QEJA 1DOAA 3KJIA 3GP8A 3K0AA 2Z4SA 1ELOA 1G1MA 1MABB 3LX8A 1HURA 3BS4A 4M22A 4Q01A 1OPXA 1WMSA 2F9MA 3AP3A 4EJSB 1R5NA 2J46A 1E9FA 4BLTA 5FL7A 4DUGA 3TR5A 2UZIR 4XTCS 3IIKA 4M4SA 2Q6TA 4BRWA 5F98A 1ZCAA 1E4VA 4B6FA 2FEOA 2VQSA 2YKGA 3A8TA 4C2UA 2H17A 1R2QA 5C2JB 4IDQA 4B76A 2P5TB 2A5YB 1M7BA 2RGNC 4LSGA 4Z51A 4UQOA 1OH5A 1W48A 4D25A 2AXPA 2ZR9A 3I73A 4K46A 5J47A 2C95A 3HU3A 2E9SA 5FI0B 2RH5A 4LHZA 1W5TA 1XBTA 3PR1A 3K9LA 3TKLA 1UPTA 2CE7A 2V7QD 3QKSB 4BFXA 3NH6A 2H8KA 2O8CB 2O8BB 1KY3A 2PZFA 4LY6A 1GSIA 3RVBA 3VR4A 5L3VA 1IXRC 3RRMA 4QGAA 4JVNA 2C2HA 4FXPA 3MAAC 1BYIA 1P2VA 4EFNA 3CBQA 1YVDA 4QM7A 1UAAA 5JWRA 3AKYA 1P3JA 2CJWB 4F38A 1R6BX 4GDFA 3TMKA 1TADA 4GOKA 1N6PA 2J87A 3ZYCA 2REXB 4ZI3A 2QE7D 2FFHA 4D4JA 2JA1A 2YNMA 1Z06A 1TF7A 1OIVA 3GLHA 1FX0A 2ZE6A 5UKDA 5IK2D 4ABYA 4N1AA 1MRSA 5LD2B 1FNNA 2PMDA 3QXHA 2OESA 3V9PA 521PA 1RRCA 2VP5A 3NBFA 3MD0A 2WAYA 2HF9A 1II8A 1ANKA 1WBBA 3I3SR 2AX4A 4TT3D 1IN8A 4OHXA 3LQRA 2JATA 2GEUA 2HLDD 4Q03A 4Q18A 2IHBA 5G53C 3SHFA 3EZ9A 1E2DA 1CKEA 3M6AA 4KLNA 5AJWA 3REFA 1E0KA 1VIAA 2QM7A 2QROA 1SHKA 1A2KC 1E98A 2ODWA 4NYJR 1N6KA 4BFSA 4QBGB 1Y3AA 1GKIA 2IXFA 2O8CA 3AVOA 3K0AB 1G8PA 1N2CE 3SBEA 2G1JA 3MCAA 5FPSA 3F5FA 2QT0A 4DEXA 2P3SA 1J8YF 4JSTA 4Y0AA 2IUUA 5FBRB 4BFVA 1UKYA 3MRSA 3TNFA 5FOXA 3PUZA 2J41A 1KNQA 3N2IA 4YC7A 1KSFX 2B21A 3B1VA 4I1UA 1LB1B 4ACBA 3GLGA 1T0HB 1ETUA 2ZROA 1E4YA 2H92A 3Q8XB 3RS3A 3U3RA 3D7MA 3KJHA 2W6ID 2OM2A 3LWNA 1LS1A 1XJQA 2WJVA 4XIGS 2YWFA 3CRW1 2RKOA 3LV8A 1W2HA 1SHZA 4PC1A 3BERA 1XD8A 2HUPA 1XPOA 2ZYTX 5FI1B 1KKLA 5EXXA 1AKEA 2W00A 2F3TA 3AVPA 3I1FA 4CGZA 4JL6A 5B58C 4E07A 1W47A 5FPHA 1BIFA 2V6JA 3PUVA 5TARA 5KOYA 5JJLA 4LBYA 3VKWA 3G0HA 3Q7QA 3IGFA 3QSYA 3TUZC 5AUOB 1GNQA 3WNDA 1FTSA 2NPIA 4MGIR 4Q9KA 4CW7A 5C4MA 1DAHA 1FMLA 1GRQA 2GNOA 3I8SA 3RABA 1O3YA 5DI3A 3L8YA 1EFRA 4UNSA 2VSXA 1BOFA 3DHWC 1Q12A 2Y8EA 4AIIA 2VP6A 4FCTA 4TLDA 3U7EB 2I3BA 3A4LA 2ZRJA 4B43A 3MSXA 4B3GA 4AYXA 5AUPB 5D3MB 3IPYA 4JLJA 3IBGA 3DOFA 4AG5A 5E95A 2YOHA 2JJ1A 4RD2A 4UXJA 4HUTA 2GESA 5H8WA 1UKZA 3TQFA 4BLSA 1XX6A 3KXLA 1JB1A 1AQYA 3LDAA 4KVGA 2V9PA 1PLJA 4TYYA 2R9VA 1II8B 2WPDA 1OB2A 4DCSA 4B75A 2A5GA 4PHGA 2WV9A 2A5JA 4XH9B 1UF9A 1HEIA 3DMDA 1AS2A 4OBEA 2BJVA 4JLOA 1E9BA 3P27A 4FCWA 3KKPA 5K8IA 1DPFA 2RB4A 3QF4A 4W7SA 1LTQA 1YZQA 5DN6D 2JEOA 4DKXA 2MSEB 1VG1A 4FMBB 3U6BA 4P31A 1VG0B 2QPAA 1Q57A 3AV0B 3L8ZA 2ZS8A 3DDCA 5FOWA 1EFUA 1JR3D 2IXEA 1TTTA 1Z6TA 1F2UB 3QOFA 5HPYB 1JNYA 4HZIA 1WBDA 3UIEA 1NN5A 3DL0A 3GJ6A 5E7JA 4EPYA 5IDVA 1JR3E 3LXXA 5FTMA 3ADKA 3VR3A 3QVUA 4RD4A 4US0R 1R8QA 4NYMR 2XZLA 4GFDA 3QE0A 5KPDA 5CK4A 1HA3A 3MMPA 5JI3E 3OFNA 3BB4A 3L0SA 2WMOB 3EIQA 4TL8A 2ZI6A 2ZJ5A 1NBMA 4GSYA 3CB4A 1EFTA 1QBKC 5B57C 4Q9HA 3BOSA 2BMDA 3THYB 1G9XA 3U3KA 1W5SA 5IF9A 4V0LA 5EE0A 4HB2A 1KYIA 5CM8B 1FL9A 1G6OA 3CM0A 4BFUA 2WWWA 3CZQA 1ZM9A 4Z1MD 1C4OA 3GEHA 3WRXC 1E2IA 2ONJA 3RRZA 4GZMA 3ZZ0A 1D2MA 3AKDA 2FG5A 5EQTA 2Z0MA 1GG2A 3DKPA 3LH5A 3LRPA 3SJZA 5KDOA 2Z5FA 4BLPA 1YR6A 2ZEJA 4GZLA 1IJEA 2ZRKA 1E99A 2ZQ5A 3GMTA 1N6RA 2QRZA 1B23P 3FWYA 4BE7B 1OFHA 3PVSA 4QHSA 3A1SA 1NVUQ 1PV4A 1AZSC 3RS2A 1HT1E 4OYHA 3Q5DA 5CITA 1FP6A 1Z6XA 3UK6A 2QT1A 1LW7A 1ZM4A 1X3SA 2OCPA 2JDID 2VSOA 1N5LA 1CS4C 3LA6A 1OV4A 1N25A 1RZ3A 4IHQA 1DTSA 1NBME 4ON9A 4JJZA 1N0WA 4XOIA 3EARA 3QF7A 4O25A 3U3MA 3X1WA 821PA 2MMCA 4RJLA 1F48A 1XEWY 3L2OB 2QU8A 1XEFA 3IKJA 3VX3A 4KBGA 1AS3A 2QAGC 1CU1A 1P7CA 2HXYA 1Z0IA 4QJ5A 1Z6AA 4DEYA 2FMXA 1GFIA 5AK0A 4DB2A 5E4FA 3WBKA 4KO8A 3IQXA 4PSAA 3V00A 1LV7A 4NU0A 3SBDA 2GJAA 3IIJA 3KFVA 1F2UA 4A8JC 1K5DA 4C7OB 3EC1A 1X1RA 3C4JA 3VMFA 3CX8A 1TQDA 1Q1ZA 2FSIA 1PJRA 5HTKA 3C15C 2DHRA 3DZ8A 3GJ0A 3I92A 3CO5A 1OKKD 3A37A 4KSBA 3K70D 4JLNA 4QHYA 4GP7A 4O2RA 3L0OA 2IWRA 4URVR 1Z3IX 5DNYB 1G8GA 1SKQA 1G7TA 2DB3A 4A36A 3QXSA 2Q3FA 2ZJ8A 4Q7JB 5FOVA 1KO7A 1R0ZA 3R9XA 1XJCA 3VQTA 3GPLA 4D4MA 4NP6A 4GMXA 4NL4H 4B71A 3T61A 1E9DA 4HLCA 1U9IC 1W0KD 3QUSA 5BYKA 1XXHE 5DN6A 2QTFA 1RFLA 4JKIA 1DBSA 4Q1CA 1R5BA 1XF9A 3ZQ6A 4Q7LA 2EFCB 2G88A 4X8HA 3BAFA 5FL3A 3VTKA 4EJSA 2XOKD 3CONA 3QXCA 3MJRA 4V0KA 5EZ5A 1KSGA 2FA9A 1NVXQ 3AGQA 2KI5A 4RY2A 1NVVR 3QKTA 1Z28A 2O8FB 5BQ5A 2ZANA 3RLFA 2GK7A 3T1TA 2Z83A 3BWDD 1CJUC 5IHPA 2GBLC 3AUYA 3CF0A 5ANRB 3QG1A 2DCUA 1Z63A 3KDSE 2CK3A 4TMKA 5TV2A 1MO5A 1Z07A 1Q1BA 3GJ4A 3NEJA 1IY2A 4Q9LA 3TVDA 2IBMA 4A0FA 1O87A 5BN3A 4LI0A 3FDIA 5JSZB 3OEED 2HCBA 2OUKA 1IN4A 2LKDA 3FMFA 3NBZC 1HE1C 1FP7A 3AUXA 4EJSC 4XD7A 4RCZA 1DG1G 2B7BA 4V02A 3DM9B 1N5JA 1YQTA 4DLZA 4L5BA 4B3FX 1OYWA 3M0EA 2IUTA 3GJ5A 3SFZA 1UBGA 2OZEA 2P6RA 3FMIA 4V03A 4MRVA 4A2WA 1N6IA 4Q21A 4GL2A 4PO8A 4PQYA 4MKGA 1S8FA 4TWZA 1KSHA 3K53A 4JMPA 4MDFA 1XMJA 1HY3A 1T5LA 2RAPA 3IUYA 4L9SA 3JVUA 3TBKA 2ZR7A 3MWLA 1W4BA 5KSPA 3K0CC 1XEXB 2C9OA 4LHYA 2QUZA 4Q4HA 4D82A 5JCPA 1TEXA 2CHVA 4KCGA 2JLSA 3LO5A 4LZZA 1A2BA 4PPFA 4D2IA 3C14C 1QVRA 4TL9A 1B0UA 2AR7A 2O8FA 1G5TA 2ATVA 2A5DA 4JLPA 5P21A 4B2LA 2HF8A 2PX3A 2ZRGA 3W5JA 4MYUA 4TZ0A 2NO0A 3K0FB 5BXQC 1DAEA 1T6NA 4W5JA 5FUWA 2CL0X 5TDHA 4FMCB 5EE5B 2ZJ2A 4B48A 3SYNA 1TPZA 2J7PA 3ICEA 3ASZA 3BRWD 4W9MC 1EWRA 1XU4A 3GFTA 4IEIA 1W49A 2GXSA 2QY9A 4J0QA 1L7VC 4M9QA 1E2LA 2YZ2A 1KI6A 1ZNZA 3I32A 4RKFA 1EFRD 2WWFA 1HE8B 3LLUA 4LUCA 2XB4A 4EKDA 4HATA 3UATA 2QRNA 2R6DA 1OXXK 3IPXA 5GJCA 1NIJA 4RFVA 1HUQA 2GILA 4OHVA 3TW8B 2QI9C 4B33A 2KE5A 2F1JA 4TT3A 5HZHA 4TQAA 1X86B 2CL6X 3FYHA 1T3SA 3IO3A 2ZXUA 1CRPA 2ZYUX 5JLJA 1N6LA 3CRQA 4KHZA 1XTJA 2D3WA 4ITRC 5AR1A 1N6NA 5BW8A 2HXSA 1T0JB 2AK3A 4UXIA 4ZIRA 2ZI4A 2ZSFA 5JBQA 3K09C 3AVXA 1GM5A 1WA5A 4JLMA 3VR5A 1E0JA 1Q3HA 3B1XA 3G5UA 5FR2A 5J5CA 1KDOA 3S1AA 2ZRBA 3QI2A 3PIRA 4JBWA 4DDTA 1ESMA 1T9HA 2AD1A 4FWTA 1KMHA 2ZREA 5CB8A 1XTSA 3GLIB 4DVGA 5CDFA 1FTNA 1U81A 3AEZA 4LYJA 3CH4B 1I2DA 2ZSBA 4AC9A 1N5IA 3FHCB 1CJTC 2GWHA 4ARZB 5L3SB 2QAJA 4L8GA 1M1YE 3FKSD 1OF1A 4B44A 4B6EA 2BCJQ 3F3YA 1M2OB 2QQ0A 4JVLA 3AF3A 1OIWA 3CRVA 3I72A 4CT5A 4PAQA 2FZLA 3BH6A 3K9NA 1KK3A 3IDQA 3CF2A 3H86A 2PZEA 4UNPA 3CRRA 1SKYB 4URWR 4TYWA 4AKIA 4B3XA 5K8UA 1Q20A 2JGNA 1ZMXA 2XNSA 1VDZA 4A8JA 3PCRB 1UBEA 4ZIRB 4DT1B 2XAUA 1MT0A 4MKIA 3SC3A 3FFAA 5HCIA 4HLDA 2W2XA 4TL7A 3VR2A 1OH8A 4LJ4A 4M1WA 2Z4RA 4I1VA 3N70A 1QDEA 1WF3A 3ZJYA 2ECKA 2RHMA 3LX5A 4TL6A 5ELXA 3QENA 5DI3B 1MV5A 1L8QA 1KI4A 2VHCA 3C16C 1KMHB 1SVLA 1UJ2A 1PLLA 3HR7A 2GVDC 5D3MA 4EPVA 4RZUA 1W4AA 1VYUA 5A4JA 3IIMA 1CTQA 3IBYA 1T8UA 2L0XA 3B7GA 3VX4A 1KMQA 2QL6A 4N0DA 2EFHB 3TIFA 1SQ5A 4LWZA 1XPUA 1V5WA 1C1YA 2V7QA 1KAGA 5EUQB 2F9LA 4JVMA 3SQWA 4QNMA 4C9BA 2IX3A 1IM2A 1L4UA 1AK2A 2JDIA 1YZNA 1OFUX 4Q4AB 1P9NA 3I5YA 4OQNA 4ZDWA 4B2IA 3THXA 3GCGA 1F2TB 3T1OA 3F0TA 1M34E 1Z6GA 2P6NA 4YXWA 3PEUA 4LC0A 2GJSA 4M1KA 4LRWA 3SN6A 2FSHA 2WM9B 2ZUDA 2QGZA 1CBUA 2SHKA 1JAHA 4YQFA 1DAFA 4R2HA 1IN6A 3S1AB 1DS6A 2OFWA 4G0NA 5K8TA 1JR6A 2GVZC 1OJLA 3OIWA 1GOTA 4ERNA 4F4JA 2XJ9A 4TMTA 3EZ6A 1GRRA 4HLUC 2OE2A 3SNHA 5KSZA 1TAGA 3WMEA 1JJ7A 4RSGA 3AF4A 1MO4A 5J40A 4JSYA 4CVNA 4BFWA 1XTIA 1YZTA 2NO1A 4LYAA 5G40A 3B82A 3GLFE 4RD6A 5CJ2A 4YMTA 2QSZA 2ZAMA 4O2LA 5EE1A 4D80A 4TLCA 2ASEA 1IQPA 2KB0A 1Q21A 4AG6A 1G4UR 3AGPA 3BXZA 1KTVA 5AJXA 4Q1AA 5FPYA 2P0EA 4GP6A 2JCSA 1GITA 3L82B 4GPTA 1XJ0A 2ORWA 1OFTA 3QPWA 3EW9A 1TEVA 1QZXA 1TQ2A 2PMKA 4TLBA 4DXAA 4N0EA 1M7HA 4NYMQ 2CL7X 1NBMD 1QG2A 1LF0A 3TSOA 1DO0A 1ZNXA 3X2SA 1ZUNB 2YHSA 2QP3A 3L0PA 2OCBA 4MGYR 4QG7A 4XTRA 4KLZA 5FPKA 4PC6A 1WCV1 4NH0A 5JMTA 1XRJA 3OZXA 3GJ7A 3LW8A 1P5ZB 1KDRA 1DEKA 3HYTA 5E7MA 4WXPA 3V4RA 4UXHA 3GFOA 2ODNA 3U44B 2K5UA 2D06A 4WZBE 4PHTA 1FQKA 1G7SA 4PZZA 4B3BA 2ZJOA 4RVCA 1U98A 2C9CA 5L3QB 3R9WA 2FE4A 3FKSA 3U7FB 3PITA 2GCOB 5CJPA 2VEDA 4PPQA 2RGAA 1TF2A 1E96A 1KI9A 2DFLA 2QEQA 2ZI9A 1H8HA 3QBTA 2IYVA 4AKEA 5AJVB 2XB2A 5KDLA 2A7QA 4LJ6A 3KUCA 4IVPA 1H8HD 2YYZA 1XCGB 1AA9A 2CCKA 1IJFA 1HYQA 5F9FA 1FQJA 2A9KA 4KU4A 3GLHE 2W58A 4WVFA 4CRWB 4DIEA 1NNEA 1CR0A 3HU1A 1TNDA 1KDPA 1YRAA 3LVQE 4CEJB 3WP0A 4DLTA 4NPHA 1ZNYA 2P6UA 2B6HA 2JJ1D 1YU9A 1QVAA 1D9ZA 4OHZA 1RRGA 1RW4A 1AS0A 4TYQA 1NRJB 1ZW6A 1CR2A 1G4AE 3NC0C 4Q02A 1J2JA 3K0SA 5TXGA 1A4RA 1SVSA 4IEEA 4NBSA 2PH1A 2H7VA 4Q1DA 3P20A 3P1JA 4NYIR 4RZ3A 2AFIE 2F7SA 3TGPA 1WB9A 2GCOA 1TQ6A 1JR3A 5TB5A 2C8VA 4WA7A 1GIAA 3VKGA 2IA5A 2BHRA 2YVUA 3TW4A 1TU4A 2D2EA 5LB2A 4MRSA 1RE0A 1KK0A 1RPZA 4KFSA 1P2SA 4V0ME 2W6IA 3ZDQA 5HR5A 4KVAA 1YZGA 3UWKA 4TSFA 2VF8A 5DLQC 5J4VA 1G3UA 4HUQA 1Z6YA 3WY9A 3A4MA 1E2HA 3TRFA 4EIWA 1E6CA 2IUSA 2PL3A 3KJGA 4M21A 2Z43A 5JFGA 1QHYA 3FMPB 1A5TA 3UMFA 1JJVA 4JJKA 3GLHB 2QMHA 2F55A 4A6PA 3ZGXA 1U0HC 4X8MA 5L3QA 2OLJA 4QM6A 1UFQA 4ZPXA 1XP8A 2YINC 3TK1A 5J4HA 1Z2AA 2IYYA 5H1YA 4LJAA 4F4CA 4F92B 1Z0AA 1YZKA 4EPXA 4D4KA 3RSLA 3H2YA 2D7DA 1CF4A 3LVRE 2EFEB 3OEHA 5EP2A 3U7HB 2NMVA 5FTLA 4DZZA 1II0A 3W9YA 1DE0A 5JJIA 3QPUA 4IDOA 3TE6A 2IWHA 3MUFA 3OF5A 3CLVA 3HYRA 2QQEA 4M1OA 5C46F 2XX3A 4JBYA 5K8LA 1VHTA 3DMNA 4CIDA 1Z08A 5CYPA 2CE2X 4KITB 3Q72A 1KI6B 3U3OA 4K81B 4TLAA 1GL9B 3W6PA 1DADA 1BYUA 3O8DA 3LFUA 2QTVB 2ZJYA 2X1VA 5BN4A 4KV9A 3Q3JB 3ND8A 2W6JD 1G5RA 2QORA 3A6PC 1EWQA 3SJCA 5EUMA 3SDZA 4HSEA 3RNLA 2CCJA 2CK3D 2BVNA 5L8VA 1XDBA 2IK8A 1G21E 3P32A 3T06B 2YWEA 3NC1C 5DSZA 4MGZR 4LJ7A 5CIWA 4B74A 2GBLA 2R65A 4EQ6B 4OK6A 3Q85A 2ZE8A 3RS0A 4DCNA 1GWNA 2I1VB 2QM8A 2P5SA 4ILEA 1D2NA 4LCBA 2VSFA 1IY1A 1W36B 3D8BA 4PSVA 4PZLA 4UNNA 4L15A 4UJ5A 2WTUA 2WOJA 1ZD1A 1AJEA 1TU3A 3HR8A 3CNOA 4HB3A 2QGNA 5DISB 2JLQA 2VO1A 4HUQB 4S35A 3FOZA 2VP0A 2NO6A 1E79D 2QP4A 3UWOA 3TUIC 1U9IA 2BC9A 4PANA 2OXCA 2WWHA 3FB4A 1W46A 2OLKA 4JL5A 5KNBA 3NXSA 1Z22A 2BDTA 1YRBA 4ZDIA 2CJWA 1MRNA 1SZPA 2J7KA 4FMDB 1D2EA 4Q1FA 4BLOA 2PLFA 1E32A 4D0LB 5FBLB 2AKYA 1DVRA 3RS5A 1U8YA 1UBCA 1DARA 2WPDD 3DOEA 3VKHA 1LS6A 1XD9A 1KDTA 1QRAA 1P61B 1SVOA 2V1XA 4EDHA 3LLMA 4MA4A 5KNCA 2W6JA 3VR1A 4D0GA 1KO4A 1P2UA 4HAXA 3SU8A 1II9A 1PLKA 3REGA 2CDNA 2FZ4A 1I4LD 1SULA 1VTKA 4A0GA 2GXQA 2VH5R 1PUIA 1BMFA 2X77A 2QPOA 1T4GA 5A5GA 2BBWA 4L9WA 1W36C 2O0JA 4XWKA 3QKUA 3ADBA 1T8TA 2OG2A 3BK7A 2OCAA 4A82A 3A58B 3EPHA 2A2ZA 2E1RA 5J4LA 2YOFA 4BEJA 2QENA 1Q1QA 3M1IA 1KY2A 1G8YA 1SVIA 1S1CA 2WKQA 4QC2A 1L2TA 4ZCLA 1M8PA 2CVHA 621PA 4QGGA 3ZVNA 1HQCA 4UNRA 3GLIA 1NMZA 3W90A 4BASA 1CRQA 5F3WB 3U2QA 1ZU4A 4QFMA 4FMDF 3ZS9A 5DO9A 3UMRA 1J7KA 3KKOA 4WBSA 1RYFA 3THWB 3IEUA 1D9XA 1U0LA 3BFVA 2JLZA 1GNPA 1R8SA 1H8ED 2GAAA 2ZI7A 3K8YA 2GEDA 1RJ9B 4G3XA 1G16A 1G19A 1CJVC 1KI3A 4PSKA 2GK6A 1KAOA 3HP1A 2FFQA 2IEYA 2ZJBA 4NONA 4X8OA 3SEAA 3ZD6A 4DRZA 2VHUA 3BD9A 4P0TA 3NHAA 4C0JA 1MO6A 1W7AA 2VRWA 4BFYA 4CT4B 3ZZTA 3GLGE 4KJZA 4E09A 1AKYA 5KSYA 4LJ8A 3CNLA 3VHLB 4A6XA 3ZZUA 3V4FA 4RD1A 1NVVQ 3GLIE 4HB0A 5FUYA 1E1RA 5CK5A 2ZM5A 1N6OA 1XTKA 4PXAA 1P9WA 4YXWD 4M8NE 5CYOA 4HAWA 3SI7A 4BUJA 1R0WA 4PR0A 2VP2A 4BLQA 3EA0A 3QBVA 4FCVA 2NPFA 1FUKA 1Y63A 4NHOA 1U99A 2XTZA 2J0QA 2IXGA 1E9SA 2RCNA 2JLXA 4OJQA 4YMUA 3PQCA 3EZ7A 5JWOA 4Q19A 1RJ9A 2OAQ1 4JLBA 1G8HA 4GBMA 1JI0A 1GZSA 2WJIA 2GA8A 2ZR0A 4PX9A 3DO6A 4HAUA 2FV8A 4Q5IA 3FKQA 3R7WA 1UDWA 1NG9A 2G1KA 4Z54A 1VYTA 4DB4A 3AVYA 2WWGA 1CEEA 1E1QD 1W44A 4DDWA 1NKTA 4M1SA 5EXPA 4AK9A 5E3HA 4OQFA 3CUEF 5C18A 2DFNA 2IC5A 1J99A 2BMJA 5CIQA 4MYCA 3OAAD 5CDFE 4KAXA 2ZSDA 1W1WA 2VHQA 5FH9A 1YR8A 2ERXA 3QF4B 1ZP6A 3JZAA 2R8RA 3MFYA 4E5UA 2BEKA 3RANA 2F6RA 3EXAA 1OXTA 3OEHD 3T1QA 3I5XA 4R71A 4F91B 3EPJA 4A4DA 3HWSA 5HCNA 5EE3A 3I8XA 1W36D 1AN0A 2ZVQX 1GDDA 3ND9A 4LV5B 1P2TA 4ZCIA 2IS2A 4NCKA 4M1MA 2ZAOA 4DSTA 1FOEB 4GOXA 4I99A 3ADDA 3ZIAD 2WOOA 2DY1A 2PZGA 4U5XA 1R0YA 2QBYB 4I1SA 3X1ZA 4QJ3A 4KXFB 4G1UC 1ONBA 3WHLA 4US1R 4URZR 1NSFA 1X8LA 1US8A 2GETA 1W0JA 4FW9A 2G0TA 4ASUD 3AVUA 5EP4A 3FMOB 2Q9AA 1CR4A 3A1UA 3FHTA 4C4PA 4JIMA 3A1VA 2WHXA 2CHGA 3KQHA 3THYA 1X6VA 2ODBA 3NWJA 4CEJA 2XTMA 5AJZA 2CNWA 2GZDA 2IHYA 5F9HA 3ZVLA 1C9KA 1UKVY 4KYIB 2ZUBA 5SZIA 1VCMA 3LY5A 4KFUA 3BB1A 5EXSA 4LBVA 5DE3A 2C9YA 4Q7MB 5CB6A 4MDEA 4JLDA 5J4KA 2I4IA 2AK2A 1HTWA 2W83A 3MWYW 2C96A 2REOA 3OFND 4HYYA 4NKRA 4BWYA 4ZI2A 2DWPA 2WSMA 2FGJA 4TTRA 2JJ2A 1QHNA 1JEDA 3L43A 5EJEA 2O0HA 3T35A 4P4SA 2QMEA 2O8EA 2Z6VA 1G18A 3EPLA 1GKUB 2ZU0C 5FOUA 1ZCBA 1SVMA 4HAZA 4H9GA 4OJKA 4P3YA 4B35A 1IAQA 1OB5A 1BKDR 4P4TA 2VLIA 3H84A 1US8B 3DVLA 4HZUB 3PV0A 1ZYUA 3RDPA 5GJBA 5D3QA 1Z0KA 2FFBA 2BM0A 3SR0A 2VPPA 5F2EA 3OHMA 1A1VA 4V0OA 2ZYWX 5GADl 2AD5A 1ESNA 1OHHD 4W5HA 1R0XA 1CJMA 4DC9A 1G7RA 1Z29A 3OIVA 4D0NA 2IEZA 1SVWA 2QPTA 2BIFA 4KSCA 3W6NA 2GAOA 3EIHA 2WVJA 3CX6A 4V0MA 5TY0A 3EA5A 3K0CA 1T5IA 4DWJA 4EAQA 2ANCA 5EXTA 2XZPA 1GILA 3ZVRA 2GF0A 3KB2A 5GJWC 2CBZA 3RWOA 3LAWA 1VECA 5DI9A 2XJ4A 3TLXA 3G82C 2Q21A 2RGNA 2WIBA 4I81A 2WZQA 3AF2A 4RCYA 4C3ZA 2VHJA 2CNWD 5JECA 5DIFA 1NY5A 3THXB 1SXJA 4M53A 2O8EB 2PLRA 4XWOA 1Z8FA 1BO6A 4OQMA 2YC4C 1EGAA 4DLWA 2I1QA 4M9ZA 1CLUA 4ZCMA 1E9CA 4JKYA 3VFDA 4JVSB 1XFAA 2BM1A 4MKFA 4Y0VA 2IYUA 2ZRHA 4G5RA 1E94E 3IILA 1IN7A 2X8AA 2PEZA 3LBIA 3ZH9B 4AI6A 4LC1A 4PC3A 1T3LA 3T34A 5KSOA 2O52A 2ZRLA 4PQFA 3U5ZB 1KJZA 1XB2A 3RAPR 3KUDA 2CHQA 3D3QA 1OFIA 3HPRA 3KXKA 1YR9A 1VCNA 4QRHA 3MGCA 2RHDA 2F1HA 5DH9A 1E2GA 1S9DA 1FPMA 2B8WA 4CEHA 1OXSC 5M04A 2ZRDA 2GZAA 4DSNA 4JYBA 3MLEA 2J3EA 1G3IA 3B6EA 3NIBA 4JBXA 2J45A 3KQLA 3CX7A 2GKSA 3EZ2A 1JBKA 2ZRMA 1TX4B 4OHWA 2XSZA 2ZYVX 4D6PA 5G41A 2YWGA 1JQLB 3PUYA 3AQ4A 1XD2A 1FFHA 1RKBA 1ZIPA 3N2EA 4IOLA 1IOZA 4BEBA 3BJIC 5JSZA 1T91A 2KWIA 1DO2A 3B9QA 4KFTA 4LGMA 1OHHA 1UADA 5JEDA 2NG1A 3CRMA 2RGBA 1D8TA 5JRJA 5KYKA 4C0HA 4HZUA 3KTAB 1P6XA 721PA 2AWOA 5IT5A 2P65A 1TF5A 2A78A 2FU5C 2AHOA 1Q1EA 2RGDA 1Z0JA 3K1JA 3LNCA 3QG5A 4UJ3A 4EPTA 1NN0A 1VG8A 1QHSA 2JJ8A 4GNKA 3K9GA 5JCZA 1ZAKA 3E2IA 3FE2A 2LCFA 1HH4A 1OH7A 4C0BA 2QZ4A 5LB4A 5L3SA 2QA5A 5GJVC 2IS4A 3NDPA 1ZRHA 4H1UA 3U44A 1U0JA 4MYHA 3EWAA 3WNBA 2XGJA 3O8CA 1NG1A 3BE4A 3NH9A 2DPXA 5FUXA 4FN5A 4IJMA 4PC2A 2JJ2D 1D6JA 4OKSA 4B34A 2FH5B 3SJBA 1SVKA 4EPWA 1MR3F 4GRAA 5LPNA 3H4MA 5IK2A 2E87A 2BMFA 3FVQA 3SFVA 4D81A 1QG4A 1NL3A 1SXJB 1P72A 2WJJA 2CXXA 1NJGA 2BMEA 2B7CA 3HU2A 3GLFA 2WSSA 2OFXA 4PC7A 4A92A 4S2EA 3QVVA 2R6AA 3QNUA 1E2PA 1E2QA 3TQCA 1NSTA 3UANA 4M0LA 4XVRA 2Q9CA 1TMKA 4POAA 4MQBA 3Q7PA 3CW2A 4IDHA 4PTLA 1U8AA 2FX3A 1SKYE 4QOSA 3L0IB 1N0VC 4IDNA 1QHHB 4RZXA 5SZHB 1NKSA 1ZBDA 3EZFA 3SOPA 2XXAA 4WIAA 4ESHA 1DAIA 2F3RA 3U7GA 4BZXA 3BB3A 3QJYA 2JLWA 5FUVA 2GCPA 1W0JD 2ZE7A 2ERYA 3CIOA 3FFBA 2GJ8A 4M9XA 3SYLA 4A2PA 4ZDKA 1FX0B 4Q4HB
chains in the Genus database with same CATH superfamily
1CY2A 1W0KA 1QX4A 3OKPA 4BFZA 3HN6A 4BKRA 4H60A 1JALA 4DIFA 3ZIAA 2XUZA 3KJEA 4EEKA 1T3ZA 2QRPA 4Q4AA 4GYWA 4ER0A 1VPWA 1KO1A 5ADUS 1K5GA 3REQB 4OGKA 3H0KA 2VTKA 4IOKA 4B6JA 1ISFA 3C3YA 1Q0UA 3ST7A 3RTCA 2G4VA 2H31A 1TYCA 2BW0A 3BTVA 2XVZA 5KOJA 2NIPA 4J16C 2X3UA 2DHEA 4ZO6A 3SMVA 1SUIA 1Y7PA 4IZOA 2A5FA 4AZSA 1GV1A 3T7DA 1XV5A 2ZT5A 4BZWA 3L93A 3K35A 2PG3A 5HJ7A 3DFZA 5KJEA 4CF7A 1UEJA 1ECPA 2A0FA 2AIRA 1XLWA 2JFHA 5DKFA 2LIVA 2QNRA 4LYFA 4HJRA 5IH3A 4ER3A 4HXYA 1OD6A 2X5NA 3OO0A 1M6YA 3PDIA 1LF5A 2HT1A 5IRCD 4ZI5A 4U6NA 1NP6A 2H6EA 2HYDA 5EZ6B 2IYZA 1GZVA 3MG9A 2OGUA 1C1DB 4NBUA 1QM5A 2QQ5A 2F4NA 2FUNB 3RYIB 2P1ZA 3QY9A 4ZOQI 3MS7A 4JYPA 2YMQA 1BCSA 2HPVA 3HPQA 2Y1OA 4Z0PA 3FJYA 1QPBA 1UPXA 1IRIA 1I0ZA 2INGX 2JI8A 4H7FA 3OUUA 4HDAA 1PW7A 4KO3S 5DGXA 2MMGA 3FBWA 2VK1A 4OK3A 4JEHA 1LWOA 3THOA 2FR8A 1IULA 2PWYA 3GT3A 3K9HA 4HWOA 4PFSA 4BNMA 4UE2A 4CU5A 4DAOA 2JGJA 5KZMB 4OY3A 5CA0F 1KQOA 2O3QA 3K9CA 4W82A 3VTAA 4JLKA 4YDSA 1LNZA 4IDDA 3UYLA 1I1HA 1QYWA 1W5BA 3K9QO 4HYEA 2A6PA 2YRFA 3IELA 2B82A 2C7PA 4YY3B 2QW0X 3NHLA 4O5OA 4HDCA 3PIDA 3TAUA 1V16B 4WVLA 1TECE 3HJNA 1O89A 3PEWA 2IP4A 1WETA 5BVGB 1I5RA 5K0NA 5KTTA 3K6SA 4QBHA 1I9CA 1T36A 2R44A 2A9RA 4KFRA 2PZKA 1WKVA 1ICIA 2R1TB 1KSJA 3NNDA 4BPRA 1T2CA 1AV7A 2KHZA 4JLSA 3RS8A 3H2JA 3QIAA 4Q48A 2QTVA 4S0ZA 2FZWA 1E3MA 3B60A 1E1QA 2YOGA 4ARZB 3CZPA 4QBIA 1ZMTA 4URUR 1KHTA 3HL0A 4QO8A 3ZXYA 2ZUSA 1KYVA 4ICIA 3P2MA 3TOZA 3O8RA 2WB4A 5H70A 1G8JA 4JT4A 2B8TA 5E4JA 1TYZA 2IYNA 3WIVA 5ARCA 3ZNNA 4CM6A 4G4IA 5M29A 4QPDA 3VAAA 3W5SA 5E1DA 4YMWA 3UCEA 1AG9A 1H8EA 3M6WA 5FYQA 5IM4F 2JA2A 4F1WA 1NLYA 2WWXA 4EQ6A 4DNFA 4IWXA 1SUAA 1WXWA 3O1HB 1CY7A 2WSSD 3U61B 4XVCA 1SZDA 1XNHA 4L5JA 2ATXA 5CG1A 3FHOA 2WIKA 5CVTA 3LKBA 4FYHA 1NURA 5LC1A 1XCMA 2MCFA 4A0RA 2FW6A 2FPMA 2CV1A 3RUDA 1D1QA 1UJNA 2XBLA 1XU9A 5AK3A 3LCCA 5AVWA 4WDRA 5EC8A 1ZUIA 1E2FA 1E2NA 1W1UA 2VF5X 4JITA 1F1BA 2CXHA 4YJDA 4YJ3B 1T8RA 4RFSB 2ZJFA 1T2NA 4I55B 5FOTA 1E4OA 3GZNB 2V4ZA 4UHDA 1P8AA 2PXXA 1NM5A 4PHFA 4HN2A 1D0SA 3PDIB 4LGVA 4P3KA 5ILQA 3R77A 4KRGA 1NBWB 1R6AA 4BMXA 4CODB 4H77A 3P2JA 4RKRA 4Y6PA 1UDAA 1FNBA 4KDEA 3B1KA 3QXXA 3TZCA 4E08A 2XCUA 1YD7A 3P4XA 4BECA 3P94A 3D6AA 1AKNA 3N8DA 1JIKA 3AO0B 3B6JA 4JFRA 4ZALA 1Z56C 3URMA 4BVHA 3F1LA 4IZIA 3HM2A 5DYWA 3OOWA 2E82A 1KAEA 2G0NA 3AG5A 1EQUA 1QQ6A 2J0UB 1XTRA 2OHJA 3E5HA 3OQHA 4NICA 4UNIA 3R8FA 4Q9IA 4DQUA 1P1FA 4RYDA 3VYWA 1P75A 4QDOA 1CP3A 5KOHB 2G6TA 3AR4A 3F5QA 3MINA 3AF1A 3DJFA 1GUBA 1W4RA 2W8ZA 1UBSB 3DBHB 4P4UA 4KI7A 5GVRA 4DSAA 1F2DA 2Y05A 1ACJA 4IXNA 3QH4A 5GM1A 2QLFA 1L1FA 3UB3A 3O26A 1R18A 2VIIA 2BN4A 1P91A 2ZVDA 4RSHA 1F5NA 4GE3A 1KWGA 3E70C 3B5JA 2XWSA 3JAWA 1IN5A 2B5WA 3EMDA 5FTNA 4BVKA 2QM0A 4G0MA 3LT4A 4QXPA 3LY7A 1E4EA 3RFFA 3K5IA 3AR5A 3QY0A 1GSAA 4ZP1A 1E0SA 3HVHA 1YJXA 1RM5A 2E2WA 2PR2A 3ONVA 4KXVA 2WD7A 2DQZA 4MUBA 5DYIA 5C9ZA 2O5RA 2XDWA 4NJOA 2LCQA 3GEEA 1CY6A 1U8EA 3BBPA 2NU9B 4HMPA 4H3KB 3FSGA 4O4LF 1U2DA 1A9RA 4NI5A 5ESRA 8MHTA 4M89A 3NOVA 3NPMA 3GGOA 1YCGA 2HBRA 2P62A 2EP8A 2WHPB 3KJZA 2R6CA 1GCAA 1LI7A 3HGMA 2M1XA 3MJEA 4U7DA 3RC3A 3PWSA 2X9NA 4JELA 1NXPA 2ZUWA 4P3NA 1K7SN 4DLSA 2A8YA 5JCOA 2MSDB 1L4GA 5COBA 1LVUA 5B2ZA 2UZ1A 2I6TA 2FETA 1D8AA 3ETGA 3GX1A 4MHTA 2C82A 1SD2A 2M6SA 1PR4A 1G60A 1P7YA 1VPLA 3DV0A 4ZVSA 1USKA 2IL1A 5J2TB 1RC8A 1JZQA 4RFSA 4WASA 1ZIOA 4DIKA 4J3NA 1BS9A 4LG1A 1Z4KA 4EITA 1TJ4A 2VNHA 3DW1X 5AW2A 1IHYA 1FEZA 2HIAA 3U48A 4K9OA 1XMQB 4JT2A 1BE6A 4C7OA 3NVAA 4RPCA 3BFKA 4RQTA 4POOA 1CEXA 1VFNA 4FE7A 4JOQA 1E1DA 4WQMA 2RBKA 5IULC 3TLBA 3QPVA 2VI5A 1IOLA 1XVVA 1KQPA 2EQBA 2UAGA 3O3NB 1A69A 4M87A 2OBMA 3RJMA 4EGQA 4EI8A 2F3UA 3GLKA 3PIIA 5B55A 3SHQA 2XMCA 4PU0A 1T6BY 2WBLC 4KOAA 2YVAA 3R0QA 4AT1A 1MAAA 3LFTA 3PXGA 2I71A 1DKRA 3NNSA 2DGDA 2FK7A 3C5EA 5DHTA 4A26A 1Y82A 5HZKA 1ZI9A 4ESVA 3UVEA 1TJPB 2X2EA 4G85A 1R7RA 1TZMA 1M2NA 4S0XA 3JARB 4UCFA 2OTCA 4X7MA 4OYLA 5H82A 3W4KA 4F72A 4DUZB 2HMSA 2BSQA 1SCBA 1T8YA 1USGA 3KVNA 1J8MF 2JAQA 3WSVA 2EIXA 3SR3A 5I7WA 2GBIA 4P53A 3AF0A 4R6WA 3SZMA 4MINA 3BMCB 4YDQA 2IDKA 3C41J 3FOWA 2RARA 5AJUA 4H6PA 1XRRA 5J43A 1R4ZA 2GEVA 4NCJA 3UB2A 3VU8A 3R3HA 4N01A 2V6IA 3JQ6A 1PYGA 4LVCA 3G7SA 2AZMA 1NT2A 4I2NA 2YJ4A 4YCLA 4RESA 1ZJ6A 1YE3A 1MDBA 4BUZA 2BI8A 4X8LA 2ZRIA 4JIGA 1E4EB 3QPAA 1XEXA 5DTIA 3OQMA 3COZA 2QTLA 3FPKA 1V43A 3NAZA 5IJ9B 2FPXA 2WF6A 2DY0A 4O6VA 2DXIA 3E53A 2HV8A 5HKKA 1J22A 4R1UA 3P26A 4I50A 4XI9A 3WVNA 5IKMA 3NBXX 1G4HA 4MUHA 1J8QA 3GGGA 1KNXA 3G2MA 2WIAA 3OIUA 3DUFA 3P9SA 1ZSYA 3IE1A 3HO1A 5DZSA 1TB4A 1X2EA 2E4UA 2VNJA 1N2EA 2OAGA 4H15A 4BMZA 5EKDA 1ZSVA 2NM0A 4I2VA 4K0KB 3OCWA 3EIUA 3K15A 3IAM1 1G2OA 3HUDA 4YS6A 1XYGA 1PD1A 2H06A 4OLBA 2IVFA 4FGJA 3OEYA 4F7WA 4QL3A 4H6XA 4WCDA 3BWBA 1VIDA 1GL6A 3BH7A 3PPWA 1J0XO 1RT9A 2JS7A 1ZPDA 4L3VA 1G3QA 4QHTA 2XNCA 2ZJ1A 5K4HA 1WXEA 4ALLA 1NY6A 1QIMA 4NABA 4A2CA 5E3IA 4TYYA 3D8RA 3STWA 4D3SA 3E5MA 3CNBA 5CFRA 1FMFA 2AI2A 1YRYE 4ZMRA 3UM9A 1L5SA 1XKQA 3R4VA 2ZVJA 2HK8A 5CCEA 1ABFA 4TV8F 2BL4A 3NIFB 1KAMA 1N2XA 2VN8A 3UTCA 2FXVA 3HR4A 2W2VA 3UXMA 4YB8A 1ZVVA 2FQQA 2ZRFA 1J97A 2HRQA 3CY6A 3D8SA 3P0RA 1PKXA 5MN4A 3QSGA 1P5JA 5FAXA 3UV7A 2EBWA 3TCKA 3X1KA 4DQLA 3NDBB 1CR1A 1A0OA 1IXSB 1QYVA 1QUEA 1GL7A 2W0SA 5H68A 2F4VB 5K03A 3BL8A 3QFRA 1D2GA 1ACLA 1TAHA 3G8YA 3K0BA 3KJNA 4HK4A 3RE1A 1YRLA 4QOFA 4FFPA 2BSXA 1GGNA 1G3MA 3PYLA 1JDPA 2PT7A 5J2UF 5KNLA 1L5YA 4XYGA 5AD1A 2FPPA 1CJKC 4O4HF 2JGMA 4Y2PA 2R47A 4RZHA 2YZKA 4PS0A 2W7TA 3EVEA 3FH0A 3SSNA 2QSYA 4UEOA 4HG2A 2I76A 4W8GA 2J48A 2FPIA 4QTZA 1O6ZA 1BMQA 1HWYA 1IB6A 1B1CA 3ITEA 3DVAA 2FE1A 4FDLA 3EUAA 3FUCA 1AE1A 4K8OA 3WL7A 3RJZA 1BD4A 1TM3E 1KJWA 1XR3A 4BRUA 3NAQA 4P0PB 5JH7B 1KZ7B 1FK8A 4OM7A 5K3BA 3STXA 1IONA 2QVZX 4U5QA 1KDZA 4JQYA 4YMSA 3UJBA 1H5UA 1Y7TA 4EH1A 5C37A 3DO5A 4RZ2A 5PNTA 3NI2A 4HWKA 5FBVB 1H94A 2PX6A 3KUKA 4OREX 1YWGO 2RB5A 5KTKA 2QX6A 4DLBA 3A0RB 1QQ5A 4DDUA 3SHWA 2R6GA 1L8OA 2GOYA 1R9MA 1Q77A 3K0EA 4PSDA 4WY8A 2A1UA 4BNUA 2HJSA 2J7PD 1U1EA 2VRCA 2XZDA 2ZWMA 3KE9A 4GQAA 3RHFA 3AY3A 3LK7A 4IIFA 3SBXA 2GD1O 4BNFA 3TGLA 5CLQA 1E7WA 5ED4A 5AVKA 1PGNA 1V3TA 1MIOA 3TFWA 4KN9S 2DEUA 3TOVA 3EZXA 3AB3A 2RDMA 3PTLA 2DFTA 4IY1A 3VOTA 2QB5A 3QYFA 4CN8A 2JIDA 4Y2SA 3NEPX 3ZBTA 3VTZA 3WYAA 4PFKA 4DWWA 1WQ1R 1YZLA 4OJYA 2A3RA 5KNBD 3W4JA 2NSHA 4PAGA 1KKMA 1DBIA 4TOIA 2GZ2A 2QLMA 3I6BA 5DYGA 3H05A 2FFRA 4HWSA 2A0UA 2F9FA 1ZIXA 1E9EA 3Q9UA 1O95C 4FDMA 3BDAA 5CVJA 2OVFA 1E1MA 3OVMA 1GKYA 2OY0A 1IUKA 1Y98A 4OOFA 5AQEA 2GD0A 3JASB 1LX6A 3FLBA 4WPGA 3H5RA 3T7JA 4PN3A 3T9CA 5CLJA 1MC5A 1NLZA 1X38A 2JI6A 5EJAA 3S29A 3A9CA 2VDWB 2GDJA 3HCRA 1JA0A 4C0AC 4GBGA 4PYOA 1SCNE 3O82A 4QEZA 1Q0PA 4IUCS 5G3ZA 2PAFA 1PD0A 3L7LA 3QWBA 4BQPA 1V8DA 4RHYA 1VSVA 2AFHA 4BZQA 1RYHA 4KGVA 4BTLA 4ROTA 3GD7A 2DUUA 1CJSA 1FUEA 2PDAA 4FINA 4RABA 1KEUA 3L49A 4XPZA 5AW5A 2P3QA 1ULZA 4G81A 1ZG3A 2JK1A 4KG7A 4JCCA 3EGIA 5KPJA 3PKZA 3AU9A 1DG3A 4UMVA 4LPSA 2Y6VA 2I7XA 2FFJA 4KR6A 3Q10A 2UXCB 3CMMA 3P0HA 3G9XA 4N65A 1K68A 2Q9BA 1R6UA 2ZDQA 4MGEA 5J5VA 2P4QA 3BBLA 4JJFA 1C4XA 3EOAI 3Q6MA 3QFCA 1Y3DE 4MYDA 4I5DA 2I5PO 3T7AA 3QI7A 5DCUA 1PUJA 1KR2A 3A4VA 3CVOA 2PZLA 2REBA 1DCKA 2Q5JA 2UVPA 3WKDA 4OSPA 4JH0A 3MT7A 2IX9A 4WOPA 2OPBA 3JATB 3UMSA 4N40A 1XCLA 2BM8A 3EBLA 4XE5A 1WEKA 2OKCA 4C14A 3G0DA 1DJLA 2C54A 2XKKA 1E2KA 1SOVA 4I4LA 2DUWA 3FNGA 2OYRA 4UFNA 5IVIA 3WB9A 4G8CA 3PXUA 2OBLA 2RHWA 3VU9B 5B30A 3QMWA 5GGYA 2C04A 5FEUA 3DM5A 4HDSB 1O94C 4J0CA 1ZC4A 1FRQA 2E5WA 2BZ1A 3WLSA 4B81A 3ISTA 1H65A 3LL4A 3QA3E 1KORA 5CX4A 4XX0B 1IOWA 3PC7A 1EESA 4B3CA 4DBLC 2JW5A 3U7RA 3JXEA 2RGGA 3AI7A 5A5DA 2R4QA 4PLFA 3P8ZA 5KNDH 2O7SA 1Z0UA 3ZK7A 2RHRA 2IZOA 1RAEA 2C2GA 2O2HA 4CUJA 2F64A 3GUCA 2G9RA 1PQWA 3NBYC 3UMMA 3E7PA 4E03A 4I1IA 1REQA 3TJZA 3UJHA 3QPCA 2AW3A 5EPEA 3PENA 421PA 3ZZMA 4X62B 2PXAA 3E9QA 3U6KA 3L8GA 3W5DA 1SXQA 1JDBC 3DXYA 5EE9A 5KNCH 4P7GA 2D2VA 2IDMA 2IU6A 3BG5A 4QXOA 1YAJA 2YFHA 3QLVC 3TOSA 2J9GA 1HKUA 2TRSB 3OX1A 1NX6A 2NSJA 2YWJA 3F67A 3V8QA 2IBSA 1MB3A 3E58A 2XKBA 5B12A 1YB5A 3KD2A 5KU1A 5LQUA 1E1LA 1Y3CE 3WA6A 2Z09A 4BYGA 3C6ZA 3B1WA 1C3OA 4Q3CA 2HBQA 1EE1A 2XB8A 1T5OA 2GJ4A 2QD1A 2WF5A 4FOPA 1N5DA 1LTKA 4HEJA 3ZJ4A 3CVVA 4IOMA 4ZCPA 1TQ4A 3WAGA 3C6KA 2Y0CA 2X19A 4N39A 2FVYA 2JHAA 4EVSA 1KXZA 3PNBA 4MI9A 1TL7C 1FFSA 3JX9A 5IKPA 3MF4A 3X1XA 3IULA 1KI1A 2VZ9A 4X1IA 3K0KA 2WKPA 1NVWQ 2HMTA 2ON6A 4CCYB 4AQDA 1DELA 2Q4TA 3LE8A 1UBTS 5M2QA 4BY9E 1JG6A 2BKUA 3N59A 3EG5A 2QBYA 1FFWA 1T4CA 2HZ7A 3EDQA 3R24A 4WZAA 3UOWA 2ORVA 2FR0A 5AUNB 4EFLA 3ZV6A 2D5LA 2X15A 2ODTX 3MOSA 1O96A 2KJQA 2B2XA 4XIIA 5AHRA 4B3JA 1A8SA 3IMFA 2HRZA 3D5TA 4UASA 2TS1A 3EG9A 5FTKA 4BVGA 2QZSA 1XMIA 2WJYA 1GN9A 2N1BA 3T15A 3FLMA 2AH5A 1K0UA 2G77B 1WUIS 3AXTA 1KQFA 1RYZA 2GTHA 1AY0A 2AFIB 2QTHA 4FZRA 3HCOA 3PVZA 1KRWA 2XEXA 2WIDA 4EY4A 4GOMD 2V55B 4FKZA 3R7FA 3LXRA 2R0QC 1T9KA 1JFLA 1ZK1A 2W2QA 4MEBA 4RXMA 4D79A 1TUGA 2FCRA 4AXBA 4ND5A 4NBNA 3FTNA 3H8VA 3QIVA 5FL7D 4G0UA 1HOXA 4QUBA 2W37A 5FTWA 3SP1A 3DD5A 4HKTA 2GPSA 2JLUA 3GZTB 1K8ZB 2ZB2A 1CP2A 1CSEE 4II7A 3TAXA 3AR8A 2YS7A 3GZJA 1EKXA 4JBLA 1RYYA 2KBFA 4JYMA 4BVEA 3ZWMA 1UC4B 3L4EA 1WDMA 1Q17A 5LP6C 3UO8B 5MN6A 2BV3A 3COYA 4LF7B 2GO7A 4P58A 2EV9A 1H5QA 2MT9A 1FW6A 1LBSA 4F2GA 4EYQA 1M2KA 4M0CA 3UY4A 2HWKA 3ENQA 2IHJA 2YVQA 4G0QA 4YBRA 2OD2A 1O6GA 4PNZA 4B09A 2XCIA 2E4AA 1DRVA 3PUKA 3CC8A 3NCHA 5LP6B 1OWNA 3VOBA 2YY6A 2G9ZA 2PM8A 3WSTA 2FWIA 3JYPA 2NPOA 3AYXB 1KI7A 3W3ZB 4V2UA 4I4CA 4EUNA 1SPBS 3GB9A 3THRA 1F0NA 2XNDD 1EWKA 2P40A 1RXUA 1Y37A 2NQ2C 5ALJA 2ZUCA 1L7XA 1ZBQA 4HDOB 3HJHA 1P3DA 1YC5A 2I4TA 1EP3B 1KI8A 2FSUA 3S4YA 1WXGA 3JS5A 3TSCA 1Y6RA 3HKCA 3GJSA 4RTMA 1J49A 3LUJA 3WLHA 4IVNA 1Q7RA 1GP2A 2PX8A 8OHMA 1RBQA 3PLRA 3O21A 4YFVA 3VVCA 4IRUB 1LPAB 4EF5A 1IBRA 2PZBA 3M1LA 4AP9A 3DF9A 4MQ4A 4DC1A 1JSRA 4W5WA 4C5AA 2QN8A 1K6IA 3I42A 1XQVA 4INAA 4CIVA 2VP9A 1V7QA 1F7VA 1IBKB 3HFRA 4IQFA 4Z0TA 3WYCA 1Z34A 2GEFA 1E8DA 4IW3B 3I61A 4LF6B 4UUBA 3BD6A 4YMVA 4JUDX 1JXQA 4TKZA 4WZAE 2OG1A 2C29D 3X1DA 4W6ZA 5DASA 4IHAA 5F1OA 3EDYA 1Y1QA 4Q4JA 3UXYA 2O2YA 3KWFA 1RYMA 4DR2B 1YJCA 1CC1S 2VHWA 3PEVA 4RIHA 1M2VA 1UL1X 2FSGA 3T5MA 3AEQA 2V1UA 4EKEA 1UAYA 3A9SA 1J90A 3A4NA 3EUFA 1CRZA 5ALSA 5JYDA 1AQJA 2IJGX 4ND7A 1R50A 5KMGB 2NSLA 5JCOC 2HGZA 4RD0A 1VRWA 2FJUA 4L6CA 1N3YA 5BW6B 2W2KA 3G0IA 3SLRA 3TLJA 3V1YA 1MA0A 5BN1A 1QOPB 1ECGA 2LP4Y 4PINA 3W3AD 4FBMA 4CFYA 3WLTA 3GCDA 2P2YA 5K0JA 4HDQB 1EFCA 5AHKA 3C74A 1Z75A 1ZVJA 3EVBA 3LP6A 2ZJZA 1NJ6A 1YSCA 1ZMRA 3NOXA 5CM9C 4EARA 7MHTA 2FWRA 1L8LA 5I8ZA 2XMPA 5BUSA 4F9GA 4TMZA 4OHYA 3IDFA 5B3LA 3PKIA 4OI4A 1OYOA 3PUXA 1U3CA 1T0BA 4DLUA 4J9VA 3HHPA 2JLRA 1LFAA 1RI2A 1RLIA 4QTTB 1ENZA 2EJWA 4MWTA 4D8WA 4EG1A 3L40A 5JAIA 2XQIA 1FDOA 2ZYAA 2VJMB 1A4UA 2H4JA 4G01B 1SUPA 1H23A 3ROFA 2VK8A 3LHSA 4W8OA 2C1EA 1QHGA 5EJ8A 3I0MA 3JYOA 1NI4A 1U63A 3EF1A 5HIAA 3QTTA 4MTCA 3VPFA 1TRHA 1Y8CA 1JQBA 1MABB 4BP8A 3E82A 1G8AA 1S2NA 2A67A 2RC6A 3OIDA 4XFKA 3ZXIA 4J1NA 1ULSA 4Y1FA 4RVDA 4F56A 2PLWA 5KTRA 2J46A 2OL4A 2X5JO 4BLTA 5FL7A 3B53X 2UZIR 1FU7A 1RKUA 2PMWB 2AZTA 2W43A 3ZHRA 2Q6TA 3W9BA 4J16A 2P9GA 4FOTA 4OHUA 2NV6A 1DHTA 4B6FA 2VDKB 1BX3A 4JLUA 4QPCA 4Z86A 2YKGA 5B2EA 3OPQA 2OVBA 1YQEA 1A5SB 4B76A 5K0ZA 4QGBA 1JWAB 1M6EX 4KWTA 5GGXA 2A5YB 2C0CA 2COUA 3EODA 4IRMA 4KE6A 2LPMA 1W48A 2Z9CA 4XZ3A 4H18A 3V7FA 3VZPA 3ELDA 1L4BA 3OICA 1KZHA 4E1BA 2G67A 5J47A 5AICA 2ZUUA 3TI7A 1HL3A 2HMWA 5BOSB 1WKCA 3B7WA 2B2CA 3FMVA 3HU3A 3IUEA 1YVRA 3PR1A 3K9LA 5FI0B 3IPAA 3P9IA 3QZUA 4INJA 1CUIA 1GGMA 1JHQA 5ICCA 1H93A 4GKAA 3I9KA 3HB5X 3NHZA 3NPAA 4X92A 3QKSB 3OD1A 3L9WA 2VG8A 1KJIA 3NH6A 3BXPA 4QX6A 3RSGA 4K6MA 4GXNA 4QTUB 4LY6A 3NETA 1GSIA 4J7CA 3VR4A 2WA2A 3OZWA 5HQTA 3D0RA 3V8EA 1BYIA 3QVLA 5AKLA 4EFNA 5CDYA 1K9SA 1AUQA 3CBQA 4QM7A 1GQQA 1SJ9A 1JAYA 2K7ZA 4U2CA 4G1VA 4YAIA 3AIOA 1R6BX 4BO0A 4UDXX 1TADA 4DLAA 1LSOA 2EAUA 4RA9A 2J87A 2PUJA 1O94D 1L8AA 3O4JA 4PLPA 5BSEA 3T7IA 5E4YA 4HHEA 4MVXA 3KK0A 1JSCA 1U8TA 5HVNA 4NV3A 1PDVA 1TF7A 1VOTA 5B4UA 2ZKLA 4PLGA 5UKDA 4KXUA 4OHKA 4AF6A 1FNNA 2HCFA 4GP9A 3OPVA 521PA 1Y3HA 3V9PA 1CK4A 4JU9A 4MSUA 4ND6A 3SYRA 1SCUA 2HF9A 4AZWA 3I3SR 3WV4A 3ESAA 4KVFA 3OZFA 4OTZA 3S68A 4PNEA 5MDHA 2FWPA 1C0KA 4Q03A 1W85B 4Q18A 4FIZA 3EZ9A 4ZC1A 2RCYA 1RPTA 3M6AA 4KLNA 1L9XA 4MW0A 5AJWA 3REFA 4KQ9A 3UJ8A 2PGJA 1A2KC 3GN1A 1PQPA 1U8CB 1W6RA 1BHJA 4JBIA 1L5HB 1UP6A 5BRNA 1OC2A 4AUEA 2CC2A 5CDSA 3ROKA 4R6XA 1CZLA 5FPSA 3MCAA 4RPLA 2VYCA 4DEXA 2P30A 2Q9UA 3A2LA 1J8YF 4OKIA 4UAVA 3U1BA 2H3EA 1W19A 4BFVA 4EMTA 5LU9A 3MRSA 1W5AA 2WAMA 1JFVA 4NAUA 4DLPA 5FOXA 1UT8A 5AW1A 3USCS 3MBIA 5K8VA 2XYHA 3LC7O 4NOMA 2C58A 1Z15A 4MKRA 3CJTA 3A6GA 3OU2A 1WPXA 4YP5A 4CL3A 5KS2A 5M5BA 4F97A 2ZROA 1N2IA 3LJKA 2F3SA 3P4UA 1M33A 4EEXA 3MOIA 3EQ8A 3CTPA 4XGQA 2A86A 4Q6BA 3EYAA 2OXFA 5REQA 1N0HA 3DEHA 1PR5A 2DBRA 4AJEA 4XIGS 2WJVA 3LV8A 1PJCA 1O95D 3UNXA 3V2UA 1M2GA 1XPOA 2NTJA 4W4TA 3W2HA 1L7NA 1O5TA 3SDBA 1CZUA 1M2HA 2I6FA 3EFOA 2C59A 1AKEA 3FMGA 1JPVA 2W00A 3AVPA 4NQRA 4TXLA 4JL6A 5B58C 4NSNA 1QAQA 1OT5A 3IA2A 2IOQA 1U28A 2NUTB 2V6JA 1M75A 5EQDA 3SC2B 4FEAA 3BHJA 2ROQA 4LBYA 3G0HA 1NXQA 1WP4A 1KJ8A 2PUWA 3IOMA 3E0XA 3ZGVA 1FTSA 1T13A 2C9BA 2NPIA 4FUTA 5C4MA 1N2BA 4PG5A 4ARCA 1EP2B 1UBLS 2WTEA 4PZAA 1MUUA 5AVUA 2A9OA 1XN4A 1FMLA 1PNTA 5HW0A 2OCLA 2QVCA 3G5AA 3RABA 1DC5A 2QUHA 1EFRA 3HYCA 5DI3A 2IPNA 5KWEA 2Q8PA 3HCNA 4TLDA 4XWTA 3A4LA 3CE6A 2FLVA 4R2LA 4B3GA 4JC4A 1ONSA 5D3MB 3BL5A 5LXTA 4CIBA 3DOFA 1NVBA 2Z08A 3EFHA 5ILOA 1CUBA 4UXJA 1SBYA 4HUTA 5C4IA 1PSDA 5HWSA 1UKZA 4EKIA 1KVQA 2VRNA 3UB4A 1KP3A 4BLSA 1A5AB 1BU8A 4XYLA 4LQLA 1JB1A 3HNRA 4MB0A 3U26A 5JSQA 2CN1A 1LRLA 3RT1A 4DG5A 5FFFA 1MXHA 2WT9A 3LP5A 4IYRA 1B26A 4B75A 2UUBB 1KFJB 4Q3OA 1JGTA 2H4ZA 5CBPB 4FMPA 1NP7A 2X0FA 2DFPA 2WV9A 4XH9B 2BGLA 4JASB 1UF9A 3WL3A 1UC8A 1ZMOA 2C4VA 3QV1A 3DMDA 3ZIUA 1M6HA 1PJZA 1BG6A 1U3FA 3IQFA 4OBEA 4OCZA 2BJVA 2G40A 1JSLA 3DBOB 5IANA 4JLOA 2XVYA 1E9BA 4N54A 2BI4A 1OZFA 1KJJA 1QIHA 1W4ZA 2DPLA 5FNVA 4D25A 5K8IA 3M6MD 4G56A 4DRXB 2V3VA 3UPDA 5TF0A 3QF4A 3IQHX 4X1KA 4ZCRA 4F8EA 7ABPA 1YZQA 2WU8A 4MV0A 3VMMA 3ZCSA 4IG4A 3NGLA 3V7UA 3AV0B 3GUHA 3UMGA 1J2EA 2JI7A 3UV3A 1AGXA 4X1OA 4X97A 3SMQA 3NJ4A 3OCYA 1QORA 1DO8A 3UCFA 3ZCUA 3Q0TA 5AVSA 4JA0A 5HPYB 1JNYA 1HTBA 2OXTA 2ZYDA 5IM5A 2FQ1A 3MMZA 3DL0A 3HCWA 4UPVA 3SEFA 3L7NA 2Q0SA 3LXXA 2CYAA 4IF4A 2EG5A 4AO6A 2XGSA 3ADKA 2B8EA 3BFPA 5EWJA 4MIOA 4NYMR 4EHLA 2QV7A 1UJ4A 5KPDA 4Y30A 2EKBA 3RVJA 4X54A 4H3VA 4WGFA 3SZOA 4BRZA 3X3HA 5CA1F 3V4VB 3ZHXA 3OZIA 1T6ZA 1FJHA 2IYOA 4ER6A 3D7SA 4TL8A 2IKSA 2ZI6A 5A5EA 1NBMA 3DLIA 2B36A 1PFYA 2V6GA 4M55A 3NTLA 2XDQA 3EDOA 5B57C 3HFSA 2QLTA 4LFCB 3UGQA 1BXZA 3OETA 3ZG6A 3VR6D 1UC9A 2BMDA 1T9GR 1K8YB 1PJSA 1ZWLA 3MPUA 3VBEA 3OKFA 5BMOA 1DRUA 5EZYF 4P81A 1H2HA 4O2BA 4V0LA 1CDOA 4O0LA 5KHAA 5CM8B 1IZZA 4CM5A 4UM5A 2H7CA 1ORRA 2AOTB 2V74B 4BFUA 4RQBA 5FB3A 1JT2A 2V59A 4B7AA 1KEKA 3L84A 1TOAA 1C4OA 4ZOEA 3RQIA 3RRZA 3MM4A 4L4XA 4JQZA 1P77A 2QL7A 3KR0A 3LH5A 2EZUA 2HK7A 2R8BA 2Z5FA 4JX8A 4AZ0A 3EE6A 3AEKB 3ZDZB 3EVGA 1QIFA 1ADBA 1MF7A 3I58A 3LBFA 3GMTA 3QOYA 3TXVA 2PA3A 2QRZA 1QR2A 2WSBA 3FWYA 1OREA 2I2AA 3PVSA 3W7AA 4QHSA 4DDMA 1NVUQ 1CFZA 3HSSA 3IXQA 3MXOA 2RD2A 2XIJA 5L6MB 2VF2A 3M82A 1HT1E 1T15A 3EGEA 3I45A 2Q1YA 3Q5DA 4OYHA 4BL5A 1BNCA 4TM8A 9LDBA 4AKSA 1Z6XA 1Z5UA 3IEMA 4D97A 1DAOA 3T9EA 3U4AA 1X3SA 4P4GA 3ZV4A 4KWHA 2JDID 2BRUC 1N5LA 1CS4C 2C5GA 1NNI1 1ZJZA 2VSOA 4I8XA 4BKPA 5JNSA 3KIPA 4YUXA 5I7HA 3V32A 2XMQA 3P0EA 1ZOIA 2HAEA 2AOXA 3GG2A 3ZVKA 1CE8A 3PFBA 4GHWA 2MMCA 2BTEA 5IT4A 1F48A 1L1RA 1JB9A 4UOQA 3ZY4A 4C2AA 3WDMA 5AVXA 4O4LB 5IUKC 2IDZA 4U7GA 1ADCA 3N8HA 4R2JA 3OOHA 3RUCA 3T7KA 1CU1A 2BFEB 1Z0IA 4QJ5A 2WFAA 4DEYA 2GRAA 4ZMBA 2GAJA 2H59A 3PJEA 4W7HA 4C4RA 1GFIA 5AK0A 1H6BA 3HI4A 3G2QA 3WBKA 1FRZA 4X84A 4ZYTA 5A5VA 3IQXA 2D5BA 1UK6A 3NR2A 2X8LA 3IIJA 3I2JA 4A8JC 1K5DA 1U5BA 4Y6SA 3C4JA 4L95C 5JPIA 3VMFA 3EXHB 3OTWA 3M1AA 2ZZMA 2WD7B 5I9TA 2DHRA 4DNXA 2GVNA 4N6NA 1IK6A 4KSBA 2EBHX 3ZBQA 4YLYA 4NAVA 4WCFB 1UQTA 4QHYA 3CNHA 4G8DA 4IJKA 5DXFA 3WWPA 4AUNA 2XCSB 4O2RA 2AJBA 1QRTA 1C7ZA 1IHOA 2IWRA 2X0KA 5I47A 4ENWA 4URVR 5DNYB 3SXUA 3QHAA 3CHYA 1G7TA 3I52A 1XRLA 4PRZA 2DB3A 3DDNA 1QF6A 1B6SA 3UHOA 3DZJA 1J33A 1NVMB 1MU0A 2NU7B 3JQFC 3JSXA 4JOSA 4OHMA 5D87A 2JI9A 3R9XA 3R5KA 3GFFA 2P2CA 5ALZA 5I7VA 3QLJA 1KXJA 3T61A 1JQKA 1U31A 2D1QA 3QVSA 3QYPA 4HOYA 4MS4B 1X15A 3QUSA 4KGDA 1XXHE 3ENVA 3NKFA 2WVHA 1ISSA 1RFLA 3AI3A 4O2BB 4Q1CA 1AQ6A 2XDAA 4LF9B 1W94A 2RJ3A 3T7EA 1XF9A 4J0EA 3TEFA 2G88A 2Q6IA 4I1PA 1VJDA 4DXHA 4EJSA 2PGOA 2XOKD 4N82A 3QXCA 1AH2A 2FWMX 4GDMA 2FPRA 4M0MA 4COKA 1PFQA 2PWAA 5D5PA 4QSHA 2BH9A 1DDIA 4MW9A 1TZBA 1KE1A 2EX0A 4DM4A 2GN2A 3L7BA 5BQ5A 2EJBA 3DZGA 2Z83A 4HFNA 3BWDD 3T1TA 1A9TA 3NANA 3KDPA 2GBLC 3GAFA 3CF0A 3L6OO 5ANRB 1U7HA 4X71A 1Z63A 2BFNA 4TMKA 4AX8A 3TVDA 4YJ3F 1Q2UA 1IY2A 3ZWCA 4ECEA 3PNLA 4AQYB 2YN2A 1QR6A 3NDRA 5BN3A 3R7SA 1F3LA 3ORFA 1PTJC 5SYAA 4K87A 3OEED 2HCBA 2NTNA 1Q1NA 2OUKA 2X5OA 4KN5A 2IEIA 2JAHA 3S2SA 4FLFA 4BBJA 4XD7A 4RCZA 1DG1G 1B8OA 3C3JA 1Y8RB 4IQ0A 1FNSA 2B5OA 1MRZA 4L5BA 5EWMB 1VIVA 3F6RA 3G8BA 2A57A 4KW7A 3J80A 6NULA 3UWMA 3BMCA 1CDDA 1QLWA 3G7UA 4EG3A 2AF3C 2HA3A 2IZ1A 1EYZA 3FMIA 4X6UA 4OUDB 4V03A 3ELBA 3JWJA 3JWHA 2E48A 3MJ4A 4FS3A 3OBBA 4PO8A 4Q21A 4MKGA 5HF9A 3SG0A 5K0EA 2JFXA 1KSHA 3K53A 5LA6B 1HY3A 1HQDA 1QIKA 3FR8A 3IUYA 2PGAA 3JVDA 3JVUA 2OGTA 4FNGA 4L9SA 1P7ZA 1W4BA 2LBPA 4LY0A 4TV8A 4ZAYA 5IJ0A 4YMGA 4EHNA 4YRLA 1L8XA 1WDWB 1XEXB 3BF7A 1W36C 2C9OA 1GTRA 1TVKA 1JKFA 2QUZA 5CNIA 2UUPA 3O03A 1TEXA 2BF7A 4KCGA 1WDKA 5L7YA 4D2IA 4EO9A 1XQ6A 4R40A 3C14C 3V1TC 1M8FA 1F4LA 2AR7A 2UYOA 5HNKA 3O0DA 4IH9A 4Q12A 4LYEA 1FJGB 1E63A 1OTHA 5KX5F 2GM3A 2PX3A 4ZA2A 4EL0A 4W5OA 1A4IA 1DJNA 2ASVA